4IO6A

Crystal structure of the avglur1 ligand binding domain complex with methionine at 1.6 angstrom resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
248
structure length
243
Chain Sequence
GSARLKGITLRIGVIESVPFTIVANVINTTKLTGYVLDLIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKKKWFQTKACP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AvGluR1 ligand binding domain
publication title Anions Mediate Ligand Binding in Adineta vaga Glutamate Receptor Ion Channels.
pubmed doi rcsb
source organism Adineta vaga
molecule tags Membrane protein
total genus 78
structure length 243
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io6A02
1M5EA 2XXVA 4YB6A 4DXUA 1EZOA 2H98A 2DS9A 4NF4B 2AIXA 3CRBA 3RUMA 1BTJA 4ND9A 3DLNA 3FXRA 1I6BA 3MQ9A 2NUVA 1LSTA 1US5A 3GXAA 1PB7A 2H4IA 3U94A 2I3VA 3SKPA 3W9WA 2OWSA 4KD5A 1PB9A 5L9OA 3LUYA 3BFUA 1FTLA 4QSCA 3CIJA 4YKKA 1Q1KA 2ZNUA 4LZ7A 2RC7A 4OETA 1POTA 2HZKA 1BP5A 4LP2B 3K02A 2DWHA 3HHGA 1B3EA 3A3UA 3R26A 4DE8A 4JWYA 1RYXA 2QRYA 1B40A 3IO4A 3MVYA 4F3SA 2DE4A 1OVTA 3OOAA 2O69A 1B51A 3A3CA 2PYYA 1MQJA 3RLFE 4JBZA 3CR9A 3ZKKA 4R2FA 2QMXA 1LAGE 3G3GA 3PMXA 3O2AA 4R6YA 1URSA 3MPLA 4OQOA 1B4ZA 3IK6B 3TUSA 1MQIA 4BDNA 4F3GA 3TTMA 3G7WA 1P1UA 5KZTA 3MJNA 4GD5A 4DDDA 1MQHA 4HTGA 5I58A 3PPOA 4KYDA 1ZJLA 2DVCA 3SEUA 3ODBA 3FV1A 5FTHA 1T0KA 4FAJA 2DYXA 4QFKA 2ZXTA 4OMBA 4NEDA 3K00A 3HSTA 2VD3A 2ZMBA 3KOTA 2XXXA 4ECFA 5B70A 5I58B 3K4UA 3MP8A 4H8JA 1SW5A 3TDJA 3H6VA 4E0XA 1YPNA 1XVYA 3KSJA 4JDFA 2PX1A 2B3FA 1ZBMA 1MH4A 2RINA 2XXWA 2D21A 4M1VA 1A8FA 4R9FA 3BBRA 1N3WA 2XXYA 4L17A 2DVZA 1ZKBA 1PEBA 4BDMA 3EHSA 3FIRA 3H3GA 4PETA 3IB1A 1US4A 2H5YA 4G68A 4RA1A 3UK4A 3C32A 3FUZA 1MXZA 4IO3A 4G77A 5FTIA 3USDA 4I9DA 3KZGA 3BKIB 4ZEFA 1YTVA 1FQEA 2F34A 1MPBA 1H44A 2XXUA 2VP1A 4RK9A 4XKQA 5I56A 4RPNA 4O3BA 4OYVA 1H43A 5H8QA 3KJTA 2KLFA 4IO2A 4WXJA 4F19A 3G3FA 3OO8A 2RF1A 4LQ2A 5I56B 1FTMA 5H8QB 3PD9A 1SDXA 1VFDA 1URDA 1GR2A 1AOVA 4GOTA 1UTBA 3TODA 3DP6A 2XXIA 4R9GA 5CMBA 1B9JA 3T66A 3KN3A 1N7XA 1B3HA 4FECA 3UN6A 1IUDA 4I1DA 3S9NC 1N84A 3C34A 3DM0A 1UTBB 3HHFA 1MS7A 1S9TA 2REGA 2Y7RA 1DTGA 2VOZA 3FD3A 4LUBA 4POXA 3E13X 4F39A 3C31A 2UVJA 3M3LA 3TTLA 2DOJA 4QRZA 1B7ZA 1MPCA 1Y9UA 1FTKA 5JTYB 3VVEA 3K6WA 1JW1A 2R9JA 4DZ1A 2OK2A 3SEWA 1B3LA 1M5FA 1PC3A 1Y20A 1FQCA 3CFXA 2OZZA 3MZ9A 4H0WA 4R74A 1B2HA 4YU0A 4F3PA 1EH3A 4FIMA 1L5TA 4NTLA 1HSJA 1XOCA 1LAXA 1NH7A 3K1PA 1ELJA 4OESA 1IXGA 3MWBA 3MP6A 3IX1A 2ONSA 1IXHA 2VD2A 5ICQA 4JB7A 1FCKA 4LA9A 1OIBA 5H8NA 3IJOB 1D3KA 3QSLA 5TPAA 1A54A 1S50A 2Y7KA 1LBCA 3H4ZA 1JVXA 5H8NB 3QYTA 3IAZA 5TPAB 4ZZAA 1DPEA 4G8NA 5CBRA 3O9PA 2ZYMA 2P2AA 4C1TA 4H65A 3FGSA 5L9SA 3RPWA 5EHSA 4EXLA 1B7HA 5DEXB 4EF1A 3TEPA 5DYHA 4GXAA 3MAMA 1VSOA 4OWDA 4EUOA 2PVUA 2XX9A 1D4NA 1B6HA 1O63A 4DCXA 1QUJA 4MBPA 2F78A 4NE4A 2QMWA 1F9BA 4FE8A 3IB0A 3CFZA 2I3WA 2QJEA 3U92A 5DVIA 3EHTA 3VLVA 4JSDA 4O3AA 5DT6A 1DTZA 4G8HA 4NF8B 2R71A 2F5XA 2ABHA 2RC8A 4F29A 2XX7A 2HQ0A 2O68A 3PGFA 1Y1ZA 3MZBA 2X7QA 2QS4A 1Y3NA 5CRYA 3KG2A 3OO6A 3S4UA 1M5CA 3CFLA 3LSFB 1MY0A 2UVGA 3TQLA 3TZAA 1HSEA 2IEEA 1LCTA 3PPRA 2CZLA 3KJ7A 4LATA 1MDQA 2AYSA 3VDFA 1KWHA 1LAHE 2REJA 3Q25A 3IJXB 3QIMA 3KOSA 1TXFA 1FQAA 2OLBA 2NVUB 3N94A 3W9VA 2XD2A 4IO6A 1H3DA 4KCCA 1SQYA 2XXRA 2I48A 1LCFA 3U8QA 3IOVA 1Z7ME 3JV9A 1UIUA 4JSOA 1MXVA 2DSFA 5I57A 1B46A 3OEMA 1B3GA 4YZZA 3FXQA 5K2YA 4N07A 2ZYKA 4R73A 3T9HB 5ELVA 4PFWA 5I57B 3KGCA 4QF9A 5JEIA 1LBBA 3C33A 1QKAA 3I5OA 2I0CA 1AIVA 3OXNA 4JWOA 2BJJX 3R6UA 3CG3A 2H99A 4RJZA 2RCAA 2GRVA 1LFIA 2D5WA 5AA1A 2H25A 4DIGA 5H8HA 3TTRA 4EF2A 3C9HA 5A5XA 2E0SA 5M2VA 3E3KA 4YKIA 3K1MA 1POY1 3THIA 5H8HB 1UIVA 4YB7A 3PD8A 4OTEA 4YB5A 3EHUA 4FJPA 2Z8FA 2Q2AA 4F18A 3S9EA 4K3FA 1AH5A 3I6VA 4JXIA 5F1QA 4OVJA 4Z7EA 1SVXB 4IO5A 4GRKA 2GFEA 1SBPA 4MLVA 3HPIA 5CI5A 3H6TA 3ILUB 4QHQA 4RYAA 4MH5A 3K6XA 1R1NA 5DVFA 1MM7A 5I2NA 1FQDA 1MQDA 1JVYA 4FEBA 5FHOA 4GLIA 4KQPA 3OMBA 4FEDA 3GBBA 3SEYA 2OWTA 3LBSA 2UVHA 3VVDA 2V3UA 2FA7A 1HSLA 1B05A 1B1XA 1USYE 2D3IA 3B6QA 4QFNA 5B7DA 4XTCQ 3I3VA 2HFBA 1MM6A 1I6AA 1NL5A 4XIGQ 5ITPA 1O64A 2H9BA 1Q35A 1URGA 3QUFA 2Q8JA 1Y4CA 3BFTA 4ZS9A 2B3BA 4EXKA 3VXBA 1XC1A 2HAUA 3B7DA 1JETA 2V93A 1GV8A 1MY3A 1PDAA 2XHDA 4IO7A 4G68B 1N7WA 2V84A 3SDFA 4UACA 5AA3A 2NOOA 4ZEBA 1MH3A 3T93B 3UP9A 1N3XA 3TMGA 4R2BA 2Z8DA 1IXCA 3IORA 2UYFA 2XX8A 4IB2A 3SEVA 1AL3A 3E4RA 3FVKA 2ONKE 4IO4A 4EDPA 3OELA 5FHMA 4F2OA 3RT6B 3MC2A 3PUVE 5I84A 3TCFA 5HBCA 4GFRA 2P1SA 4OFJA 1Y1MA 1LLSA 4TLLB 2XXHA 3CG1A 3TFLA 2QS2A 3Q27A 2QS3A 4WEPA 1OQHA 1Z7NE 2ZNSA 4BDOA 3LSLA 4BDQA 4YICA 3V5AA 2VHAA 1WVJA 4NWCA 3QAXA 2F35A 3H6WA 1EZPA 4GQOA 3ONMA 3FJGA 1GVCA 3KSXA 4KYEA 3H06B 3SERA 3PUZE 4U1OA 1P1OA 4G2ZA 1I69A 4OZ9A 4KI0E 1BKAA 1JNFA 1UTHA 2RKMA 4OFOA 5EHMA 3RNNA 4M4GA 3FVNA 5CC2A 2HAVA 1RYOA 4YKPA 3RY3A 3QUJA 2M8CA 2V3TA 4P0GA 4I62A 1XHYA 3IB2A 4H8IA 5TU0A 2DWAA 1QVSA 2NXOA 3SESA 4R6HA 2YJPA 4TOZA 3OD7A 4YMBA 3T96B 1NFTA 3CI8A 5TP9A 3K1NA 4OEVA 4KHZE 2WKYA 2Q2CA 4PFYA 2AL4A 1FQFA 1IIWA 1JEVA 3G3IA 3EQ1A 4EQ9A 4F1YA 4U23A 5TP9B 2I58A 1MY4A 3CSGA 4QFPA 2Q9TA 5BWJA 4N6PA 5CBSA 4R6KA 3B6WA 3VLUA 3SETA 3JZJA 1DPPA 4KPTA 3LC8A 4FORA 1MG1A 3FASA 2DE2A 4RK2A 2Z22A 4XXUA 3TTKA 4LZ8A 3MPKA 5L8DA 1MXWA 2AL5A 1UQWA 1ZIUA 2XXPA 3U93A 2UYEA 1QUKA 4XKPA 2V25A 5ICTA 3ZS6A 4LONB 4HW8A 2DWJA 1GGGA 4F1VA 4WEDA 1M5BA 3EN3A 2Q89A 4ZZEA 3T9UA 3WAEA 3Q29A 3PUWE 3M3FA 2Y7IA 3QK6A 4U22A 2PT1A 4RXLA 3N5LA 1IZ1A 4PFTA 5IAIA 5DVJA 2OJTA 4U21A 4G8MA 3V83A 1FTJA 4OXVA 3HCQA 2YPNA 1NNKA 4ZEKA 3R7XA 4O3CA 1MY1A 4F31B 3KN8A 2DWIA 3EF7A 2Z8EA 2O6AA 3WAFA 5I2KA 1B3FA 1OVBA 5L9MA 1MDP1 1R9QA 3FXUA 1JEUA 3K0VA 1PBQA 3H7MA 3H6UA 4LVQA 1R6ZA 5CMKA 3IOUA 5I2KB 2X26A 4WKMA 1D9VA 4BLAA 4KFQA 1USYH 1ANFA 4XKNA 1OLAA 1NNFA 1B0HA 1B58A 2ZYOA 1SI0A 2PT2A 1B5HA 4H5GA 1NKXA 3N26A 5BUUA 2LAOA 4F1UA 4FATA 1A55A 2ONRA 4ELOA 4NMYA 1P1QA 2FNCA 3O97A 2YLNA 3T9XB 4Z0IA 3H03A 1BLFA 1M5DA 1IXIA 3PUXE 4I8CA 1B4HA 4HCWA 4UA8A 4ESWA 1MRPA 3O6HA 2ANJA 2RCBA 1B0LA 2Z23A 4DXCA 3VXCA 3P7IA 1B5JA 1BIYA 4C0RA 5ITOA 4DLDA 2ZNTA 3Q26A 3O6IA 4Q8RA 3F11A 1B52A 1SW1A 1CE2A 3MW0A 4IGTA 4H6DA 2Q88A 2OCUA 2XXQA 1R9LA 4MLQA 3M3KA 4GIZA 3IL1B 3KN7A 4PE5B 1DSNA 3OSQA 2I0BA 1ZTYA 2VGQA 1IQ7A 4QSDA 1OLCA 1Y3PA 4GF8A 1QKBA 1A8EA 1TWYA 3G3KA 4X1DA 2A5TA 2I6EA 2I49A 3C36A 2NWJA 3V8XB 4P11A 2O84X 4U4SA 2Y7PA 2E1SA 3PPPA 4AB5A 3PMWA 1H45A 4C1UA 5A5XB 1IITA 1H76A 2G29A 2A5TB 1LB9A 3O29A 4DXBA 4OFLA 4YMAA 3PU5A 4ZEIA 2DXYA 3PPQA 1JQFA 3HN0A 2G93A 2DQVA 1TFAA 4PP0A 1OQGA 5K2XA 5IKBA 3MUQA 3UIFA 2R6GE 4MFIA 1ZU0A 1EZ9A 1WODA 3M8UA 1LFGA 2GHBA 2V3QA 3TELA 4YKJA 3TKDA 3FV2A 3MVZA 1DOTA 1P1NA 3O6GA 5I2NB 2O7IA 2UVIA 3MP1A 1O7TA 4GL0A 2F97A 1B5IA 2XD3A 4Q30B 5FHNA 4ESXA 4BDRA 5JK4A 2FYIA 3RQTA 2HXWA 1FW0A 2ZYNA 4BDLA 4ZE8A 2F6PA 4GVOA 5ISUA 1MQGA 1NMUA 4ONYA 3RN8A 4EQBA 1N04A 3K01A 4TQUQ 3T22A 3OSRA 1P1WA 3L6HA 5CM6A 3D4GA 1N0TA 2QSXA 2PMSA 2Y7WA 1XS5A 3HO7A 1I6QA 3PUYE 2QS1A 5KDTA 3IOTA 5AA2D 3K2DA 1NNPA 3C35A 1EU8A 3AXFA 1IEJA 4HS7A 4ZDMA 1PBPA 5KDTB 4G68C 3MZ1A 3FVOA 3FJMA 3PPNA 4XKRA 2O1LA 3MBPA 2DXRA 1VFEA 3K6VA 4RY1A 1GTKA 1SI1A 3CVGA 4GXSB 1QUIA 3CSBA 1MXXA 2I4BA 4RNSA 3DP8A 4IGRA 3LR1A 2A5SA 2XXTA 2F7CA 3TQWA 4ZECA 3OO7A 1PB8A 1TT1A 3KEIA 5J1DA 3FATA 2O1MA 4QFOA 4QFLA 3SEXA 1TFDA 1JW4A 4ELRA 1QULA 4KYSA 4X48A 3HV1A 3FVGA 2OBGA 3TCGA 2O51A 2HZLA 3QXMA 3IOWA 5CMMA 4N13A 3TAJA 3LSXA 4ZE9A 4IY5A 1A7LA 3OO9A 3DP4A 1ZLQA 4F2QA 1P99A 1A40A 4OEUA 3JYRA 4OENA 4THIA 4PFUA 4F22A 4YAHX 5JTYA 3S9MC 3DELB 1NNTA 3TCHA 3GLBA 3U72A 4H67A 4ZEDA 4U4XA 3Q28A 2B65A 2F8DA 4MF3A 2DP8A 1LAFE 1ZMGA 1XT8A 4AQ4A 4EQ7A 3RT8A 5F7VA 3PV0E 4G4PA 1MXUA 2ALUA 1SW2A 2DE3A 3VLWA 3FZVA 1LGBC 3IR1A 1UTHB 1YAEA 2W7YA 5HM4B 1SD3A 1B1HA 5LOMA 3VV5A 5I59A 3B6TA 3FJ7A 1LFHA 3GBAA 4X1BA 3G3HA 5H8SA 4HCYA 3T9VA 5DTBA 3ECRA 1N76A 4ELPA 2THIA 5I59B 3U1OA 1VR5A 2HEUA 2CMOA 3L6GA 3TPAA 4PQJA 1MPDA 1LB8A 2QPQA 5HPQA 2IA4A 2F36A 5EYFA 3TYHA 4R75A 1XVXA 2F6GA 4RPOA 3O28A 1A99A 5H8FA 3GZGA 1MY2A 4ELQA 4H1XA 1II5A 3OENA 3LSWA 3UORA 3KBRA 4E0WA 2O7UA 1B7UA 3VE1B 2F7AA 5H8FB 2P0SA 3RTWB 3UA8A 1SYHA 1SW4A 2GH9A 5DEXA 1SYIA 4KR5A 4Q0CA 4OERA 4LQ5A 3N6UA 3O66A 3S9LC 3N6TA 1MXYA 3ZKLA 1Y3QA 4NF5A 3E9XA 4U1ZA 4OHNA 3G3JA 1AMFA 4U2RA 3IO6A 1ATGA 2F7BA 2UXAA 2X7PA 4GWOA 4P0IA 4GL8A 3PMVA 4NF5B 5AA4A 3ILTB 4JWXA 1CB6A 2I4CA 4NF6A 5AA2A 2HCAA 2ESNA 5KCJA 4R72A 1S7YA 1B32A 3MVWA 4NF8A 3W15C 4IY6A 4DCYA 1VE4A 3ZSFA 3MVXA 4X9TA 5AA4B 4ISUA 4NF6B 5AA2B 1DMBA 4AB6A 5AE4A 1WDNA 5KCJB 4POWA 3D4CA 1FQBA 4LZ5A 1JW5A 1NH8A 2RC9A 3TTNA 3C4MA 4Q5TA 1Y4TA 1YCJA 3S2VA 2Y84A 1FTOA 3RGYA 1QW0A 3VVFA 4TLMB 1OMPA 3A09A 2GHAA 1QJMA 1RKMA 2PBWA 4QSEA 4NWDA 1J1NA 5CMCA 4KCDA 3RTFB 3UGWA 3OEKA 4F3BA 4NF4A 3VFJA 2QL3A 3K6UA 3KFMA 4H5FA 1D9YA 3EPEA 3V89B
