4IO7A

Crystal structure of the avglur1 ligand binding domain complex with phenylalanine at 1.9 angstrom resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
248
structure length
244
Chain Sequence
GSARLKGITLRIGVIESVPFTIVANVIRNTTKLTGYVLDLIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKKKWFQTKACP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anions Mediate Ligand Binding in Adineta vaga Glutamate Receptor Ion Channels.
pubmed doi rcsb
source organism Adineta vaga
molecule tags Membrane protein
molecule keywords AvGluR1 ligand binding domain
total genus 76
structure length 244
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io7A02
1B3GA 3HHGA 3CFLA 2RF1A 1XHYA 3IX1A 1NH7A 4BDMA 4H6DA 3MWBA 3OMBA 4LONB 4EDPA 4QFOA 2O68A 1NFTA 3QAXA 3LC8A 4KQPA 1ZBMA 3K0VA 3TCGA 5KCJA 1NH8A 4JB7A 4EXLA 3OO6A 4NWCA 4Q5TA 1SW2A 3IB2A 1B3EA 4X1DA 2Y7IA 3H6TA 4YKJA 4OHNA 3L6GA 2F7CA 1MRPA 3TAJA 3S9LC 3GBAA 3FXRA 4X48A 4BDRA 5K2XA 2XXPA 2UVHA 2XX8A 4YAHX 1P1QA 2GRVA 3IO6A 3K6VA 1N3XA 1B3LA 3JYRA 1S9TA 4U22A 1VR5A 3O6HA 3VVFA 2D5WA 1URGA 3TTKA 4IO5A 5H8NA 1DMBA 3KG2A 3LSWA 5L9OA 3DP4A 1B4ZA 1FQBA 1MXWA 2Z8FA 3G7WA 3EPEA 4GVOA 4KCCA 3VLUA 3QSLA 1DOTA 3SESA 2RCAA 3D4GA 1H45A 3FIRA 1JW5A 1TWYA 3HPIA 4H8JA 4P0IA 1B4HA 1UTBB 5DVJA 2XHDA 1RKMA 4GLIA 4IO7A 4R2FA 2QS1A 4I62A 4R74A 4G77A 1UTHA 3E9XA 1TFAA 1A99A 1JETA 2ZNSA 3MP6A 2F97A 1B1XA 2F7BA 1MQIA 4JWYA 4IO4A 5ITOA 3VE1B 1EU8A 1MY3A 4BDQA 2HFBA 5CM6A 1FQEA 1MY0A 3IB1A 1Y20A 2P2AA 3N94A 4Z7EA 3CFXA 4ZE9A 3EQ1A 3CI8A 3PMXA 5CBSA 1S7YA 1B05A 3MVXA 1O63A 4LQ2A 1GV8A 4NTLA 5I59B 1EZOA 1NNPA 1MS7A 3DM0A 3OD7A 3FXUA 3MC2A 2ABHA 5CMMA 3THIA 3K6WA 3N6UA 5HM4B 2FNCA 2I49A 4BDNA 1CE2A 2F78A 1KWHA 3C36A 3LSLA 1MXXA 5I57A 3BFTA 1SW4A 1MH3A 3H03A 4M1VA 2XXXA 4N07A 4XTCQ 3RPWA 3VLWA 5EYFA 1I69A 1JQFA 3TELA 1Y4CA 3W15C 1NL5A 1PBPA 3O28A 5I2KB 3OEKA 1OIBA 1SI1A 2DE2A 2DOJA 1FQDA 4H8IA 1MY2A 3G3FA 2H98A 3C4MA 3L6HA 1R9LA 1ZKBA 4MLQA 4EF1A 3N6TA 1JVYA 4YB5A 3T93B 1MPCA 2QS2A 2AYSA 3V8XB 2G29A 3A09A 3C31A 4UACA 4POWA 1MXZA 2GH9A 3RTWB 2O1MA 2ZMBA 3GZGA 4R6HA 1PB9A 3FVGA 3G3GA 3K01A 3N5LA 4PQJA 4NEDA 1NNFA 3TTLA 3ZKKA 4YMAA 4NF8A 1Y1MA 1IZ1A 4OEVA 3RN8A 2XXHA 3CSGA 4GXAA 3TTNA 3U92A 3VFJA 3MPLA 5DEXA 3CRBA 2Z8DA 3QUJA 4ZECA 1N7WA 4LZ5A 4DLDA 3VDFA 4KPTA 5KDTB 3TTRA 4R72A 1MH4A 3GLBA 1B7HA 3LSXA 4RPNA 3TPAA 1D3KA 3PUVE 1LAHE 3B6WA 4OESA 3TKDA 2Q2CA 1NNKA 2Y84A 5I2NA 3FV2A 4NF4A 1Z7ME 3MVWA 4DZ1A 4AQ4A 1GGGA 1NNTA 1H3DA 1RYOA 2OBGA 4RPOA 5AA1A 3SEVA 4C1TA 2Y7RA 4E0XA 1I6BA 5FHNA 3QYTA 2ZYOA 4ZEBA 3TDJA 4GL8A 1SQYA 3EHSA 3VV5A 2PYYA 3BKIB 3ODBA 2XXRA 2WKYA 3OOAA 4U1ZA 2DP8A 3SEWA 2A5SA 3TODA 3TUSA 3T9XB 2PX1A 4ZS9A 5CBRA 1B32A 4XKPA 3QIMA 1O7TA 5DEXB 5K2YA 2V3UA 3TCHA 4OYVA 4RJZA 1PB7A 3CFZA 4F19A 2HXWA 3FASA 3HO7A 1D9YA 3PV0E 4Z0IA 3RNNA 3O6IA 4FEBA 3EHUA 3FVKA 1QKBA 3Q25A 4JWOA 1TFDA 5JTYB 1QUKA 4FE8A 3OO8A 1DPEA 1MPDA 4ZEKA 4GQOA 1BLFA 2PVUA 3FVNA 2F8DA 3IK6B 3KFMA 4YZZA 3HSTA 4P0GA 3WAEA 2A5TA 4Q30B 3R7XA 2I6EA 2F7AA 4HS7A 4JXIA 3MP8A 1Z7NE 3DP6A 3JV9A 3OSQA 3R6UA 4GFRA 4RXLA 3UN6A 2ONRA 1B51A 3FXQA 2Z23A 3DLNA 1PBQA 3PPNA 5M2VA 2Q8JA 3C34A 2O51A 4BDOA 4ZEFA 4DXUA 2I48A 3G3IA 3W9WA 2QJEA 2H25A 2HEUA 5H8SA 1XC1A 2BJJX 4NE4A 1NKXA 3K1PA 3M3LA 3Q27A 4XKRA 1MY4A 1OMPA 1F9BA 4NF4B 1SW1A 2P0SA 1YTVA 2Y7KA 5A5XA 3S9MC 4YICA 5DYHA 1YAEA 5CI5A 1LSTA 3FGSA 3DP8A 4DCYA 3IOUA 1OVBA 3QXMA 2CZLA 1JW4A 5J1DA 2V3QA 5AA2D 4QFKA 4LP2B 3KJ7A 3PUWE 1IXGA 2RCBA 5FTIA 1M5FA 4OENA 4QF9A 1SD3A 4F1YA 1AMFA 3A3CA 3GXAA 4QFNA 2DWHA 1B0LA 2ANJA 3B7DA 1CB6A 2X7QA 3IOWA 1XVYA 2RINA 3IL1B 1BTJA 3JZJA 4OETA 4IO3A 4XIGQ 4ECFA 3S9NC 1NMUA 1MQGA 2V84A 3A3UA 4TLMB 4C0RA 1ELJA 4H65A 2OLBA 3O9PA 4H67A 3PPQA 5H8HA 3MP1A 5H8HB 3VXCA 4FAJA 1HSEA 2GHAA 2XXWA 1ZMGA 2ZNUA 3KN8A 2F6PA 1N3WA 3QK6A 4LATA 3O6GA 3T9UA 3UK4A 4F3SA 3IO4A 2OWTA 4M4GA 3PUXE 1VFEA 2UVJA 4WXJA 5EHMA 5A5XB 3HN0A 4G8NA 3OEMA 2OJTA 3PPPA 5KCJB 4EF2A 4F3GA 1QUIA 4FORA 3MZ9A 3SERA 4YB7A 4MF3A 3N26A 1BP5A 1MY1A 3G3JA 5FTHA 1M5CA 1PDAA 1H76A 2XXYA 3HV1A 4AB6A 3K02A 4ISUA 3ECRA 4F2OA 2HQ0A 5KDTA 1SI0A 4FECA 1N7XA 3MJNA 1FTMA 1OQHA 1SBPA 4GXSB 1B46A 3KBRA 3OENA 4FATA 1WVJA 3AXFA 4K3FA 1P1WA 3OO9A 5HBCA 4U23A 4ZEIA 4F3PA 5LOMA 1Y1ZA 1POY1 4RK2A 3UGWA 1IXHA 4U21A 4U2RA 4OXVA 3MUQA 1UTBA 1BKAA 4PETA 4TLLB 2DWIA 3U94A 3KN7A 4G2ZA 3K1NA 5I2NB 3OELA 3KOSA 3PMVA 5ISUA 4JBZA 3QUFA 4OZ9A 3PPRA 2DVZA 4JWXA 4F18A 2VHAA 3E3KA 1MM6A 3I6VA 4THIA 2Z8EA 4QSCA 2A5TB 4F31B 1LBBA 1WODA 1UIUA 3F11A 4LA9A 2O6AA 3RLFE 3PU5A 1MXUA 3PD9A 1XT8A 4LZ8A 1GTKA 2VGQA 4IY5A 4NF5A 4QSDA 3T96B 4DXBA 5ITPA 1I6AA 4Q0CA 1PB8A 1XVXA 4R2BA 2NWJA 1QW0A 3U1OA 4MH5A 1H44A 1OLAA 1OQGA 4G8HA 3KOTA 1JVXA 5FHOA 4F1VA 3H7MA 3OXNA 2HCAA 4KR5A 3UORA 3IOTA 2ZNTA 4JDFA 4PFYA 5AA3A 1YPNA 2XXVA 2I3VA 2YLNA 1RYXA 3BBRA 3ILUB 4PFTA 3D4CA 3E4RA 3Q26A 4R9FA 5I2KA 3IOVA 1D4NA 1TXFA 1II5A 2ESNA 4X9TA 2XXQA 1B5HA 1LFIA 3IR1A 4OERA 4DXCA 4EQ9A 2R9JA 4F1UA 1ZU0A 1DTZA 1QVSA 5I58A 3CIJA 1JNFA 5HPQA 4EXKA 4OEUA 1FCKA 3U72A 2ALUA 3H4ZA 3PMWA 2RC8A 2NVUB 1A54A 2AL5A 3HHFA 3I5OA 4PP0A 3RT8A 4N13A 2D3IA 4RYAA 5I84A 4ELOA 4P11A 1HSJA 3EHTA 1US5A 5ELVA 5AE4A 1MG1A 2XD3A 2AIXA 5KZTA 1LCFA 3SDFA 1UIVA 1MDP1 1Y3NA 3V83A 1MDQA 1SDXA 1M5DA 5TPAB 4IO2A 4Q8RA 1QUJA 5B70A 2XD2A 3IORA 5CRYA 1FQFA 3IAZA 3H6VA 4FIMA 1M5EA 1EZPA 3LSFB 2Q88A 4F29A 3SETA 5H8NB 4E0WA 1N76A 3K6UA 5L8DA 5I59A 3FUZA 1SVXB 2QMXA 1P99A 4YKIA 3TYHA 2RKMA 1FQAA 3FJGA 2UVGA 1Y9UA 2B3FA 2I58A 3G3HA 4OFLA 4PE5B 3K1MA 3UP9A 3VVEA 5F1QA 5AA4B 3B6QA 1A40A 4IY6A 1US4A 1BIYA 3FJ7A 1Y4TA 3UIFA 4UA8A 1GR2A 2VP1A 1JW1A 4RNSA 4F3BA 5DVFA 1SW5A 1USYE 1IEJA 3C32A 3K6XA 2DQVA 2XXUA 2DWJA 3CR9A 1QKAA 2O69A 3G3KA 3RQTA 1LBCA 2ZYNA 3LUYA 2O84X 5L9MA 2I0BA 5AA2B 4GRKA 5L9SA 1B1HA 3UA8A 3R26A 1A7LA 2ONKE 1A8FA 2XX7A 3KSXA 4H5GA 4IGRA 2F6GA 4LZ7A 3M8UA 2FA7A 1Y3PA 2O7UA 3FZVA 3ZS6A 1B7UA 1LAFE 4KYDA 2LAOA 1Q35A 2Y7PA 3LBSA 3P7IA 3PPOA 2Q2AA 2F34A 1UTHB 2ZYMA 2DE4A 3KGCA 2E0SA 4GL0A 1PEBA 3RGYA 3HCQA 3MQ9A 4U4SA 2O1LA 1B5JA 2AL4A 4O3AA 2REGA 2RC7A 3MAMA 4F39A 1LGBC 2DVCA 4QHQA 2Y7WA 3VLVA 4BLAA 2H99A 1VE4A 1T0KA 2OK2A 2IA4A 3O2AA 2HZKA 4L17A 4OVJA 2DWAA 3C9HA 2G93A 3GBBA 4FEDA 1DPPA 1B7ZA 2DE3A 1P1UA 3H6UA 3KEIA 5TP9B 3TTMA 1ATGA 5DVIA 2X26A 3H3GA 3C33A 4KYEA 5I57B 3FATA 4I9DA 4DE8A 2UYFA 2UYEA 2ZYKA 4IB2A 1B0HA 4IO6A 3FJMA 1L5TA 4EQ7A 2Q89A 4R73A 2V25A 4JSOA 2H5YA 2F36A 3LR1A 2B3BA 2RC9A 3O97A 2F5XA 4RY1A 3S9EA 2E1SA 3FVOA 4BDLA 3MBPA 3MZ1A 4H5FA 4WKMA 1GVCA 5CMBA 3RT6B 3CVGA 4F2QA 1N04A 2NOOA 3B6TA 4LUBA 3U93A 4ELRA 4ESXA 2THIA 2UVIA 5BWJA 1ZTYA 4KI0E 2H9BA 1LAGE 1Y3QA 2NUVA 1QULA 2O7IA 5IKBA 4ZZAA 4QRZA 2R71A 5AA4A 1USYH 3H06B 4NF8B 4OWDA 4QFPA 4ZE8A 5F7VA 3V89B 4H1XA 4XKQA 1P1OA 4N6PA 5I56A 5JTYA 3K00A 3KSJA 2F35A 2I4CA 3K4UA 4KD5A 1MQHA 4RK9A 3PUYE 4HCYA 1R1NA 3KN3A 3Q29A 4TQUQ 1POTA 2OZZA 5FHMA 3SEXA 1B3FA 1Q1KA 3OSRA 3T22A 4DCXA 2VD3A 2DSFA 1SYIA 2OWSA 2ZXTA 4GWOA 2FYIA 1IXCA 2Z22A 2PMSA 2QPQA 3MVYA 2QL3A 4ONYA 3RY3A 4TOZA 3S4UA 5CMCA 3SKPA 1D9VA 3T9VA 4MLVA 2P1SA 3ZSFA 4EQBA 3ZKLA 1LCTA 5AA2A 1O64A 1YCJA 3RUMA 1B40A 4I1DA 3TEPA 2R6GE 1M5BA 2GHBA 2QS3A 4G68B 4ELQA 2DXRA 2QRYA 2H4IA 5IAIA 3S2VA 3V5AA 5JK4A 4ESWA 1J1NA 1IUDA 4R6KA 1IITA 1B3HA 3KZGA 4FJPA 2GFEA 3IB0A 1AIVA 1MQDA 2DYXA 3BFUA 2PT1A 4JSDA 2B65A 4NF6A 1S50A 1IQ7A 5DT6A 2OCUA 4IGTA 1MXYA 4OFJA 1FQCA 2Q9TA 4LVQA 4ELPA 2PT2A 3K2DA 4U4XA 3SEUA 3PGFA 1MXVA 1R9QA 1ZIUA 3OO7A 4R9GA 1R6ZA 1EH3A 1VFDA 2HAUA 1SYHA 1PC3A 3MPKA 4GIZA 4MFIA 5DTBA 5TPAA 2CMOA 3M3FA 4NWDA 3FV1A 4RA1A 3WAFA 3O29A 4R75A 4HW8A 4AB5A 1OVTA 5EHSA 4F22A 5ICQA 4OFOA 2VD2A 4QSEA 2HAVA 5CMKA 4POXA 3EN3A 2KLFA 4GOTA 4YKPA 5H8FA 3EF7A 1ANFA 4NF6B 4R6YA 4U1OA 2QMWA 4LQ5A 3TZAA 2W7YA 3ONMA 2QS4A 4C1UA 1ZJLA 2I3WA 3T9HB 1LFHA 3VXBA 1AH5A 1IXIA 5I56B 3M3KA 3MVZA 1FTLA 3IJOB 3TQLA 5I58B 3DELB 4MBPA 4HTGA 4YU0A 2V93A 3FD3A 4G68A 2IEEA 2VOZA 2YPNA 1FTOA 4PFUA 1B9JA 3CSBA 3RTFB 5ICTA 4XKNA 2XX9A 1XOCA 2UXAA 2YJPA 4GF8A 1WDNA 3USDA 3PUZE 5CC2A 5B7DA 2I4BA 4ND9A 4OMBA 5TP9A 1AL3A 1A55A 1B2HA 2REJA 2I0CA 3IJXB 4G68C 3SEYA 1JEUA 2M8CA 1N84A 4EUOA 4ZEDA 4DIGA 1HSLA 1B6HA 4KHZE 2D21A 1LFGA 1MQJA 3O66A 2QSXA 1QJMA 1LB8A 1VSOA 3MZBA 4QFLA 4WEDA 1H43A 4YKKA 3H6WA 4DDDA 5BUUA 1MPBA 1TT1A 4I8CA 1OLCA 4G4PA 1UQWA 4GD5A 1AOVA 3PD8A 4YB6A 4WEPA 1A8EA 3CG3A 2ONSA 4NF5B 1ZLQA 2V3TA 4KFQA 3VVDA 1FTJA 4OQOA 5H8QA 3TCFA 4X1BA 4ZDMA 3W9VA 1B5IA 1JEVA 3C35A 3KJTA 1N0TA 4H0WA 1EZ9A 5H8FB 4O3BA 3TMGA 1B52A 2DXYA 1I6QA 4NMYA 1URDA 4G8MA 3ILTB 4HCWA 1IIWA 5JEIA 1FTKA 1XS5A 1FW0A 3MW0A 5H8QB 1P1NA 3U8QA 4XXUA 4OTEA 1URSA 2XXTA 4O3CA 3E13X 3I3VA 4KCDA 4YMBA 4ZZEA 2XXIA 3CG1A 2X7PA 1LB9A 5TU0A 3TFLA 1DTGA 2DS9A 1DSNA 2NXOA 1MM7A 4KYSA 2PBWA 1LAXA 4PFWA 3T66A 1LLSA 3TQWA 2HZLA 1B58A 3Q28A
