4IO7A

Crystal structure of the avglur1 ligand binding domain complex with phenylalanine at 1.9 angstrom resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
248
structure length
244
Chain Sequence
b'GSARLKGITLRIGVIESVPFTIVANVIRNTTKLTGYVLDLIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKKKWFQTKACP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AvGluR1 ligand binding domain
publication title Anions Mediate Ligand Binding in Adineta vaga Glutamate Receptor Ion Channels.
pubmed doi rcsb
source organism Adineta vaga
molecule tags Membrane protein
total genus 76
structure length 244
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io7A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io7A02
3D4CA 4PP0A 4QRZA 3G3GA 4DDDA 3IAZA 3MBPA 2RF1A 3RTWB 1XVYA 4OYVA 3MVXA 1AL3A 1B5JA 3IJXB 4HS7A 4OEUA 4XKQA 1N0TA 3Q25A 3USDA 2O1MA 3PGFA 1SW4A 3GZGA 5KDTA 1B46A 3G3HA 2FYIA 1AOVA 2RCAA 1VSOA 1MH4A 1Y3PA 1JW5A 3SERA 1UTHB 3Q27A 3MWBA 1Y4TA 4LZ5A 4TOZA 2O68A 1LCFA 2ZXTA 4OVJA 2REJA 1RKMA 3ZSFA 4QFNA 3M8UA 1RYOA 3IB2A 1OIBA 4LATA 3FD3A 5AA2B 1B3HA 3KOTA 4KHZE 3CSBA 4OESA 2F97A 3OSQA 1JQFA 3I3VA 3GXAA 2QPQA 3FVGA 2F5XA 3TTKA 3S9LC 2F36A 5CMBA 3TPAA 4R74A 4IO6A 1LFIA 5CI5A 3SESA 5IAIA 1YAEA 5AA4A 2XXUA 1B2HA 1IXHA 1PBQA 2A5SA 4KQPA 1QVSA 1MY1A 4ZZEA 1P1QA 1B32A 4KCDA 1P1NA 1HSEA 3GLBA 4ZEFA 2E1SA 4JWOA 3UP9A 2I48A 4FATA 2FA7A 3ILUB 2XX9A 1VFDA 1FQAA 1PB8A 2CMOA 4JWYA 5JTYA 5B7DA 2VD3A 1D3KA 4GIZA 4P11A 3RQTA 5K2YA 4GL8A 3K1NA 1ZMGA 1YTVA 5CRYA 1ZBMA 3O97A 1LSTA 3C34A 1N3XA 2GHAA 3PUZE 4DE8A 3B6QA 4PFTA 3RUMA 2CZLA 4GL0A 3C33A 4EF2A 4IO5A 2V84A 1MDP1 3H7MA 4ZEKA 3VE1B 3UGWA 3ZKLA 4G68A 1PB9A 1JEUA 1MY3A 3U1OA 4MLVA 1N04A 4F31B 3GBBA 1FTLA 3CSGA 2XXRA 5ELVA 1EH3A 4FAJA 2NVUB 2BJJX 2QL3A 2F8DA 3IO6A 1T0KA 2QRYA 3T93B 1SD3A 5BUUA 3PUVE 1B1XA 2DWJA 3HV1A 1B7HA 1MQHA 2WKYA 1B58A 4YMAA 2H9BA 1NH7A 2HAVA 1FQCA 3EQ1A 3PPRA 3Q29A 4GFRA 4NEDA 3HPIA 3JYRA 1B7UA 2XXVA 3DP6A 2PVUA 4KFQA 2M8CA 4QF9A 2V3UA 2HZLA 4F29A 2XXHA 3FUZA 3PUXE 2Q8JA 4O3AA 4L17A 4PFUA 3FV2A 1A40A 1Z7NE 3K01A 5I2NA 4GF8A 1I6QA 5I59A 3FXQA 4LONB 4JSDA 4NF8A 4DCXA 4R75A 2Y84A 1FTKA 3TCFA 3M3LA 4R9GA 2UYEA 4IY6A 4ZDMA 4EQ9A 2ZNTA 1FW0A 5TP9A 2XXPA 2I0CA 3VXBA 4H1XA 2DXRA 3ODBA 1LAXA 3FXUA 4JBZA 2HZKA 4F3BA 4ELQA 3MUQA 1LFHA 2O7IA 5FTHA 3K1PA 1H76A 3I5OA 3CFXA 1OLCA 3KJTA 4POXA 5F7VA 2DSFA 2VOZA 2YPNA 4BDNA 4DIGA 3MP6A 2OWTA 3TYHA 4M4GA 1A54A 3H6VA 4LZ8A 3THIA 1H3DA 2B3BA 1OVTA 3PV0E 1NNTA 3MVZA 1B4HA 4NF6A 4JXIA 1A8EA 3O29A 1PBPA 4PE5B 1H44A 4GRKA 2VD2A 4TLLB 1DMBA 2F6GA 3RTFB 1B6HA 2NXOA 4IGTA 5ITOA 3TELA 4NWCA 4ZE9A 1MXZA 4IY5A 3PPQA 4DCYA 2OK2A 3IX1A 1KWHA 5H8FA 2V3TA 5LOMA 5EHSA 2ONKE 2P0SA 3HN0A 1P99A 2Z8DA 4U4SA 4X48A 1Y3NA 1LB8A 2ABHA 5AA1A 4C1TA 1IXGA 3U93A 1II5A 4Q0CA 4MF3A 4YKKA 4BDRA 4EUOA 1Y1MA 4OEVA 5K2XA 4F2QA 4LUBA 3FVOA 2I58A 3UORA 3C32A 4HCWA 5H8SA 1SI1A 5TPAB 1ZTYA 3SEUA 1IUDA 4Q8RA 3KSXA 4DXBA 1NNKA 5L9SA 4MFIA 4P0IA 1MRPA 3TQLA 2UVIA 3M3FA 1NNPA 2QS4A 4EQBA 3M3KA 5ICQA 1ATGA 2Y7IA 1OQGA 1R6ZA 1MXXA 1D4NA 1NH8A 1UTBA 2XXXA 2GH9A 2XXWA 3K0VA 1GVCA 1IZ1A 3CI8A 1B1HA 2ZYKA 3TAJA 3OD7A 5I2KB 1QKBA 1MY4A 3QUJA 5DEXB 3BFUA 1B3EA 1US4A 2Q88A 3R26A 4TLMB 4YKIA 3RY3A 4RYAA 2GRVA 3CIJA 3VXCA 2OCUA 3T96B 3TEPA 2NOOA 3G7WA 1OMPA 3TMGA 2V93A 4KYSA 3KEIA 2IA4A 3VDFA 3PMXA 2PX1A 3FASA 3VFJA 3MVWA 3N6UA 2F78A 3O6HA 2NUVA 3MZ9A 1N76A 5H8HA 4YICA 2DE2A 2X7PA 2YJPA 2HEUA 5KDTB 5ICTA 2DOJA 3PPPA 3E4RA 1L5TA 1AMFA 2AIXA 2G29A 1TT1A 3S2VA 5HBCA 1JEVA 5A5XA 4GWOA 4R2FA 1XT8A 3W9WA 2DE3A 2HCAA 2DXYA 1GR2A 3KN3A 4NWDA 3L6GA 2X7QA 3BKIB 3PD8A 4DLDA 2V3QA 1DPEA 1Y3QA 2F6PA 1B5HA 4I9DA 1M5EA 4LP2B 1POY1 4EF1A 4FIMA 4G8NA 4H65A 1Y4CA 4PFYA 2O51A 1CB6A 4IO2A 4GOTA 4H8IA 3EHUA 3FJGA 2XD2A 2B65A 3PD9A 3MJNA 1S9TA 1MXYA 2ONSA 4FE8A 2DYXA 2I6EA 3O6GA 4OHNA 1FTMA 3H6TA 4K3FA 4IO4A 1B05A 5AA4B 2ALUA 4KPTA 3KN7A 4RNSA 5H8QA 4C0RA 3K1MA 3LSLA 1ZLQA 1IITA 3H06B 4RPNA 4E0XA 4X9TA 3TCGA 4M1VA 2D5WA 5ISUA 4DXCA 4F1VA 1Y9UA 1DPPA 5EYFA 5FHMA 1JETA 4UA8A 3TFLA 1A55A 4OERA 2Q89A 4H0WA 3TTMA 2R6GE 5JTYB 4ZECA 2DWIA 2H4IA 1XC1A 1N84A 3DELB 4F3GA 1YPNA 4GLIA 4MBPA 3N26A 1UTHA 4MLQA 1QKAA 1GGGA 3LSFB 2R71A 1FQBA 3FVNA 2PBWA 1F9BA 4THIA 5I58B 4R6YA 4R72A 3T9XB 2PT2A 4QFLA 1XVXA 4R73A 5AA2A 2UYFA 4UACA 4F3SA 1N7WA 3C9HA 1MQGA 1US5A 4WXJA 1R1NA 1FTOA 4NF5A 3V89B 2A5TA 3HHGA 3K4UA 2F34A 2ESNA 5HM4B 3QAXA 1MH3A 4MH5A 4ELPA 1BLFA 1FQFA 5H8NB 2H5YA 4KYDA 2UVJA 1MDQA 2Y7RA 1EZPA 5I57B 1SW5A 3SEXA 1QUIA 1SI0A 1M5BA 4FEBA 1HSJA 3G3IA 3LSXA 4ESXA 1POTA 1SBPA 4OFJA 2I4CA 4R6HA 1URSA 3O6IA 2H25A 2QMXA 4Q5TA 1URGA 3UIFA 5I56A 2RC7A 1MQDA 1MQJA 1S50A 2UXAA 2XXYA 4YZZA 4RXLA 1IIWA 4XTCQ 4C1UA 2QS2A 3D4GA 3EHTA 1J1NA 1LBCA 3FATA 1EZOA 4AB6A 1VR5A 3IL1B 4ZE8A 3PPNA 3MAMA 3TUSA 3K02A 1IXCA 1P1OA 2ZNSA 4NF4B 3G3FA 1JVYA 3U8QA 3R7XA 1ZIUA 4OENA 3VVDA 3FJ7A 3S9MC 5TU0A 4AB5A 4U1OA 3H6UA 4HTGA 2AL5A 1JNFA 3RT8A 2B3FA 2I0BA 3OO9A 3BFTA 3PMVA 2DQVA 4OFLA 1DTZA 1PDAA 1B3GA 1MS7A 2QJEA 1M5FA 3MW0A 3CFZA 2P2AA 2QS1A 2QMWA 4F1UA 1B0LA 1RYXA 2HQ0A 3FVKA 1MY0A 4NF6B 3V8XB 4ZEDA 2R9JA 1OLAA 3MPKA 3S9NC 3HHFA 3IB1A 2PT1A 3C31A 3N94A 3ZKKA 2XX7A 4TQUQ 4RK9A 2O84X 4POWA 3TTLA 1BIYA 1ZU0A 3IOUA 3V83A 1Y20A 2REGA 4H5GA 5CM6A 5DVIA 4H8JA 4OQOA 2XD3A 1DOTA 4YB7A 2Y7PA 3T9UA 2E0SA 1FQDA 2OBGA 1B7ZA 1DTGA 4QFKA 2DVCA 3QK6A 3CR9A 3FZVA 2PMSA 2XX8A 3IJOB 4WEPA 4RK2A 2P1SA 2X26A 1ANFA 3MVYA 1IQ7A 5JEIA 3LBSA 1UTBB 3KGCA 4G4PA 1FTJA 2YLNA 1B0HA 4G2ZA 1MPBA 3LC8A 4ZEBA 3TODA 5HPQA 3Q26A 4EXKA 2I4BA 3KOSA 1UIVA 4BDQA 3PUWE 5BWJA 3TQWA 3OENA 4PQJA 3B6WA 4I62A 5AA3A 3IORA 5CMKA 4ZEIA 4E0WA 4U4XA 4ELRA 4PFWA 5F1QA 1R9LA 4YB5A 2QSXA 5KCJB 1M5DA 1IEJA 2ONRA 1SDXA 1ZJLA 2V25A 1WVJA 3R6UA 2I49A 3U92A 3V5AA 3PPOA 5AA2D 1XHYA 3O28A 3K2DA 2H98A 3E9XA 1QJMA 1QUJA 3L6HA 4U23A 1JVXA 3K6WA 1MG1A 1MXWA 5A5XB 3T9HB 1A8FA 4ND9A 5CMCA 2HXWA 4F39A 3CG3A 1SVXB 1FCKA 1DSNA 2VGQA 3LUYA 1VFEA 3U72A 4GQOA 4ELOA 1Q1KA 5DYHA 3E13X 3K6VA 2AYSA 3KFMA 3BBRA 5I2KA 4H6DA 5L9OA 3OXNA 4ECFA 3LR1A 5DEXA 4RA1A 1BKAA 