chains in the Genus database with same CATH superfamily
1M5EA 4PC9A 2XXVA 4YB6A 4DXUA 1EZOA 2H98A 2PCRA 2DS9A 1VDWA 4NF4B 2AIXA 3CRBA 3RUMA 4O94A 1BTJA 4ND9A 2ZZWA 4N17A 3DLNA 4H46A 3HFUA 3FXRA 1I6BA 3MQ9A 2NUVA 4MEVA 1LSTA 1YZ0A 1US5A 3GXAA 1PB7A 5IGAA 2H4IA 3U94A 4DI3D 2I3VA 3SKPA 3W9WA 2OWSA 4KD5A 1NV4A 1PB9A 5L9OA 2WX9A 3LUYA 3BFUA 1FTLA 4QSCA 3CIJA 4YKKA 1Q1KA 2ZNUA 4LZ7A 3T0JA 2RC7A 4OETA 1POTA 2HZKA 1BP5A 4LP2B 3K02A 2DWHA 1KZ8A 3HHGA 1B3EA 3A3UA 3R26A 4DE8A 4O7MA 2R8TA 4JWYA 1RYXA 4NAPA 2QRYA 3EKIA 1B40A 4MNCA 3IO4A 3MVYA 4F3SA 2DE4A 1OVTA 1QGXA 3OOAA 2O69A 1B51A 4PBQA 3A3CA 2PYYA 1MQJA 4MAGA 3RLFE 4JBZA 3CR9A 2Y5KA 3ZKKA 1IMEA 5EQAA 4R2FA 1RDYA 2QMXA 2OX3A 1LAGE 1LBWA 3G3GA 3PMXA 3O2AA 4R6YA 1URSA 3MPLA 4OQOA 1B4ZA 3IK6B 3TUSA 1MQIA 4BDNA 3PTYA 4MNIA 4F3GA 4PDHA 3TTMA 4HXVA 3G7WA 1P1UA 5EQ9A 5KZTA 3MJNA 4GD5A 4PGPA 4DDDA 1MQHA 4HTGA 5I58A 3PPOA 4KYDA 1ZJLA 2DVCA 3SEUA 3ODBA 3FV1A 5FTHA 2B4LA 1T0KA 4FAJA 2DYXA 1INPA 4QFKA 2ZXTA 1K9ZA 4OMBA 5IZZA 4NEDA 3K00A 3HSTA 2VD3A 2ZMBA 3KOTA 2XXXA 4PCDA 4ECFA 5B70A 5FBPA 5I58B 3K4UA 3MP8A 4H8JA 1SW5A 3TDJA 3H6VA 4E0XA 1YPNA 1XVYA 3KSJA 4JDFA 2PX1A 2B3FA 1ZBMA 1MH4A 2RINA 2XXWA 2D21A 4M1VA 1A8FA 5EYGA 1YYZA 4R9FA 3BBRA 1N3WA 2XXYA 4L17A 2XWKA 1Q9DA 2DVZA 1ZKBA 1PEBA 3EHSA 4BDMA 3FIRA 3H3GA 4PETA 4NX1A 3IB1A 1US4A 5ET6A 2H5YA 4G68A 1FJ9A 4RA1A 3UK4A 3C32A 3FUZA 4N8GA 1MXZA 4IO3A 4G77A 5FTIA 3USDA 4PFIA 4I9DA 3KZGA 3BKIB 4ZEFA 1YTVA 3B50A 1FQEA 2F34A 1MPBA 1H44A 1G0HA 2XXUA 2Q74A 2VP1A 5IZ1A 4RK9A 4GWZA 4P9KA 1FJ6A 4XKQA 4RPNA 5I56A 4O3BA 4OYVA 1H43A 1G0IA 5H8QA 5IZ3A 3KJTA 2KLFA 2QVUA 4IO2A 4WXJA 4P8BA 4F19A 3G3FA 2WBBA 3OO8A 2RF1A 4LQ2A 4JVCA 5I56B 1FTMA 1EYIA 5H8QB 1FBHA 3PD9A 1SDXA 1IMDA 1VFDA 1URDA 1GR2A 1AOVA 4GOTA 2ZZXA 1UTBA 3TODA 3DP6A 2XXIA 4R9GA 5CMBA 4P1LA 1B9JA 3T66A 3KN3A 4MX6A 1N7XA 1B3HA 4FECA 3UN6A 1FPIA 1IUDA 1RDXA 4I1DA 3S9NC 1N84A 3C34A 3DM0A 1UTBB 3HHFA 1MS7A 1S9TA 2REGA 2Y7RA 1DTGA 2VOZA 2CEYA 3FD3A 4LUBA 4POXA 3E13X 4F39A 3C31A 1YXIA 2UVJA 3M3LA 3TTLA 2DOJA 4QRZA 1B7ZA 1MPCA 1Y9UA 1FTKA 5JTYB 3VVEA 3K6WA 1JW1A 2R9JA 4DZ1A 2OK2A 4PDDA 3SEWA 1B3LA 1M5FA 4NG7A 1PC3A 1Y20A 1FQCA 3CFXA 2OZZA 2P3VA 3MZ9A 4H0WA 4R74A 1B2HA 4YU0A 4F3PA 1EH3A 4FIMA 1L5TA 4NTLA 1HSJA 1XOCA 1LAXA 3ISPA 2F3DA 1NH7A 3K1PA 1ELJA 4HE1A 4OESA 1IXGA 1IMCA 3MWBA 3MP6A 3IX1A 2ONSA 1IXHA 2VD2A 5F24A 5ICQA 4JB7A 1FCKA 4LA9A 1OIBA 5H8NA 3IJOB 1D3KA 3QSLA 1NV3A 3RPLA 5TPAA 1A54A 1S50A 2Y7KA 1LBCA 3H4ZA 1JVXA 4GBWA 5H8NB 3IFAA 3QYTA 4G61A 3KBZA 3RPLB 3IAZA 5TPAB 4ZZAA 1DPEA 4G8NA 2DDKA 3MYUA 3O9PA 5CBRA 2ZYMA 2P2AA 4C1TA 4H65A 3FGSA 5L9SA 3RPWA 5EHSA 4EXLA 1B7HA 5DEXB 4EF1A 3TEPA 4P1EA 5DYHA 4GXAA 3MAMA 1VSOA 4OWDA 4EUOA 2PVUA 2XX9A 1D4NA 1B6HA 1O63A 4DCXA 1QUJA 4MBPA 2F78A 4NE4A 2QMWA 1F9BA 4N6DA 4FE8A 3IB0A 3CFZA 1FBEA 2I3WA 2QJEA 3U92A 5DVIA 3EHTA 3VLVA 4FBPA 3ROJA 2FVZA 4JSDA 4O3AA 5DT6A 1DTZA 3LUZA 4G8HA 4NF8B 2R71A 2F5XA 2ABHA 2RC8A 4F29A 4OVSA 2XX7A 2HQ0A 2MKZA 2O68A 3PGFA 5A5LA 1Y1ZA 3MZBA 2X7QA 1EYJA 2QS4A 1Y3NA 5CRYA 3KG2A 4N8YA 3OO6A 3S4UA 1M5CA 3CFLA 3LSFB 1MY0A 2UVGA 3TQLA 3TZAA 1HSEA 2IEEA 1LCTA 3PPRA 2CZLA 3KJ7A 4LATA 3QMFA 1MDQA 2AYSA 3VDFA 1KWHA 1LAHE 2REJA 3Q25A 3IJXB 3QIMA 5LDZA 3KOSA 5ET5A 2VPNA 1TXFA 1FQAA 2OLBA 2NVUB 3N94A 4GBVA 3W9VA 2XD2A 4IO6A 1H3DA 4KCCA 1SQYA 2XXRA 5LTCA 2I48A 1LCFA 3U8QA 2VT5A 3IOVA 1Z7ME 3JV9A 1UIUA 4JSOA 1MXVA 2DSFA 5I57A 1B46A 3OEMA 1B3GA 4YZZA 3FXQA 5K2YA 2HPGA 4N07A 2ZYKA 4R73A 3T9HB 5ELVA 4PFWA 5I57B 3KGCA 4QF9A 5JEIA 1LBBA 1LBXA 3C33A 1QKAA 3I5OA 2I0CA 1AIVA 5J16A 3OXNA 5I5PA 4N81A 4PGNA 3E79A 4JWOA 2BJJX 3R6UA 3CG3A 2H99A 4PAFA 4RJZA 2RCAA 2GRVA 1LFIA 2D5WA 5AA1A 2H25A 4DIGA 4N91A 5H8HA 3TTRA 4EF2A 3C9HA 5A5XA 2E0SA 5M2VA 3E3KA 4PE3A 4YKIA 3K1MA 1POY1 3THIA 5H8HB 1UIVA 1SPIA 4YB7A 3PD8A 4OTEA 4YB5A 3EHUA 4FJPA 2Z8FA 2Q2AA 4F18A 3S9EA 4K3FA 1AH5A 3I6VA 2PFZA 4JXIA 5F1QA 4OVJA 4Z7EA 1SVXB 4IO5A 4GRKA 2GFEA 1SBPA 4MLVA 3HPIA 5CI5A 2B4MA 3H6TA 3ILUB 4QHQA 4RYAA 4MH5A 3K6XA 1R1NA 5DVFA 1MM7A 5I2NA 1FQDA 1MQDA 1JVYA 4FEBA 5FHOA 4GLIA 4KQPA 3OMBA 4GWXA 4FEDA 3GBBA 4IR8A 2Y5LA 3SEYA 2OWTA 3LBSA 2UVHA 1FPFA 3VVDA 2V3UA 2FA7A 1HSLA 1B05A 1B1XA 1USYE 2D3IA 3B6QA 4QFNA 5B7DA 4XTCQ 5ET7A 3I3VA 2HFBA 1MM6A 1I6AA 1NL5A 4XIGQ 1JP4A 5ITPA 1O64A 2H9BA 1Q35A 1URGA 3QUFA 4MHFA 3BIHA 2Q8JA 1Y4CA 3BFTA 4ZS9A 2BJIA 2B3BA 1FPLA 4EXKA 4JVDA 3VXBA 1XC1A 2HAUA 3B7DA 4HE0A 1JETA 2V93A 1GV8A 1MY3A 1PDAA 2XHDA 4IO7A 4G68B 1N7WA 2V84A 3SDFA 4UACA 5AA3A 2NOOA 4ZEBA 1MH3A 3T93B 3UP9A 1N3XA 3TMGA 4LN5A 4R2BA 2Z8DA 1IXCA 3IORA 2UYFA 2XX8A 4IB2A 3SEVA 4PF8A 1AL3A 3NOHA 3E4RA 3FVKA 2ONKE 4IO4A 4X8RA 4EDPA 3OELA 5FHMA 1LBYA 5IZ3B 4F2OA 3RT6B 3MC2A 4P47A 3PUVE 5I84A 3TCFA 4MIJA 5HBCA 4GFRA 2P1SA 4OFJA 1Y1MA 1LLSA 4TLLB 2XXHA 3CG1A 1DK4A 3TFLA 3MSTA 4GWUA 2QS2A 3Q27A 1FBDA 2QS3A 4WEPA 1OQHA 1Z7NE 2ZNSA 4BDOA 3LSLA 4BDQA 4YICA 3V5AA 2VHAA 1WVJA 4NF0A 3LV0A 4NWCA 3GYYA 3QAXA 2F35A 3H6WA 1EZPA 4PF6A 4GQOA 1FBPA 3ONMA 3FJGA 1GVCA 3KSXA 4KYEA 2F3BA 3H06B 3SERA 3PUZE 4U1OA 1P1OA 4G2ZA 1I69A 4OZ9A 4KI0E 1BKAA 1JNFA 1UTHA 2RKMA 4KXPA 4OFOA 5EHMA 3RNNA 4M4GA 3FVNA 4P3LA 5CC2A 2HAVA 2KR0A 1RYOA 4GWWA 4YKPA 3RY3A 1FPDA 3QUJA 2M8CA 2V3TA 4P0GA 4I62A 1XHYA 3IB2A 4H8IA 5TU0A 2DWAA 1CNQA 1QVSA 2NXOA 3SESA 4R6HA 2YJPA 4TOZA 4HE2A 3OD7A 3SZPA 4YMBA 3T96B 1NFTA 3CI8A 5TP9A 3K1NA 4OEVA 4KHZE 2WKYA 2Q2CA 3BIGA 4PFYA 2AL4A 2FIXA 1FQFA 1IIWA 1JEVA 3G3IA 2XWOA 3EQ1A 4EQ9A 4F1YA 4GX3A 4U23A 5TP9B 2I58A 1MY4A 2VPOA 3CSGA 1NUYA 4QFPA 4MJOA 2Q9TA 5BWJA 4N6PA 5CBSA 4R6KA 3B6WA 3VLUA 3SETA 3JZJA 1RDZA 1DPPA 1FSAA 4KPTA 3LC8A 5EQ8A 4FORA 4XF5A 5DW8A 1MG1A 3FASA 4N6KA 2DE2A 4RK2A 2Z22A 2WEFA 4OANA 4XXUA 3TTKA 4LZ8A 4GX6A 3MPKA 5L8DA 1MXWA 2AL5A 2KQZA 1UQWA 1ZIUA 2XXPA 3U93A 2UYEA 1QUKA 4OA4A 4XKPA 2V25A 5ICTA 3ZS6A 4LONB 1NV6A 4HW8A 2DWJA 1GGGA 4F1VA 4WEDA 3B8BA 1M5BA 3EN3A 1XI6A 2Q89A 4ZZEA 3T9UA 3U65A 3WAEA 4I40A 3Q29A 3PUWE 3M3FA 4OVPA 2Y7IA 3QK6A 4U22A 2PT1A 4RXLA 3N5LA 1IZ1A 4PFTA 5IAIA 5DVJA 2OJTA 4U21A 4UABA 3RYDA 4G8MA 3V83A 1FTJA 4OXVA 3HCQA 2YPNA 1NNKA 4ZEKA 3R7XA 4O3CA 1MY1A 2QVVA 4F31B 3KN8A 2DWIA 3EF7A 2Z8EA 2O6AA 1NV2A 3WAFA 5I2KA 1B3FA 1OVBA 3IFCA 5L9MA 1MDP1 1R9QA 3FXUA 1FRPA 1JEUA 3K0VA 1PBQA 3H7MA 3H6UA 1KA0A 4LVQA 1R6ZA 2P3NA 5CMKA 2XWVA 1NUWA 3IOUA 5I2KB 2X26A 1K9YA 4WKMA 4H45A 1D9VA 4BLAA 4KFQA 1USYH 1ANFA 2GQ1A 4XKNA 1OLAA 1NNFA 1B0HA 1B58A 2ZYOA 1SI0A 2PT2A 1B5HA 4H5GA 1NKXA 3N26A 2CZHA 5BUUA 2LAOA 5ESYA 4F1UA 4FATA 1A55A 2ONRA 4ELOA 4NMYA 1FPGA 1P1QA 2FNCA 1FPEA 3KC0A 3O97A 2ZZVA 2CZKA 2YLNA 3T9XB 4Z0IA 3H03A 1BLFA 1M5DA 1IXIA 3PUXE 4I8CA 4MMPA 1FTAA 1B4HA 4HCWA 4UA8A 4ESWA 1MRPA 3O6HA 2ANJA 2RCBA 1B0LA 2Z23A 3FBPA 2FHYA 1NV5A 4QXDA 4DXCA 3VXCA 3P7IA 1B5JA 4OVRA 4PAKA 1BIYA 4C0RA 5ITOA 2PFYA 4DLDA 2ZNTA 4PTKA 3Q26A 3O6IA 4Q8RA 3F11A 1B52A 1SW1A 1CE2A 2HHMA 4O7IA 3MW0A 4NGUA 4IGTA 4H6DA 2Q88A 2OCUA 1FBGA 2XXQA 1R9LA 4MLQA 3M3KA 4GIZA 1FPBA 3IL1B 3KN7A 4PE5B 1DSNA 3OSQA 2I0BA 4N15A 1ZTYA 2VGQA 2FBPA 1IQ7A 4QSDA 1OLCA 1Y3PA 4GF8A 1QKBA 1A8EA 1TWYA 3G3KA 4X1DA 2A5TA 2I6EA 2I49A 3C36A 2NWJA 3V8XB 4P11A 2O84X 4U4SA 2Y7PA 2E1SA 3PPPA 2CZIA 4DI4B 4AB5A 3PMWA 1H45A 4C1UA 5A5XB 1IITA 1H76A 2G29A 2A5TB 1LB9A 3O29A 1FBFA 4DXBA 4OFLA 4YMAA 4XFEA 3PU5A 2FIEA 4ZEIA 2DXYA 3PPQA 1JQFA 3HN0A 2G93A 2DQVA 4PFRA 1TFAA 4PP0A 1OQGA 5K2XA 5IKBA 3MUQA 3UIFA 1NUXA 2R6GE 4MFIA 1ZU0A 1EZ9A 1LEVA 1WODA 3M8UA 1LFGA 4NHBA 4AS4A 4MCOA 2GHBA 2V3QA 2QFLA 5I7IA 3TELA 4YKJA 3TKDA 3FV2A 3MVZA 1DOTA 1P1NA 3O6GA 5I2NB 2O7IA 2UVIA 1BK4A 3MP1A 1O7TA 4GL0A 3T1BA 2F97A 5IM2A 1B5IA 2XD3A 4Q30B 5FHNA 4ESXA 4BDRA 5JK4A 2FYIA 3RQTA 2HXWA 1FW0A 2ZYNA 4BDLA 4I3YA 4ZE8A 2F6PA 4GVOA 5ISUA 1MQGA 1NMUA 4ONYA 5T3JA 3RN8A 4EQBA 1NV0A 1N04A 4GX4A 3K01A 4TQUQ 3T22A 3OSRA 1P1WA 3L6HA 5CM6A 3D4GA 5EYHA 1N0TA 2QSXA 2PMSA 2Y7WA 1XS5A 3HO7A 