chains in the Genus database with same CATH superfamily
3HHGA 3CFLA 2RF1A 2O68A 1ZBMA 3K0VA 3MYUA 1NH8A 5ET8A 3OO6A 4X1DA 2PFZA 1B3EA 1INPA 4PBQA 4X48A 1P1QA 3K6VA 4U22A 3VVFA 1DMBA 3KG2A 1FQBA 3G7WA 1DOTA 3D4GA 1JW5A 4P0IA 1UTBB 1RKMA 4R2FA 4OVQA 3MP6A 2F97A 1B1XA 5ITOA 4Z7EA 3CFXA 3EQ1A 3MVXA 1B05A 1GV8A 3DM0A 3OD7A 5HM4B 2ABHA 3THIA 1CE2A 2F78A 4N07A 2FIXA 3RPWA 5EYFA 1I69A 1JQFA 3TELA 1PBPA 3O28A 4PC9A 2DE2A 4H8IA 4MLQA 3C4MA 1ZKBA 4YB5A 3T93B 4OVSA 1MPCA 3V8XB 3A09A 3RTWB 3K01A 4NF8A 1IZ1A 1FJ9A 5DEXA 4DLDA 3VDFA 3PUVE 3TKDA 3B6WA 5I2NA 1Z7ME 4C1TA 1GGGA 1RYOA 1H3DA 4ZEBA 3EHSA 3ODBA 3TUSA 2XXRA 3TODA 3T9XB 2KR0A 3FASA 3HO7A 3PV0E 3O6IA 4FEBA 1QKBA 1DPEA 3IK6B 3KFMA 4Q30B 4HS7A 3OSQA 3FXQA 5M2VA 1FPEA 4ZEFA 2I48A 2P3NA 3K1PA 2Y7KA 1YAEA 5CI5A 3FGSA 3IOUA 2FVZA 4MNCA 1SD3A 4N8GA 3B7DA 1G0HA 4ECFA 1EYKA 3MP1A 5H8HB 2ZNUA 2GHAA 3UK4A 2F6PA 3T9UA 4HXVA 2OWTA 3PUXE 1KZ8A 4NG7A 4YB7A 3IFAA 1H76A 2XXYA 4AB6A 4ISUA 4HE2A 4FECA 3MJNA 4NQ8A 3KBRA 4FATA 1WVJA 3AXFA 4U23A 3T1BA 4U2RA 1UTBA 4G2ZA 3PMVA 3QUFA 4OZ9A 1LBWA 4THIA 2A5TB 3PU5A 5I5PA 1MXUA 1XT8A 1GTKA 5JTYA 1I6AA 1OLAA 1OQGA 3KOTA 4F1VA 3H7MA 4KR5A 4QXDA 3FBPA 4JDFA 3BIHA 5AA3A 3ILUB 2ESNA 2R9JA 2JJKA 3CIJA 4PF8A 4EXKA 3H4ZA 2RC8A 3HHFA 4ELOA 1HSJA 5AE4A 5ELVA 1MG1A 1UIVA 1MDP1 1SDXA 1M5DA 3IORA 3H6VA 1EZPA 3LSFB 4E0WA 5I59A 3FUZA 1SVXB 4PDDA 2UVGA 2B3FA 3G3HA 3VVEA 3UP9A 5F1QA 4MHFA 5DVFA 1SW5A 1IEJA 2XXUA 2DWJA 2O69A 3RQTA 2O84X 1FPJA 2I0BA 2WBBA 1FSAA 2XX7A 3U65A 2O7UA 3FZVA 1LAFE 1Q35A 3LBSA 3PPOA 2NVUB 3TAJA 2F34A 4F39A 1VE4A 2OK2A 2IA4A 3O2AA 2HZKA 4L17A 2DWAA 3GBBA 4FEDA 3KEIA 1P1UA 3H3GA 3C33A 2UYFA 1B0HA 4MX6A 4JSOA 2F36A 3LR1A 2B3BA 3O97A 2F5XA 4WKMA 5CMBA 3U93A 4LUBA 1ZTYA 2NUVA 2R71A 5AA4A 1USYH 1P1OA 4N6PA 3K00A 3KSJA 3K4UA 4KD5A 4TQUQ 1R1NA 1FPKA 4DCXA 4N91A 2ZXTA 1NV3A 2FYIA 1IXCA 2Z22A 4ONYA 4BDOA 3W9WA 2QL3A 1D9VA 4EQBA 3ZKLA 3TEPA 1FBCA 4NGUA 2R6GE 5IAIA 4NX1A 1YYZA 1IITA 3KZGA 1MQDA 3BFUA 2Q9TA 1MXVA 1R9QA 4XF5A 1VFDA 4IR8A 4NWDA 5EQ7A 4HW8A 1B58A 3EF7A 1NUXA 1IXIA 2QVUA 4G68A 3PUZE 5CC2A 5TP9A 3SEYA 1HSLA 2QSXA 1VSOA 1LB8A 2V3TA 1JEVA 2WYKA 1NV1A 1NI9A 1I6QA 1URDA 4G8MA 3ILTB 5JEIA 5H8QB 4OTEA 1URSA 3E13X 3I3VA 4YMBA 4ZZEA 5TU0A 2F3DA 1FBPA 2NXOA 4KYSA 2Q74A 3MSTA 3MWBA 4EDPA 4QFOA 3QAXA 3LC8A 3H6TA 4HE0A 4YKJA 4AS5A 3GBAA 2UVHA 2XX8A 1B3LA 1S9TA 1VR5A 3TTKA 1URGA 5H8NA 3DP4A 1B4ZA 4KCCA 3EPEA 1H45A 1JETA 2Y5LA 4E0XA 2F7BA 4JWYA 1MQIA 3VE1B 4IO4A 1FQEA 3IB1A 1AWBA 3N94A 1S7YA 4JVCA 4XEQA 1NNPA 3B8BA 3MC2A 2I49A 4BDNA 1IMDA 1KWHA 3C36A 3H03A 3VLWA 1Y4CA 4MNIA 5I2KB 3OEKA 2DOJA 2H98A 4EF1A 2AYSA 2G29A 3C31A 2Q8MA 4POWA 1MXZA 2O1MA 4OVTA 2BJIA 4R6HA 4UABA 4PQJA 2QVRA 3TTLA 5EQAA 1Y1MA 3RN8A 2XXHA 3U92A 3TTNA 5T3JA 3CRBA 1N7WA 3GLBA 4RPNA 4AS4A 1LAHE 1NNKA 4NF4A 3MVWA 3SEVA 2Y7RA 1I6BA 5FHNA 3QYTA 3TDJA 1SQYA 1NUWA 3VV5A 4U1ZA 2WKYA 4P1EA 2DP8A 2PX1A 1B32A 5DEXB 2ZZXA 3IFCA 2V3UA 3TCHA 4RJZA 3B50A 1FBDA 2HHMA 3EHUA 3FVKA 3Q25A 5JTYB 1MPDA 4ZEKA 4GQOA 1NUYA 2PVUA 2F8DA 3WAEA 2A5TA 3R7XA 2I6EA 2F7AA 4JXIA 2HXRA 3JV9A 1B51A 2Z23A 1PBQA 3C34A 2QJEA 2BJJX 4NE4A 1NKXA 1LEVA 3M3LA 3Q27A 4XKRA 1OMPA 2FBPA 1F9BA 1SW1A 4GBVA 1OVBA 3QXMA 2CZLA 5J1DA 1FPLA 5AA2D 3KJ7A 4QF9A 2DWHA 1CB6A 3IOWA 1BTJA 3JZJA 4OETA 1MQGA 2V84A 4H65A 5H8HA 4I40A 4MJOA 4Q5TA 1ZMGA 3E78A 1VFEA 3OEMA 2OJTA 4F3GA 4OA4A 1YZ0A 4MF3A 3N26A 1MY1A 1M5CA 3K02A 3ECRA 2HQ0A 5KDTA 5LTCA 4HE1A 1DK4A 1OQHA 4GXSB 3RPLA 3OENA 4ZEIA 5HBCA 4F3PA 2KQZA 1POY1 2B4LA 4GWXA 4PETA 5ISUA 4JBZA 3PPRA 4F18A 3I6VA 2Z8EA 4QSCA 1WODA 4IY5A 4Q0CA 2NWJA 1H44A 1XI6A 3ROJA 3OXNA 3UORA 3IOTA 4PFYA 1RYXA 4KXPA 5I2KA 1TXFA 1II5A 1B5HA 1LFIA 5I58A 4OEUA 4GBWA 2AL5A 3I5OA 2MKZA 4N13A 1IMEA 3EHTA 5ET5A 5LDZA 4O8MA 4IO2A 3IAZA 4FIMA 1M5EA 4N15A 5H8NB 3K6UA 4N6KA 4P3LA 2QMXA 4YKIA 2RKMA 3FJGA 4PE5B 3B6QA 4QBAA 4IY6A 2PCRA 4RNSA 1JW1A 1RDYA 3OMBA 3C32A 3K6XA 3G3KA 1QKAA 4PGPA 1LBCA 3LUYA 1B1HA 3UA8A 3R26A 4H5GA 1A8FA 2FHYA 2F6GA 4LZ7A 2FA7A 3ZS6A 4GWUA 1B7UA 4KYDA 3P7IA 2ZYMA 2DE4A 2E0SA 1PEBA 3RGYA 1LBVA 4O3AA 2RC7A 2DVCA 4QHQA 3VLVA 2DDKA 4BLAA 2H99A 1FPIA 1T0KA 4OVJA 3C9HA 3TTMA 5I57B 4I9DA 2UYEA 2ZYKA 4EQ7A 2V25A 1FPDA 2RC9A 2ZZWA 4BDLA 3RT6B 4DI3D 1N04A 4ELRA 5BWJA 4ESXA 4KI0E 1LAGE 1JP4A 1Y3QA 5IKBA 4OWDA 4ZE8A 4H1XA 4Z0IA 5ET7A 3PUYE 1POTA 3T22A 3S4UA 1FBGA 4TOZA 3T9VA 3ZSFA 3SKPA 1LCTA 1D9QA 4PAIA 2GHBA 4G68B 4ELQA 1KA0A 2H4IA 1NV2A 3V5AA 5JK4A 4R6KA 2GFEA 2DYXA 4JSDA 5DT6A 4IGTA 4GX4A 2PT2A 3PGFA 4R9GA 1RDXA 4RA1A 1OVTA 1IMAA 5ICQA 2HAVA 4POXA 2KLFA 4GOTA 5H8FA 1ANFA 4U1OA 3E79A 3ONMA 1ZJLA 1AH5A 3IJOB 4PFUA 2V93A 2IEEA 1FTOA 3CSBA 2UXAA 1WDNA 5B7DA 1AL3A 2M8CA 4ZEDA 1FPBA 1B6HA 2HPGA 2XA5A 1QJMA 3MZBA 4H46A 5BUUA 1MPBA 2WX9A 1OLCA 1UQWA 4YB6A 2ONSA 3QMFA 4KFQA 3VVDA 3W9VA 3C35A 1N0TA 1EZ9A 4N81A 4HCWA 1IMCA 1IIWA 1FTKA 3MW0A 2XXTA 5ET6A 4G61A 4KCDA 2XXIA 3CG1A 2X7PA 3TFLA 2DS9A 1DSNA 1MM7A 1LLSA 2R8TA 3LV0A 1NH7A 2CEYA 4LONB 4KQPA 5KCJA 4EXLA 4NWCA 1SW2A 3IB2A 2Y7IA 4OHNA 2F7CA 1MRPA 3S9LC 3FXRA 4BDRA 5K2XA 2XXPA 4YAHX 3IO6A 2GRVA 1N3XA 2D5WA 5L9OA 3VLUA 4GVOA 2Z8FA 3QSLA 3SESA 2RCAA 3FIRA 1TWYA 4H8JA 5DVJA 4GLIA 4NHBA 1UTHA 3E9XA 3A29A 3NOHA 4BDQA 1EU8A 1MY3A 2HFBA 4XFEA 2P2AA 3PMXA 5CBSA 1O63A 4LQ2A 4NTLA 5I59B 2FNCA 1FBFA 1MXXA 3BFTA 1SW4A 2XXXA 4XTCQ 3W15C 1NL5A 1MY2A 3G3FA 4N4UA 1R9LA 3N6TA 4X8RA 2ZMBA 3GZGA 3G3GA 1NNFA 4PFIA 1EYIA 3CSGA 3VFJA 3MPLA 4ZECA 2VPNA 4LZ5A 4KPTA 5EYHA 5KDTB 3LSXA 1B7HA 4OESA 2Y84A 2OBGA 4RPOA 1NV7A 5AA1A 4FBPA 4GL8A 2PYYA 2ZZVA 2A5SA 4ZS9A 4XKPA 4OYVA 4F19A 2HXWA 4O7MA 3RNNA 3LUZA 4NN3A 3OO8A 1BLFA 3FVNA 5IZ1A 3DP6A 3UN6A 3R6UA 4RXLA 4GFRA 2ONRA 3PPNA 4DXUA 2CEXA 3G3IA 2H25A 1XC1A 5I3SA 1MY4A 4NF0A 4P1LA 4YICA 4DCYA 2V3QA 4LP2B 2OWZA 2RCBA 1Q9DA 1AMFA 2F3BA 3GXAA 4QFNA 1B0LA 2ANJA 2X7QA 3ISPA 1XVYA 1NMUA 4PFRA 4TLMB 4C0RA 1ELJA 2OLBA 1IMFA 3O9PA 4H67A 3VXCA 4FAJA 1HSEA 2XXWA 3KN8A 4LATA 3QK6A 3O6GA 4WXJA 4M4GA 5EHMA 3HFUA 3MZ9A 3SERA 3G3JA 1PDAA 4F2OA 1P1WA 3OO9A 4OXVA 3MUQA 3KC0A 4TLLB 2DWIA 3KN7A 5I2NB 3OELA 3F11A 4LA9A 2O6AA 2CZHA 4LZ8A 4NF5A 3T96B 1FBEA 4PBHA 4R2BA 4MH5A 4NAPA 1BK4A 2HCAA 2ZNTA 2VT5A 1YPNA 2YLNA 3D4CA 4R9FA 3IOVA 4DXCA 4OANA 2XXQA 3IR1A 4OERA 5F24A 1JNFA 5HPQA 2ALUA 3RT8A 1NV6A 4RYAA 5I84A 1US5A 5EYGA 3V83A 1K9ZA 1MDQA 5TPAB 5B70A 5CRYA 1FQFA 4F29A 3SETA 4OVPA 2XWVA 1P99A 3TYHA 4PF6A 1Y9UA 2I58A 3K1MA 1US4A 1BIYA 2XXKA 4UA8A 2VP1A 5H8SA 3CR9A 3TTRA 5L9MA 5AA2B 3FXBA 3M8UA 2XWKA 1Y3PA 2Y7PA 2Q2AA 3KGCA 3BIGA 2AL4A 2REGA 3MAMA 1LGBC 2Y7WA 4P8BA 4GWSA 5TP9B 1DCUA 1B7ZA 2DE3A 3H6UA 1ATGA 5DVIA 3PTYA 3FATA 4IO6A 1L5TA 3FJMA 3S9EA 2E1SA 4H5FA 4F2QA 2NOOA 2THIA 2H9BA 4ZZAA 5I56A 5F7VA 4XKQA 4PAFA 2F35A 2I4CA 4RK9A 1NV5A 3Q29A 3KN3A 5FHMA 1B3FA 2VD3A 2DSFA 2OWSA 3MVYA 5IM2A 4DI4B 5CMCA 2WEFA 5AA2A 4I1DA 2QS3A 1FRPA 2QRYA 3EKIA 2QFLA 4ESWA 1J1NA 1IUDA 2XWOA 4FJPA 3IB0A 1AIVA 4NF6A 2OCUA 1MXYA 4OFJA 1FQCA 4ELPA 5FBPA 3K2DA 4U4XA 3SEUA 2GQ1A 3OO7A 1R6ZA 3SDFA 1EH3A 2HAUA 4GIZA 4MFIA 5TPAA 1FPFA 3M3FA 3FV1A 3O29A 4R75A 4F22A 1FTAA 3EN3A 4P47A 4YKPA 4R6YA 3TZAA 2W7YA 4C1UA 2I3WA 1LFHA 3VXBA 1FTLA 3DELB 4YU0A 3FD3A 2VOZA 1SPIA 2YPNA 5ICTA 3RTFB 1B9JA 4XKNA 2XX9A 2YJPA 2CZIA 3IJXB 1JEUA 4EUOA 4DIGA 2D21A 3O66A 1LBZA 1H43A 3H6WA 1TT1A 4G4PA 1AOVA 4WEPA 1A8EA 3CG3A 4NF5B 1ZLQA 5H8QA 4ZDMA 1B5IA 3KJTA 4H0WA 3TMGA 5H8FB 4O3BA 2DXYA 4NMYA 1XS5A 1FW0A 4XXUA 4O3CA 4MIJA 5IZ3A 3D1RA 1LB9A 3TQWA 3Q28A 1B3GA 1XHYA 3IX1A 4BDMA 4H6DA 1NFTA 3TCGA 4JB7A 2QVVA 3L6GA 3JYRA 3O6HA 4IO5A 3LSWA 1MXWA 5DW8A 5I7IA 3HPIA 5J16A 1B4HA 2XHDA 4IO7A 2QS1A 4I62A 4R74A 4G77A 3SZPA 1TFAA 1A99A 2ZNSA 2WBDA 5CM6A 1MY0A 4GWWA 1Y20A 4ZE9A 3CI8A 1EZOA 2WYPA 1MS7A 3FXUA 5CMMA 3K6WA 3N6UA 5I57A 3LSLA 4M1VA 1MH3A 1DBZA 1EYJA 1OIBA 1SI1A 1FQDA 3L6HA 1JVYA 2QS2A 3RYDA 4UACA 2GH9A 1PB9A 3FVGA 3N5LA 4NEDA 3ZKKA 4YMAA 