3VLWA 1NL5A 3IOWA 2UVHA 1N7XA 3VLVA 3GBAA 4G68C 5EHMA 1UQWA 1ZKBA 4EDPA 2DWHA 1B51A 3CVGA 3PU5A 4YMBA 4KCCA 4XXUA 1TXFA 1MM7A 2HFBA 4X1BA 1MQIA 4OXVA 3IR1A 3B7DA 5I84A 1OVBA 3TCHA 3FIRA 1I6BA 4KYEA 2RCBA 3EF7A 2VP1A 2I3VA 1LBBA 1Q35A 1PB7A 3H6WA 3A09A 3TTNA 4OTEA 1GV8A 4RY1A 2AL4A 2Q2CA 3W15C 4ZS9A 3QIMA 3EPEA 4XKPA 4X1DA 4XKNA 4O3CA 4I8CA 4NTLA 5DVFA 4Z0IA 3O66A 4NF5B 1WDNA 2A5TB 1H43A 4GVOA 3IK6B 3JZJA 1P1UA 1S7YA 2Z23A 5IKBA 3RPWA 4EXLA 1QW0A 3P7IA 2RINA 1B3FA 3A3CA 3TZAA 2F7BA 2Q2AA 3PMWA 3QYTA 5CC2A 3T22A 3T66A 1MPDA 4RPOA 1LAHE 3W9VA 1EZ9A 4BDOA 4XKRA 4FECA 4KI0E 4R6KA 2LAOA 3OO7A 3N6TA 1O64A 4O3BA 2XXIA 3HCQA 4IGRA 3DP8A 4F22A 2KLFA 4R9FA 4GXAA 4G68B 3SEYA 2XXTA 3MP1A 2QS3A 5I56B 3IOTA 3O2AA 2Q9TA 4N07A 3Q28A 3C35A 3AXFA 3RN8A 3EN3A 3KG2A 4G8MA 1ELJA 2GHBA 4FEDA 3FV1A 5B70A 2ZYOA 5CBRA 1TWYA 4PETA 5I58A 1GTKA 2HAUA 2I3WA 2O7UA 1MPCA 2OZZA 3IOVA 1QULA 4OFOA 5DVJA 2DS9A 4I1DA 3H3GA 3ILTB 2RKMA 3QSLA 4F18A 4LZ7A 2Z22A 1PEBA 4KD5A 1B5IA 3U94A 1B52A 2Y7WA 1LAFE 1B3LA 4F1YA 3K6UA 1TFAA 2F35A 5H8NA 1SYHA 5I2NB 5I57A 1OQHA 1WODA 5KZTA 4NE4A 5I59B 2O6AA 5CBSA 3RNNA 4P0GA 1AIVA 4NF8B 1MM6A 4KR5A 1YCJA 2PYYA 3MZ1A 4YU0A 2XXQA 4U22A 4ONYA 3PUYE 2OWSA 5TP9B 1CE2A 3HSTA 1O63A 3MP8A 1XOCA 1XS5A 3S9EA 4R2BA 4IB2A 2VHAA 2DE4A 4N13A 2OJTA 3N5LA 1MXUA 1A99A 4HCYA 3TTRA 1Y1ZA 2DP8A 3FXRA 1Z7ME 1I69A 4AQ4A 3RGYA 4F19A 4F2OA 1LCTA 1JW4A 1N3WA 5DT6A 3TKDA 2O69A 4NF4A 4WKMA 3KBRA 1USYE 3SKPA 3MPLA 3SDFA 3KN8A 4EQ7A 1FQEA 4QFPA 3FGSA 4GD5A 3RT6B 4OWDA 5ITPA 3ONMA 2ZMBA 1SQYA 3OEMA 2Z8FA 4U1ZA 1D9VA 1P1WA 1NFTA 4YAHX 2F7CA 3CG1A 5JK4A 2ZYNA 2GFEA 5H8FB 2F7AA 2DWAA 4F3PA 3G3JA 4IO7A 4H67A 1MXVA 4ESWA 1I6AA 3SEWA 4OZ9A 1QUKA 1EU8A 2FNCA 2W7YA 3E3KA 3IO4A 1AH5A 3MC2A 3ECRA 5FHOA 1NNFA 4U21A 1O7TA 3VLUA 1SYIA 3SEVA 4LVQA 3DM0A 2OLBA 4JWXA 3CRBA 1D9YA 3EHSA 4HW8A 1JW1A 1LB9A 2THIA 5FTIA 3VV5A 1LAGE 1H45A 3SETA 4YB6A 5J1DA 2H99A 3O9PA 3C36A 3OSRA 3I6VA 4WEDA 3MQ9A 4GXSB 3B6TA 3OEKA 4QFOA 4QSCA 4LQ2A 4H5FA 3A3UA 4LQ5A 4G8HA 1B4ZA 3OELA 1BTJA 4Z7EA 3IB0A 3TDJA 1IXIA 4BDLA 4YKPA 1R9QA 1A7LA 2ZNUA 1USYH 2ZYMA 3S4UA 2Y7KA 4XIGQ 3VVFA 3G3KA 1LLSA 1SW1A 3ZS6A 3QXMA 4DZ1A 4OETA 4U2RA 5AE4A 1B9JA 3T9VA 3JV9A 3KZGA 2RC9A 2RC8A 4LA9A 4JB7A 3OO6A 3UK4A 3MZBA 3K6XA 2XHDA 3OOAA 5DTBA 1URDA 3KSJA 4QSDA 5H8HB 1BP5A 2Z8EA 2DVZA 5CMMA 3OMBA 2NWJA 4JDFA 3H4ZA 4FORA 4N6PA 3K00A 5TPAA 2G93A 3UN6A 3F11A 3CFLA 3OO8A 1NKXA 2D3IA 2ANJA 1UIUA 3C4MA 5M2VA 1VE4A 5L8DA 2IEEA 3DP4A 4ISUA 2D21A 2UVGA 3DLNA 5L9MA 3HO7A 4RJZA 5FHNA 3WAEA 1PC3A 4ZZAA 1NMUA 3H03A 4QHQA 4FJPA 1B40A 3FJMA 4Q30B 3VVEA 1HSLA 3KJ7A 4BLAA 3LSWA 4JSOA 1LFGA 5KCJA 4BDMA 1M5CA 4NMYA 3RLFE 1LGBC 4G77A 4YKJA 3QUFA 2O1LA 4QSEA 4OMBA 3WAFA 5H8QB 4DXUA 1MY2A 1SW2A 3UA8A 1TFDA 4IO3A
chains in the Genus database with same CATH superfamily
3D4CA 4PP0A 4QRZA 3G3GA 4DDDA 3IAZA 3MBPA 2RF1A 3RTWB 1XVYA 4OYVA 3MVXA 1AL3A 1B5JA 3IJXB 4HS7A 4OEUA 4XKQA 1N0TA 3Q25A 3USDA 2O1MA 3PGFA 1SW4A 4OVQA 5I5PA 3GZGA 4GWXA 5KDTA 1B46A 3G3HA 2FYIA 1AOVA 2RCAA 1VSOA 1MH4A 1JW5A 1Y3PA 3SERA 1UTHB 3Q27A 3MWBA 4AS4A 3B50A 1Y4TA 4LZ5A 4TOZA 2O68A 1LCFA 2ZXTA 4OVJA 2REJA 1RKMA 3ZSFA 4QFNA 3M8UA 1RYOA 2GQ1A 2WBBA 3IB2A 1OIBA 4LATA 3FD3A 5AA2B 1B3HA 3KOTA 4KHZE 3CSBA 5ET6A 4OESA 2F97A 5EQ9A 3OSQA 1JQFA 4PFIA 3I3VA 3GXAA 1FPKA 2QPQA 5EYGA 3FVGA 2F5XA 3TTKA 3S9LC 2F36A 5CMBA 3TPAA 4R74A 5J16A 4IO6A 1LFIA 5CI5A 3SESA 4HE0A 5IAIA 1YAEA 4NG7A 5AA4A 4QBAA 2XXUA 1B2HA 1IXHA 1PBQA 1FPEA 2A5SA 4KQPA 1QVSA 1FRPA 1MY1A 4ZZEA 1P1QA 1B32A 4KCDA 1P1NA 1HSEA 3GLBA 4ZEFA 2E1SA 1VDWA 4DI3D 4JWOA 3UP9A 2I48A 4FATA 2FA7A 3ILUB 2WBDA 2XX9A 1VFDA 1FQAA 1PB8A 2CMOA 4JWYA 5JTYA 5B7DA 2VD3A 1D3KA 4GIZA 4N15A 4GWUA 4P11A 1FPDA 3RQTA 1NV2A 1K9YA 5K2YA 3FBPA 4FBPA 4GL8A 3K1NA 1ZMGA 1YTVA 5CRYA 1ZBMA 3O97A 1LSTA 4PAFA 4N8GA 3C34A 1N3XA 1IMCA 2GHAA 3PUZE 4DE8A 3B6QA 4PFTA 2FIXA 4PDHA 3RUMA 1NV5A 2CZLA 4GL0A 3C33A 4EF2A 4IO5A 2V84A 1MDP1 3H7MA 4ZEKA 3VE1B 3UGWA 3ZKLA 4G68A 1PB9A 1JEUA 1MY3A 3U1OA 4MLVA 1N04A 4F31B 3GBBA 1FTLA 2FVZA 3CSGA 2XXRA 5ELVA 2VPOA 1EH3A 4FAJA 2NVUB 2BJJX 2QL3A 2F8DA 3IO6A 4NF0A 1T0KA 2QRYA 3T93B 1SD3A 5BUUA 3PUVE 4MNIA 1B1XA 2DWJA 3HV1A 1B7HA 1MQHA 2WKYA 1B58A 4PBHA 4YMAA 2H9BA 1NH7A 2HAVA 1FQCA 3EQ1A 3PPRA 3Q29A 4NGUA 4GFRA 4NEDA 2QVUA 3HPIA 3JYRA 1B7UA 2XXVA 3DP6A 2PVUA 4KFQA 2ZZVA 2M8CA 4QF9A 2V3UA 2HZLA 1SPIA 2Y5KA 2XXHA 5EQ8A 4F29A 3FUZA 3PUXE 2Q8JA 4O3AA 4L17A 4PFUA 3FV2A 1A40A 1Z7NE 3K01A 5I2NA 4GF8A 1I6QA 5I59A 3FXQA 4LONB 4JSDA 4NF8A 4N6DA 4DCXA 2OWZA 2DDKA 4R75A 2Y84A 1K9ZA 1FTKA 3TCFA 3M3LA 4R9GA 2UYEA 4IY6A 4MAGA 4ZDMA 4EQ9A 2ZNTA 1FW0A 1IMEA 5TP9A 2XXPA 2I0CA 2PFYA 3VXBA 4H1XA 4GX3A 1LEVA 2DXRA 3ODBA 5IZZA 1LAXA 3FXUA 4GWWA 4JBZA 2HZKA 4F3BA 4ELQA 3MUQA 1LFHA 2O7IA 5FTHA 3K1PA 1H76A 3I5OA 3CFXA 1OLCA 3KJTA 1FSAA 4P47A 2Q74A 4POXA 5F7VA 2DSFA 2VOZA 2YPNA 4BDNA 1EYIA 4DIGA 4PAKA 3MP6A 4GWZA 2OWTA 4HXVA 3TYHA 4M4GA 5IGAA 1A54A 3H6VA 4LZ8A 3THIA 1H3DA 2B3BA 1OVTA 3PV0E 1NNTA 3MVZA 1B4HA 4NF6A 4JXIA 4H45A 1A8EA 3O29A 1KA1A 1PBPA 4PE5B 1H44A 4GRKA 2XWIA 2VD2A 2FHYA 4TLLB 1DMBA 2F6GA 3RTFB 1B6HA 2NXOA 4IGTA 5ITOA 3TELA 1IMBA 4NWCA 4ZE9A 1MXZA 4IY5A 3PPQA 4PFBA 1FPLA 4DCYA 2OK2A 3IX1A 2Q8MA 5EYHA 1KWHA 5H8FA 2WYKA 5ET7A 2V3TA 5LOMA 5EHSA 2ONKE 2P0SA 3HN0A 1P99A 2Z8DA 4U4SA 4X48A 1Y3NA 1LB8A 4G61A 2ABHA 5AA1A 3FXBA 4C1TA 1IXGA 3U93A 1II5A 4Q0CA 4MF3A 4YKKA 2FIEA 4BDRA 4EUOA 1Y1MA 2MKZA 4OEVA 5K2XA 4F2QA 4LUBA 4GWYA 3FVOA 4N91A 2I58A 3UORA 3C32A 4HCWA 5H8SA 1SI1A 5TPAB 1ZTYA 3SEUA 1IUDA 3RPLB 4Q8RA 3KSXA 4DXBA 2WEFA 1NNKA 5L9SA 4MFIA 4P0IA 1MRPA 3IFCA 3TQLA 2UVIA 1LBVA 3M3FA 1NNPA 2QS4A 4N8YA 4EQBA 3M3KA 5ICQA 1ATGA 2Y7IA 1OQGA 1R6ZA 1MXXA 1D4NA 1NH8A 1UTBA 2XXXA 2XWKA 2GH9A 2XXWA 3K0VA 1GVCA 1IZ1A 3CI8A 1B1HA 2ZYKA 4OVRA 3TAJA 3OD7A 5I2KB 1QKBA 1MY4A 3QUJA 4O8MA 5LDZA 5DEXB 3BFUA 1B3EA 1RDXA 1US4A 2Q88A 3R26A 4TLMB 4MMPA 4YKIA 3RY3A 4RYAA 2GRVA 3CIJA 3VXCA 2B4MA 2OCUA 3T96B 3TEPA 2NOOA 3G7WA 1OMPA 4MX6A 3TMGA 2V93A 4KYSA 3KEIA 4NHBA 2IA4A 5I7IA 3VDFA 1D9QA 3PMXA 5IM2A 2PX1A 4PF8A 