2V4CA 4X04A 1AWBA 1I6QA 3PUYE 2QS1A 4GWYA 3IOTA 5AA2D 5KDTA 3K2DA 1NNPA 3C35A 1EU8A 3AXFA 4PBHA 1IEJA 4HS7A 1EYKA 4ZDMA 1PBPA 5KDTB 4G68C 1NV1A 3MZ1A 3FVOA 3FJMA 3PPNA 3FXBA 4XKRA 2O1LA 4MNPA 3MBPA 2DXRA 1VFEA 3K6VA 3A29A 4RY1A 4I3EA 1GTKA 1SI1A 3CVGA 4GXSB 1QUIA 3CSBA 1MXXA 2I4BA 4RNSA 3DP8A 4IGRA 1IMFA 3LR1A 1NV7A 2A5SA 2XXTA 2F7CA 2XWIA 3TQWA 4ZECA 3OO7A 1PB8A 1TT1A 3KEIA 5J1DA 3FATA 2O1MA 4QFOA 4QFLA 3SEXA 4XEQA 1TFDA 1JW4A 1D9QA 4ELRA 1KA1A 1QULA 4KYSA 4X48A 3HV1A 3FVGA 2OBGA 3TCGA 2O51A 4P56A 2HZLA 3QXMA 3IOWA 5CMMA 1NUZA 2CEXA 1NI9A 4N13A 3TAJA 3LSXA 4ZE9A 4IY5A 1LBZA 1A7LA 3OO9A 3DP4A 1ZLQA 4F2QA 1P99A 1A40A 4OEUA 3JYRA 4OENA 4THIA 4PFUA 4F22A 4YAHX 5JTYA 3S9MC 3DELB 1NNTA 3TCHA 2XXKA 3GLBA 3U72A 4H67A 4ZEDA 4U4XA 3Q28A 2B65A 2F8DA 4MF3A 4GWSA 2DP8A 1LAFE 1ZMGA 1XT8A 4AQ4A 4EQ7A 3RT8A 5F7VA 3PV0E 4G4PA 1MXUA 2ALUA 1SW2A 2DE3A 1FBCA 3VLWA 3FZVA 1LGBC 2QVRA 2OWZA 3IR1A 1UTHB 1YAEA 2W7YA 5HM4B 1SD3A 1B1HA 5LOMA 2WBDA 3VV5A 4AS5A 5I59A 3B6TA 3FJ7A 1LFHA 3GBAA 4X1BA 3G3HA 5H8SA 4HCYA 3T9VA 5DTBA 3ECRA 1N76A 4ELPA 2THIA 5I59B 3U1OA 1VR5A 2HEUA 2CMOA 3L6GA 3TPAA 2WYKA 4PQJA 1MPDA 4JVIA 1LB8A 4NN3A 2QPQA 5HPQA 2IA4A 2F36A 5EYFA 3TYHA 4R75A 2Q8MA 1XVXA 2F6GA 4RPOA 3O28A 1A99A 1IMBA 5H8FA 3GZGA 1MY2A 4ELQA 4H1XA 4O8MA 1II5A 3OENA 3LSWA 3UORA 3KBRA 4E0WA 2O7UA 1B7UA 3E78A 3VE1B 2F7AA 5H8FB 2P0SA 3RTWB 3UA8A 4NQ8A 1SYHA 4OVQA 1SW4A 2GH9A 5DEXA 1SYIA 4KR5A 4Q0CA 4OERA 4LQ5A 3N6UA 3O66A 3KC1A 4QBAA 3S9LC 3N6TA 1MXYA 1LBVA 3ZKLA 1Y3QA 2JJKA 1DCUA 4NF5A 3E9XA 4U1ZA 1DBZA 4OHNA 3G3JA 1AMFA 4U2RA 3IO6A 2L5VA 1ATGA 2F7BA 2UXAA 2X7PA 4GWOA 2XA5A 1FPKA 4P0IA 4GL8A 3PMVA 1IMAA 4NF5B 5AA4A 3ILTB 4JWXA 1CB6A 2I4CA 2WYPA 4NF6A 5AA2A 2HCAA 2ESNA 5KCJA 4R72A 1S7YA 5ET8A 1B32A 3MVWA 4NF8A 3W15C 4IY6A 4DCYA 1VE4A 3ZSFA 3MVXA 4X9TA 5AA4B 4ISUA 3D1RA 4NF6B 5AA2B 1DMBA 4AB6A 5AE4A 1WDNA 4OVTA 5KCJB 4POWA 3D4CA 4N4UA 1FQBA 4LZ5A 1JW5A 1NH8A 2RC9A 3TTNA 3C4MA 4Q5TA 1Y4TA 1YCJA 1FPJA 3S2VA 2Y84A 1FTOA 3RGYA 1QW0A 3VVFA 4TLMB 1OMPA 3A09A 2GHAA 1QJMA 1RKMA 2PBWA 4PFBA 4QSEA 5I3SA 2HXRA 4NWDA 1J1NA 5CMCA 4KCDA 3RTFB 3UGWA 3OEKA 4F3BA 4NF4A 5EQ7A 4PAIA 3VFJA 2QL3A 3K6UA 3CHGA 3KFMA 4H5FA 1D9YA 3EPEA 3V89B
chains in the Genus database with same CATH topology
1M5EA 2XXVA 4YB6A 4DXUA 1EZOA 2H98A 2DS9A 4NF4B 2AIXA 3CRBA 3RUMA 1BTJA 4ND9A 3DLNA 3FXRA 1I6BA 3MQ9A 2NUVA 1LSTA 1US5A 3GXAA 1PB7A 2H4IA 3U94A 2I3VA 3SKPA 3W9WA 2OWSA 4KD5A 1PB9A 5L9OA 3LUYA 3BFUA 1FTLA 4QSCA 3CIJA 4YKKA 1Q1KA 2ZNUA 4LZ7A 2RC7A 4OETA 1POTA 2HZKA 1BP5A 4LP2B 3K02A 2DWHA 3HHGA 1B3EA 3A3UA 3R26A 4DE8A 4JWYA 1RYXA 2QRYA 1B40A 3IO4A 3MVYA 4F3SA 2DE4A 1OVTA 3OOAA 2O69A 1B51A 3A3CA 2PYYA 1MQJA 3RLFE 4JBZA 3CR9A 3ZKKA 4R2FA 2QMXA 1LAGE 3G3GA 3PMXA 3O2AA 4R6YA 1URSA 3MPLA 4OQOA 1B4ZA 3IK6B 3TUSA 1MQIA 4BDNA 4F3GA 3TTMA 3G7WA 1P1UA 5KZTA 3MJNA 4GD5A 4DDDA 1MQHA 4HTGA 5I58A 3PPOA 4KYDA 1ZJLA 2DVCA 3SEUA 3ODBA 3FV1A 5FTHA 1T0KA 4FAJA 2DYXA 4QFKA 2ZXTA 4OMBA 4NEDA 3K00A 3HSTA 2VD3A 2ZMBA 3KOTA 2XXXA 4ECFA 5B70A 5I58B 3K4UA 3MP8A 4H8JA 1SW5A 3TDJA 3H6VA 4E0XA 1YPNA 1XVYA 3KSJA 4JDFA 2PX1A 2B3FA 1ZBMA 1MH4A 2RINA 2XXWA 2D21A 4M1VA 1A8FA 4R9FA 3BBRA 1N3WA 2XXYA 4L17A 2DVZA 1ZKBA 1PEBA 4BDMA 3EHSA 3FIRA 3H3GA 4PETA 3IB1A 1US4A 2H5YA 4G68A 4RA1A 3UK4A 3C32A 3FUZA 1MXZA 4IO3A 4G77A 5FTIA 3USDA 4I9DA 3KZGA 3BKIB 4ZEFA 1YTVA 1FQEA 2F34A 1MPBA 1H44A 2XXUA 2VP1A 4RK9A 4XKQA 5I56A 4RPNA 4O3BA 4OYVA 1H43A 5H8QA 3KJTA 2KLFA 4IO2A 4WXJA 4F19A 3G3FA 3OO8A 2RF1A 4LQ2A 5I56B 1FTMA 5H8QB 3PD9A 1SDXA 1VFDA 1URDA 1GR2A 1AOVA 4GOTA 1UTBA 3TODA 3DP6A 2XXIA 4R9GA 5CMBA 1B9JA 3T66A 3KN3A 1N7XA 1B3HA 4FECA 3UN6A 1IUDA 4I1DA 3S9NC 1N84A 3C34A 3DM0A 1UTBB 3HHFA 1MS7A 1S9TA 2REGA 2Y7RA 1DTGA 2VOZA 3FD3A 4LUBA 4POXA 3E13X 4F39A 3C31A 2UVJA 3M3LA 3TTLA 2DOJA 4QRZA 1B7ZA 1MPCA 1Y9UA 1FTKA 5JTYB 3VVEA 3K6WA 1JW1A 2R9JA 4DZ1A 2OK2A 3SEWA 1B3LA 1M5FA 1PC3A 1Y20A 1FQCA 3CFXA 2OZZA 3MZ9A 4H0WA 4R74A 1B2HA 4YU0A 4F3PA 1EH3A 4FIMA 1L5TA 4NTLA 1HSJA 1XOCA 1LAXA 1NH7A 3K1PA 1ELJA 4OESA 1IXGA 3MWBA 3MP6A 3IX1A 2ONSA 1IXHA 2VD2A 5ICQA 4JB7A 1FCKA 4LA9A 1OIBA 5H8NA 3IJOB 1D3KA 3QSLA 5TPAA 1A54A 1S50A 2Y7KA 1LBCA 3H4ZA 1JVXA 5H8NB 3QYTA 3IAZA 5TPAB 4ZZAA 1DPEA 4G8NA 5CBRA 3O9PA 2ZYMA 2P2AA 4C1TA 4H65A 3FGSA 5L9SA 3RPWA 5EHSA 4EXLA 1B7HA 5DEXB 4EF1A 3TEPA 5DYHA 4GXAA 3MAMA 1VSOA 4OWDA 4EUOA 2PVUA 2XX9A 1D4NA 1B6HA 1O63A 4DCXA 1QUJA 4MBPA 2F78A 4NE4A 2QMWA 1F9BA 4FE8A 3IB0A 3CFZA 2I3WA 2QJEA 3U92A 5DVIA 3EHTA 3VLVA 4JSDA 4O3AA 5DT6A 1DTZA 4G8HA 4NF8B 2R71A 2F5XA 2ABHA 2RC8A 4F29A 2XX7A 2HQ0A 2O68A 3PGFA 1Y1ZA 3MZBA 2X7QA 2QS4A 1Y3NA 5CRYA 3KG2A 3OO6A 3S4UA 1M5CA 3CFLA 3LSFB 1MY0A 2UVGA 3TQLA 3TZAA 1HSEA 2IEEA 1LCTA 3PPRA 2CZLA 3KJ7A 4LATA 1MDQA 2AYSA 3VDFA 1KWHA 1LAHE 2REJA 3Q25A 3IJXB 3QIMA 3KOSA 1TXFA 1FQAA 2OLBA 2NVUB 3N94A 3W9VA 2XD2A 4IO6A 1H3DA 4KCCA 1SQYA 2XXRA 2I48A 1LCFA 3U8QA 3IOVA 1Z7ME 3JV9A 1UIUA 4JSOA 1MXVA 2DSFA 5I57A 1B46A 3OEMA 1B3GA 4YZZA 3FXQA 5K2YA 4N07A 2ZYKA 4R73A 3T9HB 5ELVA 4PFWA 5I57B 3KGCA 4QF9A 5JEIA 1LBBA 3C33A 1QKAA 3I5OA 2I0CA 1AIVA 3OXNA 4JWOA 2BJJX 3R6UA 3CG3A 2H99A 4RJZA 2RCAA 2GRVA 1LFIA 2D5WA 5AA1A 2H25A 4DIGA 5H8HA 3TTRA 4EF2A 3C9HA 5A5XA 2E0SA 5M2VA 3E3KA 4YKIA 3K1MA 1POY1 3THIA 5H8HB 1UIVA 4YB7A 3PD8A 4OTEA 4YB5A 3EHUA 4FJPA 2Z8FA 2Q2AA 4F18A 3S9EA 4K3FA 1AH5A 3I6VA 4JXIA 5F1QA 4OVJA 4Z7EA 1SVXB 4IO5A 4GRKA 2GFEA 1SBPA 4MLVA 3HPIA 5CI5A 3H6TA 3ILUB 4QHQA 4RYAA 4MH5A 3K6XA 1R1NA 5DVFA 1MM7A 5I2NA 1FQDA 1MQDA 1JVYA 4FEBA 5FHOA 4GLIA 4KQPA 3OMBA 4FEDA 3GBBA 3SEYA 2OWTA 3LBSA 2UVHA 3VVDA 2V3UA 2FA7A 1HSLA 1B05A 1B1XA 1USYE 2D3IA 3B6QA 4QFNA 5B7DA 4XTCQ 3I3VA 2HFBA 1MM6A 1I6AA 1NL5A 4XIGQ 5ITPA 1O64A 2H9BA 1Q35A 1URGA 3QUFA 2Q8JA 1Y4CA 3BFTA 4ZS9A 2B3BA 4EXKA 3VXBA 1XC1A 2HAUA 3B7DA 1JETA 2V93A 1GV8A 1MY3A 1PDAA 2XHDA 4IO7A 4G68B 1N7WA 2V84A 3SDFA 4UACA 5AA3A 2NOOA 4ZEBA 1MH3A 3T93B 3UP9A 1N3XA 3TMGA 4R2BA 2Z8DA 1IXCA 3IORA 2UYFA 2XX8A 4IB2A 3SEVA 1AL3A 3E4RA 3FVKA 2ONKE 4IO4A 4EDPA 3OELA 5FHMA 4F2OA 3RT6B 3MC2A 3PUVE 5I84A 3TCFA 5HBCA 4GFRA 2P1SA 4OFJA 1Y1MA 1LLSA 4TLLB 2XXHA 3CG1A 3TFLA 2QS2A 3Q27A 2QS3A 4WEPA 1OQHA 1Z7NE 2ZNSA 4BDOA 3LSLA 4BDQA 4YICA 3V5AA 2VHAA 1WVJA 4NWCA 3QAXA 2F35A 3H6WA 1EZPA 4GQOA 3ONMA 3FJGA 1GVCA 3KSXA 4KYEA 3H06B 3SERA 3PUZE 4U1OA 1P1OA 4G2ZA 1I69A 4OZ9A 4KI0E 1BKAA 1JNFA 1UTHA 2RKMA 4OFOA 5EHMA 3RNNA 4M4GA 3FVNA 5CC2A 2HAVA 1RYOA 4YKPA 3RY3A 3QUJA 2M8CA 2V3TA 4P0GA 4I62A 1XHYA 3IB2A 4H8IA 5TU0A 2DWAA 1QVSA 2NXOA 3SESA 4R6HA 2YJPA 4TOZA 3OD7A 4YMBA 3T96B 1NFTA 3CI8A 5TP9A 3K1NA 4OEVA 4KHZE 2WKYA 2Q2CA 4PFYA 2AL4A 1FQFA 1IIWA 1JEVA 3G3IA 3EQ1A 4EQ9A 4F1YA 4U23A 5TP9B 2I58A 1MY4A 3CSGA 4QFPA 2Q9TA 5BWJA 4N6PA 5CBSA 4R6KA 3B6WA 3VLUA 3SETA 3JZJA 1DPPA 4KPTA 3LC8A 4FORA 1MG1A 3FASA 2DE2A 4RK2A 2Z22A 4XXUA 3TTKA 4LZ8A 3MPKA 5L8DA 1MXWA 2AL5A 1UQWA 1ZIUA 2XXPA 3U93A 2UYEA 1QUKA 4XKPA 2V25A 5ICTA 3ZS6A 4LONB 4HW8A 2DWJA 1GGGA 4F1VA 4WEDA 1M5BA 3EN3A 2Q89A 4ZZEA 3T9UA 3WAEA 3Q29A 3PUWE 3M3FA 2Y7IA 3QK6A 4U22A 2PT1A 4RXLA 3N5LA 1IZ1A 4PFTA 5IAIA 5DVJA 2OJTA 4U21A 4G8MA 3V83A 1FTJA 4OXVA 3HCQA 2YPNA 1NNKA 4ZEKA 3R7XA 4O3CA 1MY1A 4F31B 3KN8A 2DWIA 3EF7A 2Z8EA 2O6AA 3WAFA 5I2KA 1B3FA 1OVBA 5L9MA 1MDP1 1R9QA 3FXUA 1JEUA 3K0VA 1PBQA 3H7MA 3H6UA 4LVQA 1R6ZA 5CMKA 3IOUA 5I2KB 2X26A 4WKMA 1D9VA 4BLAA 4KFQA 1USYH 1ANFA 4XKNA 1OLAA 1NNFA 1B0HA 1B58A 2ZYOA 1SI0A 2PT2A 1B5HA 4H5GA 1NKXA 3N26A 5BUUA 2LAOA 4F1UA 4FATA 1A55A 2ONRA 4ELOA 4NMYA 1P1QA 2FNCA 3O97A 2YLNA 3T9XB 4Z0IA 3H03A 1BLFA 1M5DA 1IXIA 3PUXE 4I8CA 1B4HA 4HCWA 4UA8A 4ESWA 1MRPA 3O6HA 2ANJA 2RCBA 1B0LA 2Z23A 4DXCA 3VXCA 3P7IA 1B5JA 1BIYA 4C0RA 5ITOA 4DLDA 2ZNTA 3Q26A 3O6IA 4Q8RA 3F11A 1B52A 1SW1A 1CE2A 3MW0A 4IGTA 4H6DA 2Q88A 2OCUA 2XXQA 1R9LA 4MLQA 3M3KA 4GIZA 3IL1B 3KN7A 4PE5B 1DSNA 3OSQA 2I0BA 1ZTYA 2VGQA 1IQ7A 4QSDA 1OLCA 1Y3PA 4GF8A 1QKBA 1A8EA 1TWYA 3G3KA 4X1DA 2A5TA 2I6EA 2I49A 3C36A 2NWJA 3V8XB 4P11A 2O84X 4U4SA 2Y7PA 2E1SA 3PPPA 4AB5A 3PMWA 1H45A 4C1UA 5A5XB 1IITA 1H76A 2G29A 2A5TB 1LB9A 3O29A 4DXBA 4OFLA 4YMAA 3PU5A 4ZEIA 2DXYA 3PPQA 1JQFA 3HN0A 2G93A 2DQVA 1TFAA 4PP0A 1OQGA 5K2XA 5IKBA 3MUQA 3UIFA 2R6GE 4MFIA 1ZU0A 1EZ9A 1WODA 3M8UA 1LFGA 2GHBA 2V3QA 3TELA 4YKJA 3TKDA 3FV2A 3MVZA 1DOTA 1P1NA 3O6GA 5I2NB 2O7IA 2UVIA 3MP1A 1O7TA 4GL0A 2F97A 1B5IA 2XD3A 4Q30B 