4OEVA 4GXAA 2Z8DA 3QUJA 4R72A 1MH4A 3TPAA 1D3KA 2Q2CA 3FV2A 4AQ4A 1NNTA 2ZYOA 3BKIB 3OOAA 3SEWA 1QGXA 5CBRA 3QIMA 1O7TA 4MMPA 4O7IA 1PB7A 3CFZA 1D9YA 4PAKA 4JWOA 1TFDA 1QUKA 4FE8A 4YZZA 3HSTA 4P0GA 3MP8A 1Z7NE 3DLNA 2Q8JA 2O51A 2HEUA 4NF4B 2P0SA 1YTVA 5A5XA 5DYHA 1LSTA 3DP8A 4O94A 2XWIA 1JW4A 4QFKA 3PUWE 1IXGA 5FTIA 1M5FA 4OENA 1K9YA 4F1YA 3A3CA 4GX3A 2CZKA 2RINA 3IL1B 1NUZA 4IO3A 4XIGQ 3S9NC 4LN5A 3A3UA 3PPQA 1FBHA 1LBYA 1N3WA 4F3SA 3IO4A 4N17A 2UVJA 5A5XB 4P9KA 3HN0A 4G8NA 3PPPA 5KCJB 4EF2A 1QUIA 4FORA 1KA1A 1BP5A 3RPLB 5FTHA 3CHGA 3HV1A 1SI0A 1N7XA 1FTMA 1SBPA 4H45A 1B46A 4MNPA 2L5VA 4K3FA 5LOMA 1Y1ZA 4RK2A 3UGWA 1IXHA 4U21A 4GX6A 1BKAA 3U94A 3K1NA 3KOSA 2DVZA 4JWXA 2VHAA 3E3KA 4JVDA 1MM6A 3KC1A 4F31B 1LBBA 1UIUA 3RLFE 2PFYA 3PD9A 2VGQA 4QSDA 4DXBA 5ITPA 1PB8A 1XVXA 1QW0A 3U1OA 4G8HA 1JVXA 4GWYA 5FHOA 4PE3A 4PFTA 2XXVA 2I3VA 3BBRA 5EQ9A 3E4RA 3Q26A 1D4NA 4X9TA 4F1UA 4EQ9A 1ZU0A 1DTZA 1QVSA 1FCKA 3U72A 3PMWA 1A54A 4PP0A 3KBZA 1IMBA 2D3IA 4P11A 4I3EA 4MAGA 2XD3A 2AIXA 5KZTA 1LCFA 1Y3NA 2FIEA 4Q8RA 1QUJA 2XD2A 2Q88A 1N76A 5L8DA 5A5LA 1FQAA 4OFLA 1A40A 3FJ7A 3UIFA 1Y4TA 1GR2A 4F3BA 1USYE 4MCOA 2DQVA 5L9SA 2ZYNA 4JVIA 4GRKA 1A7LA 2ONKE 2OX3A 3KSXA 4IGRA 1FPGA 4PTKA 2LAOA 1UTHB 4GL0A 5IZ3B 3HCQA 3MQ9A 4U4SA 2O1LA 1YXIA 1B5JA 3T0JA 2G93A 1DPPA 2X26A 4KYEA 4DE8A 4X04A 4IB2A 2Q89A 1RDZA 4R73A 2H5YA 4RY1A 4PDHA 3FVOA 3MBPA 3MZ1A 1GVCA 3CVGA 3B6TA 2UVIA 3GYYA 2P3VA 1QULA 2O7IA 4QRZA 4MEVA 3H06B 4NF8B 4QFPA 5AA4B 3V89B 4PFBA 4PGNA 3S9MC 1MQHA 4HCYA 4DZ1A 2OZZA 3SEXA 2VPOA 1Q1KA 3OSRA 1CNQA 1SYIA 4GWOA 2PMSA 2QPQA 3RY3A 4MLVA 2P1SA 1O64A 1YCJA 3RUMA 1B40A 1M5BA 2DXRA 3S2VA 1B3HA 1LBXA 4P56A 2PT1A 2B65A 1S50A 1IQ7A 4OVRA 5IZZA 5EQ8A 4LVQA 1ZIUA 2B4MA 3MPKA 5DTBA 1SYHA 1PC3A 2CMOA 3WAFA 4AB5A 5EHSA 4OFOA 2VD2A 4QSEA 5CMKA 4NF6B 4I3YA 2QMWA 4LQ5A 1NV0A 2QS4A 4PCDA 3T9HB 5I56B 3M3KA 3MVZA 3TQLA 5I58B 4MBPA 4HTGA 1XOCA 4GF8A 3USDA 4GWZA 2I4BA 4ND9A 4OMBA 1B2HA 1A55A 4G68C 2REJA 2I0CA 1NV4A 4N8YA 4N6DA 1N84A 4KHZE 1LFGA 1MQJA 4YKKA 4QFLA 4WEDA 4DDDA 5ESYA 2V4CA 4I8CA 4GD5A 3PD8A 1VDWA 1FTJA 4OQOA 2Y5KA 3TCFA 4X1BA 1B52A 1P1NA 3U8QA 1DTGA 5IGAA 2PBWA 1FJ6A 1LAXA 4PFWA 3T66A 2HZLA 5K2YA 1G0IA
chains in the Genus database with same CATH topology
1B3GA 3HHGA 3CFLA 2RF1A 1XHYA 3IX1A 1NH7A 4BDMA 4H6DA 3MWBA 3OMBA 4LONB 4EDPA 4QFOA 2O68A 1NFTA 3QAXA 3LC8A 4KQPA 1ZBMA 3K0VA 3TCGA 5KCJA 1NH8A 4JB7A 4EXLA 3OO6A 4NWCA 4Q5TA 1SW2A 3IB2A 1B3EA 4X1DA 2Y7IA 3H6TA 4YKJA 4OHNA 3L6GA 2F7CA 1MRPA 3TAJA 3S9LC 3GBAA 3FXRA 4X48A 4BDRA 5K2XA 2XXPA 2UVHA 2XX8A 4YAHX 1P1QA 2GRVA 3IO6A 3K6VA 1N3XA 1B3LA 3JYRA 1S9TA 4U22A 1VR5A 3O6HA 3VVFA 2D5WA 1URGA 3TTKA 4IO5A 5H8NA 1DMBA 3KG2A 3LSWA 5L9OA 3DP4A 1B4ZA 1FQBA 1MXWA 2Z8FA 3G7WA 3EPEA 4GVOA 4KCCA 3VLUA 3QSLA 1DOTA 3SESA 2RCAA 3D4GA 1H45A 3FIRA 1JW5A 1TWYA 3HPIA 4H8JA 4P0IA 1B4HA 1UTBB 5DVJA 2XHDA 1RKMA 4GLIA 4IO7A 4R2FA 2QS1A 4I62A 4R74A 4G77A 1UTHA 3E9XA 1TFAA 1A99A 1JETA 2ZNSA 3MP6A 2F97A 1B1XA 2F7BA 1MQIA 4JWYA 4IO4A 5ITOA 3VE1B 1EU8A 1MY3A 4BDQA 2HFBA 5CM6A 1FQEA 1MY0A 3IB1A 1Y20A 2P2AA 3N94A 4Z7EA 3CFXA 4ZE9A 3EQ1A 3CI8A 3PMXA 5CBSA 1S7YA 1B05A 3MVXA 1O63A 4LQ2A 1GV8A 4NTLA 5I59B 1EZOA 1NNPA 1MS7A 3DM0A 3OD7A 3FXUA 3MC2A 2ABHA 5CMMA 3THIA 3K6WA 3N6UA 5HM4B 2FNCA 2I49A 4BDNA 1CE2A 2F78A 1KWHA 3C36A 3LSLA 1MXXA 5I57A 3BFTA 1SW4A 1MH3A 3H03A 4M1VA 2XXXA 4N07A 4XTCQ 3RPWA 3VLWA 5EYFA 1I69A 1JQFA 3TELA 1Y4CA 3W15C 1NL5A 1PBPA 3O28A 5I2KB 3OEKA 1OIBA 1SI1A 2DE2A 2DOJA 1FQDA 4H8IA 1MY2A 3G3FA 2H98A 3C4MA 3L6HA 1R9LA 1ZKBA 4MLQA 4EF1A 3N6TA 1JVYA 4YB5A 3T93B 1MPCA 2QS2A 2AYSA 3V8XB 2G29A 3A09A 3C31A 4UACA 4POWA 1MXZA 2GH9A 3RTWB 2O1MA 2ZMBA 3GZGA 4R6HA 1PB9A 3FVGA 3G3GA 3K01A 3N5LA 4PQJA 4NEDA 1NNFA 3TTLA 3ZKKA 4YMAA 4NF8A 1Y1MA 1IZ1A 4OEVA 3RN8A 2XXHA 3CSGA 4GXAA 3TTNA 3U92A 3VFJA 3MPLA 5DEXA 3CRBA 2Z8DA 3QUJA 4ZECA 1N7WA 4LZ5A 4DLDA 3VDFA 4KPTA 5KDTB 3TTRA 4R72A 1MH4A 3GLBA 1B7HA 3LSXA 4RPNA 3TPAA 1D3KA 3PUVE 1LAHE 3B6WA 4OESA 3TKDA 2Q2CA 1NNKA 2Y84A 5I2NA 3FV2A 4NF4A 1Z7ME 3MVWA 4DZ1A 4AQ4A 1GGGA 1NNTA 1H3DA 1RYOA 2OBGA 4RPOA 5AA1A 3SEVA 4C1TA 2Y7RA 4E0XA 1I6BA 5FHNA 3QYTA 2ZYOA 4ZEBA 3TDJA 4GL8A 1SQYA 3EHSA 3VV5A 2PYYA 3BKIB 3ODBA 2XXRA 2WKYA 3OOAA 4U1ZA 2DP8A 3SEWA 2A5SA 3TODA 3TUSA 3T9XB 2PX1A 4ZS9A 5CBRA 1B32A 4XKPA 3QIMA 1O7TA 5DEXB 5K2YA 2V3UA 3TCHA 4OYVA 4RJZA 1PB7A 3CFZA 4F19A 2HXWA 3FASA 3HO7A 1D9YA 3PV0E 4Z0IA 3RNNA 3O6IA 4FEBA 3EHUA 3FVKA 1QKBA 3Q25A 4JWOA 1TFDA 5JTYB 1QUKA 4FE8A 3OO8A 1DPEA 1MPDA 4ZEKA 4GQOA 1BLFA 2PVUA 3FVNA 2F8DA 3IK6B 3KFMA 4YZZA 3HSTA 4P0GA 3WAEA 2A5TA 4Q30B 3R7XA 2I6EA 2F7AA 4HS7A 4JXIA 3MP8A 1Z7NE 3DP6A 3JV9A 3OSQA 3R6UA 4GFRA 4RXLA 3UN6A 2ONRA 1B51A 3FXQA 2Z23A 3DLNA 1PBQA 3PPNA 5M2VA 2Q8JA 3C34A 2O51A 4BDOA 4ZEFA 4DXUA 2I48A 3G3IA 3W9WA 2QJEA 2H25A 2HEUA 5H8SA 1XC1A 2BJJX 4NE4A 1NKXA 3K1PA 3M3LA 3Q27A 4XKRA 1MY4A 1OMPA 1F9BA 4NF4B 1SW1A 2P0SA 1YTVA 2Y7KA 5A5XA 3S9MC 4YICA 5DYHA 1YAEA 5CI5A 1LSTA 3FGSA 3DP8A 4DCYA 3IOUA 1OVBA 3QXMA 2CZLA 1JW4A 5J1DA 2V3QA 5AA2D 4QFKA 4LP2B 3KJ7A 3PUWE 1IXGA 2RCBA 5FTIA 1M5FA 4OENA 4QF9A 1SD3A 4F1YA 1AMFA 3A3CA 3GXAA 4QFNA 2DWHA 1B0LA 2ANJA 3B7DA 1CB6A 2X7QA 3IOWA 1XVYA 2RINA 3IL1B 1BTJA 3JZJA 4OETA 4IO3A 4XIGQ 4ECFA 3S9NC 1NMUA 1MQGA 2V84A 3A3UA 4TLMB 4C0RA 1ELJA 4H65A 2OLBA 3O9PA 4H67A 3PPQA 5H8HA 3MP1A 5H8HB 3VXCA 4FAJA 1HSEA 2GHAA 2XXWA 1ZMGA 2ZNUA 3KN8A 2F6PA 1N3WA 3QK6A 4LATA 3O6GA 3T9UA 3UK4A 4F3SA 3IO4A 2OWTA 4M4GA 3PUXE 1VFEA 2UVJA 4WXJA 5EHMA 5A5XB 3HN0A 4G8NA 3OEMA 2OJTA 3PPPA 5KCJB 4EF2A 4F3GA 1QUIA 4FORA 3MZ9A 3SERA 4YB7A 4MF3A 3N26A 1BP5A 1MY1A 3G3JA 5FTHA 1M5CA 1PDAA 1H76A 2XXYA 3HV1A 4AB6A 3K02A 4ISUA 3ECRA 4F2OA 2HQ0A 5KDTA 1SI0A 4FECA 1N7XA 3MJNA 1FTMA 1OQHA 1SBPA 4GXSB 1B46A 3KBRA 3OENA 4FATA 1WVJA 3AXFA 4K3FA 1P1WA 3OO9A 5HBCA 4U23A 4ZEIA 4F3PA 5LOMA 1Y1ZA 1POY1 4RK2A 3UGWA 1IXHA 4U21A 4U2RA 4OXVA 3MUQA 1UTBA 1BKAA 4PETA 4TLLB 2DWIA 3U94A 3KN7A 4G2ZA 3K1NA 5I2NB 3OELA 3KOSA 3PMVA 5ISUA 4JBZA 3QUFA 4OZ9A 3PPRA 2DVZA 4JWXA 4F18A 2VHAA 3E3KA 1MM6A 3I6VA 4THIA 2Z8EA 4QSCA 2A5TB 4F31B 1LBBA 1WODA 1UIUA 3F11A 4LA9A 2O6AA 3RLFE 3PU5A 1MXUA 3PD9A 1XT8A 4LZ8A 1GTKA 2VGQA 4IY5A 4NF5A 4QSDA 3T96B 4DXBA 5ITPA 1I6AA 4Q0CA 1PB8A 1XVXA 4R2BA 2NWJA 1QW0A 3U1OA 4MH5A 1H44A 1OLAA 1OQGA 4G8HA 3KOTA 1JVXA 5FHOA 4F1VA 3H7MA 3OXNA 2HCAA 4KR5A 3UORA 3IOTA 2ZNTA 4JDFA 4PFYA 5AA3A 1YPNA 2XXVA 2I3VA 2YLNA 1RYXA 3BBRA 3ILUB 4PFTA 3D4CA 3E4RA 3Q26A 4R9FA 5I2KA 3IOVA 1D4NA 1TXFA 1II5A 2ESNA 4X9TA 2XXQA 1B5HA 1LFIA 3IR1A 4OERA 4DXCA 4EQ9A 2R9JA 4F1UA 1ZU0A 1DTZA 1QVSA 5I58A 3CIJA 1JNFA 5HPQA 4EXKA 4OEUA 1FCKA 3U72A 2ALUA 3H4ZA 3PMWA 2RC8A 2NVUB 1A54A 2AL5A 3HHFA 3I5OA 4PP0A 3RT8A 4N13A 2D3IA 4RYAA 5I84A 4ELOA 4P11A 1HSJA 3EHTA 1US5A 5ELVA 5AE4A 1MG1A 2XD3A 2AIXA 5KZTA 1LCFA 3SDFA 1UIVA 1MDP1 1Y3NA 3V83A 1MDQA 1SDXA 1M5DA 5TPAB 4IO2A 4Q8RA 1QUJA 5B70A 2XD2A 3IORA 5CRYA 1FQFA 3IAZA 3H6VA 4FIMA 1M5EA 1EZPA 3LSFB 2Q88A 4F29A 3SETA 5H8NB 4E0WA 1N76A 3K6UA 5L8DA 5I59A 3FUZA 1SVXB 2QMXA 1P99A 4YKIA 3TYHA 2RKMA 1FQAA 3FJGA 2UVGA 1Y9UA 2B3FA 2I58A 3G3HA 4OFLA 4PE5B 3K1MA 3UP9A 3VVEA 5F1QA 5AA4B 3B6QA 1A40A 4IY6A 1US4A 1BIYA 3FJ7A 1Y4TA 3UIFA 4UA8A 1GR2A 2VP1A 1JW1A 4RNSA 4F3BA 5DVFA 1SW5A 1USYE 1IEJA 3C32A 3K6XA 2DQVA 2XXUA 2DWJA 3CR9A 1QKAA 2O69A 3G3KA 3RQTA 1LBCA 2ZYNA 3LUYA 2O84X 5L9MA 2I0BA 5AA2B 4GRKA 5L9SA 1B1HA 3UA8A 3R26A 1A7LA 2ONKE 1A8FA 2XX7A 3KSXA 4H5GA 4IGRA 2F6GA 4LZ7A 3M8UA 2FA7A 1Y3PA 2O7UA 3FZVA 3ZS6A 1B7UA 1LAFE 4KYDA 2LAOA 1Q35A 2Y7PA 3LBSA 3P7IA 3PPOA 2Q2AA 2F34A 1UTHB 2ZYMA 2DE4A 3KGCA 2E0SA 4GL0A 1PEBA 3RGYA 3HCQA 3MQ9A 4U4SA 2O1LA 1B5JA 2AL4A 4O3AA 2REGA 2RC7A 3MAMA 4F39A 1LGBC 2DVCA 4QHQA 2Y7WA 3VLVA 4BLAA 2H99A 1VE4A 1T0KA 2OK2A 2IA4A 3O2AA 2HZKA 4L17A 4OVJA 2DWAA 3C9HA 2G93A 3GBBA 4FEDA 1DPPA 1B7ZA 2DE3A 1P1UA 3H6UA 3KEIA 5TP9B 3TTMA 1ATGA 5DVIA 2X26A 3H3GA 3C33A 4KYEA 5I57B 3FATA 4I9DA 4DE8A 2UYFA 2UYEA 2ZYKA 4IB2A 1B0HA 4IO6A 3FJMA 1L5TA 4EQ7A 2Q89A 4R73A 2V25A 4JSOA 2H5YA 2F36A 3LR1A 2B3BA 2RC9A 3O97A 2F5XA 4RY1A 3S9EA 2E1SA 3FVOA 4BDLA 3MBPA 3MZ1A 4H5FA 4WKMA 1GVCA 5CMBA 3RT6B 3CVGA 4F2QA 1N04A 2NOOA 3B6TA 4LUBA 3U93A 4ELRA 4ESXA 2THIA 2UVIA 5BWJA 1ZTYA 4KI0E 2H9BA 1LAGE 1Y3QA 2NUVA 1QULA 2O7IA 5IKBA 4ZZAA 4QRZA 2R71A 5AA4A 1USYH 3H06B 4NF8B 4OWDA 4QFPA 4ZE8A 5F7VA 