3FASA 3VFJA 3MVWA 3N6UA 2F78A 3O6HA 2NUVA 3MZ9A 1N76A 1YYZA 5H8HA 4YICA 2HPGA 2DE2A 2X7PA 2YJPA 3T1BA 2HEUA 5KDTB 5ICTA 2DOJA 3PPPA 3E4RA 1L5TA 1AMFA 2XA5A 2AIXA 2ZZWA 2G29A 1TT1A 3S2VA 5HBCA 1JEVA 5A5XA 4GWOA 4PCDA 1XT8A 4R2FA 3W9WA 3RYDA 1FPGA 2DE3A 2HCAA 2DXYA 1GR2A 3KN3A 3QMFA 4NWDA 3L6GA 4OVTA 1NUXA 2X7QA 3SZPA 3BKIB 3PD8A 4DLDA 2V3QA 3MYUA 1DPEA 1Y3QA 2F6PA 1B5HA 4I9DA 1M5EA 4JVDA 4PF6A 5IZ3A 4LP2B 2QVRA 2WX9A 1POY1 4EF1A 4FIMA 4G8NA 4H65A 3T0JA 1Y4CA 1NV0A 4PFYA 2O51A 1CB6A 4IO2A 4PGNA 3IFAA 4GOTA 4H8IA 3EHUA 3FJGA 2CZHA 2XD2A 2B65A 3PD9A 3MJNA 1S9TA 4NX1A 1MXYA 2ONSA 4FE8A 2DYXA 1NV7A 2I6EA 3O6GA 4OHNA 1FTMA 3H6TA 4K3FA 4IO4A 1B05A 1IMDA 5AA4B 2ALUA 2OX3A 4KPTA 3KN7A 4RNSA 5H8QA 2VPNA 4C0RA 3K1MA 3LSLA 1ZLQA 1IITA 3H06B 4RPNA 4E0XA 4X9TA 3TCGA 4M1VA 2D5WA 4MIJA 4DXCA 4F1VA 5ISUA 1DPPA 1Y9UA 5EYFA 5FHMA 1JETA 4UA8A 3TFLA 1A55A 4OERA 2Q89A 4H0WA 3TTMA 2R6GE 3PTYA 5JTYB 4ZECA 2DWIA 2H4IA 1XC1A 1N84A 3DELB 4P1LA 4F3GA 1YPNA 4GLIA 4MNPA 4MBPA 3N26A 1UTHA 1KZ8A 5F24A 4MLQA 1QKAA 1NV3A 1GGGA 3LSFB 2R71A 1FQBA 4NQ8A 3FVNA 2PBWA 1F9BA 4JVIA 4THIA 5I58B 4R6YA 4R72A 3T9XB 2PT2A 4QFLA 4PAIA 1XVXA 4R73A 5AA2A 1IMAA 2UYFA 4UACA 3KC0A 1AWBA 4I3EA 4F3SA 3LUZA 1N7WA 3C9HA 1MQGA 1US5A 4WXJA 1R1NA 1FTOA 2PCRA 4NF5A 3V89B 2A5TA 3HHGA 5I3SA 3K4UA 2F34A 2ESNA 5HM4B 1G0IA 3QAXA 1MH3A 4MH5A 4ELPA 1BLFA 1FQFA 5H8NB 2H5YA 4KYDA 2UVJA 1MDQA 2Y7RA 1EZPA 5I57B 1SW5A 2JJKA 3SEXA 1QUIA 1SI0A 1M5BA 4FEBA 1HSJA 3G3IA 3LSXA 4ESXA 2F3BA 1POTA 1SBPA 4OFJA 2I4CA 4R6HA 1URSA 3O6IA 5DW8A 2H25A 2QMXA 4Q5TA 4MCOA 1URGA 3UIFA 5I56A 2RC7A 1MQDA 1MQJA 1S50A 2UXAA 4QXDA 5EQAA 1G0HA 2XXYA 2HHMA 4N81A 4YZZA 4RXLA 1IIWA 4XTCQ 4C1UA 2QS2A 3D4GA 3EHTA 1J1NA 1LBCA 3FATA 1EZOA 4AB6A 3ISPA 1VR5A 3IL1B 1FBPA 3KC1A 4ZE8A 3PPNA 3MAMA 3TUSA 3K02A 1IXCA 1P1OA 2ZNSA 4NF4B 4O94A 3G3FA 2KQZA 1JVYA 3U8QA 3R7XA 1ZIUA 4OENA 3VVDA 3FJ7A 3S9MC 5TU0A 2P3NA 4AB5A 4OANA 4U1OA 3H6UA 4HTGA 2AL5A 1JNFA 3RT8A 2B3FA 2I0BA 3OO9A 4OVPA 3BFTA 5ET5A 4N17A 3PMVA 2DQVA 4OFLA 1DTZA 1KA0A 1PDAA 1B3GA 4O7MA 1MS7A 2QJEA 1M5FA 4PBQA 3MW0A 3CFZA 2P2AA 2QS1A 2QMWA 1QGXA 4F1UA 1B0LA 1RYXA 4N4UA 1FPIA 2HQ0A 3FVKA 3D1RA 1MY0A 3E79A 4NF6B 3V8XB 4O7IA 4ZEDA 2R9JA 5ESYA 1OLAA 3MPKA 3S9NC 3HHFA 2P3VA 3IB1A 2PT1A 3C31A 3N94A 3ZKKA 3KBZA 2XX7A 4TQUQ 4RK9A 4GX4A 2O84X 1RDYA 4POWA 3TTLA 1BIYA 1ZU0A 3IOUA 3V83A 1Y20A 2REGA 4H5GA 5CM6A 5DVIA 4H8JA 4GBWA 4OQOA 2XD3A 1DOTA 4YB7A 2Y7PA 3T9UA 4XFEA 2E0SA 2V4CA 3MSTA 1FQDA 4NN3A 2OBGA 1B7ZA 1DTGA 4QFKA 2DVCA 4PC9A 3QK6A 3CR9A 4MNCA 1FJ9A 3U65A 3FZVA 2PMSA 2XX8A 3IJOB 4WEPA 4RK2A 4I40A 1NI9A 2P1SA 4P8BA 2X26A 1ANFA 3MVYA 1IQ7A 5JEIA 3LBSA 1UTBB 3KGCA 4G4PA 1FTJA 2YLNA 1B0HA 4G2ZA 1MPBA 3LC8A 4ZEBA 4GX6A 3TODA 5HPQA 3Q26A 4EXKA 2I4BA 1FBCA 3KOSA 1LBZA 4GBVA 1UIVA 4BDQA 3PUWE 5BWJA 3TQWA 4I3YA 1FBGA 3OENA 1FBFA 4PQJA 3B6WA 4I62A 5AA3A 3IORA 5CMKA 4ZEIA 4E0WA 4U4XA 1JP4A 4ELRA 4PFWA 5F1QA 1R9LA 4YB5A 2QSXA 5KCJB 1NV4A 1M5DA 1IEJA 2ONRA 1SDXA 1ZJLA 1YZ0A 2V25A 1WVJA 3R6UA 2I49A 5FBPA 3U92A 3V5AA 3PPOA 3CHGA 5AA2D 1XHYA 3O28A 3K2DA 2H98A 3E9XA 1QJMA 1QUJA 3RPLA 3L6HA 4U23A 1JVXA 3K6WA 1MG1A 1MXWA 5A5XB 3T9HB 1A8FA 2Y5LA 3HFUA 4ND9A 5CMCA 2HXWA 4X04A 4F39A 3CG3A 1SVXB 1FCKA 1DSNA 2VGQA 3LUYA 1VFEA 3U72A 4GQOA 4ELOA 1Q1KA 4JVCA 5DYHA 3E13X 3K6VA 1NV1A 2AYSA 3KFMA 2HXRA 3BBRA 2FBPA 5I2KA 4H6DA 5L9OA 3OXNA 4ECFA 3LR1A 4LN5A 5DEXA 4RA1A 1BKAA 3VLWA 1NL5A 3IOWA 2UVHA 1N7XA 3VLVA 3GBAA 4G68C 5EHMA 1UQWA 1ZKBA 3BIGA 4EDPA 2DWHA 1B51A 4OA4A 3CVGA 3PU5A 4YMBA 4KCCA 4XXUA 1TXFA 1MM7A 1RDZA 2HFBA 4X1BA 1MQIA 4OXVA 3IR1A 3B7DA 5I84A 3ROJA 1OVBA 3TCHA 2F3DA 4PGPA 1FPFA 3FIRA 1EYKA 1I6BA 4KYEA 2RCBA 3EF7A 2VP1A 2I3VA 1LBBA 1Q35A 1PB7A 3H6WA 3A09A 3TTNA 4OTEA 1GV8A 4RY1A 2AL4A 5T3JA 2Q2CA 3W15C 3E78A 4ZS9A 3QIMA 3EPEA 4PTKA 4XKPA 4X1DA 4DI4B 4XKNA 4O3CA 4I8CA 4NTLA 5DVFA 4Z0IA 4HE2A 3O66A 4NF5B 1WDNA 2A5TB 1H43A 4GVOA 3IK6B 3JZJA 1P1UA 2CZIA 1S7YA 2Z23A 5IKBA 3RPWA 4EXLA 1QW0A 3P7IA 2RINA 1B3FA 4PDDA 3A3CA 3TZAA 2F7BA 2Q2AA 3A29A 3PMWA 3QYTA 5CC2A 3T22A 3T66A 1MPDA 4RPOA 1LAHE 3W9VA 1EZ9A 4BDOA 4XKRA 4FECA 4PFRA 4KI0E 4R6KA 2LAOA 3OO7A 3N6TA 1O64A 4O3BA 2QVVA 2XXIA 3HCQA 4IGRA 3DP8A 4F22A 2KLFA 1Q9DA 4R9FA 4GXAA 4G68B 3SEYA 2XXTA 3MP1A 2QS3A 5I56B 1IMFA 3IOTA 1LBXA 3O2AA 2Q9TA 4N07A 3Q28A 3C35A 4P1EA 3AXFA 3RN8A 2CEYA 3EN3A 3KG2A 2XWOA 4XF5A 4G8MA 1ELJA 2GHBA 4FEDA 3FV1A 5IZ1A 5B70A 2ZYOA 2CZKA 2PFZA 5CBRA 1TWYA 4PETA 5I58A 1GTKA 2R8TA 2HAUA 2I3WA 2O7UA 4P3LA 1BK4A 1MPCA 2OZZA 3B8BA 3IOVA 1QULA 4OFOA 5DVJA 2DS9A 4I1DA 3LV0A 3H3GA 3ILTB 2RKMA 3QSLA 4F18A 4LZ7A 2Z22A 1PEBA 4KD5A 1B5IA 3U94A 1B52A 2Y7WA 1LAFE 1FBEA 1B3LA 4P9KA 4F1YA 3K6UA 1TFAA 2F35A 1LBWA 5H8NA 1SYHA 5I2NB 5I57A 1OQHA 1FPBA 1WODA 5KZTA 4NE4A 5I59B 2O6AA 5CBSA 4IR8A 3RNNA 4P0GA 1AIVA 4NF8B 1MM6A 4KR5A 1YCJA 2PYYA 1CNQA 3MZ1A 4YU0A 2XXQA 3BIHA 4U22A 4ONYA 3PUYE 2OWSA 5TP9B 1CE2A 3HSTA 1O63A 3MP8A 1XOCA 1XS5A 3S9EA 4R2BA 4IB2A 2VHAA 5LTCA 2DE4A 4N13A 2OJTA 4UABA 3N5LA 1MXUA 1A99A 4HCYA 3TTRA 1Y1ZA 2DP8A 3FXRA 1Z7ME 1I69A 4AQ4A 3RGYA 4F19A 4X8RA 4F2OA 1LCTA 1NUWA 1JW4A 1N3WA 3EKIA 5A5LA 1EYJA 5DT6A 1FBHA 3TKDA 1FTAA 2O69A 4NF4A 1INPA 4WKMA 3KBRA 1USYE 3SKPA 3MPLA 5EQ7A 3SDFA 3KN8A 4EQ7A 1FQEA 4QFPA 3FGSA 4GD5A 3RT6B 4OWDA 5ITPA 3ONMA 1FJ6A 2XWVA 2ZMBA 1SQYA 3OEMA 2Z8FA 4U1ZA 1D9VA 1DK4A 1P1WA 1NFTA 4YAHX 2F7CA 3CG1A 5JK4A 2ZYNA 2GFEA 5H8FB 2F7AA 2DWAA 4F3PA 3G3JA 4IO7A 4H67A 1MXVA 4ESWA 1FBDA 1I6AA 3SEWA 4OZ9A 1QUKA 1EU8A 2FNCA 2W7YA 3E3KA 4GWSA 4H46A 4PE3A 3IO4A 1AH5A 3MC2A 3ECRA 5FHOA 1NNFA 4U21A 1O7TA 3VLUA 1SYIA 3SEVA 4LVQA 3DM0A 2OLBA 4JWXA 1NUZA 3CRBA 1D9YA 3EHSA 4AS5A 4HW8A 1JW1A 1LB9A 2THIA 5FTIA 3VV5A 1LAGE 1H45A 3SETA 4YB6A 5J1DA 2H99A 3GYYA 3O9PA 3C36A 3OSRA 3I6VA 4WEDA 3MQ9A 2L5VA 4GXSB 3B6TA 3OEKA 4QFOA 4QSCA 4LQ2A 4H5FA 3A3UA 1NV6A 4LQ5A 2WYPA 4G8HA 1B4ZA 4P56A 3NOHA 3OELA 1BTJA 1LBYA 4Z7EA 3IB0A 3TDJA 1IXIA 4MJOA 4BDLA 4YKPA 1R9QA 1A7LA 2ZNUA 1USYH 2ZYMA 3S4UA 2Y7KA 4XIGQ 3VVFA 3G3KA 1LLSA 1SW1A 3ZS6A 3QXMA 4DZ1A 4OETA 4U2RA 5AE4A 1B9JA 3T9VA 1DCUA 3JV9A 3KZGA 2RC9A 2RC8A 1YXIA 4LA9A 4JB7A 3OO6A 3UK4A 3MZBA 3K6XA 2XHDA 3OOAA 5DTBA 1URDA 2VT5A 3KSJA 4QSDA 5H8HB 1BP5A 5ET8A 2Z8EA 2DVZA 5CMMA 3OMBA 2NWJA 4JDFA 4HE1A 3H4ZA 4FORA 4N6PA 3K00A 5TPAA 2G93A 3UN6A 3F11A 4MHFA 3CFLA 3OO8A 1NKXA 2D3IA 2ANJA 1UIUA 2B4LA 3C4MA 5M2VA 1DBZA 1VE4A 5L8DA 2IEEA 3DP4A 4ISUA 2D21A 2BJIA 2UVGA 3DLNA 5L9MA 3HO7A 4RJZA 5FHNA 3WAEA 2QFLA 4MEVA 1PC3A 4ZZAA 2XXKA 5IZ3B 1NMUA 3H03A 4QHQA 4FJPA 1B40A 3FJMA 4Q30B 3VVEA 1HSLA 2ZZXA 3KJ7A 4BLAA 3LSWA 4XEQA 4JSOA 1FPJA 1LFGA 4N6KA 5KCJA 4BDMA 1M5CA 1XI6A 1NUYA 4NMYA 3RLFE 1LGBC 2KR0A 4G77A 4YKJA 4OVSA 3QUFA 2O1LA 4KXPA 4QSEA 4OMBA 3WAFA 5H8QB 1MY2A 2CEXA 4DXUA 1SW2A 4NAPA 3UA8A 1TFDA 4IO3A