5FHNA 4ESXA 4BDRA 5JK4A 2FYIA 3RQTA 2HXWA 1FW0A 2ZYNA 4BDLA 4ZE8A 2F6PA 4GVOA 5ISUA 1MQGA 1NMUA 4ONYA 3RN8A 4EQBA 1N04A 3K01A 4TQUQ 3T22A 3OSRA 1P1WA 3L6HA 5CM6A 3D4GA 1N0TA 2QSXA 2PMSA 2Y7WA 1XS5A 3HO7A 1I6QA 3PUYE 2QS1A 5KDTA 3IOTA 5AA2D 3K2DA 1NNPA 3C35A 1EU8A 3AXFA 1IEJA 4HS7A 4ZDMA 1PBPA 5KDTB 4G68C 3MZ1A 3FVOA 3FJMA 3PPNA 4XKRA 2O1LA 3MBPA 2DXRA 1VFEA 3K6VA 4RY1A 1GTKA 1SI1A 3CVGA 4GXSB 1QUIA 3CSBA 1MXXA 2I4BA 4RNSA 3DP8A 4IGRA 3LR1A 2A5SA 2XXTA 2F7CA 3TQWA 4ZECA 3OO7A 1PB8A 1TT1A 3KEIA 5J1DA 3FATA 2O1MA 4QFOA 4QFLA 3SEXA 1TFDA 1JW4A 4ELRA 1QULA 4KYSA 4X48A 3HV1A 3FVGA 2OBGA 3TCGA 2O51A 2HZLA 3QXMA 3IOWA 5CMMA 4N13A 3TAJA 3LSXA 4ZE9A 4IY5A 1A7LA 3OO9A 3DP4A 1ZLQA 4F2QA 1P99A 1A40A 4OEUA 3JYRA 4OENA 4THIA 4PFUA 4F22A 4YAHX 5JTYA 3S9MC 3DELB 1NNTA 3TCHA 3GLBA 3U72A 4H67A 4ZEDA 4U4XA 3Q28A 2B65A 2F8DA 4MF3A 2DP8A 1LAFE 1ZMGA 1XT8A 4AQ4A 4EQ7A 3RT8A 5F7VA 3PV0E 4G4PA 1MXUA 2ALUA 1SW2A 2DE3A 3VLWA 3FZVA 1LGBC 3IR1A 1UTHB 1YAEA 2W7YA 5HM4B 1SD3A 1B1HA 5LOMA 3VV5A 5I59A 3B6TA 3FJ7A 1LFHA 3GBAA 4X1BA 3G3HA 5H8SA 4HCYA 3T9VA 5DTBA 3ECRA 1N76A 4ELPA 2THIA 5I59B 3U1OA 1VR5A 2HEUA 2CMOA 3L6GA 3TPAA 4PQJA 1MPDA 1LB8A 2QPQA 5HPQA 2IA4A 2F36A 5EYFA 3TYHA 4R75A 1XVXA 2F6GA 4RPOA 3O28A 1A99A 5H8FA 3GZGA 1MY2A 4ELQA 4H1XA 1II5A 3OENA 3LSWA 3UORA 3KBRA 4E0WA 2O7UA 1B7UA 3VE1B 2F7AA 5H8FB 2P0SA 3RTWB 3UA8A 1SYHA 1SW4A 2GH9A 5DEXA 1SYIA 4KR5A 4Q0CA 4OERA 4LQ5A 3N6UA 3O66A 3S9LC 3N6TA 1MXYA 3ZKLA 1Y3QA 4NF5A 3E9XA 4U1ZA 4OHNA 3G3JA 1AMFA 4U2RA 3IO6A 1ATGA 2F7BA 2UXAA 2X7PA 4GWOA 4P0IA 4GL8A 3PMVA 4NF5B 5AA4A 3ILTB 4JWXA 1CB6A 2I4CA 4NF6A 5AA2A 2HCAA 2ESNA 5KCJA 4R72A 1S7YA 1B32A 3MVWA 4NF8A 3W15C 4IY6A 4DCYA 1VE4A 3ZSFA 3MVXA 4X9TA 5AA4B 4ISUA 4NF6B 5AA2B 1DMBA 4AB6A 5AE4A 1WDNA 5KCJB 4POWA 3D4CA 1FQBA 4LZ5A 1JW5A 1NH8A 2RC9A 3TTNA 3C4MA 4Q5TA 1Y4TA 1YCJA 3S2VA 2Y84A 1FTOA 3RGYA 1QW0A 3VVFA 4TLMB 1OMPA 3A09A 2GHAA 1QJMA 1RKMA 2PBWA 4QSEA 4NWDA 1J1NA 5CMCA 4KCDA 3RTFB 3UGWA 3OEKA 4F3BA 4NF4A 3VFJA 2QL3A 3K6UA 3KFMA 4H5FA 1D9YA 3EPEA 3V89B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M5E A;  2XXV A;  4YB6 A;  4DXU A;  1EZO A;  2H98 A;  2DS9 A;  4NF4 B;  2AIX A;  3CRB A;  3RUM A;  1BTJ A;  4ND9 A;  3DLN A;  3FXR A;  1I6B A;  3MQ9 A;  2NUV A;  1LST A;  1US5 A;  3GXA A;  1PB7 A;  2H4I A;  3U94 A;  2I3V A;  3SKP A;  3W9W A;  2OWS A;  4KD5 A;  1PB9 A;  5L9O A;  3LUY A;  3BFU A;  1FTL A;  4QSC A;  3CIJ A;  4YKK A;  1Q1K A;  2ZNU A;  4LZ7 A;  2RC7 A;  4OET A;  1POT A;  2HZK A;  1BP5 A;  4LP2 B;  3K02 A;  2DWH A;  3HHG A;  1B3E A;  3A3U A;  3R26 A;  4DE8 A;  4JWY A;  1RYX A;  2QRY A;  1B40 A;  3IO4 A;  3MVY A;  4F3S A;  2DE4 A;  1OVT A;  3OOA A;  2O69 A;  1B51 A;  3A3C A;  2PYY A;  1MQJ A;  3RLF E;  4JBZ A;  3CR9 A;  3ZKK A;  4R2F A;  2QMX A;  1LAG E;  3G3G A;  3PMX A;  3O2A A;  4R6Y A;  1URS A;  3MPL A;  4OQO A;  1B4Z A;  3IK6 B;  3TUS A;  1MQI A;  4BDN A;  4F3G A;  3TTM A;  3G7W A;  1P1U A;  5KZT A;  3MJN A;  4GD5 A;  4DDD A;  1MQH A;  4HTG A;  5I58 A;  3PPO A;  4KYD A;  1ZJL A;  2DVC A;  3SEU A;  3ODB A;  3FV1 A;  5FTH A;  1T0K A;  4FAJ A;  2DYX A;  4QFK A;  2ZXT A;  4OMB A;  4NED A;  3K00 A;  3HST A;  2VD3 A;  2ZMB A;  3KOT A;  2XXX A;  4ECF A;  5B70 A;  5I58 B;  3K4U A;  3MP8 A;  4H8J A;  1SW5 A;  3TDJ A;  3H6V A;  4E0X A;  1YPN A;  1XVY A;  3KSJ A;  4JDF A;  2PX1 A;  2B3F A;  1ZBM A;  1MH4 A;  2RIN A;  2XXW A;  2D21 A;  4M1V A;  1A8F A;  4R9F A;  3BBR A;  1N3W A;  2XXY A;  4L17 A;  2DVZ A;  1ZKB A;  1PEB A;  4BDM A;  3EHS A;  3FIR A;  3H3G A;  4PET A;  3IB1 A;  1US4 A;  2H5Y A;  4G68 A;  4RA1 A;  3UK4 A;  3C32 A;  3FUZ A;  1MXZ A;  4IO3 A;  4G77 A;  5FTI A;  3USD A;  4I9D A;  3KZG A;  3BKI B;  4ZEF A;  1YTV A;  1FQE A;  2F34 A;  1MPB A;  1H44 A;  2XXU A;  2VP1 A;  4RK9 A;  4XKQ A;  5I56 A;  4RPN A;  4O3B A;  4OYV A;  1H43 A;  5H8Q A;  3KJT A;  2KLF A;  4IO2 A;  4WXJ A;  4F19 A;  3G3F A;  3OO8 A;  2RF1 A;  4LQ2 A;  5I56 B;  1FTM A;  5H8Q B;  3PD9 A;  1SDX A;  1VFD A;  1URD A;  1GR2 A;  1AOV A;  4GOT A;  1UTB A;  3TOD A;  3DP6 A;  2XXI A;  4R9G A;  5CMB A;  1B9J A;  3T66 A;  3KN3 A;  1N7X A;  1B3H A;  4FEC A;  3UN6 A;  1IUD A;  4I1D A;  3S9N C;  1N84 A;  3C34 A;  3DM0 A;  1UTB B;  3HHF A;  1MS7 A;  1S9T A;  2REG A;  2Y7R A;  1DTG A;  2VOZ A;  3FD3 A;  4LUB A;  4POX A;  3E13 X;  4F39 A;  3C31 A;  2UVJ A;  3M3L A;  3TTL A;  2DOJ A;  4QRZ A;  1B7Z A;  1MPC A;  1Y9U A;  1FTK A;  5JTY B;  3VVE A;  3K6W A;  1JW1 A;  2R9J A;  4DZ1 A;  2OK2 A;  3SEW A;  1B3L A;  1M5F A;  1PC3 A;  1Y20 A;  1FQC A;  3CFX A;  2OZZ A;  3MZ9 A;  4H0W A;  4R74 A;  1B2H A;  4YU0 A;  4F3P A;  1EH3 A;  4FIM A;  1L5T A;  4NTL A;  1HSJ A;  1XOC A;  1LAX A;  1NH7 A;  3K1P A;  1ELJ A;  4OES A;  1IXG A;  3MWB A;  3MP6 A;  3IX1 A;  2ONS A;  1IXH A;  2VD2 A;  5ICQ A;  4JB7 A;  1FCK A;  4LA9 A;  1OIB A;  5H8N A;  3IJO B;  1D3K A;  3QSL A;  5TPA A;  1A54 A;  1S50 A;  2Y7K A;  1LBC A;  3H4Z A;  1JVX A;  5H8N B;  3QYT A;  3IAZ A;  5TPA B;  4ZZA A;  1DPE A;  4G8N A;  5CBR A;  3O9P A;  2ZYM A;  2P2A A;  4C1T A;  4H65 A;  3FGS A;  5L9S A;  3RPW A;  5EHS A;  4EXL A;  1B7H A;  5DEX B;  4EF1 A;  3TEP A;  5DYH A;  4GXA A;  3MAM A;  1VSO A;  4OWD A;  4EUO A;  2PVU A;  2XX9 A;  1D4N A;  1B6H A;  1O63 A;  4DCX A;  1QUJ A;  4MBP A;  2F78 A;  4NE4 A;  2QMW A;  1F9B A;  4FE8 A;  3IB0 A;  3CFZ A;  2I3W A;  2QJE A;  3U92 A;  5DVI A;  3EHT A;  3VLV A;  4JSD A;  4O3A A;  5DT6 A;  1DTZ A;  4G8H A;  4NF8 B;  2R71 A;  2F5X A;  2ABH A;  2RC8 A;  4F29 A;  2XX7 A;  2HQ0 A;  2O68 A;  3PGF A;  1Y1Z A;  3MZB A;  2X7Q A;  2QS4 A;  1Y3N A;  5CRY A;  3KG2 A;  3OO6 A;  3S4U A;  1M5C A;  3CFL A;  3LSF B;  1MY0 A;  2UVG A;  3TQL A;  3TZA A;  1HSE A;  2IEE A;  1LCT A;  3PPR A;  2CZL A;  3KJ7 A;  4LAT A;  1MDQ A;  2AYS A;  3VDF A;  1KWH A;  1LAH E;  2REJ A;  3Q25 A;  3IJX B;  3QIM A;  3KOS A;  1TXF A;  1FQA A;  2OLB A;  2NVU B;  3N94 A;  3W9V A;  2XD2 A;  4IO6 A;  1H3D A;  4KCC A;  1SQY A;  2XXR A;  2I48 A;  1LCF A;  3U8Q A;  3IOV A;  1Z7M E;  3JV9 A;  1UIU A;  4JSO A;  1MXV A;  2DSF A;  5I57 A;  1B46 A;  3OEM A;  1B3G A;  4YZZ A;  3FXQ A;  5K2Y A;  4N07 A;  2ZYK A;  4R73 A;  3T9H B;  5ELV A;  4PFW A;  5I57 B;  3KGC A;  4QF9 A;  5JEI A;  1LBB A;  3C33 A;  1QKA A;  3I5O A;  2I0C A;  1AIV A;  3OXN A;  4JWO A;  2BJJ X;  3R6U A;  3CG3 A;  2H99 A;  4RJZ A;  2RCA A;  2GRV A;  1LFI A;  2D5W A;  5AA1 A;  2H25 A;  4DIG A;  5H8H A;  3TTR A;  4EF2 A;  3C9H A;  5A5X A;  2E0S A;  5M2V A;  3E3K A;  4YKI A;  3K1M A;  1POY 1;  3THI A;  5H8H B;  1UIV A;  4YB7 A;  3PD8 A;  4OTE A;  4YB5 A;  3EHU A;  4FJP A;  2Z8F A;  2Q2A A;  4F18 A;  3S9E A;  4K3F A;  1AH5 A;  3I6V A;  4JXI A;  5F1Q A;  4OVJ A;  4Z7E A;  1SVX B;  4IO5 A;  4GRK A;  2GFE A;  1SBP A;  4MLV A;  3HPI A;  5CI5 A;  3H6T A;  3ILU B;  4QHQ A;  4RYA A;  4MH5 A;  3K6X A;  1R1N A;  5DVF A;  1MM7 A;  5I2N A;  1FQD A;  1MQD A;  1JVY A;  4FEB A;  5FHO A;  4GLI A;  4KQP A;  3OMB A;  4FED A;  3GBB A;  3SEY A;  2OWT A;  3LBS A;  2UVH A;  3VVD A;  2V3U A;  2FA7 A;  1HSL A;  1B05 A;  1B1X A;  1USY E;  2D3I A;  3B6Q A;  4QFN A;  5B7D A;  4XTC Q;  3I3V A;  2HFB A;  1MM6 A;  1I6A A;  1NL5 A;  4XIG Q;  5ITP A;  1O64 A;  2H9B A;  1Q35 A;  1URG A;  3QUF A;  2Q8J A;  1Y4C A;  3BFT A;  4ZS9 A;  2B3B A;  4EXK A;  3VXB A;  1XC1 A;  2HAU A;  3B7D A;  1JET A;  2V93 A;  1GV8 A;  1MY3 A;  1PDA A;  2XHD A;  4IO7 A;  4G68 B;  1N7W A;  2V84 A;  3SDF A;  4UAC A;  5AA3 A;  2NOO A;  4ZEB A;  1MH3 A;  3T93 B;  3UP9 A;  1N3X A;  3TMG A;  4R2B A;  2Z8D A;  1IXC A;  3IOR A;  2UYF A;  2XX8 A;  4IB2 A;  3SEV A;  1AL3 A;  3E4R A;  3FVK A;  2ONK E;  4IO4 A;  4EDP A;  3OEL A;  5FHM A;  4F2O A;  3RT6 B;  3MC2 A;  3PUV E;  5I84 A;  3TCF A;  5HBC A;  4GFR A;  2P1S A;  4OFJ A;  1Y1M A;  1LLS A;  4TLL B;  2XXH A;  3CG1 A;  3TFL A;  2QS2 A;  3Q27 A;  2QS3 A;  4WEP A;  1OQH A;  1Z7N E;  2ZNS A;  4BDO A;  3LSL A;  4BDQ A;  4YIC A;  3V5A A;  2VHA A;  1WVJ A;  4NWC A;  3QAX A;  2F35 A;  3H6W A;  1EZP A;  4GQO A;  3ONM A;  3FJG A;  1GVC A;  3KSX A;  4KYE A;  3H06 B;  3SER A;  3PUZ E;  4U1O A;  1P1O A;  4G2Z A;  1I69 A;  4OZ9 A;  4KI0 E;  1BKA A;  1JNF A;  1UTH A;  2RKM A;  4OFO A;  5EHM A;  3RNN A;  4M4G A;  3FVN A;  5CC2 A;  2HAV A;  1RYO A;  4YKP A;  