3V89B 4H1XA 4XKQA 1P1OA 4N6PA 5I56A 5JTYA 3K00A 3KSJA 2F35A 2I4CA 3K4UA 4KD5A 1MQHA 4RK9A 3PUYE 4HCYA 1R1NA 3KN3A 3Q29A 4TQUQ 1POTA 2OZZA 5FHMA 3SEXA 1B3FA 1Q1KA 3OSRA 3T22A 4DCXA 2VD3A 2DSFA 1SYIA 2OWSA 2ZXTA 4GWOA 2FYIA 1IXCA 2Z22A 2PMSA 2QPQA 3MVYA 2QL3A 4ONYA 3RY3A 4TOZA 3S4UA 5CMCA 3SKPA 1D9VA 3T9VA 4MLVA 2P1SA 3ZSFA 4EQBA 3ZKLA 1LCTA 5AA2A 1O64A 1YCJA 3RUMA 1B40A 4I1DA 3TEPA 2R6GE 1M5BA 2GHBA 2QS3A 4G68B 4ELQA 2DXRA 2QRYA 2H4IA 5IAIA 3S2VA 3V5AA 5JK4A 4ESWA 1J1NA 1IUDA 4R6KA 1IITA 1B3HA 3KZGA 4FJPA 2GFEA 3IB0A 1AIVA 1MQDA 2DYXA 3BFUA 2PT1A 4JSDA 2B65A 4NF6A 1S50A 1IQ7A 5DT6A 2OCUA 4IGTA 1MXYA 4OFJA 1FQCA 2Q9TA 4LVQA 4ELPA 2PT2A 3K2DA 4U4XA 3SEUA 3PGFA 1MXVA 1R9QA 1ZIUA 3OO7A 4R9GA 1R6ZA 1EH3A 1VFDA 2HAUA 1SYHA 1PC3A 3MPKA 4GIZA 4MFIA 5DTBA 5TPAA 2CMOA 3M3FA 4NWDA 3FV1A 4RA1A 3WAFA 3O29A 4R75A 4HW8A 4AB5A 1OVTA 5EHSA 4F22A 5ICQA 4OFOA 2VD2A 4QSEA 2HAVA 5CMKA 4POXA 3EN3A 2KLFA 4GOTA 4YKPA 5H8FA 3EF7A 1ANFA 4NF6B 4R6YA 4U1OA 2QMWA 4LQ5A 3TZAA 2W7YA 3ONMA 2QS4A 4C1UA 1ZJLA 2I3WA 3T9HB 1LFHA 3VXBA 1AH5A 1IXIA 5I56B 3M3KA 3MVZA 1FTLA 3IJOB 3TQLA 5I58B 3DELB 4MBPA 4HTGA 4YU0A 2V93A 3FD3A 4G68A 2IEEA 2VOZA 2YPNA 1FTOA 4PFUA 1B9JA 3CSBA 3RTFB 5ICTA 4XKNA 2XX9A 1XOCA 2UXAA 2YJPA 4GF8A 1WDNA 3USDA 3PUZE 5CC2A 5B7DA 2I4BA 4ND9A 4OMBA 5TP9A 1AL3A 1A55A 1B2HA 2REJA 2I0CA 3IJXB 4G68C 3SEYA 1JEUA 2M8CA 1N84A 4EUOA 4ZEDA 4DIGA 1HSLA 1B6HA 4KHZE 2D21A 1LFGA 1MQJA 3O66A 2QSXA 1QJMA 1LB8A 1VSOA 3MZBA 4QFLA 4WEDA 1H43A 4YKKA 3H6WA 4DDDA 5BUUA 1MPBA 1TT1A 4I8CA 1OLCA 4G4PA 1UQWA 4GD5A 1AOVA 3PD8A 4YB6A 4WEPA 1A8EA 3CG3A 2ONSA 4NF5B 1ZLQA 2V3TA 4KFQA 3VVDA 1FTJA 4OQOA 5H8QA 3TCFA 4X1BA 4ZDMA 3W9VA 1B5IA 1JEVA 3C35A 3KJTA 1N0TA 4H0WA 1EZ9A 5H8FB 4O3BA 3TMGA 1B52A 2DXYA 1I6QA 4NMYA 1URDA 4G8MA 3ILTB 4HCWA 1IIWA 5JEIA 1FTKA 1XS5A 1FW0A 3MW0A 5H8QB 1P1NA 3U8QA 4XXUA 4OTEA 1URSA 2XXTA 4O3CA 3E13X 3I3VA 4KCDA 4YMBA 4ZZEA 2XXIA 3CG1A 2X7PA 1LB9A 5TU0A 3TFLA 1DTGA 2DS9A 1DSNA 2NXOA 1MM7A 4KYSA 2PBWA 1LAXA 4PFWA 3T66A 1LLSA 3TQWA 2HZLA 1B58A 3Q28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3G A;  3HHG A;  3CFL A;  2RF1 A;  1XHY A;  3IX1 A;  1NH7 A;  4BDM A;  4H6D A;  3MWB A;  3OMB A;  4LON B;  4EDP A;  4QFO A;  2O68 A;  1NFT A;  3QAX A;  3LC8 A;  4KQP A;  1ZBM A;  3K0V A;  3TCG A;  5KCJ A;  1NH8 A;  4JB7 A;  4EXL A;  3OO6 A;  4NWC A;  4Q5T A;  1SW2 A;  3IB2 A;  1B3E A;  4X1D A;  2Y7I A;  3H6T A;  4YKJ A;  4OHN A;  3L6G A;  2F7C A;  1MRP A;  3TAJ A;  3S9L C;  3GBA A;  3FXR A;  4X48 A;  4BDR A;  5K2X A;  2XXP A;  2UVH A;  2XX8 A;  4YAH X;  1P1Q A;  2GRV A;  3IO6 A;  3K6V A;  1N3X A;  1B3L A;  3JYR A;  1S9T A;  4U22 A;  1VR5 A;  3O6H A;  3VVF A;  2D5W A;  1URG A;  3TTK A;  4IO5 A;  5H8N A;  1DMB A;  3KG2 A;  3LSW A;  5L9O A;  3DP4 A;  1B4Z A;  1FQB A;  1MXW A;  2Z8F A;  3G7W A;  3EPE A;  4GVO A;  4KCC A;  3VLU A;  3QSL A;  1DOT A;  3SES A;  2RCA A;  3D4G A;  1H45 A;  3FIR A;  1JW5 A;  1TWY A;  3HPI A;  4H8J A;  4P0I A;  1B4H A;  1UTB B;  5DVJ A;  2XHD A;  1RKM A;  4GLI A;  4IO7 A;  4R2F A;  2QS1 A;  4I62 A;  4R74 A;  4G77 A;  1UTH A;  3E9X A;  1TFA A;  1A99 A;  1JET A;  2ZNS A;  3MP6 A;  2F97 A;  1B1X A;  2F7B A;  1MQI A;  4JWY A;  4IO4 A;  5ITO A;  3VE1 B;  1EU8 A;  1MY3 A;  4BDQ A;  2HFB A;  5CM6 A;  1FQE A;  1MY0 A;  3IB1 A;  1Y20 A;  2P2A A;  3N94 A;  4Z7E A;  3CFX A;  4ZE9 A;  3EQ1 A;  3CI8 A;  3PMX A;  5CBS A;  1S7Y A;  1B05 A;  3MVX A;  1O63 A;  4LQ2 A;  1GV8 A;  4NTL A;  5I59 B;  1EZO A;  1NNP A;  1MS7 A;  3DM0 A;  3OD7 A;  3FXU A;  3MC2 A;  2ABH A;  5CMM A;  3THI A;  3K6W A;  3N6U A;  5HM4 B;  2FNC A;  2I49 A;  4BDN A;  1CE2 A;  2F78 A;  1KWH A;  3C36 A;  3LSL A;  1MXX A;  5I57 A;  3BFT A;  1SW4 A;  1MH3 A;  3H03 A;  4M1V A;  2XXX A;  4N07 A;  4XTC Q;  3RPW A;  3VLW A;  5EYF A;  1I69 A;  1JQF A;  3TEL A;  1Y4C A;  3W15 C;  1NL5 A;  1PBP A;  3O28 A;  5I2K B;  3OEK A;  1OIB A;  1SI1 A;  2DE2 A;  2DOJ A;  1FQD A;  4H8I A;  1MY2 A;  3G3F A;  2H98 A;  3C4M A;  3L6H A;  1R9L A;  1ZKB A;  4MLQ A;  4EF1 A;  3N6T A;  1JVY A;  4YB5 A;  3T93 B;  1MPC A;  2QS2 A;  2AYS A;  3V8X B;  2G29 A;  3A09 A;  3C31 A;  4UAC A;  4POW A;  1MXZ A;  2GH9 A;  3RTW B;  2O1M A;  2ZMB A;  3GZG A;  4R6H A;  1PB9 A;  3FVG A;  3G3G A;  3K01 A;  3N5L A;  4PQJ A;  4NED A;  1NNF A;  3TTL A;  3ZKK A;  4YMA A;  4NF8 A;  1Y1M A;  1IZ1 A;  4OEV A;  3RN8 A;  2XXH A;  3CSG A;  4GXA A;  3TTN A;  3U92 A;  3VFJ A;  3MPL A;  5DEX A;  3CRB A;  2Z8D A;  3QUJ A;  4ZEC A;  1N7W A;  4LZ5 A;  4DLD A;  3VDF A;  4KPT A;  5KDT B;  3TTR A;  4R72 A;  1MH4 A;  3GLB A;  1B7H A;  3LSX A;  4RPN A;  3TPA A;  1D3K A;  3PUV E;  1LAH E;  3B6W A;  4OES A;  3TKD A;  2Q2C A;  1NNK A;  2Y84 A;  5I2N A;  3FV2 A;  4NF4 A;  1Z7M E;  3MVW A;  4DZ1 A;  4AQ4 A;  1GGG A;  1NNT A;  1H3D A;  1RYO A;  2OBG A;  4RPO A;  5AA1 A;  3SEV A;  4C1T A;  2Y7R A;  4E0X A;  1I6B A;  5FHN A;  3QYT A;  2ZYO A;  4ZEB A;  3TDJ A;  4GL8 A;  1SQY A;  3EHS A;  3VV5 A;  2PYY A;  3BKI B;  3ODB A;  2XXR A;  2WKY A;  3OOA A;  4U1Z A;  2DP8 A;  3SEW A;  2A5S A;  3TOD A;  3TUS A;  3T9X B;  2PX1 A;  4ZS9 A;  5CBR A;  1B32 A;  4XKP A;  3QIM A;  1O7T A;  5DEX B;  5K2Y A;  2V3U A;  3TCH A;  4OYV A;  4RJZ A;  1PB7 A;  3CFZ A;  4F19 A;  2HXW A;  3FAS A;  3HO7 A;  1D9Y A;  3PV0 E;  4Z0I A;  3RNN A;  3O6I A;  4FEB A;  3EHU A;  3FVK A;  1QKB A;  3Q25 A;  4JWO A;  1TFD A;  5JTY B;  1QUK A;  4FE8 A;  3OO8 A;  1DPE A;  1MPD A;  4ZEK A;  4GQO A;  1BLF A;  2PVU A;  3FVN A;  2F8D A;  3IK6 B;  3KFM A;  4YZZ A;  3HST A;  4P0G A;  3WAE A;  2A5T A;  4Q30 B;  3R7X A;  2I6E A;  2F7A A;  4HS7 A;  4JXI A;  3MP8 A;  1Z7N E;  3DP6 A;  3JV9 A;  3OSQ A;  3R6U A;  4GFR A;  4RXL A;  3UN6 A;  2ONR A;  1B51 A;  3FXQ A;  2Z23 A;  3DLN A;  1PBQ A;  3PPN A;  5M2V A;  2Q8J A;  3C34 A;  2O51 A;  4BDO A;  4ZEF A;  4DXU A;  2I48 A;  3G3I A;  3W9W A;  2QJE A;  2H25 A;  2HEU A;  5H8S A;  1XC1 A;  2BJJ X;  4NE4 A;  1NKX A;  3K1P A;  3M3L A;  3Q27 A;  4XKR A;  1MY4 A;  1OMP A;  1F9B A;  4NF4 B;  1SW1 A;  2P0S A;  1YTV A;  2Y7K A;  5A5X A;  3S9M C;  4YIC A;  5DYH A;  1YAE A;  5CI5 A;  1LST A;  3FGS A;  3DP8 A;  4DCY A;  3IOU A;  1OVB A;  3QXM A;  2CZL A;  1JW4 A;  5J1D A;  2V3Q A;  5AA2 D;  4QFK A;  4LP2 B;  3KJ7 A;  3PUW E;  1IXG A;  2RCB A;  5FTI A;  1M5F A;  4OEN A;  4QF9 A;  1SD3 A;  4F1Y A;  1AMF A;  3A3C A;  3GXA A;  4QFN A;  2DWH A;  1B0L A;  2ANJ A;  3B7D A;  1CB6 A;  2X7Q A;  3IOW A;  1XVY A;  2RIN A;  3IL1 B;  1BTJ A;  3JZJ A;  4OET A;  4IO3 A;  4XIG Q;  4ECF A;  3S9N C;  1NMU A;  1MQG A;  2V84 A;  3A3U A;  4TLM B;  4C0R A;  1ELJ A;  4H65 A;  2OLB A;  3O9P A;  4H67 A;  3PPQ A;  5H8H A;  3MP1 A;  5H8H B;  3VXC A;  4FAJ A;  1HSE A;  2GHA A;  2XXW A;  1ZMG A;  2ZNU A;  3KN8 A;  2F6P A;  1N3W A;  3QK6 A;  4LAT A;  3O6G A;  3T9U A;  3UK4 A;  4F3S A;  3IO4 A;  2OWT A;  4M4G A;  3PUX E;  1VFE A;  2UVJ A;  4WXJ A;  5EHM A;  5A5X B;  3HN0 A;  4G8N A;  3OEM A;  2OJT A;  3PPP A;  5KCJ B;  4EF2 A;  4F3G A;  1QUI A;  4FOR A;  3MZ9 A;  3SER A;  4YB7 A;  4MF3 A;  3N26 A;  1BP5 A;  1MY1 A;  3G3J A;  5FTH A;  1M5C A;  1PDA A;  1H76 A;  2XXY A;  3HV1 A;  4AB6 A;  3K02 A;  4ISU A;  3ECR A;  4F2O A;  2HQ0 A;  5KDT A;  1SI0 A;  4FEC A;  1N7X A;  3MJN A;  1FTM A;  1OQH A;  1SBP A;  4GXS B;  1B46 A;  3KBR A;  3OEN A;  4FAT A;  1WVJ A;  3AXF A;  4K3F A;  1P1W A;  3OO9 A;  5HBC A;  4U23 A;  4ZEI A;  4F3P A;  5LOM A;  1Y1Z A;  1POY 1;  4RK2 A;  3UGW A;  1IXH A;  4U21 A;  4U2R A;  4OXV A;  3MUQ A;  1UTB A;  1BKA A;  4PET A;  4TLL B;  2DWI A;  3U94 A;  3KN7 A;  4G2Z A;  3K1N A;  5I2N B;  3OEL A;  3KOS A;  3PMV A;  5ISU A;  4JBZ A;  3QUF A;  4OZ9 A;  3PPR A;  2DVZ A;  4JWX A;  4F18 A;  2VHA A;  3E3K A;  1MM6 A;  3I6V A;  4THI A;  2Z8E A;  4QSC A;  2A5T B;  4F31 B;  1LBB A;  1WOD A;  1UIU A;  3F11 A;  4LA9 A;  2O6A A;  3RLF E;  3PU5 A;  1MXU A;  3PD9 A;  1XT8 A;  4LZ8 A;  1GTK A;  2VGQ A;  4IY5 A;  4NF5 A;  4QSD A;  3T96 B;  4DXB A;  5ITP A;  1I6A A;  4Q0C A;  1PB8 A;  1XVX A;  4R2B A;  2NWJ A;  1QW0 A;  3U1O A;  4MH5 A;  1H44 A;  1OLA A;  1OQG A;  4G8H A;  3KOT A;  1JVX A;  5FHO A;  4F1V A;  3H7M A;  3OXN A;  2HCA A;  4KR5 A;  3UOR A;  3IOT A;  2ZNT A;  4JDF A;  4PFY A;  5AA3 A;  1YPN A;  2XXV A;  2I3V A;  2YLN A;  1RYX A;  