chains in the Genus database with same CATH topology
3D4CA 4PP0A 4QRZA 3G3GA 4DDDA 3IAZA 3MBPA 2RF1A 3RTWB 1XVYA 4OYVA 3MVXA 1AL3A 1B5JA 3IJXB 4HS7A 4OEUA 4XKQA 1N0TA 3Q25A 3USDA 2O1MA 3PGFA 1SW4A 3GZGA 5KDTA 1B46A 3G3HA 2FYIA 1AOVA 2RCAA 1VSOA 1MH4A 1Y3PA 1JW5A 3SERA 1UTHB 3Q27A 3MWBA 1Y4TA 4LZ5A 4TOZA 2O68A 1LCFA 2ZXTA 4OVJA 2REJA 1RKMA 3ZSFA 4QFNA 3M8UA 1RYOA 3IB2A 1OIBA 4LATA 3FD3A 5AA2B 1B3HA 3KOTA 4KHZE 3CSBA 4OESA 2F97A 3OSQA 1JQFA 3I3VA 3GXAA 2QPQA 3FVGA 2F5XA 3TTKA 3S9LC 2F36A 5CMBA 3TPAA 4R74A 4IO6A 1LFIA 5CI5A 3SESA 5IAIA 1YAEA 5AA4A 2XXUA 1B2HA 1IXHA 1PBQA 2A5SA 4KQPA 1QVSA 1MY1A 4ZZEA 1P1QA 1B32A 4KCDA 1P1NA 1HSEA 3GLBA 4ZEFA 2E1SA 4JWOA 3UP9A 2I48A 4FATA 2FA7A 3ILUB 2XX9A 1VFDA 1FQAA 1PB8A 2CMOA 4JWYA 5JTYA 5B7DA 2VD3A 1D3KA 4GIZA 4P11A 3RQTA 5K2YA 4GL8A 3K1NA 1ZMGA 1YTVA 5CRYA 1ZBMA 3O97A 1LSTA 3C34A 1N3XA 2GHAA 3PUZE 4DE8A 3B6QA 4PFTA 3RUMA 2CZLA 4GL0A 3C33A 4EF2A 4IO5A 2V84A 1MDP1 3H7MA 4ZEKA 3VE1B 3UGWA 3ZKLA 4G68A 1PB9A 1JEUA 1MY3A 3U1OA 4MLVA 1N04A 4F31B 3GBBA 1FTLA 3CSGA 2XXRA 5ELVA 1EH3A 4FAJA 2NVUB 2BJJX 2QL3A 2F8DA 3IO6A 1T0KA 2QRYA 3T93B 1SD3A 5BUUA 3PUVE 1B1XA 2DWJA 3HV1A 1B7HA 1MQHA 2WKYA 1B58A 4YMAA 2H9BA 1NH7A 2HAVA 1FQCA 3EQ1A 3PPRA 3Q29A 4GFRA 4NEDA 3HPIA 3JYRA 1B7UA 2XXVA 3DP6A 2PVUA 4KFQA 2M8CA 4QF9A 2V3UA 2HZLA 4F29A 2XXHA 3FUZA 3PUXE 2Q8JA 4O3AA 4L17A 4PFUA 3FV2A 1A40A 1Z7NE 3K01A 5I2NA 4GF8A 1I6QA 5I59A 3FXQA 4LONB 4JSDA 4NF8A 4DCXA 4R75A 2Y84A 1FTKA 3TCFA 3M3LA 4R9GA 2UYEA 4IY6A 4ZDMA 4EQ9A 2ZNTA 1FW0A 5TP9A 2XXPA 2I0CA 3VXBA 4H1XA 2DXRA 3ODBA 1LAXA 3FXUA 4JBZA 2HZKA 4F3BA 4ELQA 3MUQA 1LFHA 2O7IA 5FTHA 3K1PA 1H76A 3I5OA 3CFXA 1OLCA 3KJTA 4POXA 5F7VA 2DSFA 2VOZA 2YPNA 4BDNA 4DIGA 3MP6A 2OWTA 3TYHA 4M4GA 1A54A 3H6VA 4LZ8A 3THIA 1H3DA 2B3BA 1OVTA 3PV0E 1NNTA 3MVZA 1B4HA 4NF6A 4JXIA 1A8EA 3O29A 1PBPA 4PE5B 1H44A 4GRKA 2VD2A 4TLLB 1DMBA 2F6GA 3RTFB 1B6HA 2NXOA 4IGTA 5ITOA 3TELA 4NWCA 4ZE9A 1MXZA 4IY5A 3PPQA 4DCYA 2OK2A 3IX1A 1KWHA 5H8FA 2V3TA 5LOMA 5EHSA 2ONKE 2P0SA 3HN0A 1P99A 2Z8DA 4U4SA 4X48A 1Y3NA 1LB8A 2ABHA 5AA1A 4C1TA 1IXGA 3U93A 1II5A 4Q0CA 4MF3A 4YKKA 4BDRA 4EUOA 1Y1MA 4OEVA 5K2XA 4F2QA 4LUBA 3FVOA 2I58A 3UORA 3C32A 4HCWA 5H8SA 1SI1A 5TPAB 1ZTYA 3SEUA 1IUDA 4Q8RA 3KSXA 4DXBA 1NNKA 5L9SA 4MFIA 4P0IA 1MRPA 3TQLA 2UVIA 3M3FA 1NNPA 2QS4A 4EQBA 3M3KA 5ICQA 1ATGA 2Y7IA 1OQGA 1R6ZA 1MXXA 1D4NA 1NH8A 1UTBA 2XXXA 2GH9A 2XXWA 3K0VA 1GVCA 1IZ1A 3CI8A 1B1HA 2ZYKA 3TAJA 3OD7A 5I2KB 1QKBA 1MY4A 3QUJA 5DEXB 3BFUA 1B3EA 1US4A 2Q88A 3R26A 4TLMB 4YKIA 3RY3A 4RYAA 2GRVA 3CIJA 3VXCA 2OCUA 3T96B 3TEPA 2NOOA 3G7WA 1OMPA 3TMGA 2V93A 4KYSA 3KEIA 2IA4A 3VDFA 3PMXA 2PX1A 3FASA 3VFJA 3MVWA 3N6UA 2F78A 3O6HA 2NUVA 3MZ9A 1N76A 5H8HA 4YICA 2DE2A 2X7PA 2YJPA 2HEUA 5KDTB 5ICTA 2DOJA 3PPPA 3E4RA 1L5TA 1AMFA 2AIXA 2G29A 1TT1A 3S2VA 5HBCA 1JEVA 5A5XA 4GWOA 4R2FA 1XT8A 3W9WA 2DE3A 2HCAA 2DXYA 1GR2A 3KN3A 4NWDA 3L6GA 2X7QA 3BKIB 3PD8A 4DLDA 2V3QA 1DPEA 1Y3QA 2F6PA 1B5HA 4I9DA 1M5EA 4LP2B 1POY1 4EF1A 4FIMA 4G8NA 4H65A 1Y4CA 4PFYA 2O51A 1CB6A 4IO2A 4GOTA 4H8IA 3EHUA 3FJGA 2XD2A 2B65A 3PD9A 3MJNA 1S9TA 1MXYA 2ONSA 4FE8A 2DYXA 2I6EA 3O6GA 4OHNA 1FTMA 3H6TA 4K3FA 4IO4A 1B05A 5AA4B 2ALUA 4KPTA 3KN7A 4RNSA 5H8QA 4C0RA 3K1MA 3LSLA 1ZLQA 1IITA 3H06B 4RPNA 4E0XA 4X9TA 3TCGA 4M1VA 2D5WA 5ISUA 4DXCA 4F1VA 1Y9UA 1DPPA 5EYFA 5FHMA 1JETA 4UA8A 3TFLA 1A55A 4OERA 2Q89A 4H0WA 3TTMA 2R6GE 5JTYB 4ZECA 2DWIA 2H4IA 1XC1A 1N84A 3DELB 4F3GA 1YPNA 4GLIA 4MBPA 3N26A 1UTHA 4MLQA 1QKAA 1GGGA 3LSFB 2R71A 1FQBA 3FVNA 2PBWA 1F9BA 4THIA 5I58B 4R6YA 4R72A 3T9XB 2PT2A 4QFLA 1XVXA 4R73A 5AA2A 2UYFA 4UACA 4F3SA 1N7WA 3C9HA 1MQGA 1US5A 4WXJA 1R1NA 1FTOA 4NF5A 3V89B 2A5TA 3HHGA 3K4UA 2F34A 2ESNA 5HM4B 3QAXA 1MH3A 4MH5A 4ELPA 1BLFA 1FQFA 5H8NB 2H5YA 4KYDA 2UVJA 1MDQA 2Y7RA 1EZPA 5I57B 1SW5A 3SEXA 1QUIA 1SI0A 1M5BA 4FEBA 1HSJA 3G3IA 3LSXA 4ESXA 1POTA 1SBPA 4OFJA 2I4CA 4R6HA 1URSA 3O6IA 2H25A 2QMXA 4Q5TA 1URGA 3UIFA 5I56A 2RC7A 1MQDA 1MQJA 1S50A 2UXAA 2XXYA 4YZZA 4RXLA 1IIWA 4XTCQ 4C1UA 2QS2A 3D4GA 3EHTA 1J1NA 1LBCA 3FATA 1EZOA 4AB6A 1VR5A 3IL1B 4ZE8A 3PPNA 3MAMA 3TUSA 3K02A 1IXCA 1P1OA 2ZNSA 4NF4B 3G3FA 1JVYA 3U8QA 3R7XA 1ZIUA 4OENA 3VVDA 3FJ7A 3S9MC 5TU0A 4AB5A 4U1OA 3H6UA 4HTGA 2AL5A 1JNFA 3RT8A 2B3FA 2I0BA 3OO9A 3BFTA 3PMVA 2DQVA 4OFLA 1DTZA 1PDAA 1B3GA 1MS7A 2QJEA 1M5FA 3MW0A 3CFZA 2P2AA 2QS1A 2QMWA 4F1UA 1B0LA 1RYXA 2HQ0A 3FVKA 1MY0A 4NF6B 3V8XB 4ZEDA 2R9JA 1OLAA 3MPKA 3S9NC 3HHFA 3IB1A 2PT1A 3C31A 3N94A 3ZKKA 2XX7A 4TQUQ 4RK9A 2O84X 4POWA 3TTLA 1BIYA 1ZU0A 3IOUA 3V83A 1Y20A 2REGA 4H5GA 5CM6A 5DVIA 4H8JA 4OQOA 2XD3A 1DOTA 4YB7A 2Y7PA 3T9UA 2E0SA 1FQDA 2OBGA 1B7ZA 1DTGA 4QFKA 2DVCA 3QK6A 3CR9A 3FZVA 2PMSA 2XX8A 3IJOB 4WEPA 4RK2A 2P1SA 2X26A 1ANFA 3MVYA 1IQ7A 5JEIA 3LBSA 1UTBB 3KGCA 4G4PA 1FTJA 2YLNA 1B0HA 4G2ZA 1MPBA 3LC8A 4ZEBA 3TODA 5HPQA 3Q26A 4EXKA 2I4BA 3KOSA 1UIVA 4BDQA 3PUWE 5BWJA 3TQWA 3OENA 4PQJA 3B6WA 4I62A 5AA3A 3IORA 5CMKA 4ZEIA 4E0WA 4U4XA 4ELRA 4PFWA 5F1QA 1R9LA 4YB5A 2QSXA 5KCJB 1M5DA 1IEJA 2ONRA 1SDXA 1ZJLA 2V25A 1WVJA 3R6UA 2I49A 3U92A 3V5AA 3PPOA 5AA2D 1XHYA 3O28A 3K2DA 2H98A 3E9XA 1QJMA 1QUJA 3L6HA 4U23A 1JVXA 3K6WA 1MG1A 1MXWA 5A5XB 3T9HB 1A8FA 4ND9A 5CMCA 2HXWA 4F39A 3CG3A 1SVXB 1FCKA 1DSNA 2VGQA 3LUYA 1VFEA 3U72A 4GQOA 4ELOA 1Q1KA 5DYHA 3E13X 3K6VA 2AYSA 3KFMA 3BBRA 5I2KA 4H6DA 5L9OA 3OXNA 4ECFA 3LR1A 5DEXA 4RA1A 1BKAA 