3RY3 A;  3QUJ A;  2M8C A;  2V3T A;  4P0G A;  4I62 A;  1XHY A;  3IB2 A;  4H8I A;  5TU0 A;  2DWA A;  1QVS A;  2NXO A;  3SES A;  4R6H A;  2YJP A;  4TOZ A;  3OD7 A;  4YMB A;  3T96 B;  1NFT A;  3CI8 A;  5TP9 A;  3K1N A;  4OEV A;  4KHZ E;  2WKY A;  2Q2C A;  4PFY A;  2AL4 A;  1FQF A;  1IIW A;  1JEV A;  3G3I A;  3EQ1 A;  4EQ9 A;  4F1Y A;  4U23 A;  5TP9 B;  2I58 A;  1MY4 A;  3CSG A;  4QFP A;  2Q9T A;  5BWJ A;  4N6P A;  5CBS A;  4R6K A;  3B6W A;  3VLU A;  3SET A;  3JZJ A;  1DPP A;  4KPT A;  3LC8 A;  4FOR A;  1MG1 A;  3FAS A;  2DE2 A;  4RK2 A;  2Z22 A;  4XXU A;  3TTK A;  4LZ8 A;  3MPK A;  5L8D A;  1MXW A;  2AL5 A;  1UQW A;  1ZIU A;  2XXP A;  3U93 A;  2UYE A;  1QUK A;  4XKP A;  2V25 A;  5ICT A;  3ZS6 A;  4LON B;  4HW8 A;  2DWJ A;  1GGG A;  4F1V A;  4WED A;  1M5B A;  3EN3 A;  2Q89 A;  4ZZE A;  3T9U A;  3WAE A;  3Q29 A;  3PUW E;  3M3F A;  2Y7I A;  3QK6 A;  4U22 A;  2PT1 A;  4RXL A;  3N5L A;  1IZ1 A;  4PFT A;  5IAI A;  5DVJ A;  2OJT A;  4U21 A;  4G8M A;  3V83 A;  1FTJ A;  4OXV A;  3HCQ A;  2YPN A;  1NNK A;  4ZEK A;  3R7X A;  4O3C A;  1MY1 A;  4F31 B;  3KN8 A;  2DWI A;  3EF7 A;  2Z8E A;  2O6A A;  3WAF A;  5I2K A;  1B3F A;  1OVB A;  5L9M A;  1MDP 1;  1R9Q A;  3FXU A;  1JEU A;  3K0V A;  1PBQ A;  3H7M A;  3H6U A;  4LVQ A;  1R6Z A;  5CMK A;  3IOU A;  5I2K B;  2X26 A;  4WKM A;  1D9V A;  4BLA A;  4KFQ A;  1USY H;  1ANF A;  4XKN A;  1OLA A;  1NNF A;  1B0H A;  1B58 A;  2ZYO A;  1SI0 A;  2PT2 A;  1B5H A;  4H5G A;  1NKX A;  3N26 A;  5BUU A;  2LAO A;  4F1U A;  4FAT A;  1A55 A;  2ONR A;  4ELO A;  4NMY A;  1P1Q A;  2FNC A;  3O97 A;  2YLN A;  3T9X B;  4Z0I A;  3H03 A;  1BLF A;  1M5D A;  1IXI A;  3PUX E;  4I8C A;  1B4H A;  4HCW A;  4UA8 A;  4ESW A;  1MRP A;  3O6H A;  2ANJ A;  2RCB A;  1B0L A;  2Z23 A;  4DXC A;  3VXC A;  3P7I A;  1B5J A;  1BIY A;  4C0R A;  5ITO A;  4DLD A;  2ZNT A;  3Q26 A;  3O6I A;  4Q8R A;  3F11 A;  1B52 A;  1SW1 A;  1CE2 A;  3MW0 A;  4IGT A;  4H6D A;  2Q88 A;  2OCU A;  2XXQ A;  1R9L A;  4MLQ A;  3M3K A;  4GIZ A;  3IL1 B;  3KN7 A;  4PE5 B;  1DSN A;  3OSQ A;  2I0B A;  1ZTY A;  2VGQ A;  1IQ7 A;  4QSD A;  1OLC A;  1Y3P A;  4GF8 A;  1QKB A;  1A8E A;  1TWY A;  3G3K A;  4X1D A;  2A5T A;  2I6E A;  2I49 A;  3C36 A;  2NWJ A;  3V8X B;  4P11 A;  2O84 X;  4U4S A;  2Y7P A;  2E1S A;  3PPP A;  4AB5 A;  3PMW A;  1H45 A;  4C1U A;  5A5X B;  1IIT A;  1H76 A;  2G29 A;  2A5T B;  1LB9 A;  3O29 A;  4DXB A;  4OFL A;  4YMA A;  3PU5 A;  4ZEI A;  2DXY A;  3PPQ A;  1JQF A;  3HN0 A;  2G93 A;  2DQV A;  1TFA A;  4PP0 A;  1OQG A;  5K2X A;  5IKB A;  3MUQ A;  3UIF A;  2R6G E;  4MFI A;  1ZU0 A;  1EZ9 A;  1WOD A;  3M8U A;  1LFG A;  2GHB A;  2V3Q A;  3TEL A;  4YKJ A;  3TKD A;  3FV2 A;  3MVZ A;  1DOT A;  1P1N A;  3O6G A;  5I2N B;  2O7I A;  2UVI A;  3MP1 A;  1O7T A;  4GL0 A;  2F97 A;  1B5I A;  2XD3 A;  4Q30 B;  5FHN A;  4ESX A;  4BDR A;  5JK4 A;  2FYI A;  3RQT A;  2HXW A;  1FW0 A;  2ZYN A;  4BDL A;  4ZE8 A;  2F6P A;  4GVO A;  5ISU A;  1MQG A;  1NMU A;  4ONY A;  3RN8 A;  4EQB A;  1N04 A;  3K01 A;  4TQU Q;  3T22 A;  3OSR A;  1P1W A;  3L6H A;  5CM6 A;  3D4G A;  1N0T A;  2QSX A;  2PMS A;  2Y7W A;  1XS5 A;  3HO7 A;  1I6Q A;  3PUY E;  2QS1 A;  5KDT A;  3IOT A;  5AA2 D;  3K2D A;  1NNP A;  3C35 A;  1EU8 A;  3AXF A;  1IEJ A;  4HS7 A;  4ZDM A;  1PBP A;  5KDT B;  4G68 C;  3MZ1 A;  3FVO A;  3FJM A;  3PPN A;  4XKR A;  2O1L A;  3MBP A;  2DXR A;  1VFE A;  3K6V A;  4RY1 A;  1GTK A;  1SI1 A;  3CVG A;  4GXS B;  1QUI A;  3CSB A;  1MXX A;  2I4B A;  4RNS A;  3DP8 A;  4IGR A;  3LR1 A;  2A5S A;  2XXT A;  2F7C A;  3TQW A;  4ZEC A;  3OO7 A;  1PB8 A;  1TT1 A;  3KEI A;  5J1D A;  3FAT A;  2O1M A;  4QFO A;  4QFL A;  3SEX A;  1TFD A;  1JW4 A;  4ELR A;  1QUL A;  4KYS A;  4X48 A;  3HV1 A;  3FVG A;  2OBG A;  3TCG A;  2O51 A;  2HZL A;  3QXM A;  3IOW A;  5CMM A;  4N13 A;  3TAJ A;  3LSX A;  4ZE9 A;  4IY5 A;  1A7L A;  3OO9 A;  3DP4 A;  1ZLQ A;  4F2Q A;  1P99 A;  1A40 A;  4OEU A;  3JYR A;  4OEN A;  4THI A;  4PFU A;  4F22 A;  4YAH X;  5JTY A;  3S9M C;  3DEL B;  1NNT A;  3TCH A;  3GLB A;  3U72 A;  4H67 A;  4ZED A;  4U4X A;  3Q28 A;  2B65 A;  2F8D A;  4MF3 A;  2DP8 A;  1LAF E;  1ZMG A;  1XT8 A;  4AQ4 A;  4EQ7 A;  3RT8 A;  5F7V A;  3PV0 E;  4G4P A;  1MXU A;  2ALU A;  1SW2 A;  2DE3 A;  3VLW A;  3FZV A;  1LGB C;  3IR1 A;  1UTH B;  1YAE A;  2W7Y A;  5HM4 B;  1SD3 A;  1B1H A;  5LOM A;  3VV5 A;  5I59 A;  3B6T A;  3FJ7 A;  1LFH A;  3GBA A;  4X1B A;  3G3H A;  5H8S A;  4HCY A;  3T9V A;  5DTB A;  3ECR A;  1N76 A;  4ELP A;  2THI A;  5I59 B;  3U1O A;  1VR5 A;  2HEU A;  2CMO A;  3L6G A;  3TPA A;  4PQJ A;  1MPD A;  1LB8 A;  2QPQ A;  5HPQ A;  2IA4 A;  2F36 A;  5EYF A;  3TYH A;  4R75 A;  1XVX A;  2F6G A;  4RPO A;  3O28 A;  1A99 A;  5H8F A;  3GZG A;  1MY2 A;  4ELQ A;  4H1X A;  1II5 A;  3OEN A;  3LSW A;  3UOR A;  3KBR A;  4E0W A;  2O7U A;  1B7U A;  3VE1 B;  2F7A A;  5H8F B;  2P0S A;  3RTW B;  3UA8 A;  1SYH A;  1SW4 A;  2GH9 A;  5DEX A;  1SYI A;  4KR5 A;  4Q0C A;  4OER A;  4LQ5 A;  3N6U A;  3O66 A;  3S9L C;  3N6T A;  1MXY A;  3ZKL A;  1Y3Q A;  4NF5 A;  3E9X A;  4U1Z A;  4OHN A;  3G3J A;  1AMF A;  4U2R A;  3IO6 A;  1ATG A;  2F7B A;  2UXA A;  2X7P A;  4GWO A;  4P0I A;  4GL8 A;  3PMV A;  4NF5 B;  5AA4 A;  3ILT B;  4JWX A;  1CB6 A;  2I4C A;  4NF6 A;  5AA2 A;  2HCA A;  2ESN A;  5KCJ A;  4R72 A;  1S7Y A;  1B32 A;  3MVW A;  4NF8 A;  3W15 C;  4IY6 A;  4DCY A;  1VE4 A;  3ZSF A;  3MVX A;  4X9T A;  5AA4 B;  4ISU A;  4NF6 B;  5AA2 B;  1DMB A;  4AB6 A;  5AE4 A;  1WDN A;  5KCJ B;  4POW A;  3D4C A;  1FQB A;  4LZ5 A;  1JW5 A;  1NH8 A;  2RC9 A;  3TTN A;  3C4M A;  4Q5T A;  1Y4T A;  1YCJ A;  3S2V A;  2Y84 A;  1FTO A;  3RGY A;  1QW0 A;  3VVF A;  4TLM B;  1OMP A;  3A09 A;  2GHA A;  1QJM A;  1RKM A;  2PBW A;  4QSE A;  4NWD A;  1J1N A;  5CMC A;  4KCD A;  3RTF B;  3UGW A;  3OEK A;  4F3B A;  4NF4 A;  3VFJ A;  2QL3 A;  3K6U A;  3KFM A;  4H5F A;  1D9Y A;  3EPE A;  3V89 B; 
#chains in the Genus database with same CATH topology
 1M5E A;  4PC9 A;  2XXV A;  4YB6 A;  4DXU A;  1EZO A;  2H98 A;  2PCR A;  2DS9 A;  1VDW A;  4NF4 B;  2AIX A;  3CRB A;  3RUM A;  4O94 A;  1BTJ A;  4ND9 A;  2ZZW A;  4N17 A;  3DLN A;  4H46 A;  3HFU A;  3FXR A;  1I6B A;  3MQ9 A;  2NUV A;  4MEV A;  1LST A;  1YZ0 A;  1US5 A;  3GXA A;  1PB7 A;  5IGA A;  2H4I A;  3U94 A;  4DI3 D;  2I3V A;  3SKP A;  3W9W A;  2OWS A;  4KD5 A;  1NV4 A;  1PB9 A;  5L9O A;  2WX9 A;  3LUY A;  3BFU A;  1FTL A;  4QSC A;  3CIJ A;  4YKK A;  1Q1K A;  2ZNU A;  4LZ7 A;  3T0J A;  2RC7 A;  4OET A;  1POT A;  2HZK A;  1BP5 A;  4LP2 B;  3K02 A;  2DWH A;  1KZ8 A;  3HHG A;  1B3E A;  3A3U A;  3R26 A;  4DE8 A;  4O7M A;  2R8T A;  4JWY A;  1RYX A;  4NAP A;  2QRY A;  3EKI A;  1B40 A;  4MNC A;  3IO4 A;  3MVY A;  4F3S A;  2DE4 A;  1OVT A;  1QGX A;  3OOA A;  2O69 A;  1B51 A;  4PBQ A;  3A3C A;  2PYY A;  1MQJ A;  4MAG A;  3RLF E;  4JBZ A;  3CR9 A;  2Y5K A;  3ZKK A;  1IME A;  5EQA A;  4R2F A;  1RDY A;  2QMX A;  2OX3 A;  1LAG E;  1LBW A;  3G3G A;  3PMX A;  3O2A A;  4R6Y A;  1URS A;  3MPL A;  4OQO A;  1B4Z A;  3IK6 B;  3TUS A;  1MQI A;  4BDN A;  3PTY A;  4MNI A;  4F3G A;  4PDH A;  3TTM A;  4HXV A;  3G7W A;  1P1U A;  5EQ9 A;  5KZT A;  3MJN A;  4GD5 A;  4PGP A;  4DDD A;  1MQH A;  4HTG A;  5I58 A;  3PPO A;  4KYD A;  1ZJL A;  2DVC A;  3SEU A;  3ODB A;  3FV1 A;  5FTH A;  2B4L A;  1T0K A;  4FAJ A;  2DYX A;  1INP A;  4QFK A;  2ZXT A;  1K9Z A;  4OMB A;  5IZZ A;  4NED A;  3K00 A;  3HST A;  2VD3 A;  2ZMB A;  3KOT A;  2XXX A;  4PCD A;  4ECF A;  5B70 A;  5FBP A;  5I58 B;  3K4U A;  3MP8 A;  4H8J A;  1SW5 A;  3TDJ A;  3H6V A;  4E0X A;  1YPN A;  1XVY A;  3KSJ A;  4JDF A;  2PX1 A;  2B3F A;  1ZBM A;  1MH4 A;  2RIN A;  2XXW A;  2D21 A;  4M1V A;  1A8F A;  5EYG A;  1YYZ A;  4R9F A;  3BBR A;  1N3W A;  2XXY A;  4L17 A;  2XWK A;  1Q9D A;  2DVZ A;  1ZKB A;  1PEB A;  3EHS A;  4BDM A;  3FIR A;  3H3G A;  4PET A;  4NX1 A;  3IB1 A;  1US4 A;  5ET6 A;  2H5Y A;  4G68 A;  1FJ9 A;  4RA1 A;  3UK4 A;  3C32 A;  3FUZ A;  4N8G A;  1MXZ A;  4IO3 A;  4G77 A;  5FTI A;  3USD A;  4PFI A;  4I9D A;  3KZG A;  3BKI B;  4ZEF A;  1YTV A;  3B50 A;  1FQE A;  2F34 A;  1MPB A;  1H44 A;  1G0H A;  2XXU A;  2Q74 A;  2VP1 A;  5IZ1 A;  4RK9 A;  4GWZ A;  4P9K A;  1FJ6 A;  4XKQ A;  4RPN A;  5I56 A;  4O3B A;  4OYV A;  1H43 A;  1G0I A;  