3BBR A;  3ILU B;  4PFT A;  3D4C A;  3E4R A;  3Q26 A;  4R9F A;  5I2K A;  3IOV A;  1D4N A;  1TXF A;  1II5 A;  2ESN A;  4X9T A;  2XXQ A;  1B5H A;  1LFI A;  3IR1 A;  4OER A;  4DXC A;  4EQ9 A;  2R9J A;  4F1U A;  1ZU0 A;  1DTZ A;  1QVS A;  5I58 A;  3CIJ A;  1JNF A;  5HPQ A;  4EXK A;  4OEU A;  1FCK A;  3U72 A;  2ALU A;  3H4Z A;  3PMW A;  2RC8 A;  2NVU B;  1A54 A;  2AL5 A;  3HHF A;  3I5O A;  4PP0 A;  3RT8 A;  4N13 A;  2D3I A;  4RYA A;  5I84 A;  4ELO A;  4P11 A;  1HSJ A;  3EHT A;  1US5 A;  5ELV A;  5AE4 A;  1MG1 A;  2XD3 A;  2AIX A;  5KZT A;  1LCF A;  3SDF A;  1UIV A;  1MDP 1;  1Y3N A;  3V83 A;  1MDQ A;  1SDX A;  1M5D A;  5TPA B;  4IO2 A;  4Q8R A;  1QUJ A;  5B70 A;  2XD2 A;  3IOR A;  5CRY A;  1FQF A;  3IAZ A;  3H6V A;  4FIM A;  1M5E A;  1EZP A;  3LSF B;  2Q88 A;  4F29 A;  3SET A;  5H8N B;  4E0W A;  1N76 A;  3K6U A;  5L8D A;  5I59 A;  3FUZ A;  1SVX B;  2QMX A;  1P99 A;  4YKI A;  3TYH A;  2RKM A;  1FQA A;  3FJG A;  2UVG A;  1Y9U A;  2B3F A;  2I58 A;  3G3H A;  4OFL A;  4PE5 B;  3K1M A;  3UP9 A;  3VVE A;  5F1Q A;  5AA4 B;  3B6Q A;  1A40 A;  4IY6 A;  1US4 A;  1BIY A;  3FJ7 A;  1Y4T A;  3UIF A;  4UA8 A;  1GR2 A;  2VP1 A;  1JW1 A;  4RNS A;  4F3B A;  5DVF A;  1SW5 A;  1USY E;  1IEJ A;  3C32 A;  3K6X A;  2DQV A;  2XXU A;  2DWJ A;  3CR9 A;  1QKA A;  2O69 A;  3G3K A;  3RQT A;  1LBC A;  2ZYN A;  3LUY A;  2O84 X;  5L9M A;  2I0B A;  5AA2 B;  4GRK A;  5L9S A;  1B1H A;  3UA8 A;  3R26 A;  1A7L A;  2ONK E;  1A8F A;  2XX7 A;  3KSX A;  4H5G A;  4IGR A;  2F6G A;  4LZ7 A;  3M8U A;  2FA7 A;  1Y3P A;  2O7U A;  3FZV A;  3ZS6 A;  1B7U A;  1LAF E;  4KYD A;  2LAO A;  1Q35 A;  2Y7P A;  3LBS A;  3P7I A;  3PPO A;  2Q2A A;  2F34 A;  1UTH B;  2ZYM A;  2DE4 A;  3KGC A;  2E0S A;  4GL0 A;  1PEB A;  3RGY A;  3HCQ A;  3MQ9 A;  4U4S A;  2O1L A;  1B5J A;  2AL4 A;  4O3A A;  2REG A;  2RC7 A;  3MAM A;  4F39 A;  1LGB C;  2DVC A;  4QHQ A;  2Y7W A;  3VLV A;  4BLA A;  2H99 A;  1VE4 A;  1T0K A;  2OK2 A;  2IA4 A;  3O2A A;  2HZK A;  4L17 A;  4OVJ A;  2DWA A;  3C9H A;  2G93 A;  3GBB A;  4FED A;  1DPP A;  1B7Z A;  2DE3 A;  1P1U A;  3H6U A;  3KEI A;  5TP9 B;  3TTM A;  1ATG A;  5DVI A;  2X26 A;  3H3G A;  3C33 A;  4KYE A;  5I57 B;  3FAT A;  4I9D A;  4DE8 A;  2UYF A;  2UYE A;  2ZYK A;  4IB2 A;  1B0H A;  4IO6 A;  3FJM A;  1L5T A;  4EQ7 A;  2Q89 A;  4R73 A;  2V25 A;  4JSO A;  2H5Y A;  2F36 A;  3LR1 A;  2B3B A;  2RC9 A;  3O97 A;  2F5X A;  4RY1 A;  3S9E A;  2E1S A;  3FVO A;  4BDL A;  3MBP A;  3MZ1 A;  4H5F A;  4WKM A;  1GVC A;  5CMB A;  3RT6 B;  3CVG A;  4F2Q A;  1N04 A;  2NOO A;  3B6T A;  4LUB A;  3U93 A;  4ELR A;  4ESX A;  2THI A;  2UVI A;  5BWJ A;  1ZTY A;  4KI0 E;  2H9B A;  1LAG E;  1Y3Q A;  2NUV A;  1QUL A;  2O7I A;  5IKB A;  4ZZA A;  4QRZ A;  2R71 A;  5AA4 A;  1USY H;  3H06 B;  4NF8 B;  4OWD A;  4QFP A;  4ZE8 A;  5F7V A;  3V89 B;  4H1X A;  4XKQ A;  1P1O A;  4N6P A;  5I56 A;  5JTY A;  3K00 A;  3KSJ A;  2F35 A;  2I4C A;  3K4U A;  4KD5 A;  1MQH A;  4RK9 A;  3PUY E;  4HCY A;  1R1N A;  3KN3 A;  3Q29 A;  4TQU Q;  1POT A;  2OZZ A;  5FHM A;  3SEX A;  1B3F A;  1Q1K A;  3OSR A;  3T22 A;  4DCX A;  2VD3 A;  2DSF A;  1SYI A;  2OWS A;  2ZXT A;  4GWO A;  2FYI A;  1IXC A;  2Z22 A;  2PMS A;  2QPQ A;  3MVY A;  2QL3 A;  4ONY A;  3RY3 A;  4TOZ A;  3S4U A;  5CMC A;  3SKP A;  1D9V A;  3T9V A;  4MLV A;  2P1S A;  3ZSF A;  4EQB A;  3ZKL A;  1LCT A;  5AA2 A;  1O64 A;  1YCJ A;  3RUM A;  1B40 A;  4I1D A;  3TEP A;  2R6G E;  1M5B A;  2GHB A;  2QS3 A;  4G68 B;  4ELQ A;  2DXR A;  2QRY A;  2H4I A;  5IAI A;  3S2V A;  3V5A A;  5JK4 A;  4ESW A;  1J1N A;  1IUD A;  4R6K A;  1IIT A;  1B3H A;  3KZG A;  4FJP A;  2GFE A;  3IB0 A;  1AIV A;  1MQD A;  2DYX A;  3BFU A;  2PT1 A;  4JSD A;  2B65 A;  4NF6 A;  1S50 A;  1IQ7 A;  5DT6 A;  2OCU A;  4IGT A;  1MXY A;  4OFJ A;  1FQC A;  2Q9T A;  4LVQ A;  4ELP A;  2PT2 A;  3K2D A;  4U4X A;  3SEU A;  3PGF A;  1MXV A;  1R9Q A;  1ZIU A;  3OO7 A;  4R9G A;  1R6Z A;  1EH3 A;  1VFD A;  2HAU A;  1SYH A;  1PC3 A;  3MPK A;  4GIZ A;  4MFI A;  5DTB A;  5TPA A;  2CMO A;  3M3F A;  4NWD A;  3FV1 A;  4RA1 A;  3WAF A;  3O29 A;  4R75 A;  4HW8 A;  4AB5 A;  1OVT A;  5EHS A;  4F22 A;  5ICQ A;  4OFO A;  2VD2 A;  4QSE A;  2HAV A;  5CMK A;  4POX A;  3EN3 A;  2KLF A;  4GOT A;  4YKP A;  5H8F A;  3EF7 A;  1ANF A;  4NF6 B;  4R6Y A;  4U1O A;  2QMW A;  4LQ5 A;  3TZA A;  2W7Y A;  3ONM A;  2QS4 A;  4C1U A;  1ZJL A;  2I3W A;  3T9H B;  1LFH A;  3VXB A;  1AH5 A;  1IXI A;  5I56 B;  3M3K A;  3MVZ A;  1FTL A;  3IJO B;  3TQL A;  5I58 B;  3DEL B;  4MBP A;  4HTG A;  4YU0 A;  2V93 A;  3FD3 A;  4G68 A;  2IEE A;  2VOZ A;  2YPN A;  1FTO A;  4PFU A;  1B9J A;  3CSB A;  3RTF B;  5ICT A;  4XKN A;  2XX9 A;  1XOC A;  2UXA A;  2YJP A;  4GF8 A;  1WDN A;  3USD A;  3PUZ E;  5CC2 A;  5B7D A;  2I4B A;  4ND9 A;  4OMB A;  5TP9 A;  1AL3 A;  1A55 A;  1B2H A;  2REJ A;  2I0C A;  3IJX B;  4G68 C;  3SEY A;  1JEU A;  2M8C A;  1N84 A;  4EUO A;  4ZED A;  4DIG A;  1HSL A;  1B6H A;  4KHZ E;  2D21 A;  1LFG A;  1MQJ A;  3O66 A;  2QSX A;  1QJM A;  1LB8 A;  1VSO A;  3MZB A;  4QFL A;  4WED A;  1H43 A;  4YKK A;  3H6W A;  4DDD A;  5BUU A;  1MPB A;  1TT1 A;  4I8C A;  1OLC A;  4G4P A;  1UQW A;  4GD5 A;  1AOV A;  3PD8 A;  4YB6 A;  4WEP A;  1A8E A;  3CG3 A;  2ONS A;  4NF5 B;  1ZLQ A;  2V3T A;  4KFQ A;  3VVD A;  1FTJ A;  4OQO A;  5H8Q A;  3TCF A;  4X1B A;  4ZDM A;  3W9V A;  1B5I A;  1JEV A;  3C35 A;  3KJT A;  1N0T A;  4H0W A;  1EZ9 A;  5H8F B;  4O3B A;  3TMG A;  1B52 A;  2DXY A;  1I6Q A;  4NMY A;  1URD A;  4G8M A;  3ILT B;  4HCW A;  1IIW A;  5JEI A;  1FTK A;  1XS5 A;  1FW0 A;  3MW0 A;  5H8Q B;  1P1N A;  3U8Q A;  4XXU A;  4OTE A;  1URS A;  2XXT A;  4O3C A;  3E13 X;  3I3V A;  4KCD A;  4YMB A;  4ZZE A;  2XXI A;  3CG1 A;  2X7P A;  1LB9 A;  5TU0 A;  3TFL A;  1DTG A;  2DS9 A;  1DSN A;  2NXO A;  1MM7 A;  4KYS A;  2PBW A;  1LAX A;  4PFW A;  3T66 A;  1LLS A;  3TQW A;  2HZL A;  1B58 A;  3Q28 A; 
#chains in the Genus database with same CATH topology
 3HHG A;  3CFL A;  2RF1 A;  2O68 A;  1ZBM A;  3K0V A;  3MYU A;  1NH8 A;  5ET8 A;  3OO6 A;  4X1D A;  2PFZ A;  1B3E A;  1INP A;  4PBQ A;  4X48 A;  1P1Q A;  3K6V A;  4U22 A;  3VVF A;  1DMB A;  3KG2 A;  1FQB A;  3G7W A;  1DOT A;  3D4G A;  1JW5 A;  4P0I A;  1UTB B;  1RKM A;  4R2F A;  4OVQ A;  3MP6 A;  2F97 A;  1B1X A;  5ITO A;  4Z7E A;  3CFX A;  3EQ1 A;  3MVX A;  1B05 A;  1GV8 A;  3DM0 A;  3OD7 A;  5HM4 B;  2ABH A;  3THI A;  1CE2 A;  2F78 A;  4N07 A;  2FIX A;  3RPW A;  5EYF A;  1I69 A;  1JQF A;  3TEL A;  1PBP A;  3O28 A;  4PC9 A;  2DE2 A;  4H8I A;  4MLQ A;  3C4M A;  1ZKB A;  4YB5 A;  3T93 B;  4OVS A;  1MPC A;  3V8X B;  3A09 A;  3RTW B;  3K01 A;  4NF8 A;  1IZ1 A;  1FJ9 A;  5DEX A;  4DLD A;  3VDF A;  3PUV E;  3TKD A;  3B6W A;  5I2N A;  1Z7M E;  4C1T A;  1GGG A;  1RYO A;  1H3D A;  4ZEB A;  3EHS A;  3ODB A;  3TUS A;  2XXR A;  3TOD A;  3T9X B;  2KR0 A;  3FAS A;  3HO7 A;  3PV0 E;  3O6I A;  4FEB A;  1QKB A;  1DPE A;  3IK6 B;  3KFM A;  4Q30 B;  4HS7 A;  3OSQ A;  3FXQ A;  5M2V A;  1FPE A;  4ZEF A;  2I48 A;  2P3N A;  3K1P A;  2Y7K A;  1YAE A;  5CI5 A;  3FGS A;  3IOU A;  2FVZ A;  4MNC A;  1SD3 A;  4N8G A;  3B7D A;  1G0H A;  4ECF A;  1EYK A;  3MP1 A;  5H8H B;  2ZNU A;  2GHA A;  3UK4 A;  2F6P A;  3T9U A;  4HXV A;  2OWT A;  3PUX E;  1KZ8 A;  4NG7 A;  4YB7 A;  3IFA A;  1H76 A;  2XXY A;  4AB6 A;  4ISU A;  4HE2 A;  4FEC A;  3MJN A;  4NQ8 A;  3KBR A;  4FAT A;  1WVJ A;  3AXF A;  4U23 A;  3T1B A;  4U2R A;  1UTB A;  4G2Z A;  3PMV A;  3QUF A;  4OZ9 A;  1LBW A;  4THI A;  2A5T B;  3PU5 A;  5I5P A;  1MXU A;  1XT8 A;  1GTK A;  5JTY A;  1I6A A;  1OLA A;  1OQG A;  3KOT A;  4F1V A;  3H7M A;  4KR5 A;  4QXD A;  3FBP A;  4JDF A;  3BIH A;  5AA3 A;  3ILU B;  2ESN A;  2R9J A;  2JJK A;  3CIJ A;  4PF8 A;  4EXK A;  3H4Z A;  2RC8 A;  3HHF A;  4ELO A;  1HSJ A;  5AE4 A;  5ELV A;  1MG1 A;  1UIV A;  1MDP 1;  1SDX A;  1M5D A;  3IOR A;  3H6V A;  1EZP A;  3LSF B;  4E0W A;  5I59 A;  3FUZ A;  1SVX B;  4PDD A;  2UVG A;  2B3F A;  3G3H A;  3VVE A;  3UP9 A;  5F1Q A;  4MHF A;  5DVF A;  1SW5 A;  1IEJ A;  2XXU A;  2DWJ A;  2O69 A;  3RQT A;  2O84 X;  1FPJ A;  2I0B A;  2WBB A;  1FSA A;  2XX7 A;  3U65 A;  2O7U A;  3FZV A;  1LAF E;  1Q35 A;  3LBS A;  3PPO A;  2NVU B;  3TAJ A;  2F34 A;  4F39 A;  1VE4 A;  2OK2 A;  2IA4 A;  3O2A A;  