3VLWA 1NL5A 3IOWA 2UVHA 1N7XA 3VLVA 3GBAA 4G68C 5EHMA 1UQWA 1ZKBA 4EDPA 2DWHA 1B51A 3CVGA 3PU5A 4YMBA 4KCCA 4XXUA 1TXFA 1MM7A 2HFBA 4X1BA 1MQIA 4OXVA 3IR1A 3B7DA 5I84A 1OVBA 3TCHA 3FIRA 1I6BA 4KYEA 2RCBA 3EF7A 2VP1A 2I3VA 1LBBA 1Q35A 1PB7A 3H6WA 3A09A 3TTNA 4OTEA 1GV8A 4RY1A 2AL4A 2Q2CA 3W15C 4ZS9A 3QIMA 3EPEA 4XKPA 4X1DA 4XKNA 4O3CA 4I8CA 4NTLA 5DVFA 4Z0IA 3O66A 4NF5B 1WDNA 2A5TB 1H43A 4GVOA 3IK6B 3JZJA 1P1UA 1S7YA 2Z23A 5IKBA 3RPWA 4EXLA 1QW0A 3P7IA 2RINA 1B3FA 3A3CA 3TZAA 2F7BA 2Q2AA 3PMWA 3QYTA 5CC2A 3T22A 3T66A 1MPDA 4RPOA 1LAHE 3W9VA 1EZ9A 4BDOA 4XKRA 4FECA 4KI0E 4R6KA 2LAOA 3OO7A 3N6TA 1O64A 4O3BA 2XXIA 3HCQA 4IGRA 3DP8A 4F22A 2KLFA 4R9FA 4GXAA 4G68B 3SEYA 2XXTA 3MP1A 2QS3A 5I56B 3IOTA 3O2AA 2Q9TA 4N07A 3Q28A 3C35A 3AXFA 3RN8A 3EN3A 3KG2A 4G8MA 1ELJA 2GHBA 4FEDA 3FV1A 5B70A 2ZYOA 5CBRA 1TWYA 4PETA 5I58A 1GTKA 2HAUA 2I3WA 2O7UA 1MPCA 2OZZA 3IOVA 1QULA 4OFOA 5DVJA 2DS9A 4I1DA 3H3GA 3ILTB 2RKMA 3QSLA 4F18A 4LZ7A 2Z22A 1PEBA 4KD5A 1B5IA 3U94A 1B52A 2Y7WA 1LAFE 1B3LA 4F1YA 3K6UA 1TFAA 2F35A 5H8NA 1SYHA 5I2NB 5I57A 1OQHA 1WODA 5KZTA 4NE4A 5I59B 2O6AA 5CBSA 3RNNA 4P0GA 1AIVA 4NF8B 1MM6A 4KR5A 1YCJA 2PYYA 3MZ1A 4YU0A 2XXQA 4U22A 4ONYA 3PUYE 2OWSA 5TP9B 1CE2A 3HSTA 1O63A 3MP8A 1XOCA 1XS5A 3S9EA 4R2BA 4IB2A 2VHAA 2DE4A 4N13A 2OJTA 3N5LA 1MXUA 1A99A 4HCYA 3TTRA 1Y1ZA 2DP8A 3FXRA 1Z7ME 1I69A 4AQ4A 3RGYA 4F19A 4F2OA 1LCTA 1JW4A 1N3WA 5DT6A 3TKDA 2O69A 4NF4A 4WKMA 3KBRA 1USYE 3SKPA 3MPLA 3SDFA 3KN8A 4EQ7A 1FQEA 4QFPA 3FGSA 4GD5A 3RT6B 4OWDA 5ITPA 3ONMA 2ZMBA 1SQYA 3OEMA 2Z8FA 4U1ZA 1D9VA 1P1WA 1NFTA 4YAHX 2F7CA 3CG1A 5JK4A 2ZYNA 2GFEA 5H8FB 2F7AA 2DWAA 4F3PA 3G3JA 4IO7A 4H67A 1MXVA 4ESWA 1I6AA 3SEWA 4OZ9A 1QUKA 1EU8A 2FNCA 2W7YA 3E3KA 3IO4A 1AH5A 3MC2A 3ECRA 5FHOA 1NNFA 4U21A 1O7TA 3VLUA 1SYIA 3SEVA 4LVQA 3DM0A 2OLBA 4JWXA 3CRBA 1D9YA 3EHSA 4HW8A 1JW1A 1LB9A 2THIA 5FTIA 3VV5A 1LAGE 1H45A 3SETA 4YB6A 5J1DA 2H99A 3O9PA 3C36A 3OSRA 3I6VA 4WEDA 3MQ9A 4GXSB 3B6TA 3OEKA 4QFOA 4QSCA 4LQ2A 4H5FA 3A3UA 4LQ5A 4G8HA 1B4ZA 3OELA 1BTJA 4Z7EA 3IB0A 3TDJA 1IXIA 4BDLA 4YKPA 1R9QA 1A7LA 2ZNUA 1USYH 2ZYMA 3S4UA 2Y7KA 4XIGQ 3VVFA 3G3KA 1LLSA 1SW1A 3ZS6A 3QXMA 4DZ1A 4OETA 4U2RA 5AE4A 1B9JA 3T9VA 3JV9A 3KZGA 2RC9A 2RC8A 4LA9A 4JB7A 3OO6A 3UK4A 3MZBA 3K6XA 2XHDA 3OOAA 5DTBA 1URDA 3KSJA 4QSDA 5H8HB 1BP5A 2Z8EA 2DVZA 5CMMA 3OMBA 2NWJA 4JDFA 3H4ZA 4FORA 4N6PA 3K00A 5TPAA 2G93A 3UN6A 3F11A 3CFLA 3OO8A 1NKXA 2D3IA 2ANJA 1UIUA 3C4MA 5M2VA 1VE4A 5L8DA 2IEEA 3DP4A 4ISUA 2D21A 2UVGA 3DLNA 5L9MA 3HO7A 4RJZA 5FHNA 3WAEA 1PC3A 4ZZAA 1NMUA 3H03A 4QHQA 4FJPA 1B40A 3FJMA 4Q30B 3VVEA 1HSLA 3KJ7A 4BLAA 3LSWA 4JSOA 1LFGA 5KCJA 4BDMA 1M5CA 4NMYA 3RLFE 1LGBC 4G77A 4YKJA 3QUFA 2O1LA 4QSEA 4OMBA 3WAFA 5H8QB 4DXUA 1MY2A 1SW2A 3UA8A 1TFDA 4IO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4C A;  4PP0 A;  4QRZ A;  3G3G A;  4DDD A;  3IAZ A;  3MBP A;  2RF1 A;  3RTW B;  1XVY A;  4OYV A;  3MVX A;  1AL3 A;  1B5J A;  3IJX B;  4HS7 A;  4OEU A;  4XKQ A;  1N0T A;  3Q25 A;  3USD A;  2O1M A;  3PGF A;  1SW4 A;  3GZG A;  5KDT A;  1B46 A;  3G3H A;  2FYI A;  1AOV A;  2RCA A;  1VSO A;  1MH4 A;  1Y3P A;  1JW5 A;  3SER A;  1UTH B;  3Q27 A;  3MWB A;  1Y4T A;  4LZ5 A;  4TOZ A;  2O68 A;  1LCF A;  2ZXT A;  4OVJ A;  2REJ A;  1RKM A;  3ZSF A;  4QFN A;  3M8U A;  1RYO A;  3IB2 A;  1OIB A;  4LAT A;  3FD3 A;  5AA2 B;  1B3H A;  3KOT A;  4KHZ E;  3CSB A;  4OES A;  2F97 A;  3OSQ A;  1JQF A;  3I3V A;  3GXA A;  2QPQ A;  3FVG A;  2F5X A;  3TTK A;  3S9L C;  2F36 A;  5CMB A;  3TPA A;  4R74 A;  4IO6 A;  1LFI A;  5CI5 A;  3SES A;  5IAI A;  1YAE A;  5AA4 A;  2XXU A;  1B2H A;  1IXH A;  1PBQ A;  2A5S A;  4KQP A;  1QVS A;  1MY1 A;  4ZZE A;  1P1Q A;  1B32 A;  4KCD A;  1P1N A;  1HSE A;  3GLB A;  4ZEF A;  2E1S A;  4JWO A;  3UP9 A;  2I48 A;  4FAT A;  2FA7 A;  3ILU B;  2XX9 A;  1VFD A;  1FQA A;  1PB8 A;  2CMO A;  4JWY A;  5JTY A;  5B7D A;  2VD3 A;  1D3K A;  4GIZ A;  4P11 A;  3RQT A;  5K2Y A;  4GL8 A;  3K1N A;  1ZMG A;  1YTV A;  5CRY A;  1ZBM A;  3O97 A;  1LST A;  3C34 A;  1N3X A;  2GHA A;  3PUZ E;  4DE8 A;  3B6Q A;  4PFT A;  3RUM A;  2CZL A;  4GL0 A;  3C33 A;  4EF2 A;  4IO5 A;  2V84 A;  1MDP 1;  3H7M A;  4ZEK A;  3VE1 B;  3UGW A;  3ZKL A;  4G68 A;  1PB9 A;  1JEU A;  1MY3 A;  3U1O A;  4MLV A;  1N04 A;  4F31 B;  3GBB A;  1FTL A;  3CSG A;  2XXR A;  5ELV A;  1EH3 A;  4FAJ A;  2NVU B;  2BJJ X;  2QL3 A;  2F8D A;  3IO6 A;  1T0K A;  2QRY A;  3T93 B;  1SD3 A;  5BUU A;  3PUV E;  1B1X A;  2DWJ A;  3HV1 A;  1B7H A;  1MQH A;  2WKY A;  1B58 A;  4YMA A;  2H9B A;  1NH7 A;  2HAV A;  1FQC A;  3EQ1 A;  3PPR A;  3Q29 A;  4GFR A;  4NED A;  3HPI A;  3JYR A;  1B7U A;  2XXV A;  3DP6 A;  2PVU A;  4KFQ A;  2M8C A;  4QF9 A;  2V3U A;  2HZL A;  4F29 A;  2XXH A;  3FUZ A;  3PUX E;  2Q8J A;  4O3A A;  4L17 A;  4PFU A;  3FV2 A;  1A40 A;  1Z7N E;  3K01 A;  5I2N A;  4GF8 A;  1I6Q A;  5I59 A;  3FXQ A;  4LON B;  4JSD A;  4NF8 A;  4DCX A;  4R75 A;  2Y84 A;  1FTK A;  3TCF A;  3M3L A;  4R9G A;  2UYE A;  4IY6 A;  4ZDM A;  4EQ9 A;  2ZNT A;  1FW0 A;  5TP9 A;  2XXP A;  2I0C A;  3VXB A;  4H1X A;  2DXR A;  3ODB A;  1LAX A;  3FXU A;  4JBZ A;  2HZK A;  4F3B A;  4ELQ A;  3MUQ A;  1LFH A;  2O7I A;  5FTH A;  3K1P A;  1H76 A;  3I5O A;  3CFX A;  1OLC A;  3KJT A;  4POX A;  5F7V A;  2DSF A;  2VOZ A;  2YPN A;  4BDN A;  4DIG A;  3MP6 A;  2OWT A;  3TYH A;  4M4G A;  1A54 A;  3H6V A;  4LZ8 A;  3THI A;  1H3D A;  2B3B A;  1OVT A;  3PV0 E;  1NNT A;  3MVZ A;  1B4H A;  4NF6 A;  4JXI A;  1A8E A;  3O29 A;  1PBP A;  4PE5 B;  1H44 A;  4GRK A;  2VD2 A;  4TLL B;  1DMB A;  2F6G A;  3RTF B;  1B6H A;  2NXO A;  4IGT A;  5ITO A;  3TEL A;  4NWC A;  4ZE9 A;  1MXZ A;  4IY5 A;  3PPQ A;  4DCY A;  2OK2 A;  3IX1 A;  1KWH A;  5H8F A;  2V3T A;  5LOM A;  5EHS A;  2ONK E;  2P0S A;  3HN0 A;  1P99 A;  2Z8D A;  4U4S A;  4X48 A;  1Y3N A;  1LB8 A;  2ABH A;  5AA1 A;  4C1T A;  1IXG A;  3U93 A;  1II5 A;  4Q0C A;  4MF3 A;  4YKK A;  4BDR A;  4EUO A;  1Y1M A;  4OEV A;  5K2X A;  4F2Q A;  4LUB A;  3FVO A;  2I58 A;  3UOR A;  3C32 A;  4HCW A;  5H8S A;  1SI1 