5H8Q A;  5IZ3 A;  3KJT A;  2KLF A;  2QVU A;  4IO2 A;  4WXJ A;  4P8B A;  4F19 A;  3G3F A;  2WBB A;  3OO8 A;  2RF1 A;  4LQ2 A;  4JVC A;  5I56 B;  1FTM A;  1EYI A;  5H8Q B;  1FBH A;  3PD9 A;  1SDX A;  1IMD A;  1VFD A;  1URD A;  1GR2 A;  1AOV A;  4GOT A;  2ZZX A;  1UTB A;  3TOD A;  3DP6 A;  2XXI A;  4R9G A;  5CMB A;  4P1L A;  1B9J A;  3T66 A;  3KN3 A;  4MX6 A;  1N7X A;  1B3H A;  4FEC A;  3UN6 A;  1FPI A;  1IUD A;  1RDX A;  4I1D A;  3S9N C;  1N84 A;  3C34 A;  3DM0 A;  1UTB B;  3HHF A;  1MS7 A;  1S9T A;  2REG A;  2Y7R A;  1DTG A;  2VOZ A;  2CEY A;  3FD3 A;  4LUB A;  4POX A;  3E13 X;  4F39 A;  3C31 A;  1YXI A;  2UVJ A;  3M3L A;  3TTL A;  2DOJ A;  4QRZ A;  1B7Z A;  1MPC A;  1Y9U A;  1FTK A;  5JTY B;  3VVE A;  3K6W A;  1JW1 A;  2R9J A;  4DZ1 A;  2OK2 A;  4PDD A;  3SEW A;  1B3L A;  1M5F A;  4NG7 A;  1PC3 A;  1Y20 A;  1FQC A;  3CFX A;  2OZZ A;  2P3V A;  3MZ9 A;  4H0W A;  4R74 A;  1B2H A;  4YU0 A;  4F3P A;  1EH3 A;  4FIM A;  1L5T A;  4NTL A;  1HSJ A;  1XOC A;  1LAX A;  3ISP A;  2F3D A;  1NH7 A;  3K1P A;  1ELJ A;  4HE1 A;  4OES A;  1IXG A;  1IMC A;  3MWB A;  3MP6 A;  3IX1 A;  2ONS A;  1IXH A;  2VD2 A;  5F24 A;  5ICQ A;  4JB7 A;  1FCK A;  4LA9 A;  1OIB A;  5H8N A;  3IJO B;  1D3K A;  3QSL A;  1NV3 A;  3RPL A;  5TPA A;  1A54 A;  1S50 A;  2Y7K A;  1LBC A;  3H4Z A;  1JVX A;  4GBW A;  5H8N B;  3IFA A;  3QYT A;  4G61 A;  3KBZ A;  3RPL B;  3IAZ A;  5TPA B;  4ZZA A;  1DPE A;  4G8N A;  2DDK A;  3MYU A;  3O9P A;  5CBR A;  2ZYM A;  2P2A A;  4C1T A;  4H65 A;  3FGS A;  5L9S A;  3RPW A;  5EHS A;  4EXL A;  1B7H A;  5DEX B;  4EF1 A;  3TEP A;  4P1E A;  5DYH A;  4GXA A;  3MAM A;  1VSO A;  4OWD A;  4EUO A;  2PVU A;  2XX9 A;  1D4N A;  1B6H A;  1O63 A;  4DCX A;  1QUJ A;  4MBP A;  2F78 A;  4NE4 A;  2QMW A;  1F9B A;  4N6D A;  4FE8 A;  3IB0 A;  3CFZ A;  1FBE A;  2I3W A;  2QJE A;  3U92 A;  5DVI A;  3EHT A;  3VLV A;  4FBP A;  3ROJ A;  2FVZ A;  4JSD A;  4O3A A;  5DT6 A;  1DTZ A;  3LUZ A;  4G8H A;  4NF8 B;  2R71 A;  2F5X A;  2ABH A;  2RC8 A;  4F29 A;  4OVS A;  2XX7 A;  2HQ0 A;  2MKZ A;  2O68 A;  3PGF A;  5A5L A;  1Y1Z A;  3MZB A;  2X7Q A;  1EYJ A;  2QS4 A;  1Y3N A;  5CRY A;  3KG2 A;  4N8Y A;  3OO6 A;  3S4U A;  1M5C A;  3CFL A;  3LSF B;  1MY0 A;  2UVG A;  3TQL A;  3TZA A;  1HSE A;  2IEE A;  1LCT A;  3PPR A;  2CZL A;  3KJ7 A;  4LAT A;  3QMF A;  1MDQ A;  2AYS A;  3VDF A;  1KWH A;  1LAH E;  2REJ A;  3Q25 A;  3IJX B;  3QIM A;  5LDZ A;  3KOS A;  5ET5 A;  2VPN A;  1TXF A;  1FQA A;  2OLB A;  2NVU B;  3N94 A;  4GBV A;  3W9V A;  2XD2 A;  4IO6 A;  1H3D A;  4KCC A;  1SQY A;  2XXR A;  5LTC A;  2I48 A;  1LCF A;  3U8Q A;  2VT5 A;  3IOV A;  1Z7M E;  3JV9 A;  1UIU A;  4JSO A;  1MXV A;  2DSF A;  5I57 A;  1B46 A;  3OEM A;  1B3G A;  4YZZ A;  3FXQ A;  5K2Y A;  2HPG A;  4N07 A;  2ZYK A;  4R73 A;  3T9H B;  5ELV A;  4PFW A;  5I57 B;  3KGC A;  4QF9 A;  5JEI A;  1LBB A;  1LBX A;  3C33 A;  1QKA A;  3I5O A;  2I0C A;  1AIV A;  5J16 A;  3OXN A;  5I5P A;  4N81 A;  4PGN A;  3E79 A;  4JWO A;  2BJJ X;  3R6U A;  3CG3 A;  2H99 A;  4PAF A;  4RJZ A;  2RCA A;  2GRV A;  1LFI A;  2D5W A;  5AA1 A;  2H25 A;  4DIG A;  4N91 A;  5H8H A;  3TTR A;  4EF2 A;  3C9H A;  5A5X A;  2E0S A;  5M2V A;  3E3K A;  4PE3 A;  4YKI A;  3K1M A;  1POY 1;  3THI A;  5H8H B;  1UIV A;  1SPI A;  4YB7 A;  3PD8 A;  4OTE A;  4YB5 A;  3EHU A;  4FJP A;  2Z8F A;  2Q2A A;  4F18 A;  3S9E A;  4K3F A;  1AH5 A;  3I6V A;  2PFZ A;  4JXI A;  5F1Q A;  4OVJ A;  4Z7E A;  1SVX B;  4IO5 A;  4GRK A;  2GFE A;  1SBP A;  4MLV A;  3HPI A;  5CI5 A;  2B4M A;  3H6T A;  3ILU B;  4QHQ A;  4RYA A;  4MH5 A;  3K6X A;  1R1N A;  5DVF A;  1MM7 A;  5I2N A;  1FQD A;  1MQD A;  1JVY A;  4FEB A;  5FHO A;  4GLI A;  4KQP A;  3OMB A;  4GWX A;  4FED A;  3GBB A;  4IR8 A;  2Y5L A;  3SEY A;  2OWT A;  3LBS A;  2UVH A;  1FPF A;  3VVD A;  2V3U A;  2FA7 A;  1HSL A;  1B05 A;  1B1X A;  1USY E;  2D3I A;  3B6Q A;  4QFN A;  5B7D A;  4XTC Q;  5ET7 A;  3I3V A;  2HFB A;  1MM6 A;  1I6A A;  1NL5 A;  4XIG Q;  1JP4 A;  5ITP A;  1O64 A;  2H9B A;  1Q35 A;  1URG A;  3QUF A;  4MHF A;  3BIH A;  2Q8J A;  1Y4C A;  3BFT A;  4ZS9 A;  2BJI A;  2B3B A;  1FPL A;  4EXK A;  4JVD A;  3VXB A;  1XC1 A;  2HAU A;  3B7D A;  4HE0 A;  1JET A;  2V93 A;  1GV8 A;  1MY3 A;  1PDA A;  2XHD A;  4IO7 A;  4G68 B;  1N7W A;  2V84 A;  3SDF A;  4UAC A;  5AA3 A;  2NOO A;  4ZEB A;  1MH3 A;  3T93 B;  3UP9 A;  1N3X A;  3TMG A;  4LN5 A;  4R2B A;  2Z8D A;  1IXC A;  3IOR A;  2UYF A;  2XX8 A;  4IB2 A;  3SEV A;  4PF8 A;  1AL3 A;  3NOH A;  3E4R A;  3FVK A;  2ONK E;  4IO4 A;  4X8R A;  4EDP A;  3OEL A;  5FHM A;  1LBY A;  5IZ3 B;  4F2O A;  3RT6 B;  3MC2 A;  4P47 A;  3PUV E;  5I84 A;  3TCF A;  4MIJ A;  5HBC A;  4GFR A;  2P1S A;  4OFJ A;  1Y1M A;  1LLS A;  4TLL B;  2XXH A;  3CG1 A;  1DK4 A;  3TFL A;  3MST A;  4GWU A;  2QS2 A;  3Q27 A;  1FBD A;  2QS3 A;  4WEP A;  1OQH A;  1Z7N E;  2ZNS A;  4BDO A;  3LSL A;  4BDQ A;  4YIC A;  3V5A A;  2VHA A;  1WVJ A;  4NF0 A;  3LV0 A;  4NWC A;  3GYY A;  3QAX A;  2F35 A;  3H6W A;  1EZP A;  4PF6 A;  4GQO A;  1FBP A;  3ONM A;  3FJG A;  1GVC A;  3KSX A;  4KYE A;  2F3B A;  3H06 B;  3SER A;  3PUZ E;  4U1O A;  1P1O A;  4G2Z A;  1I69 A;  4OZ9 A;  4KI0 E;  1BKA A;  1JNF A;  1UTH A;  2RKM A;  4KXP A;  4OFO A;  5EHM A;  3RNN A;  4M4G A;  3FVN A;  4P3L A;  5CC2 A;  2HAV A;  2KR0 A;  1RYO A;  4GWW A;  4YKP A;  3RY3 A;  1FPD A;  3QUJ A;  2M8C A;  2V3T A;  4P0G A;  4I62 A;  1XHY A;  3IB2 A;  4H8I A;  5TU0 A;  2DWA A;  1CNQ A;  1QVS A;  2NXO A;  3SES A;  4R6H A;  2YJP A;  4TOZ A;  4HE2 A;  3OD7 A;  3SZP A;  4YMB A;  3T96 B;  1NFT A;  3CI8 A;  5TP9 A;  3K1N A;  4OEV A;  4KHZ E;  2WKY A;  2Q2C A;  3BIG A;  4PFY A;  2AL4 A;  2FIX A;  1FQF A;  1IIW A;  1JEV A;  3G3I A;  2XWO A;  3EQ1 A;  4EQ9 A;  4F1Y A;  4GX3 A;  4U23 A;  5TP9 B;  2I58 A;  1MY4 A;  2VPO A;  3CSG A;  1NUY A;  4QFP A;  4MJO A;  2Q9T A;  5BWJ A;  4N6P A;  5CBS A;  4R6K A;  3B6W A;  3VLU A;  3SET A;  3JZJ A;  1RDZ A;  1DPP A;  1FSA A;  4KPT A;  3LC8 A;  5EQ8 A;  4FOR A;  4XF5 A;  5DW8 A;  1MG1 A;  3FAS A;  4N6K A;  2DE2 A;  4RK2 A;  2Z22 A;  2WEF A;  4OAN A;  4XXU A;  3TTK A;  4LZ8 A;  4GX6 A;  3MPK A;  5L8D A;  1MXW A;  2AL5 A;  2KQZ A;  1UQW A;  1ZIU A;  2XXP A;  3U93 A;  2UYE A;  1QUK A;  4OA4 A;  4XKP A;  2V25 A;  5ICT A;  3ZS6 A;  4LON B;  1NV6 A;  4HW8 A;  2DWJ A;  1GGG A;  4F1V A;  4WED A;  3B8B A;  1M5B A;  3EN3 A;  1XI6 A;  2Q89 A;  4ZZE A;  3T9U A;  3U65 A;  3WAE A;  4I40 A;  3Q29 A;  3PUW E;  3M3F A;  4OVP A;  2Y7I A;  3QK6 A;  4U22 A;  2PT1 A;  4RXL A;  3N5L A;  1IZ1 A;  4PFT A;  5IAI A;  5DVJ A;  2OJT A;  4U21 A;  4UAB A;  3RYD A;  4G8M A;  3V83 A;  1FTJ A;  4OXV A;  3HCQ A;  2YPN A;  1NNK A;  4ZEK A;  3R7X A;  4O3C A;  1MY1 A;  2QVV A;  4F31 B;  3KN8 A;  2DWI A;  3EF7 A;  2Z8E A;  2O6A A;  1NV2 A;  3WAF A;  5I2K A;  1B3F A;  1OVB A;  3IFC A;  5L9M A;  1MDP 1;  1R9Q A;  3FXU A;  1FRP A;  1JEU A;  3K0V A;  1PBQ A;  3H7M A;  3H6U A;  1KA0 A;  4LVQ A;  1R6Z A;  2P3N A;  5CMK A;  2XWV A;  1NUW A;  3IOU A;  5I2K B;  2X26 A;  1K9Y A;  4WKM A;  4H45 A;  1D9V A;  4BLA A;  4KFQ A;  1USY H;  1ANF A;  2GQ1 A;  4XKN A;  1OLA A;  1NNF A;  1B0H A;  1B58 A;  2ZYO A;  1SI0 A;  2PT2 A;  1B5H A;  4H5G A;  1NKX A;  3N26 A;  2CZH A;  5BUU A;  2LAO A;  5ESY A;  4F1U A;  4FAT A;  1A55 A;  2ONR A;  4ELO A;  4NMY A;  1FPG A;  1P1Q A;  2FNC A;  1FPE A;  3KC0 A;  3O97 A;  2ZZV A;  2CZK A;  2YLN A;  3T9X B;  4Z0I A;  3H03 A;  1BLF A;  1M5D A;  1IXI A;  3PUX E;  4I8C A;  4MMP A;  1FTA A;  1B4H A;  4HCW A;  4UA8 A;  4ESW A;  1MRP A;  3O6H A;  2ANJ A;  2RCB A;  1B0L A;  2Z23 A;  3FBP A;  2FHY A;  1NV5 A;  4QXD A;  4DXC A;  3VXC A;  3P7I A;  1B5J A;  4OVR A;  4PAK A;  1BIY A;  4C0R A;  5ITO A;  2PFY A;  4DLD A;  2ZNT A;  4PTK A;  3Q26 A;  3O6I A;  4Q8R A;  3F11 A;  1B52 A;  1SW1 A;  1CE2 A;  2HHM A;  4O7I A;  3MW0 A;  4NGU A;  4IGT A;  4H6D A;  2Q88 A;  2OCU A;  1FBG A;  2XXQ A;  1R9L A;  4MLQ A;  3M3K A;  4GIZ A;  1FPB A;  3IL1 B;  3KN7 A;  4PE5 B;  1DSN A;  3OSQ A;  2I0B A;  4N15 A;  1ZTY A;  2VGQ A;  2FBP A;  1IQ7 A;  4QSD A;  1OLC A;  1Y3P A;  4GF8 A;  1QKB A;  1A8E A;  1TWY A;  3G3K A;  4X1D A;  2A5T A;  2I6E A;  2I49 A;  3C36 A;  2NWJ A;  3V8X B;  4P11 A;  2O84 X;  4U4S A;  2Y7P A;  2E1S A;  3PPP A;  2CZI A;  