2HZK A;  4L17 A;  2DWA A;  3GBB A;  4FED A;  3KEI A;  1P1U A;  3H3G A;  3C33 A;  2UYF A;  1B0H A;  4MX6 A;  4JSO A;  2F36 A;  3LR1 A;  2B3B A;  3O97 A;  2F5X A;  4WKM A;  5CMB A;  3U93 A;  4LUB A;  1ZTY A;  2NUV A;  2R71 A;  5AA4 A;  1USY H;  1P1O A;  4N6P A;  3K00 A;  3KSJ A;  3K4U A;  4KD5 A;  4TQU Q;  1R1N A;  1FPK A;  4DCX A;  4N91 A;  2ZXT A;  1NV3 A;  2FYI A;  1IXC A;  2Z22 A;  4ONY A;  4BDO A;  3W9W A;  2QL3 A;  1D9V A;  4EQB A;  3ZKL A;  3TEP A;  1FBC A;  4NGU A;  2R6G E;  5IAI A;  4NX1 A;  1YYZ A;  1IIT A;  3KZG A;  1MQD A;  3BFU A;  2Q9T A;  1MXV A;  1R9Q A;  4XF5 A;  1VFD A;  4IR8 A;  4NWD A;  5EQ7 A;  4HW8 A;  1B58 A;  3EF7 A;  1NUX A;  1IXI A;  2QVU A;  4G68 A;  3PUZ E;  5CC2 A;  5TP9 A;  3SEY A;  1HSL A;  2QSX A;  1VSO A;  1LB8 A;  2V3T A;  1JEV A;  2WYK A;  1NV1 A;  1NI9 A;  1I6Q A;  1URD A;  4G8M A;  3ILT B;  5JEI A;  5H8Q B;  4OTE A;  1URS A;  3E13 X;  3I3V A;  4YMB A;  4ZZE A;  5TU0 A;  2F3D A;  1FBP A;  2NXO A;  4KYS A;  2Q74 A;  3MST A;  3MWB A;  4EDP A;  4QFO A;  3QAX A;  3LC8 A;  3H6T A;  4HE0 A;  4YKJ A;  4AS5 A;  3GBA A;  2UVH A;  2XX8 A;  1B3L A;  1S9T A;  1VR5 A;  3TTK A;  1URG A;  5H8N A;  3DP4 A;  1B4Z A;  4KCC A;  3EPE A;  1H45 A;  1JET A;  2Y5L A;  4E0X A;  2F7B A;  4JWY A;  1MQI A;  3VE1 B;  4IO4 A;  1FQE A;  3IB1 A;  1AWB A;  3N94 A;  1S7Y A;  4JVC A;  4XEQ A;  1NNP A;  3B8B A;  3MC2 A;  2I49 A;  4BDN A;  1IMD A;  1KWH A;  3C36 A;  3H03 A;  3VLW A;  1Y4C A;  4MNI A;  5I2K B;  3OEK A;  2DOJ A;  2H98 A;  4EF1 A;  2AYS A;  2G29 A;  3C31 A;  2Q8M A;  4POW A;  1MXZ A;  2O1M A;  4OVT A;  2BJI A;  4R6H A;  4UAB A;  4PQJ A;  2QVR A;  3TTL A;  5EQA A;  1Y1M A;  3RN8 A;  2XXH A;  3U92 A;  3TTN A;  5T3J A;  3CRB A;  1N7W A;  3GLB A;  4RPN A;  4AS4 A;  1LAH E;  1NNK A;  4NF4 A;  3MVW A;  3SEV A;  2Y7R A;  1I6B A;  5FHN A;  3QYT A;  3TDJ A;  1SQY A;  1NUW A;  3VV5 A;  4U1Z A;  2WKY A;  4P1E A;  2DP8 A;  2PX1 A;  1B32 A;  5DEX B;  2ZZX A;  3IFC A;  2V3U A;  3TCH A;  4RJZ A;  3B50 A;  1FBD A;  2HHM A;  3EHU A;  3FVK A;  3Q25 A;  5JTY B;  1MPD A;  4ZEK A;  4GQO A;  1NUY A;  2PVU A;  2F8D A;  3WAE A;  2A5T A;  3R7X A;  2I6E A;  2F7A A;  4JXI A;  2HXR A;  3JV9 A;  1B51 A;  2Z23 A;  1PBQ A;  3C34 A;  2QJE A;  2BJJ X;  4NE4 A;  1NKX A;  1LEV A;  3M3L A;  3Q27 A;  4XKR A;  1OMP A;  2FBP A;  1F9B A;  1SW1 A;  4GBV A;  1OVB A;  3QXM A;  2CZL A;  5J1D A;  1FPL A;  5AA2 D;  3KJ7 A;  4QF9 A;  2DWH A;  1CB6 A;  3IOW A;  1BTJ A;  3JZJ A;  4OET A;  1MQG A;  2V84 A;  4H65 A;  5H8H A;  4I40 A;  4MJO A;  4Q5T A;  1ZMG A;  3E78 A;  1VFE A;  3OEM A;  2OJT A;  4F3G A;  4OA4 A;  1YZ0 A;  4MF3 A;  3N26 A;  1MY1 A;  1M5C A;  3K02 A;  3ECR A;  2HQ0 A;  5KDT A;  5LTC A;  4HE1 A;  1DK4 A;  1OQH A;  4GXS B;  3RPL A;  3OEN A;  4ZEI A;  5HBC A;  4F3P A;  2KQZ A;  1POY 1;  2B4L A;  4GWX A;  4PET A;  5ISU A;  4JBZ A;  3PPR A;  4F18 A;  3I6V A;  2Z8E A;  4QSC A;  1WOD A;  4IY5 A;  4Q0C A;  2NWJ A;  1H44 A;  1XI6 A;  3ROJ A;  3OXN A;  3UOR A;  3IOT A;  4PFY A;  1RYX A;  4KXP A;  5I2K A;  1TXF A;  1II5 A;  1B5H A;  1LFI A;  5I58 A;  4OEU A;  4GBW A;  2AL5 A;  3I5O A;  2MKZ A;  4N13 A;  1IME A;  3EHT A;  5ET5 A;  5LDZ A;  4O8M A;  4IO2 A;  3IAZ A;  4FIM A;  1M5E A;  4N15 A;  5H8N B;  3K6U A;  4N6K A;  4P3L A;  2QMX A;  4YKI A;  2RKM A;  3FJG A;  4PE5 B;  3B6Q A;  4QBA A;  4IY6 A;  2PCR A;  4RNS A;  1JW1 A;  1RDY A;  3OMB A;  3C32 A;  3K6X A;  3G3K A;  1QKA A;  4PGP A;  1LBC A;  3LUY A;  1B1H A;  3UA8 A;  3R26 A;  4H5G A;  1A8F A;  2FHY A;  2F6G A;  4LZ7 A;  2FA7 A;  3ZS6 A;  4GWU A;  1B7U A;  4KYD A;  3P7I A;  2ZYM A;  2DE4 A;  2E0S A;  1PEB A;  3RGY A;  1LBV A;  4O3A A;  2RC7 A;  2DVC A;  4QHQ A;  3VLV A;  2DDK A;  4BLA A;  2H99 A;  1FPI A;  1T0K A;  4OVJ A;  3C9H A;  3TTM A;  5I57 B;  4I9D A;  2UYE A;  2ZYK A;  4EQ7 A;  2V25 A;  1FPD A;  2RC9 A;  2ZZW A;  4BDL A;  3RT6 B;  4DI3 D;  1N04 A;  4ELR A;  5BWJ A;  4ESX A;  4KI0 E;  1LAG E;  1JP4 A;  1Y3Q A;  5IKB A;  4OWD A;  4ZE8 A;  4H1X A;  4Z0I A;  5ET7 A;  3PUY E;  1POT A;  3T22 A;  3S4U A;  1FBG A;  4TOZ A;  3T9V A;  3ZSF A;  3SKP A;  1LCT A;  1D9Q A;  4PAI A;  2GHB A;  4G68 B;  4ELQ A;  1KA0 A;  2H4I A;  1NV2 A;  3V5A A;  5JK4 A;  4R6K A;  2GFE A;  2DYX A;  4JSD A;  5DT6 A;  4IGT A;  4GX4 A;  2PT2 A;  3PGF A;  4R9G A;  1RDX A;  4RA1 A;  1OVT A;  1IMA A;  5ICQ A;  2HAV A;  4POX A;  2KLF A;  4GOT A;  5H8F A;  1ANF A;  4U1O A;  3E79 A;  3ONM A;  1ZJL A;  1AH5 A;  3IJO B;  4PFU A;  2V93 A;  2IEE A;  1FTO A;  3CSB A;  2UXA A;  1WDN A;  5B7D A;  1AL3 A;  2M8C A;  4ZED A;  1FPB A;  1B6H A;  2HPG A;  2XA5 A;  1QJM A;  3MZB A;  4H46 A;  5BUU A;  1MPB A;  2WX9 A;  1OLC A;  1UQW A;  4YB6 A;  2ONS A;  3QMF A;  4KFQ A;  3VVD A;  3W9V A;  3C35 A;  1N0T A;  1EZ9 A;  4N81 A;  4HCW A;  1IMC A;  1IIW A;  1FTK A;  3MW0 A;  2XXT A;  5ET6 A;  4G61 A;  4KCD A;  2XXI A;  3CG1 A;  2X7P A;  3TFL A;  2DS9 A;  1DSN A;  1MM7 A;  1LLS A;  2R8T A;  3LV0 A;  1NH7 A;  2CEY A;  4LON B;  4KQP A;  5KCJ A;  4EXL A;  4NWC A;  1SW2 A;  3IB2 A;  2Y7I A;  4OHN A;  2F7C A;  1MRP A;  3S9L C;  3FXR A;  4BDR A;  5K2X A;  2XXP A;  4YAH X;  3IO6 A;  2GRV A;  1N3X A;  2D5W A;  5L9O A;  3VLU A;  4GVO A;  2Z8F A;  3QSL A;  3SES A;  2RCA A;  3FIR A;  1TWY A;  4H8J A;  5DVJ A;  4GLI A;  4NHB A;  1UTH A;  3E9X A;  3A29 A;  3NOH A;  4BDQ A;  1EU8 A;  1MY3 A;  2HFB A;  4XFE A;  2P2A A;  3PMX A;  5CBS A;  1O63 A;  4LQ2 A;  4NTL A;  5I59 B;  2FNC A;  1FBF A;  1MXX A;  3BFT A;  1SW4 A;  2XXX A;  4XTC Q;  3W15 C;  1NL5 A;  1MY2 A;  3G3F A;  4N4U A;  1R9L A;  3N6T A;  4X8R A;  2ZMB A;  3GZG A;  3G3G A;  1NNF A;  4PFI A;  1EYI A;  3CSG A;  3VFJ A;  3MPL A;  4ZEC A;  2VPN A;  4LZ5 A;  4KPT A;  5EYH A;  5KDT B;  3LSX A;  1B7H A;  4OES A;  2Y84 A;  2OBG A;  4RPO A;  1NV7 A;  5AA1 A;  4FBP A;  4GL8 A;  2PYY A;  2ZZV A;  2A5S A;  4ZS9 A;  4XKP A;  4OYV A;  4F19 A;  2HXW A;  4O7M A;  3RNN A;  3LUZ A;  4NN3 A;  3OO8 A;  1BLF A;  3FVN A;  5IZ1 A;  3DP6 A;  3UN6 A;  3R6U A;  4RXL A;  4GFR A;  2ONR A;  3PPN A;  4DXU A;  2CEX A;  3G3I A;  2H25 A;  1XC1 A;  5I3S A;  1MY4 A;  4NF0 A;  4P1L A;  4YIC A;  4DCY A;  2V3Q A;  4LP2 B;  2OWZ A;  2RCB A;  1Q9D A;  1AMF A;  2F3B A;  3GXA A;  4QFN A;  1B0L A;  2ANJ A;  2X7Q A;  3ISP A;  1XVY A;  1NMU A;  4PFR A;  4TLM B;  4C0R A;  1ELJ A;  2OLB A;  1IMF A;  3O9P A;  4H67 A;  3VXC A;  4FAJ A;  1HSE A;  2XXW A;  3KN8 A;  4LAT A;  3QK6 A;  3O6G A;  4WXJ A;  4M4G A;  5EHM A;  3HFU A;  3MZ9 A;  3SER A;  3G3J A;  1PDA A;  4F2O A;  1P1W A;  3OO9 A;  4OXV A;  3MUQ A;  3KC0 A;  4TLL B;  2DWI A;  3KN7 A;  5I2N B;  3OEL A;  3F11 A;  4LA9 A;  2O6A A;  2CZH A;  4LZ8 A;  4NF5 A;  3T96 B;  1FBE A;  4PBH A;  4R2B A;  4MH5 A;  4NAP A;  1BK4 A;  2HCA A;  2ZNT A;  2VT5 A;  1YPN A;  2YLN A;  3D4C A;  4R9F A;  3IOV A;  4DXC A;  4OAN A;  2XXQ A;  3IR1 A;  4OER A;  5F24 A;  1JNF A;  5HPQ A;  2ALU A;  3RT8 A;  1NV6 A;  4RYA A;  5I84 A;  1US5 A;  5EYG A;  3V83 A;  1K9Z A;  1MDQ A;  5TPA B;  5B70 A;  5CRY A;  1FQF A;  4F29 A;  3SET A;  4OVP A;  2XWV A;  1P99 A;  3TYH A;  4PF6 A;  1Y9U A;  2I58 A;  3K1M A;  1US4 A;  1BIY A;  2XXK A;  4UA8 A;  2VP1 A;  5H8S A;  3CR9 A;  3TTR A;  5L9M A;  5AA2 B;  3FXB A;  3M8U A;  2XWK A;  1Y3P A;  2Y7P A;  2Q2A A;  3KGC A;  3BIG A;  2AL4 A;  2REG A;  3MAM A;  1LGB C;  2Y7W A;  4P8B A;  4GWS A;  5TP9 B;  1DCU A;  1B7Z A;  2DE3 A;  3H6U A;  1ATG A;  5DVI A;  3PTY A;  3FAT A;  4IO6 A;  1L5T A;  3FJM A;  3S9E A;  2E1S A;  4H5F A;  4F2Q A;  2NOO A;  2THI A;  2H9B A;  4ZZA A;  5I56 A;  5F7V A;  4XKQ A;  4PAF A;  2F35 A;  2I4C A;  4RK9 A;  1NV5 A;  3Q29 A;  3KN3 A;  5FHM A;  1B3F A;  2VD3 A;  2DSF A;  2OWS A;  3MVY A;  5IM2 A;  4DI4 B;  5CMC A;  2WEF A;  5AA2 A;  4I1D A;  2QS3 A;  1FRP A;  2QRY A;  3EKI A;  2QFL A;  4ESW A;  1J1N A;  1IUD A;  2XWO A;  4FJP A;  3IB0 A;  1AIV A;  4NF6 A;  2OCU A;  1MXY A;  4OFJ A;  1FQC A;  4ELP A;  5FBP A;  3K2D A;  4U4X A;  3SEU A;  2GQ1 A;  3OO7 A;  1R6Z A;  3SDF A;  1EH3 A;  2HAU A;  4GIZ A;  4MFI A;  5TPA A;  1FPF A;  3M3F A;  3FV1 A;  3O29 A;  4R75 A;  4F22 A;  1FTA A;  3EN3 A;  4P47 A;  4YKP A;  4R6Y A;  3TZA A;  2W7Y A;  4C1U A;  2I3W A;  1LFH A;  3VXB A;  1FTL A;  3DEL B;  4YU0 A;  3FD3 A;  2VOZ A;  1SPI A;  