A;  5TPA B;  1ZTY A;  3SEU A;  1IUD A;  4Q8R A;  3KSX A;  4DXB A;  1NNK A;  5L9S A;  4MFI A;  4P0I A;  1MRP A;  3TQL A;  2UVI A;  3M3F A;  1NNP A;  2QS4 A;  4EQB A;  3M3K A;  5ICQ A;  1ATG A;  2Y7I A;  1OQG A;  1R6Z A;  1MXX A;  1D4N A;  1NH8 A;  1UTB A;  2XXX A;  2GH9 A;  2XXW A;  3K0V A;  1GVC A;  1IZ1 A;  3CI8 A;  1B1H A;  2ZYK A;  3TAJ A;  3OD7 A;  5I2K B;  1QKB A;  1MY4 A;  3QUJ A;  5DEX B;  3BFU A;  1B3E A;  1US4 A;  2Q88 A;  3R26 A;  4TLM B;  4YKI A;  3RY3 A;  4RYA A;  2GRV A;  3CIJ A;  3VXC A;  2OCU A;  3T96 B;  3TEP A;  2NOO A;  3G7W A;  1OMP A;  3TMG A;  2V93 A;  4KYS A;  3KEI A;  2IA4 A;  3VDF A;  3PMX A;  2PX1 A;  3FAS A;  3VFJ A;  3MVW A;  3N6U A;  2F78 A;  3O6H A;  2NUV A;  3MZ9 A;  1N76 A;  5H8H A;  4YIC A;  2DE2 A;  2X7P A;  2YJP A;  2HEU A;  5KDT B;  5ICT A;  2DOJ A;  3PPP A;  3E4R A;  1L5T A;  1AMF A;  2AIX A;  2G29 A;  1TT1 A;  3S2V A;  5HBC A;  1JEV A;  5A5X A;  4GWO A;  4R2F A;  1XT8 A;  3W9W A;  2DE3 A;  2HCA A;  2DXY A;  1GR2 A;  3KN3 A;  4NWD A;  3L6G A;  2X7Q A;  3BKI B;  3PD8 A;  4DLD A;  2V3Q A;  1DPE A;  1Y3Q A;  2F6P A;  1B5H A;  4I9D A;  1M5E A;  4LP2 B;  1POY 1;  4EF1 A;  4FIM A;  4G8N A;  4H65 A;  1Y4C A;  4PFY A;  2O51 A;  1CB6 A;  4IO2 A;  4GOT A;  4H8I A;  3EHU A;  3FJG A;  2XD2 A;  2B65 A;  3PD9 A;  3MJN A;  1S9T A;  1MXY A;  2ONS A;  4FE8 A;  2DYX A;  2I6E A;  3O6G A;  4OHN A;  1FTM A;  3H6T A;  4K3F A;  4IO4 A;  1B05 A;  5AA4 B;  2ALU A;  4KPT A;  3KN7 A;  4RNS A;  5H8Q A;  4C0R A;  3K1M A;  3LSL A;  1ZLQ A;  1IIT A;  3H06 B;  4RPN A;  4E0X A;  4X9T A;  3TCG A;  4M1V A;  2D5W A;  5ISU A;  4DXC A;  4F1V A;  1Y9U A;  1DPP A;  5EYF A;  5FHM A;  1JET A;  4UA8 A;  3TFL A;  1A55 A;  4OER A;  2Q89 A;  4H0W A;  3TTM A;  2R6G E;  5JTY B;  4ZEC A;  2DWI A;  2H4I A;  1XC1 A;  1N84 A;  3DEL B;  4F3G A;  1YPN A;  4GLI A;  4MBP A;  3N26 A;  1UTH A;  4MLQ A;  1QKA A;  1GGG A;  3LSF B;  2R71 A;  1FQB A;  3FVN A;  2PBW A;  1F9B A;  4THI A;  5I58 B;  4R6Y A;  4R72 A;  3T9X B;  2PT2 A;  4QFL A;  1XVX A;  4R73 A;  5AA2 A;  2UYF A;  4UAC A;  4F3S A;  1N7W A;  3C9H A;  1MQG A;  1US5 A;  4WXJ A;  1R1N A;  1FTO A;  4NF5 A;  3V89 B;  2A5T A;  3HHG A;  3K4U A;  2F34 A;  2ESN A;  5HM4 B;  3QAX A;  1MH3 A;  4MH5 A;  4ELP A;  1BLF A;  1FQF A;  5H8N B;  2H5Y A;  4KYD A;  2UVJ A;  1MDQ A;  2Y7R A;  1EZP A;  5I57 B;  1SW5 A;  3SEX A;  1QUI A;  1SI0 A;  1M5B A;  4FEB A;  1HSJ A;  3G3I A;  3LSX A;  4ESX A;  1POT A;  1SBP A;  4OFJ A;  2I4C A;  4R6H A;  1URS A;  3O6I A;  2H25 A;  2QMX A;  4Q5T A;  1URG A;  3UIF A;  5I56 A;  2RC7 A;  1MQD A;  1MQJ A;  1S50 A;  2UXA A;  2XXY A;  4YZZ A;  4RXL A;  1IIW A;  4XTC Q;  4C1U A;  2QS2 A;  3D4G A;  3EHT A;  1J1N A;  1LBC A;  3FAT A;  1EZO A;  4AB6 A;  1VR5 A;  3IL1 B;  4ZE8 A;  3PPN A;  3MAM A;  3TUS A;  3K02 A;  1IXC A;  1P1O A;  2ZNS A;  4NF4 B;  3G3F A;  1JVY A;  3U8Q A;  3R7X A;  1ZIU A;  4OEN A;  3VVD A;  3FJ7 A;  3S9M C;  5TU0 A;  4AB5 A;  4U1O A;  3H6U A;  4HTG A;  2AL5 A;  1JNF A;  3RT8 A;  2B3F A;  2I0B A;  3OO9 A;  3BFT A;  3PMV A;  2DQV A;  4OFL A;  1DTZ A;  1PDA A;  1B3G A;  1MS7 A;  2QJE A;  1M5F A;  3MW0 A;  3CFZ A;  2P2A A;  2QS1 A;  2QMW A;  4F1U A;  1B0L A;  1RYX A;  2HQ0 A;  3FVK A;  1MY0 A;  4NF6 B;  3V8X B;  4ZED A;  2R9J A;  1OLA A;  3MPK A;  3S9N C;  3HHF A;  3IB1 A;  2PT1 A;  3C31 A;  3N94 A;  3ZKK A;  2XX7 A;  4TQU Q;  4RK9 A;  2O84 X;  4POW A;  3TTL A;  1BIY A;  1ZU0 A;  3IOU A;  3V83 A;  1Y20 A;  2REG A;  4H5G A;  5CM6 A;  5DVI A;  4H8J A;  4OQO A;  2XD3 A;  1DOT A;  4YB7 A;  2Y7P A;  3T9U A;  2E0S A;  1FQD A;  2OBG A;  1B7Z A;  1DTG A;  4QFK A;  2DVC A;  3QK6 A;  3CR9 A;  3FZV A;  2PMS A;  2XX8 A;  3IJO B;  4WEP A;  4RK2 A;  2P1S A;  2X26 A;  1ANF A;  3MVY A;  1IQ7 A;  5JEI A;  3LBS A;  1UTB B;  3KGC A;  4G4P A;  1FTJ A;  2YLN A;  1B0H A;  4G2Z A;  1MPB A;  3LC8 A;  4ZEB A;  3TOD A;  5HPQ A;  3Q26 A;  4EXK A;  2I4B A;  3KOS A;  1UIV A;  4BDQ A;  3PUW E;  5BWJ A;  3TQW A;  3OEN A;  4PQJ A;  3B6W A;  4I62 A;  5AA3 A;  3IOR A;  5CMK A;  4ZEI A;  4E0W A;  4U4X A;  4ELR A;  4PFW A;  5F1Q A;  1R9L A;  4YB5 A;  2QSX A;  5KCJ B;  1M5D A;  1IEJ A;  2ONR A;  1SDX A;  1ZJL A;  2V25 A;  1WVJ A;  3R6U A;  2I49 A;  3U92 A;  3V5A A;  3PPO A;  5AA2 D;  1XHY A;  3O28 A;  3K2D A;  2H98 A;  3E9X A;  1QJM A;  1QUJ A;  3L6H A;  4U23 A;  1JVX A;  3K6W A;  1MG1 A;  1MXW A;  5A5X B;  3T9H B;  1A8F A;  4ND9 A;  5CMC A;  2HXW A;  4F39 A;  3CG3 A;  1SVX B;  1FCK A;  1DSN A;  2VGQ A;  3LUY A;  1VFE A;  3U72 A;  4GQO A;  4ELO A;  1Q1K A;  5DYH A;  3E13 X;  3K6V A;  2AYS A;  3KFM A;  3BBR A;  5I2K A;  4H6D A;  5L9O A;  3OXN A;  4ECF A;  3LR1 A;  5DEX A;  4RA1 A;  1BKA A;  3VLW A;  1NL5 A;  3IOW A;  2UVH A;  1N7X A;  3VLV A;  3GBA A;  4G68 C;  5EHM A;  1UQW A;  1ZKB A;  4EDP A;  2DWH A;  1B51 A;  3CVG A;  3PU5 A;  4YMB A;  4KCC A;  4XXU A;  1TXF A;  1MM7 A;  2HFB A;  4X1B A;  1MQI A;  4OXV A;  3IR1 A;  3B7D A;  5I84 A;  1OVB A;  3TCH A;  3FIR A;  1I6B A;  4KYE A;  2RCB A;  3EF7 A;  2VP1 A;  2I3V A;  1LBB A;  1Q35 A;  1PB7 A;  3H6W A;  3A09 A;  3TTN A;  4OTE A;  1GV8 A;  4RY1 A;  2AL4 A;  2Q2C A;  3W15 C;  4ZS9 A;  3QIM A;  3EPE A;  4XKP A;  4X1D A;  4XKN A;  4O3C A;  4I8C A;  4NTL A;  5DVF A;  4Z0I A;  3O66 A;  4NF5 B;  1WDN A;  2A5T B;  1H43 A;  4GVO A;  3IK6 B;  3JZJ A;  1P1U A;  1S7Y A;  2Z23 A;  5IKB A;  3RPW A;  4EXL A;  1QW0 A;  3P7I A;  2RIN A;  1B3F A;  3A3C A;  3TZA A;  2F7B A;  2Q2A A;  3PMW A;  3QYT A;  5CC2 A;  3T22 A;  3T66 A;  1MPD A;  4RPO A;  1LAH E;  3W9V A;  1EZ9 A;  4BDO A;  4XKR A;  4FEC A;  4KI0 E;  4R6K A;  2LAO A;  3OO7 A;  3N6T A;  1O64 A;  4O3B A;  2XXI A;  3HCQ A;  4IGR A;  3DP8 A;  4F22 A;  2KLF A;  4R9F A;  4GXA A;  4G68 B;  3SEY A;  2XXT A;  3MP1 A;  2QS3 A;  5I56 B;  3IOT A;  3O2A A;  2Q9T A;  4N07 A;  3Q28 A;  3C35 A;  3AXF A;  3RN8 A;  3EN3 A;  3KG2 A;  4G8M A;  1ELJ A;  2GHB A;  4FED A;  3FV1 A;  5B70 A;  2ZYO A;  5CBR A;  1TWY A;  4PET A;  5I58 A;  1GTK A;  2HAU A;  2I3W A;  2O7U A;  1MPC