4DI4 B;  4AB5 A;  3PMW A;  1H45 A;  4C1U A;  5A5X B;  1IIT A;  1H76 A;  2G29 A;  2A5T B;  1LB9 A;  3O29 A;  1FBF A;  4DXB A;  4OFL A;  4YMA A;  4XFE A;  3PU5 A;  2FIE A;  4ZEI A;  2DXY A;  3PPQ A;  1JQF A;  3HN0 A;  2G93 A;  2DQV A;  4PFR A;  1TFA A;  4PP0 A;  1OQG A;  5K2X A;  5IKB A;  3MUQ A;  3UIF A;  1NUX A;  2R6G E;  4MFI A;  1ZU0 A;  1EZ9 A;  1LEV A;  1WOD A;  3M8U A;  1LFG A;  4NHB A;  4AS4 A;  4MCO A;  2GHB A;  2V3Q A;  2QFL A;  5I7I A;  3TEL A;  4YKJ A;  3TKD A;  3FV2 A;  3MVZ A;  1DOT A;  1P1N A;  3O6G A;  5I2N B;  2O7I A;  2UVI A;  1BK4 A;  3MP1 A;  1O7T A;  4GL0 A;  3T1B A;  2F97 A;  5IM2 A;  1B5I A;  2XD3 A;  4Q30 B;  5FHN A;  4ESX A;  4BDR A;  5JK4 A;  2FYI A;  3RQT A;  2HXW A;  1FW0 A;  2ZYN A;  4BDL A;  4I3Y A;  4ZE8 A;  2F6P A;  4GVO A;  5ISU A;  1MQG A;  1NMU A;  4ONY A;  5T3J A;  3RN8 A;  4EQB A;  1NV0 A;  1N04 A;  4GX4 A;  3K01 A;  4TQU Q;  3T22 A;  3OSR A;  1P1W A;  3L6H A;  5CM6 A;  3D4G A;  5EYH A;  1N0T A;  2QSX A;  2PMS A;  2Y7W A;  1XS5 A;  3HO7 A;  2V4C A;  4X04 A;  1AWB A;  1I6Q A;  3PUY E;  2QS1 A;  4GWY A;  3IOT A;  5AA2 D;  5KDT A;  3K2D A;  1NNP A;  3C35 A;  1EU8 A;  3AXF A;  4PBH A;  1IEJ A;  4HS7 A;  1EYK A;  4ZDM A;  1PBP A;  5KDT B;  4G68 C;  1NV1 A;  3MZ1 A;  3FVO A;  3FJM A;  3PPN A;  3FXB A;  4XKR A;  2O1L A;  4MNP A;  3MBP A;  2DXR A;  1VFE A;  3K6V A;  3A29 A;  4RY1 A;  4I3E A;  1GTK A;  1SI1 A;  3CVG A;  4GXS B;  1QUI A;  3CSB A;  1MXX A;  2I4B A;  4RNS A;  3DP8 A;  4IGR A;  1IMF A;  3LR1 A;  1NV7 A;  2A5S A;  2XXT A;  2F7C A;  2XWI A;  3TQW A;  4ZEC A;  3OO7 A;  1PB8 A;  1TT1 A;  3KEI A;  5J1D A;  3FAT A;  2O1M A;  4QFO A;  4QFL A;  3SEX A;  4XEQ A;  1TFD A;  1JW4 A;  1D9Q A;  4ELR A;  1KA1 A;  1QUL A;  4KYS A;  4X48 A;  3HV1 A;  3FVG A;  2OBG A;  3TCG A;  2O51 A;  4P56 A;  2HZL A;  3QXM A;  3IOW A;  5CMM A;  1NUZ A;  2CEX A;  1NI9 A;  4N13 A;  3TAJ A;  3LSX A;  4ZE9 A;  4IY5 A;  1LBZ A;  1A7L A;  3OO9 A;  3DP4 A;  1ZLQ A;  4F2Q A;  1P99 A;  1A40 A;  4OEU A;  3JYR A;  4OEN A;  4THI A;  4PFU A;  4F22 A;  4YAH X;  5JTY A;  3S9M C;  3DEL B;  1NNT A;  3TCH A;  2XXK A;  3GLB A;  3U72 A;  4H67 A;  4ZED A;  4U4X A;  3Q28 A;  2B65 A;  2F8D A;  4MF3 A;  4GWS A;  2DP8 A;  1LAF E;  1ZMG A;  1XT8 A;  4AQ4 A;  4EQ7 A;  3RT8 A;  5F7V A;  3PV0 E;  4G4P A;  1MXU A;  2ALU A;  1SW2 A;  2DE3 A;  1FBC A;  3VLW A;  3FZV A;  1LGB C;  2QVR A;  2OWZ A;  3IR1 A;  1UTH B;  1YAE A;  2W7Y A;  5HM4 B;  1SD3 A;  1B1H A;  5LOM A;  2WBD A;  3VV5 A;  4AS5 A;  5I59 A;  3B6T A;  3FJ7 A;  1LFH A;  3GBA A;  4X1B A;  3G3H A;  5H8S A;  4HCY A;  3T9V A;  5DTB A;  3ECR A;  1N76 A;  4ELP A;  2THI A;  5I59 B;  3U1O A;  1VR5 A;  2HEU A;  2CMO A;  3L6G A;  3TPA A;  2WYK A;  4PQJ A;  1MPD A;  4JVI A;  1LB8 A;  4NN3 A;  2QPQ A;  5HPQ A;  2IA4 A;  2F36 A;  5EYF A;  3TYH A;  4R75 A;  2Q8M A;  1XVX A;  2F6G A;  4RPO A;  3O28 A;  1A99 A;  1IMB A;  5H8F A;  3GZG A;  1MY2 A;  4ELQ A;  4H1X A;  4O8M A;  1II5 A;  3OEN A;  3LSW A;  3UOR A;  3KBR A;  4E0W A;  2O7U A;  1B7U A;  3E78 A;  3VE1 B;  2F7A A;  5H8F B;  2P0S A;  3RTW B;  3UA8 A;  4NQ8 A;  1SYH A;  4OVQ A;  1SW4 A;  2GH9 A;  5DEX A;  1SYI A;  4KR5 A;  4Q0C A;  4OER A;  4LQ5 A;  3N6U A;  3O66 A;  3KC1 A;  4QBA A;  3S9L C;  3N6T A;  1MXY A;  1LBV A;  3ZKL A;  1Y3Q A;  2JJK A;  1DCU A;  4NF5 A;  3E9X A;  4U1Z A;  1DBZ A;  4OHN A;  3G3J A;  1AMF A;  4U2R A;  3IO6 A;  2L5V A;  1ATG A;  2F7B A;  2UXA A;  2X7P A;  4GWO A;  2XA5 A;  1FPK A;  4P0I A;  4GL8 A;  3PMV A;  1IMA A;  4NF5 B;  5AA4 A;  3ILT B;  4JWX A;  1CB6 A;  2I4C A;  2WYP A;  4NF6 A;  5AA2 A;  2HCA A;  2ESN A;  5KCJ A;  4R72 A;  1S7Y A;  5ET8 A;  1B32 A;  3MVW A;  4NF8 A;  3W15 C;  4IY6 A;  4DCY A;  1VE4 A;  3ZSF A;  3MVX A;  4X9T A;  5AA4 B;  4ISU A;  3D1R A;  4NF6 B;  5AA2 B;  1DMB A;  4AB6 A;  5AE4 A;  1WDN A;  4OVT A;  5KCJ B;  4POW A;  3D4C A;  4N4U A;  1FQB A;  4LZ5 A;  1JW5 A;  1NH8 A;  2RC9 A;  3TTN A;  3C4M A;  4Q5T A;  1Y4T A;  1YCJ A;  1FPJ A;  3S2V A;  2Y84 A;  1FTO A;  3RGY A;  1QW0 A;  3VVF A;  4TLM B;  1OMP A;  3A09 A;  2GHA A;  1QJM A;  1RKM A;  2PBW A;  4PFB A;  4QSE A;  5I3S A;  2HXR A;  4NWD A;  1J1N A;  5CMC A;  4KCD A;  3RTF B;  3UGW A;  3OEK A;  4F3B A;  4NF4 A;  5EQ7 A;  4PAI A;  3VFJ A;  2QL3 A;  3K6U A;  3CHG A;  3KFM A;  4H5F A;  1D9Y A;  3EPE A;  3V89 B; 
#chains in the Genus database with same CATH homology
 1M5E A;  2XXV A;  4YB6 A;  4DXU A;  1EZO A;  2H98 A;  2DS9 A;  4NF4 B;  2AIX A;  3CRB A;  3RUM A;  1BTJ A;  4ND9 A;  3DLN A;  3FXR A;  1I6B A;  3MQ9 A;  2NUV A;  1LST A;  1US5 A;  3GXA A;  1PB7 A;  2H4I A;  3U94 A;  2I3V A;  3SKP A;  3W9W A;  2OWS A;  4KD5 A;  1PB9 A;  5L9O A;  3LUY A;  3BFU A;  1FTL A;  4QSC A;  3CIJ A;  4YKK A;  1Q1K A;  2ZNU A;  4LZ7 A;  2RC7 A;  4OET A;  1POT A;  2HZK A;  1BP5 A;  4LP2 B;  3K02 A;  2DWH A;  3HHG A;  1B3E A;  3A3U A;  3R26 A;  4DE8 A;  4JWY A;  1RYX A;  2QRY A;  1B40 A;  3IO4 A;  3MVY A;  4F3S A;  2DE4 A;  1OVT A;  3OOA A;  2O69 A;  1B51 A;  3A3C A;  2PYY A;  1MQJ A;  3RLF E;  4JBZ A;  3CR9 A;  3ZKK A;  4R2F A;  2QMX A;  1LAG E;  3G3G A;  3PMX A;  3O2A A;  4R6Y A;  1URS A;  3MPL A;  4OQO A;  1B4Z A;  3IK6 B;  3TUS A;  1MQI A;  4BDN A;  4F3G A;  3TTM A;  3G7W A;  1P1U A;  5KZT A;  3MJN A;  4GD5 A;  4DDD A;  1MQH A;  4HTG A;  5I58 A;  3PPO A;  4KYD A;  1ZJL A;  2DVC A;  3SEU A;  3ODB A;  3FV1 A;  5FTH A;  1T0K A;  4FAJ A;  2DYX A;  4QFK A;  2ZXT A;  4OMB A;  4NED A;  3K00 A;  3HST A;  2VD3 A;  2ZMB A;  3KOT A;  2XXX A;  4ECF A;  5B70 A;  5I58 B;  3K4U A;  3MP8 A;  4H8J A;  1SW5 A;  3TDJ A;  3H6V A;  4E0X A;  1YPN A;  1XVY A;  3KSJ A;  4JDF A;  2PX1 A;  2B3F A;  1ZBM A;  1MH4 A;  2RIN A;  2XXW A;  2D21 A;  4M1V A;  1A8F A;  4R9F A;  3BBR A;  1N3W A;  2XXY A;  4L17 A;  2DVZ A;  1ZKB A;  1PEB A;  4BDM A;  3EHS A;  3FIR A;  3H3G A;  4PET A;  3IB1 A;  1US4 A;  2H5Y A;  4G68 A;  4RA1 A;  3UK4 A;  3C32 A;  3FUZ A;  1MXZ A;  4IO3 A;  4G77 A;  5FTI A;  3USD A;  4I9D A;  3KZG A;  3BKI B;  4ZEF A;  1YTV A;  1FQE A;  2F34 A;  1MPB A;  1H44 A;  2XXU A;  2VP1 A;  4RK9 A;  4XKQ A;  5I56 A;  4RPN A;  4O3B A;  4OYV A;  1H43 A;  5H8Q A;  3KJT A;  2KLF A;  4IO2 A;  4WXJ A;  4F19 A;  3G3F A;  3OO8 A;  2RF1 A;  4LQ2 A;  5I56 B;  1FTM A;  5H8Q B;  3PD9 A;  1SDX A;  1VFD A;  1URD A;  1GR2 A;  1AOV A;  4GOT A;  1UTB A;  3TOD A;  3DP6 A;  2XXI A;  4R9G A;  5CMB A;  1B9J A;  3T66 A;  3KN3 A;  1N7X A;  1B3H A;  4FEC A;  3UN6 A;  1IUD A;  4I1D A;  3S9N C;  1N84 A;  3C34 A;  3DM0 A;  1UTB B;  3HHF A;  1MS7 A;  1S9T A;  2REG A;  2Y7R A;  1DTG A;  2VOZ A;  3FD3 A;  4LUB A;  4POX A;  3E13 X;  4F39 A;  3C31 A;  2UVJ A;  3M3L A;  3TTL A;  2DOJ A;  4QRZ A;  1B7Z A;  1MPC A;  1Y9U A;  1FTK A;  5JTY B;  3VVE A;  3K6W A;  1JW1 A;  2R9J A;  4DZ1 A;  2OK2 A;  3SEW A;  1B3L A;  1M5F A;  1PC3 A;  1Y20 A;  1FQC A;  3CFX A;  2OZZ A;  3MZ9 A;  4H0W A;  4R74 A;  1B2H A;  4YU0 A;  4F3P A;  1EH3 A;  4FIM A;  1L5T A;  4NTL A;  1HSJ A;  1XOC A;  1LAX A;  1NH7 A;  3K1P A;  1ELJ A;  4OES A;  1IXG A;  3MWB A;  3MP6 A;  3IX1 A;  2ONS A;  1IXH A;  2VD2 A;  5ICQ A;  4JB7 A;  1FCK A;  4LA9 A;  1OIB A;  5H8N A;  3IJO B;  1D3K A;  3QSL A;  5TPA A;  1A54 A;  1S50 A;  2Y7K A;  1LBC A;  3H4Z A;  1JVX A;  5H8N B;  3QYT A;  3IAZ A;  5TPA B;  4ZZA A;  1DPE A;  4G8N A;  5CBR A;  3O9P A;  2ZYM A;  2P2A A;  4C1T A;  4H65 A;  3FGS A;  5L9S A;  3RPW A;  5EHS A;  4EXL A;  1B7H A;  5DEX B;  4EF1 A;  3TEP A;  5DYH A;  4GXA A;  3MAM A;  1VSO A;  4OWD A;  4EUO A;  2PVU A;  2XX9 A;  1D4N A;  1B6H A;  1O63 A;  4DCX A;  1QUJ A;  4MBP A;  2F78 A;  4NE4 A;  2QMW A;  1F9B A;  4FE8 A;  3IB0 A;  3CFZ A;  2I3W A;  2QJE A;  3U92 A;  5DVI A;  3EHT A;  3VLV A;  4JSD A;  4O3A A;  5DT6 A;  1DTZ A;  4G8H A;  4NF8 B;  2R71 A;  2F5X A;  2ABH A;  2RC8 A;  4F29 A;  2XX7 A;  2HQ0 A;  2O68 A;  3PGF A;  1Y1Z A;  3MZB A;  2X7Q A;  2QS4 A;  1Y3N A;  5CRY A;  3KG2 A;  3OO6 A;  3S4U A;  1M5C A;  3CFL A;  3LSF B;  1MY0 A;  2UVG A;  3TQL A;  3TZA A;  1HSE A;  2IEE A;  1LCT A;  3PPR A;  2CZL A;  3KJ7 A;  4LAT A;  1MDQ A;  2AYS A;  3VDF A;  1KWH A;  1LAH E;  2REJ A;  3Q25 A;  3IJX B;  3QIM A;  3KOS A;  1TXF A;  1FQA A;  2OLB A;  2NVU B;  3N94 A;  3W9V A;  2XD2 A;  4IO6 A;  1H3D A;  4KCC A;  