2YPN A;  5ICT A;  3RTF B;  1B9J A;  4XKN A;  2XX9 A;  2YJP A;  2CZI A;  3IJX B;  1JEU A;  4EUO A;  4DIG A;  2D21 A;  3O66 A;  1LBZ A;  1H43 A;  3H6W A;  1TT1 A;  4G4P A;  1AOV A;  4WEP A;  1A8E A;  3CG3 A;  4NF5 B;  1ZLQ A;  5H8Q A;  4ZDM A;  1B5I A;  3KJT A;  4H0W A;  3TMG A;  5H8F B;  4O3B A;  2DXY A;  4NMY A;  1XS5 A;  1FW0 A;  4XXU A;  4O3C A;  4MIJ A;  5IZ3 A;  3D1R A;  1LB9 A;  3TQW A;  3Q28 A;  1B3G A;  1XHY A;  3IX1 A;  4BDM A;  4H6D A;  1NFT A;  3TCG A;  4JB7 A;  2QVV A;  3L6G A;  3JYR A;  3O6H A;  4IO5 A;  3LSW A;  1MXW A;  5DW8 A;  5I7I A;  3HPI A;  5J16 A;  1B4H A;  2XHD A;  4IO7 A;  2QS1 A;  4I62 A;  4R74 A;  4G77 A;  3SZP A;  1TFA A;  1A99 A;  2ZNS A;  2WBD A;  5CM6 A;  1MY0 A;  4GWW A;  1Y20 A;  4ZE9 A;  3CI8 A;  1EZO A;  2WYP A;  1MS7 A;  3FXU A;  5CMM A;  3K6W A;  3N6U A;  5I57 A;  3LSL A;  4M1V A;  1MH3 A;  1DBZ A;  1EYJ A;  1OIB A;  1SI1 A;  1FQD A;  3L6H A;  1JVY A;  2QS2 A;  3RYD A;  4UAC A;  2GH9 A;  1PB9 A;  3FVG A;  3N5L A;  4NED A;  3ZKK A;  4YMA A;  4OEV A;  4GXA A;  2Z8D A;  3QUJ A;  4R72 A;  1MH4 A;  3TPA A;  1D3K A;  2Q2C A;  3FV2 A;  4AQ4 A;  1NNT A;  2ZYO A;  3BKI B;  3OOA A;  3SEW A;  1QGX A;  5CBR A;  3QIM A;  1O7T A;  4MMP A;  4O7I A;  1PB7 A;  3CFZ A;  1D9Y A;  4PAK A;  4JWO A;  1TFD A;  1QUK A;  4FE8 A;  4YZZ A;  3HST A;  4P0G A;  3MP8 A;  1Z7N E;  3DLN A;  2Q8J A;  2O51 A;  2HEU A;  4NF4 B;  2P0S A;  1YTV A;  5A5X A;  5DYH A;  1LST A;  3DP8 A;  4O94 A;  2XWI A;  1JW4 A;  4QFK A;  3PUW E;  1IXG A;  5FTI A;  1M5F A;  4OEN A;  1K9Y A;  4F1Y A;  3A3C A;  4GX3 A;  2CZK A;  2RIN A;  3IL1 B;  1NUZ A;  4IO3 A;  4XIG Q;  3S9N C;  4LN5 A;  3A3U A;  3PPQ A;  1FBH A;  1LBY A;  1N3W A;  4F3S A;  3IO4 A;  4N17 A;  2UVJ A;  5A5X B;  4P9K A;  3HN0 A;  4G8N A;  3PPP A;  5KCJ B;  4EF2 A;  1QUI A;  4FOR A;  1KA1 A;  1BP5 A;  3RPL B;  5FTH A;  3CHG A;  3HV1 A;  1SI0 A;  1N7X A;  1FTM A;  1SBP A;  4H45 A;  1B46 A;  4MNP A;  2L5V A;  4K3F A;  5LOM A;  1Y1Z A;  4RK2 A;  3UGW A;  1IXH A;  4U21 A;  4GX6 A;  1BKA A;  3U94 A;  3K1N A;  3KOS A;  2DVZ A;  4JWX A;  2VHA A;  3E3K A;  4JVD A;  1MM6 A;  3KC1 A;  4F31 B;  1LBB A;  1UIU A;  3RLF E;  2PFY A;  3PD9 A;  2VGQ A;  4QSD A;  4DXB A;  5ITP A;  1PB8 A;  1XVX A;  1QW0 A;  3U1O A;  4G8H A;  1JVX A;  4GWY A;  5FHO A;  4PE3 A;  4PFT A;  2XXV A;  2I3V A;  3BBR A;  5EQ9 A;  3E4R A;  3Q26 A;  1D4N A;  4X9T A;  4F1U A;  4EQ9 A;  1ZU0 A;  1DTZ A;  1QVS A;  1FCK A;  3U72 A;  3PMW A;  1A54 A;  4PP0 A;  3KBZ A;  1IMB A;  2D3I A;  4P11 A;  4I3E A;  4MAG A;  2XD3 A;  2AIX A;  5KZT A;  1LCF A;  1Y3N A;  2FIE A;  4Q8R A;  1QUJ A;  2XD2 A;  2Q88 A;  1N76 A;  5L8D A;  5A5L A;  1FQA A;  4OFL A;  1A40 A;  3FJ7 A;  3UIF A;  1Y4T A;  1GR2 A;  4F3B A;  1USY E;  4MCO A;  2DQV A;  5L9S A;  2ZYN A;  4JVI A;  4GRK A;  1A7L A;  2ONK E;  2OX3 A;  3KSX A;  4IGR A;  1FPG A;  4PTK A;  2LAO A;  1UTH B;  4GL0 A;  5IZ3 B;  3HCQ A;  3MQ9 A;  4U4S A;  2O1L A;  1YXI A;  1B5J A;  3T0J A;  2G93 A;  1DPP A;  2X26 A;  4KYE A;  4DE8 A;  4X04 A;  4IB2 A;  2Q89 A;  1RDZ A;  4R73 A;  2H5Y A;  4RY1 A;  4PDH A;  3FVO A;  3MBP A;  3MZ1 A;  1GVC A;  3CVG A;  3B6T A;  2UVI A;  3GYY A;  2P3V A;  1QUL A;  2O7I A;  4QRZ A;  4MEV A;  3H06 B;  4NF8 B;  4QFP A;  5AA4 B;  3V89 B;  4PFB A;  4PGN A;  3S9M C;  1MQH A;  4HCY A;  4DZ1 A;  2OZZ A;  3SEX A;  2VPO A;  1Q1K A;  3OSR A;  1CNQ A;  1SYI A;  4GWO A;  2PMS A;  2QPQ A;  3RY3 A;  4MLV A;  2P1S A;  1O64 A;  1YCJ A;  3RUM A;  1B40 A;  1M5B A;  2DXR A;  3S2V A;  1B3H A;  1LBX A;  4P56 A;  2PT1 A;  2B65 A;  1S50 A;  1IQ7 A;  4OVR A;  5IZZ A;  5EQ8 A;  4LVQ A;  1ZIU A;  2B4M A;  3MPK A;  5DTB A;  1SYH A;  1PC3 A;  2CMO A;  3WAF A;  4AB5 A;  5EHS A;  4OFO A;  2VD2 A;  4QSE A;  5CMK A;  4NF6 B;  4I3Y A;  2QMW A;  4LQ5 A;  1NV0 A;  2QS4 A;  4PCD A;  3T9H B;  5I56 B;  3M3K A;  3MVZ A;  3TQL A;  5I58 B;  4MBP A;  4HTG A;  1XOC A;  4GF8 A;  3USD A;  4GWZ A;  2I4B A;  4ND9 A;  4OMB A;  1B2H A;  1A55 A;  4G68 C;  2REJ A;  2I0C A;  1NV4 A;  4N8Y A;  4N6D A;  1N84 A;  4KHZ E;  1LFG A;  1MQJ A;  4YKK A;  4QFL A;  4WED A;  4DDD A;  5ESY A;  2V4C A;  4I8C A;  4GD5 A;  3PD8 A;  1VDW A;  1FTJ A;  4OQO A;  2Y5K A;  3TCF A;  4X1B A;  1B52 A;  1P1N A;  3U8Q A;  1DTG A;  5IGA A;  2PBW A;  1FJ6 A;  1LAX A;  4PFW A;  3T66 A;  2HZL A;  5K2Y A;  1G0I A; 
#chains in the Genus database with same CATH homology
 1B3G A;  3HHG A;  3CFL A;  2RF1 A;  1XHY A;  3IX1 A;  1NH7 A;  4BDM A;  4H6D A;  3MWB A;  3OMB A;  4LON B;  4EDP A;  4QFO A;  2O68 A;  1NFT A;  3QAX A;  3LC8 A;  4KQP A;  1ZBM A;  3K0V A;  3TCG A;  5KCJ A;  1NH8 A;  4JB7 A;  4EXL A;  3OO6 A;  4NWC A;  4Q5T A;  1SW2 A;  3IB2 A;  1B3E A;  4X1D A;  2Y7I A;  3H6T A;  4YKJ A;  4OHN A;  3L6G A;  2F7C A;  1MRP A;  3TAJ A;  3S9L C;  3GBA A;  3FXR A;  4X48 A;  4BDR A;  5K2X A;  2XXP A;  2UVH A;  2XX8 A;  4YAH X;  1P1Q A;  2GRV A;  3IO6 A;  3K6V A;  1N3X A;  1B3L A;  3JYR A;  1S9T A;  4U22 A;  1VR5 A;  3O6H A;  3VVF A;  2D5W A;  1URG A;  3TTK A;  4IO5 A;  5H8N A;  1DMB A;  3KG2 A;  3LSW A;  5L9O A;  3DP4 A;  1B4Z A;  1FQB A;  1MXW A;  2Z8F A;  3G7W A;  3EPE A;  4GVO A;  4KCC A;  3VLU A;  3QSL A;  1DOT A;  3SES A;  2RCA A;  3D4G A;  1H45 A;  3FIR A;  1JW5 A;  1TWY A;  3HPI A;  4H8J A;  4P0I A;  1B4H A;  1UTB B;  5DVJ A;  2XHD A;  1RKM A;  4GLI A;  4IO7 A;  4R2F A;  2QS1 A;  4I62 A;  4R74 A;  4G77 A;  1UTH A;  3E9X A;  1TFA A;  1A99 A;  1JET A;  2ZNS A;  3MP6 A;  2F97 A;  1B1X A;  2F7B A;  1MQI A;  4JWY A;  4IO4 A;  5ITO A;  3VE1 B;  1EU8 A;  1MY3 A;  4BDQ A;  2HFB A;  5CM6 A;  1FQE A;  1MY0 A;  3IB1 A;  1Y20 A;  2P2A A;  3N94 A;  4Z7E A;  3CFX A;  4ZE9 A;  3EQ1 A;  3CI8 A;  3PMX A;  5CBS A;  1S7Y A;  1B05 A;  3MVX A;  1O63 A;  4LQ2 A;  1GV8 A;  4NTL A;  5I59 B;  1EZO A;  1NNP A;  1MS7 A;  3DM0 A;  3OD7 A;  3FXU A;  3MC2 A;  2ABH A;  5CMM A;  3THI A;  3K6W A;  3N6U A;  5HM4 B;  2FNC A;  2I49 A;  4BDN A;  1CE2 A;  2F78 A;  1KWH A;  3C36 A;  3LSL A;  1MXX A;  5I57 A;  3BFT A;  1SW4 A;  1MH3 A;  3H03 A;  4M1V A;  2XXX A;  4N07 A;  4XTC Q;  3RPW A;  3VLW A;  5EYF A;  1I69 A;  1JQF A;  3TEL A;  1Y4C A;  3W15 C;  1NL5 A;  1PBP A;  3O28 A;  5I2K B;  3OEK A;  1OIB A;  1SI1 A;  2DE2 A;  2DOJ A;  1FQD A;  4H8I A;  1MY2 A;  3G3F A;  2H98 A;  3C4M A;  3L6H A;  1R9L A;  1ZKB A;  4MLQ A;  4EF1 A;  3N6T A;  1JVY A;  4YB5 A;  3T93 B;  1MPC A;  2QS2 A;  2AYS A;  3V8X B;  2G29 A;  3A09 A;  3C31 A;  4UAC A;  4POW A;  1MXZ A;  2GH9 A;  3RTW B;  2O1M A;  2ZMB A;  3GZG A;  4R6H A;  1PB9 A;  3FVG A;  3G3G A;  3K01 A;  3N5L A;  4PQJ A;  4NED A;  1NNF A;  3TTL A;  3ZKK A;  4YMA A;  4NF8 A;  1Y1M A;  1IZ1 A;  4OEV A;  3RN8 A;  2XXH A;  3CSG A;  4GXA A;  3TTN A;  3U92 A;  3VFJ A;  3MPL A;  5DEX A;  3CRB A;  2Z8D A;  3QUJ A;  4ZEC A;  1N7W A;  4LZ5 A;  4DLD A;  3VDF A;  4KPT A;  5KDT B;  3TTR A;  4R72 A;  1MH4 A;  3GLB A;  1B7H A;  3LSX A;  4RPN A;  3TPA A;  1D3K A;  3PUV E;  1LAH E;  3B6W A;  4OES A;  3TKD A;  2Q2C A;  1NNK A;  2Y84 A;  5I2N A;  3FV2 A;  4NF4 A;  1Z7M E;  3MVW A;  4DZ1 A;  4AQ4 A;  1GGG A;  1NNT A;  1H3D A;  1RYO A;  2OBG A;  4RPO A;  5AA1 A;  3SEV A;  4C1T A;  2Y7R A;  4E0X A;  1I6B A;  5FHN A;  3QYT A;  2ZYO A;  4ZEB A;  3TDJ A;  4GL8 A;  1SQY A;  3EHS A;  3VV5 A;  2PYY A;  3BKI B;  3ODB A;  2XXR A;  2WKY A;  3OOA A;  4U1Z A;  2DP8 A;  3SEW A;  2A5S A;  3TOD A;  3TUS A;  3T9X B;  2PX1 A;  4ZS9 A;  5CBR A;  1B32 A;  4XKP A;  3QIM A;  1O7T A;  5DEX B;  5K2Y A;  2V3U A;  3TCH A;  4OYV A;  4RJZ A;  1PB7 A;  3CFZ A;  4F19 A;  2HXW A;  3FAS A;  3HO7 A;  1D9Y A;  3PV0 E;  4Z0I A;  3RNN A;  3O6I A;  4FEB A;  3EHU A;  3FVK A;  1QKB A;  3Q25 A;  4JWO A;  1TFD A;  5JTY B;  1QUK A;  4FE8 A;  3OO8 A;  1DPE A;  1MPD A;  4ZEK A;  4GQO A;  1BLF A;  2PVU A;  3FVN A;  2F8D A;  3IK6 B;  3KFM A;  4YZZ A;  3HST A;  4P0G A;  3WAE A;  2A5T A;  4Q30 B;  3R7X A;  2I6E A;  2F7A A;  4HS7 A;  4JXI A;  3MP8 A;  1Z7N E;  3DP6 A;  3JV9 A;  3OSQ A;  3R6U A;  4GFR A;  4RXL A;  3UN6 A;  2ONR A;  1B51 A;  3FXQ A;  2Z23 A;  3DLN A;  1PBQ A;  3PPN A;  5M2V A;  2Q8J A;  3C34 A;  2O51 A;  4BDO A;  4ZEF A;  4DXU A;  2I48 A;  3G3I A;  3W9W A;  2QJE A;  2H25 A;  2HEU A;  5H8S A;  1XC1 A;  2BJJ X;  4NE4 A;  1NKX A;  3K1P A;  3M3L