A;  2OZZ A;  3IOV A;  1QUL A;  4OFO A;  5DVJ A;  2DS9 A;  4I1D A;  3H3G A;  3ILT B;  2RKM A;  3QSL A;  4F18 A;  4LZ7 A;  2Z22 A;  1PEB A;  4KD5 A;  1B5I A;  3U94 A;  1B52 A;  2Y7W A;  1LAF E;  1B3L A;  4F1Y A;  3K6U A;  1TFA A;  2F35 A;  5H8N A;  1SYH A;  5I2N B;  5I57 A;  1OQH A;  1WOD A;  5KZT A;  4NE4 A;  5I59 B;  2O6A A;  5CBS A;  3RNN A;  4P0G A;  1AIV A;  4NF8 B;  1MM6 A;  4KR5 A;  1YCJ A;  2PYY A;  3MZ1 A;  4YU0 A;  2XXQ A;  4U22 A;  4ONY A;  3PUY E;  2OWS A;  5TP9 B;  1CE2 A;  3HST A;  1O63 A;  3MP8 A;  1XOC A;  1XS5 A;  3S9E A;  4R2B A;  4IB2 A;  2VHA A;  2DE4 A;  4N13 A;  2OJT A;  3N5L A;  1MXU A;  1A99 A;  4HCY A;  3TTR A;  1Y1Z A;  2DP8 A;  3FXR A;  1Z7M E;  1I69 A;  4AQ4 A;  3RGY A;  4F19 A;  4F2O A;  1LCT A;  1JW4 A;  1N3W A;  5DT6 A;  3TKD A;  2O69 A;  4NF4 A;  4WKM A;  3KBR A;  1USY E;  3SKP A;  3MPL A;  3SDF A;  3KN8 A;  4EQ7 A;  1FQE A;  4QFP A;  3FGS A;  4GD5 A;  3RT6 B;  4OWD A;  5ITP A;  3ONM A;  2ZMB A;  1SQY A;  3OEM A;  2Z8F A;  4U1Z A;  1D9V A;  1P1W A;  1NFT A;  4YAH X;  2F7C A;  3CG1 A;  5JK4 A;  2ZYN A;  2GFE A;  5H8F B;  2F7A A;  2DWA A;  4F3P A;  3G3J A;  4IO7 A;  4H67 A;  1MXV A;  4ESW A;  1I6A A;  3SEW A;  4OZ9 A;  1QUK A;  1EU8 A;  2FNC A;  2W7Y A;  3E3K A;  3IO4 A;  1AH5 A;  3MC2 A;  3ECR A;  5FHO A;  1NNF A;  4U21 A;  1O7T A;  3VLU A;  1SYI A;  3SEV A;  4LVQ A;  3DM0 A;  2OLB A;  4JWX A;  3CRB A;  1D9Y A;  3EHS A;  4HW8 A;  1JW1 A;  1LB9 A;  2THI A;  5FTI A;  3VV5 A;  1LAG E;  1H45 A;  3SET A;  4YB6 A;  5J1D A;  2H99 A;  3O9P A;  3C36 A;  3OSR A;  3I6V A;  4WED A;  3MQ9 A;  4GXS B;  3B6T A;  3OEK A;  4QFO A;  4QSC A;  4LQ2 A;  4H5F A;  3A3U A;  4LQ5 A;  4G8H A;  1B4Z A;  3OEL A;  1BTJ A;  4Z7E A;  3IB0 A;  3TDJ A;  1IXI A;  4BDL A;  4YKP A;  1R9Q A;  1A7L A;  2ZNU A;  1USY H;  2ZYM A;  3S4U A;  2Y7K A;  4XIG Q;  3VVF A;  3G3K A;  1LLS A;  1SW1 A;  3ZS6 A;  3QXM A;  4DZ1 A;  4OET A;  4U2R A;  5AE4 A;  1B9J A;  3T9V A;  3JV9 A;  3KZG A;  2RC9 A;  2RC8 A;  4LA9 A;  4JB7 A;  3OO6 A;  3UK4 A;  3MZB A;  3K6X A;  2XHD A;  3OOA A;  5DTB A;  1URD A;  3KSJ A;  4QSD A;  5H8H B;  1BP5 A;  2Z8E A;  2DVZ A;  5CMM A;  3OMB A;  2NWJ A;  4JDF A;  3H4Z A;  4FOR A;  4N6P A;  3K00 A;  5TPA A;  2G93 A;  3UN6 A;  3F11 A;  3CFL A;  3OO8 A;  1NKX A;  2D3I A;  2ANJ A;  1UIU A;  3C4M A;  5M2V A;  1VE4 A;  5L8D A;  2IEE A;  3DP4 A;  4ISU A;  2D21 A;  2UVG A;  3DLN A;  5L9M A;  3HO7 A;  4RJZ A;  5FHN A;  3WAE A;  1PC3 A;  4ZZA A;  1NMU A;  3H03 A;  4QHQ A;  4FJP A;  1B40 A;  3FJM A;  4Q30 B;  3VVE A;  1HSL A;  3KJ7 A;  4BLA A;  3LSW A;  4JSO A;  1LFG A;  5KCJ A;  4BDM A;  1M5C A;  4NMY A;  3RLF E;  1LGB C;  4G77 A;  4YKJ A;  3QUF A;  2O1L A;  4QSE A;  4OMB A;  3WAF A;  5H8Q B;  4DXU A;  1MY2 A;  1SW2 A;  3UA8 A;  1TFD A;  4IO3 A; 
#chains in the Genus database with same CATH topology
 3D4C A;  4PP0 A;  4QRZ A;  3G3G A;  4DDD A;  3IAZ A;  3MBP A;  2RF1 A;  3RTW B;  1XVY A;  4OYV A;  3MVX A;  1AL3 A;  1B5J A;  3IJX B;  4HS7 A;  4OEU A;  4XKQ A;  1N0T A;  3Q25 A;  3USD A;  2O1M A;  3PGF A;  1SW4 A;  4OVQ A;  5I5P A;  3GZG A;  4GWX A;  5KDT A;  1B46 A;  3G3H A;  2FYI A;  1AOV A;  2RCA A;  1VSO A;  1MH4 A;  1JW5 A;  1Y3P A;  3SER A;  1UTH B;  3Q27 A;  3MWB A;  4AS4 A;  3B50 A;  1Y4T A;  4LZ5 A;  4TOZ A;  2O68 A;  1LCF A;  2ZXT A;  4OVJ A;  2REJ A;  1RKM A;  3ZSF A;  4QFN A;  3M8U A;  1RYO A;  2GQ1 A;  2WBB A;  3IB2 A;  1OIB A;  4LAT A;  3FD3 A;  5AA2 B;  1B3H A;  3KOT A;  4KHZ E;  3CSB A;  5ET6 A;  4OES A;  2F97 A;  5EQ9 A;  3OSQ A;  1JQF A;  4PFI A;  3I3V A;  3GXA A;  1FPK A;  2QPQ A;  5EYG A;  3FVG A;  2F5X A;  3TTK A;  3S9L C;  2F36 A;  5CMB A;  3TPA A;  4R74 A;  5J16 A;  4IO6 A;  1LFI A;  5CI5 A;  3SES A;  4HE0 A;  5IAI A;  1YAE A;  4NG7 A;  5AA4 A;  4QBA A;  2XXU A;  1B2H A;  1IXH A;  1PBQ A;  1FPE A;  2A5S A;  4KQP A;  1QVS A;  1FRP A;  1MY1 A;  4ZZE A;  1P1Q A;  1B32 A;  4KCD A;  1P1N A;  1HSE A;  3GLB A;  4ZEF A;  2E1S A;  1VDW A;  4DI3 D;  4JWO A;  3UP9 A;  2I48 A;  4FAT A;  2FA7 A;  3ILU B;  2WBD A;  2XX9 A;  1VFD A;  1FQA A;  1PB8 A;  2CMO A;  4JWY A;  5JTY A;  5B7D A;  2VD3 A;  1D3K A;  4GIZ A;  4N15 A;  4GWU A;  4P11 A;  1FPD A;  3RQT A;  1NV2 A;  1K9Y A;  5K2Y A;  3FBP A;  4FBP A;  4GL8 A;  3K1N A;  1ZMG A;  1YTV A;  5CRY A;  1ZBM A;  3O97 A;  1LST A;  4PAF A;  4N8G A;  3C34 A;  1N3X A;  1IMC A;  2GHA A;  3PUZ E;  4DE8 A;  3B6Q A;  4PFT A;  2FIX A;  4PDH A;  3RUM A;  1NV5 A;  2CZL A;  4GL0 A;  3C33 A;  4EF2 A;  4IO5 A;  2V84 A;  1MDP 1;  3H7M A;  4ZEK A;  3VE1 B;  3UGW A;  3ZKL A;  4G68 A;  1PB9 A;  1JEU A;  1MY3 A;  3U1O A;  4MLV A;  1N04 A;  4F31 B;  3GBB A;  1FTL A;  2FVZ A;  3CSG A;  2XXR A;  5ELV A;  2VPO A;  1EH3 A;  4FAJ A;  2NVU B;  2BJJ X;  2QL3 A;  2F8D A;  3IO6 A;  4NF0 A;  1T0K A;  2QRY A;  3T93 B;  1SD3 A;  5BUU A;  3PUV E;  4MNI A;  1B1X A;  2DWJ A;  3HV1 A;  1B7H A;  1MQH A;  2WKY A;  1B58 A;  4PBH A;  4YMA A;  2H9B A;  1NH7 A;  2HAV A;  1FQC A;  3EQ1 A;  3PPR A;  3Q29 A;  4NGU A;  4GFR A;  4NED A;  2QVU A;  3HPI A;  3JYR A;  1B7U A;  2XXV A;  3DP6 A;  2PVU A;  4KFQ A;  2ZZV A;  2M8C A;  4QF9 A;  2V3U A;  2HZL A;  1SPI A;  2Y5K A;  2XXH A;  5EQ8 A;  4F29 A;  3FUZ A;  3PUX E;  2Q8J A;  4O3A A;  4L17 A;  4PFU A;  3FV2 A;  1A40 A;  1Z7N E;  3K01 A;  5I2N A;  4GF8 A;  1I6Q A;  5I59 A;  3FXQ A;  4LON B;  4JSD A;  4NF8 A;  4N6D A;  4DCX A;  2OWZ A;  2DDK A;  4R75 A;  2Y84 A;  1K9Z A;  1FTK A;  3TCF A;  3M3L A;  4R9G A;  2UYE A;  4IY6 A;  4MAG A;  4ZDM A;  4EQ9 A;  2ZNT A;  1FW0 A;  1IME A;  5TP9 A;  2XXP A;  2I0C A;  2PFY A;  3VXB A;  4H1X A;  4GX3 A;  1LEV A;  2DXR A;  3ODB A;  5IZZ A;  1LAX A;  3FXU A;  4GWW A;  4JBZ A;  2HZK A;  4F3B A;  4ELQ A;  3MUQ A;  1LFH A;  2O7I A;  5FTH A;  3K1P A;  1H76 A;  3I5O A;  3CFX A;  1OLC A;  3KJT A;  1FSA A;  4P47 A;  2Q74 A;  4POX A;  5F7V A;  2DSF A;  2VOZ A;  2YPN A;  4BDN A;  1EYI A;  4DIG A;  4PAK A;  3MP6 A;  4GWZ A;  2OWT A;  4HXV A;  3TYH A;  4M4G A;  5IGA A;  1A54 A;  3H6V A;  4LZ8 A;  3THI