1SQY A;  2XXR A;  2I48 A;  1LCF A;  3U8Q A;  3IOV A;  1Z7M E;  3JV9 A;  1UIU A;  4JSO A;  1MXV A;  2DSF A;  5I57 A;  1B46 A;  3OEM A;  1B3G A;  4YZZ A;  3FXQ A;  5K2Y A;  4N07 A;  2ZYK A;  4R73 A;  3T9H B;  5ELV A;  4PFW A;  5I57 B;  3KGC A;  4QF9 A;  5JEI A;  1LBB A;  3C33 A;  1QKA A;  3I5O A;  2I0C A;  1AIV A;  3OXN A;  4JWO A;  2BJJ X;  3R6U A;  3CG3 A;  2H99 A;  4RJZ A;  2RCA A;  2GRV A;  1LFI A;  2D5W A;  5AA1 A;  2H25 A;  4DIG A;  5H8H A;  3TTR A;  4EF2 A;  3C9H A;  5A5X A;  2E0S A;  5M2V A;  3E3K A;  4YKI A;  3K1M A;  1POY 1;  3THI A;  5H8H B;  1UIV A;  4YB7 A;  3PD8 A;  4OTE A;  4YB5 A;  3EHU A;  4FJP A;  2Z8F A;  2Q2A A;  4F18 A;  3S9E A;  4K3F A;  1AH5 A;  3I6V A;  4JXI A;  5F1Q A;  4OVJ A;  4Z7E A;  1SVX B;  4IO5 A;  4GRK A;  2GFE A;  1SBP A;  4MLV A;  3HPI A;  5CI5 A;  3H6T A;  3ILU B;  4QHQ A;  4RYA A;  4MH5 A;  3K6X A;  1R1N A;  5DVF A;  1MM7 A;  5I2N A;  1FQD A;  1MQD A;  1JVY A;  4FEB A;  5FHO A;  4GLI A;  4KQP A;  3OMB A;  4FED A;  3GBB A;  3SEY A;  2OWT A;  3LBS A;  2UVH A;  3VVD A;  2V3U A;  2FA7 A;  1HSL A;  1B05 A;  1B1X A;  1USY E;  2D3I A;  3B6Q A;  4QFN A;  5B7D A;  4XTC Q;  3I3V A;  2HFB A;  1MM6 A;  1I6A A;  1NL5 A;  4XIG Q;  5ITP A;  1O64 A;  2H9B A;  1Q35 A;  1URG A;  3QUF A;  2Q8J A;  1Y4C A;  3BFT A;  4ZS9 A;  2B3B A;  4EXK A;  3VXB A;  1XC1 A;  2HAU A;  3B7D A;  1JET A;  2V93 A;  1GV8 A;  1MY3 A;  1PDA A;  2XHD A;  4IO7 A;  4G68 B;  1N7W A;  2V84 A;  3SDF A;  4UAC A;  5AA3 A;  2NOO A;  4ZEB A;  1MH3 A;  3T93 B;  3UP9 A;  1N3X A;  3TMG A;  4R2B A;  2Z8D A;  1IXC A;  3IOR A;  2UYF A;  2XX8 A;  4IB2 A;  3SEV A;  1AL3 A;  3E4R A;  3FVK A;  2ONK E;  4IO4 A;  4EDP A;  3OEL A;  5FHM A;  4F2O A;  3RT6 B;  3MC2 A;  3PUV E;  5I84 A;  3TCF A;  5HBC A;  4GFR A;  2P1S A;  4OFJ A;  1Y1M A;  1LLS A;  4TLL B;  2XXH A;  3CG1 A;  3TFL A;  2QS2 A;  3Q27 A;  2QS3 A;  4WEP A;  1OQH A;  1Z7N E;  2ZNS A;  4BDO A;  3LSL A;  4BDQ A;  4YIC A;  3V5A A;  2VHA A;  1WVJ A;  4NWC A;  3QAX A;  2F35 A;  3H6W A;  1EZP A;  4GQO A;  3ONM A;  3FJG A;  1GVC A;  3KSX A;  4KYE A;  3H06 B;  3SER A;  3PUZ E;  4U1O A;  1P1O A;  4G2Z A;  1I69 A;  4OZ9 A;  4KI0 E;  1BKA A;  1JNF A;  1UTH A;  2RKM A;  4OFO A;  5EHM A;  3RNN A;  4M4G A;  3FVN A;  5CC2 A;  2HAV A;  1RYO A;  4YKP A;  3RY3 A;  3QUJ A;  2M8C A;  2V3T A;  4P0G A;  4I62 A;  1XHY A;  3IB2 A;  4H8I A;  5TU0 A;  2DWA A;  1QVS A;  2NXO A;  3SES A;  4R6H A;  2YJP A;  4TOZ A;  3OD7 A;  4YMB A;  3T96 B;  1NFT A;  3CI8 A;  5TP9 A;  3K1N A;  4OEV A;  4KHZ E;  2WKY A;  2Q2C A;  4PFY A;  2AL4 A;  1FQF A;  1IIW A;  1JEV A;  3G3I A;  3EQ1 A;  4EQ9 A;  4F1Y A;  4U23 A;  5TP9 B;  2I58 A;  1MY4 A;  3CSG A;  4QFP A;  2Q9T A;  5BWJ A;  4N6P A;  5CBS A;  4R6K A;  3B6W A;  3VLU A;  3SET A;  3JZJ A;  1DPP A;  4KPT A;  3LC8 A;  4FOR A;  1MG1 A;  3FAS A;  2DE2 A;  4RK2 A;  2Z22 A;  4XXU A;  3TTK A;  4LZ8 A;  3MPK A;  5L8D A;  1MXW A;  2AL5 A;  1UQW A;  1ZIU A;  2XXP A;  3U93 A;  2UYE A;  1QUK A;  4XKP A;  2V25 A;  5ICT A;  3ZS6 A;  4LON B;  4HW8 A;  2DWJ A;  1GGG A;  4F1V A;  4WED A;  1M5B A;  3EN3 A;  2Q89 A;  4ZZE A;  3T9U A;  3WAE A;  3Q29 A;  3PUW E;  3M3F A;  2Y7I A;  3QK6 A;  4U22 A;  2PT1 A;  4RXL A;  3N5L A;  1IZ1 A;  4PFT A;  5IAI A;  5DVJ A;  2OJT A;  4U21 A;  4G8M A;  3V83 A;  1FTJ A;  4OXV A;  3HCQ A;  2YPN A;  1NNK A;  4ZEK A;  3R7X A;  4O3C A;  1MY1 A;  4F31 B;  3KN8 A;  2DWI A;  3EF7 A;  2Z8E A;  2O6A A;  3WAF A;  5I2K A;  1B3F A;  1OVB A;  5L9M A;  1MDP 1;  1R9Q A;  3FXU A;  1JEU A;  3K0V A;  1PBQ A;  3H7M A;  3H6U A;  4LVQ A;  1R6Z A;  5CMK A;  3IOU A;  5I2K B;  2X26 A;  4WKM A;  1D9V A;  4BLA A;  4KFQ A;  1USY H;  1ANF A;  4XKN A;  1OLA A;  1NNF A;  1B0H A;  1B58 A;  2ZYO A;  1SI0 A;  2PT2 A;  1B5H A;  4H5G A;  1NKX A;  3N26 A;  5BUU A;  2LAO A;  4F1U A;  4FAT A;  1A55 A;  2ONR A;  4ELO A;  4NMY A;  1P1Q A;  2FNC A;  3O97 A;  2YLN A;  3T9X B;  4Z0I A;  3H03 A;  1BLF A;  1M5D A;  1IXI A;  3PUX E;  4I8C A;  1B4H A;  4HCW A;  4UA8 A;  4ESW A;  1MRP A;  3O6H A;  2ANJ A;  2RCB A;  1B0L A;  2Z23 A;  4DXC A;  3VXC A;  3P7I A;  1B5J A;  1BIY A;  4C0R A;  5ITO A;  4DLD A;  2ZNT A;  3Q26 A;  3O6I A;  4Q8R A;  3F11 A;  1B52 A;  1SW1 A;  1CE2 A;  3MW0 A;  4IGT A;  4H6D A;  2Q88 A;  2OCU A;  2XXQ A;  1R9L A;  4MLQ A;  3M3K A;  4GIZ A;  3IL1 B;  3KN7 A;  4PE5 B;  1DSN A;  3OSQ A;  2I0B A;  1ZTY A;  2VGQ A;  1IQ7 A;  4QSD A;  1OLC A;  1Y3P A;  4GF8 A;  1QKB A;  1A8E A;  1TWY A;  3G3K A;  4X1D A;  2A5T A;  2I6E A;  2I49 A;  3C36 A;  2NWJ A;  3V8X B;  4P11 A;  2O84 X;  4U4S A;  2Y7P A;  2E1S A;  3PPP A;  4AB5 A;  3PMW A;  1H45 A;  4C1U A;  5A5X B;  1IIT A;  1H76 A;  2G29 A;  2A5T B;  1LB9 A;  3O29 A;  4DXB A;  4OFL A;  4YMA A;  3PU5 A;  4ZEI A;  2DXY A;  3PPQ A;  1JQF A;  3HN0 A;  2G93 A;  2DQV A;  1TFA A;  4PP0 A;  1OQG A;  5K2X A;  5IKB A;  3MUQ A;  3UIF A;  2R6G E;  4MFI A;  1ZU0 A;  1EZ9 A;  1WOD A;  3M8U A;  1LFG A;  2GHB A;  2V3Q A;  3TEL A;  4YKJ A;  3TKD A;  3FV2 A;  3MVZ A;  1DOT A;  1P1N A;  3O6G A;  5I2N B;  2O7I A;  2UVI A;  3MP1 A;  1O7T A;  4GL0 A;  2F97 A;  1B5I A;  2XD3 A;  4Q30 B;  5FHN A;  4ESX A;  4BDR A;  5JK4 A;  2FYI A;  3RQT A;  2HXW A;  1FW0 A;  2ZYN A;  4BDL A;  4ZE8 A;  2F6P A;  4GVO A;  5ISU A;  1MQG A;  1NMU A;  4ONY A;  3RN8 A;  4EQB A;  1N04 A;  3K01 A;  4TQU Q;  3T22 A;  3OSR A;  1P1W A;  3L6H A;  5CM6 A;  3D4G A;  1N0T A;  2QSX A;  2PMS A;  2Y7W A;  1XS5 A;  3HO7 A;  1I6Q A;  3PUY E;  2QS1 A;  5KDT A;  3IOT A;  5AA2 D;  3K2D A;  1NNP A;  3C35 A;  1EU8 A;  3AXF A;  1IEJ A;  4HS7 A;  4ZDM A;  1PBP A;  5KDT B;  4G68 C;  3MZ1 A;  3FVO A;  3FJM A;  3PPN A;  4XKR A;  2O1L A;  3MBP A;  2DXR A;  1VFE A;  3K6V A;  4RY1 A;  1GTK A;  1SI1 A;  3CVG A;  4GXS B;  1QUI A;  3CSB A;  1MXX A;  2I4B A;  4RNS A;  3DP8 A;  4IGR A;  3LR1 A;  2A5S A;  2XXT A;  2F7C A;  3TQW A;  4ZEC A;  3OO7 A;  1PB8 A;  1TT1 A;  3KEI A;  5J1D A;  3FAT A;  2O1M A;  4QFO A;  4QFL A;  3SEX A;  1TFD A;  1JW4 A;  4ELR A;  1QUL A;  4KYS A;  4X48 A;  3HV1 A;  3FVG A;  2OBG A;  3TCG A;  2O51 A;  2HZL A;  3QXM A;  3IOW A;  5CMM A;  4N13 A;  3TAJ A;  3LSX A;  4ZE9 A;  4IY5 A;  1A7L A;  3OO9 A;  3DP4 A;  1ZLQ A;  4F2Q A;  1P99 A;  1A40 A;  4OEU A;  3JYR A;  4OEN A;  4THI A;  4PFU A;  4F22 A;  4YAH X;  5JTY A;  3S9M C;  3DEL B;  1NNT A;  3TCH A;  3GLB A;  3U72 A;  4H67 A;  4ZED A;  4U4X A;  3Q28 A;  2B65 A;  2F8D A;  4MF3 A;  2DP8 A;  1LAF E;  1ZMG A;  1XT8 A;  4AQ4 A;  4EQ7 A;  3RT8 A;  5F7V A;  3PV0 E;  4G4P A;  1MXU A;  2ALU A;  1SW2 A;  2DE3 A;  3VLW A;  3FZV A;  1LGB C;  3IR1 A;  1UTH B;  1YAE A;  2W7Y A;  5HM4 B;  1SD3 A;  1B1H A;  5LOM A;  3VV5 A;  5I59 A;  3B6T A;  3FJ7 A;  1LFH A;  3GBA A;  4X1B A;  3G3H A;  5H8S A;  4HCY A;  3T9V A;  5DTB A;  3ECR A;  1N76 A;  4ELP A;  2THI A;  5I59 B;  3U1O A;  1VR5 A;  2HEU A;  2CMO A;  3L6G A;  3TPA A;  4PQJ A;  1MPD A;  1LB8 A;  2QPQ A;  5HPQ A;  2IA4 A;  2F36 A;  5EYF A;  3TYH A;  4R75 A;  1XVX A;  2F6G A;  4RPO A;  3O28 A;  1A99 A;  5H8F A;  3GZG A;  1MY2 A;  4ELQ A;  4H1X A;  1II5 A;  3OEN A;  3LSW A;  3UOR A;  3KBR A;  4E0W A;  2O7U A;  1B7U A;  3VE1 B;  2F7A A;  5H8F B;  2P0S A;  3RTW B;  3UA8 A;  1SYH A;  1SW4 A;  2GH9 A;  5DEX A;  1SYI A;  4KR5 A;  4Q0C A;  4OER A;  4LQ5 A;  3N6U A;  3O66 A;  3S9L C;  3N6T A;  1MXY A;  3ZKL A;  1Y3Q A;  4NF5 A;  3E9X A;  4U1Z A;  4OHN A;  3G3J A;  1AMF A;  4U2R A;  3IO6 A;  1ATG A;  2F7B A;  2UXA A;  2X7P A;  4GWO A;  4P0I A;  4GL8 A;  3PMV A;  4NF5 B;  5AA4 A;  3ILT B;  4JWX A;  1CB6 A;  2I4C A;  4NF6 A;  5AA2 A;  2HCA A;  2ESN A;  5KCJ A;  4R72 A;  1S7Y A;  1B32 A;  3MVW A;  4NF8 A;  3W15 C;  4IY6 A;  4DCY A;  1VE4 A;  3ZSF A;  3MVX A;  4X9T A;  5AA4 B;  4ISU A;  4NF6 B;  5AA2 B;  1DMB A;  4AB6 A;  5AE4 A;  1WDN A;  5KCJ B;  4POW A;  3D4C A;  1FQB A;  4LZ5 A;  1JW5 A;  1NH8 A;  2RC9 A;  3TTN A;  3C4M A;  4Q5T A;  1Y4T A;  1YCJ A;  3S2V A;  2Y84 A;  1FTO A;  3RGY A;  1QW0 A;  3VVF A;  4TLM B;  1OMP A;  3A09 A;  2GHA A;  1QJM A;  1RKM A;  2PBW A;  4QSE A;  4NWD A;  1J1N A;  5CMC A;  4KCD A;  3RTF B;  3UGW A;  3OEK A;  4F3B A;  4NF4 A;  3VFJ A;  2QL3 A;  3K6U A;  3KFM A;  4H5F A;  1D9Y A;  3EPE A;  3V89 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...