A;  3Q27 A;  4XKR A;  1MY4 A;  1OMP A;  1F9B A;  4NF4 B;  1SW1 A;  2P0S A;  1YTV A;  2Y7K A;  5A5X A;  3S9M C;  4YIC A;  5DYH A;  1YAE A;  5CI5 A;  1LST A;  3FGS A;  3DP8 A;  4DCY A;  3IOU A;  1OVB A;  3QXM A;  2CZL A;  1JW4 A;  5J1D A;  2V3Q A;  5AA2 D;  4QFK A;  4LP2 B;  3KJ7 A;  3PUW E;  1IXG A;  2RCB A;  5FTI A;  1M5F A;  4OEN A;  4QF9 A;  1SD3 A;  4F1Y A;  1AMF A;  3A3C A;  3GXA A;  4QFN A;  2DWH A;  1B0L A;  2ANJ A;  3B7D A;  1CB6 A;  2X7Q A;  3IOW A;  1XVY A;  2RIN A;  3IL1 B;  1BTJ A;  3JZJ A;  4OET A;  4IO3 A;  4XIG Q;  4ECF A;  3S9N C;  1NMU A;  1MQG A;  2V84 A;  3A3U A;  4TLM B;  4C0R A;  1ELJ A;  4H65 A;  2OLB A;  3O9P A;  4H67 A;  3PPQ A;  5H8H A;  3MP1 A;  5H8H B;  3VXC A;  4FAJ A;  1HSE A;  2GHA A;  2XXW A;  1ZMG A;  2ZNU A;  3KN8 A;  2F6P A;  1N3W A;  3QK6 A;  4LAT A;  3O6G A;  3T9U A;  3UK4 A;  4F3S A;  3IO4 A;  2OWT A;  4M4G A;  3PUX E;  1VFE A;  2UVJ A;  4WXJ A;  5EHM A;  5A5X B;  3HN0 A;  4G8N A;  3OEM A;  2OJT A;  3PPP A;  5KCJ B;  4EF2 A;  4F3G A;  1QUI A;  4FOR A;  3MZ9 A;  3SER A;  4YB7 A;  4MF3 A;  3N26 A;  1BP5 A;  1MY1 A;  3G3J A;  5FTH A;  1M5C A;  1PDA A;  1H76 A;  2XXY A;  3HV1 A;  4AB6 A;  3K02 A;  4ISU A;  3ECR A;  4F2O A;  2HQ0 A;  5KDT A;  1SI0 A;  4FEC A;  1N7X A;  3MJN A;  1FTM A;  1OQH A;  1SBP A;  4GXS B;  1B46 A;  3KBR A;  3OEN A;  4FAT A;  1WVJ A;  3AXF A;  4K3F A;  1P1W A;  3OO9 A;  5HBC A;  4U23 A;  4ZEI A;  4F3P A;  5LOM A;  1Y1Z A;  1POY 1;  4RK2 A;  3UGW A;  1IXH A;  4U21 A;  4U2R A;  4OXV A;  3MUQ A;  1UTB A;  1BKA A;  4PET A;  4TLL B;  2DWI A;  3U94 A;  3KN7 A;  4G2Z A;  3K1N A;  5I2N B;  3OEL A;  3KOS A;  3PMV A;  5ISU A;  4JBZ A;  3QUF A;  4OZ9 A;  3PPR A;  2DVZ A;  4JWX A;  4F18 A;  2VHA A;  3E3K A;  1MM6 A;  3I6V A;  4THI A;  2Z8E A;  4QSC A;  2A5T B;  4F31 B;  1LBB A;  1WOD A;  1UIU A;  3F11 A;  4LA9 A;  2O6A A;  3RLF E;  3PU5 A;  1MXU A;  3PD9 A;  1XT8 A;  4LZ8 A;  1GTK A;  2VGQ A;  4IY5 A;  4NF5 A;  4QSD A;  3T96 B;  4DXB A;  5ITP A;  1I6A A;  4Q0C A;  1PB8 A;  1XVX A;  4R2B A;  2NWJ A;  1QW0 A;  3U1O A;  4MH5 A;  1H44 A;  1OLA A;  1OQG A;  4G8H A;  3KOT A;  1JVX A;  5FHO A;  4F1V A;  3H7M A;  3OXN A;  2HCA A;  4KR5 A;  3UOR A;  3IOT A;  2ZNT A;  4JDF A;  4PFY A;  5AA3 A;  1YPN A;  2XXV A;  2I3V A;  2YLN A;  1RYX A;  3BBR A;  3ILU B;  4PFT A;  3D4C A;  3E4R A;  3Q26 A;  4R9F A;  5I2K A;  3IOV A;  1D4N A;  1TXF A;  1II5 A;  2ESN A;  4X9T A;  2XXQ A;  1B5H A;  1LFI A;  3IR1 A;  4OER A;  4DXC A;  4EQ9 A;  2R9J A;  4F1U A;  1ZU0 A;  1DTZ A;  1QVS A;  5I58 A;  3CIJ A;  1JNF A;  5HPQ A;  4EXK A;  4OEU A;  1FCK A;  3U72 A;  2ALU A;  3H4Z A;  3PMW A;  2RC8 A;  2NVU B;  1A54 A;  2AL5 A;  3HHF A;  3I5O A;  4PP0 A;  3RT8 A;  4N13 A;  2D3I A;  4RYA A;  5I84 A;  4ELO A;  4P11 A;  1HSJ A;  3EHT A;  1US5 A;  5ELV A;  5AE4 A;  1MG1 A;  2XD3 A;  2AIX A;  5KZT A;  1LCF A;  3SDF A;  1UIV A;  1MDP 1;  1Y3N A;  3V83 A;  1MDQ A;  1SDX A;  1M5D A;  5TPA B;  4IO2 A;  4Q8R A;  1QUJ A;  5B70 A;  2XD2 A;  3IOR A;  5CRY A;  1FQF A;  3IAZ A;  3H6V A;  4FIM A;  1M5E A;  1EZP A;  3LSF B;  2Q88 A;  4F29 A;  3SET A;  5H8N B;  4E0W A;  1N76 A;  3K6U A;  5L8D A;  5I59 A;  3FUZ A;  1SVX B;  2QMX A;  1P99 A;  4YKI A;  3TYH A;  2RKM A;  1FQA A;  3FJG A;  2UVG A;  1Y9U A;  2B3F A;  2I58 A;  3G3H A;  4OFL A;  4PE5 B;  3K1M A;  3UP9 A;  3VVE A;  5F1Q A;  5AA4 B;  3B6Q A;  1A40 A;  4IY6 A;  1US4 A;  1BIY A;  3FJ7 A;  1Y4T A;  3UIF A;  4UA8 A;  1GR2 A;  2VP1 A;  1JW1 A;  4RNS A;  4F3B A;  5DVF A;  1SW5 A;  1USY E;  1IEJ A;  3C32 A;  3K6X A;  2DQV A;  2XXU A;  2DWJ A;  3CR9 A;  1QKA A;  2O69 A;  3G3K A;  3RQT A;  1LBC A;  2ZYN A;  3LUY A;  2O84 X;  5L9M A;  2I0B A;  5AA2 B;  4GRK A;  5L9S A;  1B1H A;  3UA8 A;  3R26 A;  1A7L A;  2ONK E;  1A8F A;  2XX7 A;  3KSX A;  4H5G A;  4IGR A;  2F6G A;  4LZ7 A;  3M8U A;  2FA7 A;  1Y3P A;  2O7U A;  3FZV A;  3ZS6 A;  1B7U A;  1LAF E;  4KYD A;  2LAO A;  1Q35 A;  2Y7P A;  3LBS A;  3P7I A;  3PPO A;  2Q2A A;  2F34 A;  1UTH B;  2ZYM A;  2DE4 A;  3KGC A;  2E0S A;  4GL0 A;  1PEB A;  3RGY A;  3HCQ A;  3MQ9 A;  4U4S A;  2O1L A;  1B5J A;  2AL4 A;  4O3A A;  2REG A;  2RC7 A;  3MAM A;  4F39 A;  1LGB C;  2DVC A;  4QHQ A;  2Y7W A;  3VLV A;  4BLA A;  2H99 A;  1VE4 A;  1T0K A;  2OK2 A;  2IA4 A;  3O2A A;  2HZK A;  4L17 A;  4OVJ A;  2DWA A;  3C9H A;  2G93 A;  3GBB A;  4FED A;  1DPP A;  1B7Z A;  2DE3 A;  1P1U A;  3H6U A;  3KEI A;  5TP9 B;  3TTM A;  1ATG A;  5DVI A;  2X26 A;  3H3G A;  3C33 A;  4KYE A;  5I57 B;  3FAT A;  4I9D A;  4DE8 A;  2UYF A;  2UYE A;  2ZYK A;  4IB2 A;  1B0H A;  4IO6 A;  3FJM A;  1L5T A;  4EQ7 A;  2Q89 A;  4R73 A;  2V25 A;  4JSO A;  2H5Y A;  2F36 A;  3LR1 A;  2B3B A;  2RC9 A;  3O97 A;  2F5X A;  4RY1 A;  3S9E A;  2E1S A;  3FVO A;  4BDL A;  3MBP A;  3MZ1 A;  4H5F A;  4WKM A;  1GVC A;  5CMB A;  3RT6 B;  3CVG A;  4F2Q A;  1N04 A;  2NOO A;  3B6T A;  4LUB A;  3U93 A;  4ELR A;  4ESX A;  2THI A;  2UVI A;  5BWJ A;  1ZTY A;  4KI0 E;  2H9B A;  1LAG E;  1Y3Q A;  2NUV A;  1QUL A;  2O7I A;  5IKB A;  4ZZA A;  4QRZ A;  2R71 A;  5AA4 A;  1USY H;  3H06 B;  4NF8 B;  4OWD A;  4QFP A;  4ZE8 A;  5F7V A;  3V89 B;  4H1X A;  4XKQ A;  1P1O A;  4N6P A;  5I56 A;  5JTY A;  3K00 A;  3KSJ A;  2F35 A;  2I4C A;  3K4U A;  4KD5 A;  1MQH A;  4RK9 A;  3PUY E;  4HCY A;  1R1N A;  3KN3 A;  3Q29 A;  4TQU Q;  1POT A;  2OZZ A;  5FHM A;  3SEX A;  1B3F A;  1Q1K A;  3OSR A;  3T22 A;  4DCX A;  2VD3 A;  2DSF A;  1SYI A;  2OWS A;  2ZXT A;  4GWO A;  2FYI A;  1IXC A;  2Z22 A;  2PMS A;  2QPQ A;  3MVY A;  2QL3 A;  4ONY A;  3RY3 A;  4TOZ A;  3S4U A;  5CMC A;  3SKP A;  1D9V A;  3T9V A;  4MLV A;  2P1S A;  3ZSF A;  4EQB A;  3ZKL A;  1LCT A;  5AA2 A;  1O64 A;  1YCJ A;  3RUM A;  1B40 A;  4I1D A;  3TEP A;  2R6G E;  1M5B A;  2GHB A;  2QS3 A;  4G68 B;  4ELQ A;  2DXR A;  2QRY A;  2H4I A;  5IAI A;  3S2V A;  3V5A A;  5JK4 A;  4ESW A;  1J1N A;  1IUD A;  4R6K A;  1IIT A;  1B3H A;  3KZG A;  4FJP A;  2GFE A;  3IB0 A;  1AIV A;  1MQD A;  2DYX A;  3BFU A;  2PT1 A;  4JSD A;  2B65 A;  4NF6 A;  1S50 A;  1IQ7 A;  5DT6 A;  2OCU A;  4IGT A;  1MXY A;  4OFJ A;  1FQC A;  2Q9T A;  4LVQ A;  4ELP A;  2PT2 A;  3K2D A;  4U4X A;  3SEU A;  3PGF A;  1MXV A;  1R9Q A;  1ZIU A;  3OO7 A;  4R9G A;  1R6Z A;  1EH3 A;  1VFD A;  2HAU A;  1SYH A;  1PC3 A;  3MPK A;  4GIZ A;  4MFI A;  5DTB A;  5TPA A;  2CMO A;  3M3F A;  4NWD A;  3FV1 A;  4RA1 A;  3WAF A;  3O29 A;  4R75 A;  4HW8 A;  4AB5 A;  1OVT A;  5EHS A;  4F22 A;  5ICQ A;  4OFO A;  2VD2 A;  4QSE A;  2HAV A;  5CMK A;  4POX A;  3EN3 A;  2KLF A;  4GOT A;  4YKP A;  5H8F A;  3EF7 A;  1ANF A;  4NF6 B;  4R6Y A;  4U1O A;  2QMW A;  4LQ5 A;  3TZA A;  2W7Y A;  3ONM A;  2QS4 A;  4C1U A;  1ZJL A;  2I3W A;  3T9H B;  1LFH A;  3VXB A;  1AH5 A;  1IXI A;  5I56 B;  3M3K A;  3MVZ A;  1FTL A;  3IJO B;  3TQL A;  5I58 B;  3DEL B;  4MBP A;  4HTG A;  4YU0 A;  2V93 A;  3FD3 A;  4G68 A;  2IEE A;  2VOZ A;  2YPN A;  1FTO A;  4PFU A;  1B9J A;  3CSB A;  3RTF B;  5ICT A;  4XKN A;  2XX9 A;  1XOC A;  2UXA A;  2YJP A;  4GF8 A;  1WDN A;  3USD A;  3PUZ E;  5CC2 A;  5B7D A;  2I4B A;  4ND9 A;  4OMB A;  5TP9 A;  1AL3 A;  1A55 A;  1B2H A;  2REJ A;  2I0C A;  3IJX B;  4G68 C;  3SEY A;  1JEU A;  2M8C A;  1N84 A;  4EUO A;  4ZED A;  4DIG A;  1HSL A;  1B6H A;  4KHZ E;  2D21 A;  1LFG A;  1MQJ A;  3O66 A;  2QSX A;  1QJM A;  1LB8 A;  1VSO A;  3MZB A;  4QFL A;  4WED A;  1H43 A;  4YKK A;  3H6W A;  4DDD A;  5BUU A;  1MPB A;  1TT1 A;  4I8C A;  1OLC A;  4G4P A;  1UQW A;  4GD5 A;  1AOV A;  3PD8 A;  4YB6 A;  4WEP A;  1A8E A;  3CG3 A;  2ONS A;  4NF5 B;  1ZLQ A;  2V3T A;  4KFQ A;  3VVD A;  1FTJ A;  4OQO A;  5H8Q A;  3TCF A;  4X1B A;  4ZDM A;  3W9V A;  1B5I A;  1JEV A;  3C35 A;  3KJT A;  1N0T A;  4H0W A;  1EZ9 A;  5H8F B;  4O3B A;  3TMG A;  1B52 A;  2DXY A;  1I6Q A;  4NMY A;  1URD A;  4G8M A;  3ILT B;  4HCW A;  1IIW A;  5JEI A;  1FTK A;  1XS5 A;  1FW0 A;  3MW0 A;  5H8Q B;  1P1N A;  3U8Q A;  4XXU A;  4OTE A;  1URS A;  2XXT A;  4O3C A;  3E13 X;  3I3V A;  4KCD A;  4YMB A;  4ZZE A;  2XXI A;  3CG1 A;  2X7P A;  1LB9 A;  5TU0 A;  3TFL A;  1DTG A;  2DS9 A;  1DSN A;  2NXO A;  1MM7 A;  4KYS A;  2PBW A;  1LAX A;  4PFW A;  3T66 A;  1LLS A;  3TQW A;  2HZL A;  1B58 A;  3Q28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...