A;  1H3D A;  2B3B A;  1OVT A;  3PV0 E;  1NNT A;  3MVZ A;  1B4H A;  4NF6 A;  4JXI A;  4H45 A;  1A8E A;  3O29 A;  1KA1 A;  1PBP A;  4PE5 B;  1H44 A;  4GRK A;  2XWI A;  2VD2 A;  2FHY A;  4TLL B;  1DMB A;  2F6G A;  3RTF B;  1B6H A;  2NXO A;  4IGT A;  5ITO A;  3TEL A;  1IMB A;  4NWC A;  4ZE9 A;  1MXZ A;  4IY5 A;  3PPQ A;  4PFB A;  1FPL A;  4DCY A;  2OK2 A;  3IX1 A;  2Q8M A;  5EYH A;  1KWH A;  5H8F A;  2WYK A;  5ET7 A;  2V3T A;  5LOM A;  5EHS A;  2ONK E;  2P0S A;  3HN0 A;  1P99 A;  2Z8D A;  4U4S A;  4X48 A;  1Y3N A;  1LB8 A;  4G61 A;  2ABH A;  5AA1 A;  3FXB A;  4C1T A;  1IXG A;  3U93 A;  1II5 A;  4Q0C A;  4MF3 A;  4YKK A;  2FIE A;  4BDR A;  4EUO A;  1Y1M A;  2MKZ A;  4OEV A;  5K2X A;  4F2Q A;  4LUB A;  4GWY A;  3FVO A;  4N91 A;  2I58 A;  3UOR A;  3C32 A;  4HCW A;  5H8S A;  1SI1 A;  5TPA B;  1ZTY A;  3SEU A;  1IUD A;  3RPL B;  4Q8R A;  3KSX A;  4DXB A;  2WEF A;  1NNK A;  5L9S A;  4MFI A;  4P0I A;  1MRP A;  3IFC A;  3TQL A;  2UVI A;  1LBV A;  3M3F A;  1NNP A;  2QS4 A;  4N8Y A;  4EQB A;  3M3K A;  5ICQ A;  1ATG A;  2Y7I A;  1OQG A;  1R6Z A;  1MXX A;  1D4N A;  1NH8 A;  1UTB A;  2XXX A;  2XWK A;  2GH9 A;  2XXW A;  3K0V A;  1GVC A;  1IZ1 A;  3CI8 A;  1B1H A;  2ZYK A;  4OVR A;  3TAJ A;  3OD7 A;  5I2K B;  1QKB A;  1MY4 A;  3QUJ A;  4O8M A;  5LDZ A;  5DEX B;  3BFU A;  1B3E A;  1RDX A;  1US4 A;  2Q88 A;  3R26 A;  4TLM B;  4MMP A;  4YKI A;  3RY3 A;  4RYA A;  2GRV A;  3CIJ A;  3VXC A;  2B4M A;  2OCU A;  3T96 B;  3TEP A;  2NOO A;  3G7W A;  1OMP A;  4MX6 A;  3TMG A;  2V93 A;  4KYS A;  3KEI A;  4NHB A;  2IA4 A;  5I7I A;  3VDF A;  1D9Q A;  3PMX A;  5IM2 A;  2PX1 A;  4PF8 A;  3FAS A;  3VFJ A;  3MVW A;  3N6U A;  2F78 A;  3O6H A;  2NUV A;  3MZ9 A;  1N76 A;  1YYZ A;  5H8H A;  4YIC A;  2HPG A;  2DE2 A;  2X7P A;  2YJP A;  3T1B A;  2HEU A;  5KDT B;  5ICT A;  2DOJ A;  3PPP A;  3E4R A;  1L5T A;  1AMF A;  2XA5 A;  2AIX A;  2ZZW A;  2G29 A;  1TT1 A;  3S2V A;  5HBC A;  1JEV A;  5A5X A;  4GWO A;  4PCD A;  1XT8 A;  4R2F A;  3W9W A;  3RYD A;  1FPG A;  2DE3 A;  2HCA A;  2DXY A;  1GR2 A;  3KN3 A;  3QMF A;  4NWD A;  3L6G A;  4OVT A;  1NUX A;  2X7Q A;  3SZP A;  3BKI B;  3PD8 A;  4DLD A;  2V3Q A;  3MYU A;  1DPE A;  1Y3Q A;  2F6P A;  1B5H A;  4I9D A;  1M5E A;  4JVD A;  4PF6 A;  5IZ3 A;  4LP2 B;  2QVR A;  2WX9 A;  1POY 1;  4EF1 A;  4FIM A;  4G8N A;  4H65 A;  3T0J A;  1Y4C A;  1NV0 A;  4PFY A;  2O51 A;  1CB6 A;  4IO2 A;  4PGN A;  3IFA A;  4GOT A;  4H8I A;  3EHU A;  3FJG A;  2CZH A;  2XD2 A;  2B65 A;  3PD9 A;  3MJN A;  1S9T A;  4NX1 A;  1MXY A;  2ONS A;  4FE8 A;  2DYX A;  1NV7 A;  2I6E A;  3O6G A;  4OHN A;  1FTM A;  3H6T A;  4K3F A;  4IO4 A;  1B05 A;  1IMD A;  5AA4 B;  2ALU A;  2OX3 A;  4KPT A;  3KN7 A;  4RNS A;  5H8Q A;  2VPN A;  4C0R A;  3K1M A;  3LSL A;  1ZLQ A;  1IIT A;  3H06 B;  4RPN A;  4E0X A;  4X9T A;  3TCG A;  4M1V A;  2D5W A;  4MIJ A;  4DXC A;  4F1V A;  5ISU A;  1DPP A;  1Y9U A;  5EYF A;  5FHM A;  1JET A;  4UA8 A;  3TFL A;  1A55 A;  4OER A;  2Q89 A;  4H0W A;  3TTM A;  2R6G E;  3PTY A;  5JTY B;  4ZEC A;  2DWI A;  2H4I A;  1XC1 A;  1N84 A;  3DEL B;  4P1L A;  4F3G A;  1YPN A;  4GLI A;  4MNP A;  4MBP A;  3N26 A;  1UTH A;  1KZ8 A;  5F24 A;  4MLQ A;  1QKA A;  1NV3 A;  1GGG A;  3LSF B;  2R71 A;  1FQB A;  4NQ8 A;  3FVN A;  2PBW A;  1F9B A;  4JVI A;  4THI A;  5I58 B;  4R6Y A;  4R72 A;  3T9X B;  2PT2 A;  4QFL A;  4PAI A;  1XVX A;  4R73 A;  5AA2 A;  1IMA A;  2UYF A;  4UAC A;  3KC0 A;  1AWB A;  4I3E A;  4F3S A;  3LUZ A;  1N7W A;  3C9H A;  1MQG A;  1US5 A;  4WXJ A;  1R1N A;  1FTO A;  2PCR A;  4NF5 A;  3V89 B;  2A5T A;  3HHG A;  5I3S A;  3K4U A;  2F34 A;  2ESN A;  5HM4 B;  1G0I A;  3QAX A;  1MH3 A;  4MH5 A;  4ELP A;  1BLF A;  1FQF A;  5H8N B;  2H5Y A;  4KYD A;  2UVJ A;  1MDQ A;  2Y7R A;  1EZP A;  5I57 B;  1SW5 A;  2JJK A;  3SEX A;  1QUI A;  1SI0 A;  1M5B A;  4FEB A;  1HSJ A;  3G3I A;  3LSX A;  4ESX A;  2F3B A;  1POT A;  1SBP A;  4OFJ A;  2I4C A;  4R6H A;  1URS A;  3O6I A;  5DW8 A;  2H25 A;  2QMX A;  4Q5T A;  4MCO A;  1URG A;  3UIF A;  5I56 A;  2RC7 A;  1MQD A;  1MQJ A;  1S50 A;  2UXA A;  4QXD A;  5EQA A;  1G0H A;  2XXY A;  2HHM A;  4N81 A;  4YZZ A;  4RXL A;  1IIW A;  4XTC Q;  4C1U A;  2QS2 A;  3D4G A;  3EHT A;  1J1N A;  1LBC A;  3FAT A;  1EZO A;  4AB6 A;  3ISP A;  1VR5 A;  3IL1 B;  1FBP A;  3KC1 A;  4ZE8 A;  3PPN A;  3MAM A;  3TUS A;  3K02 A;  1IXC A;  1P1O A;  2ZNS A;  4NF4 B;  4O94 A;  3G3F A;  2KQZ A;  1JVY A;  3U8Q A;  3R7X A;  1ZIU A;  4OEN A;  3VVD A;  3FJ7 A;  3S9M C;  5TU0 A;  2P3N A;  4AB5 A;  4OAN A;  4U1O A;  3H6U A;  4HTG A;  2AL5 A;  1JNF A;  3RT8 A;  2B3F A;  2I0B A;  3OO9 A;  4OVP A;  3BFT A;  5ET5 A;  4N17 A;  3PMV A;  2DQV A;  4OFL A;  1DTZ A;  1KA0 A;  1PDA A;  1B3G A;  4O7M A;  1MS7 A;  2QJE A;  1M5F A;  4PBQ A;  3MW0 A;  3CFZ A;  2P2A A;  2QS1 A;  2QMW A;  1QGX A;  4F1U A;  1B0L A;  1RYX A;  4N4U A;  1FPI A;  2HQ0 A;  3FVK A;  3D1R A;  1MY0 A;  3E79 A;  4NF6 B;  3V8X B;  4O7I A;  4ZED A;  2R9J A;  5ESY A;  1OLA A;  3MPK A;  3S9N C;  3HHF A;  2P3V A;  3IB1 A;  2PT1 A;  3C31 A;  3N94 A;  3ZKK A;  3KBZ A;  2XX7 A;  4TQU Q;  4RK9 A;  4GX4 A;  2O84 X;  1RDY A;  4POW A;  3TTL A;  1BIY A;  1ZU0 A;  3IOU A;  3V83 A;  1Y20 A;  2REG A;  4H5G A;  5CM6 A;  5DVI A;  4H8J A;  4GBW A;  4OQO A;  2XD3 A;  1DOT A;  4YB7 A;  2Y7P A;  3T9U A;  4XFE A;  2E0S A;  2V4C A;  3MST A;  1FQD A;  4NN3 A;  2OBG A;  1B7Z A;  1DTG A;  4QFK A;  2DVC A;  4PC9 A;  3QK6 A;  3CR9 A;  4MNC A;  1FJ9 A;  3U65 A;  3FZV A;  2PMS A;  2XX8 A;  3IJO B;  4WEP A;  4RK2 A;  4I40 A;  1NI9 A;  2P1S A;  4P8B A;  2X26 A;  1ANF A;  3MVY A;  1IQ7 A;  5JEI A;  3LBS A;  1UTB B;  3KGC A;  4G4P A;  1FTJ A;  2YLN A;  1B0H A;  4G2Z A;  1MPB A;  3LC8 A;  4ZEB A;  4GX6 A;  3TOD A;  5HPQ A;  3Q26 A;  4EXK A;  2I4B A;  1FBC A;  3KOS A;  1LBZ A;  4GBV A;  1UIV A;  4BDQ A;  3PUW E;  5BWJ A;  3TQW A;  4I3Y A;  1FBG A;  3OEN A;  1FBF A;  4PQJ A;  3B6W A;  4I62 A;  5AA3 A;  3IOR A;  5CMK A;  4ZEI A;  4E0W A;  4U4X A;  1JP4 A;  4ELR A;  4PFW A;  5F1Q A;  1R9L A;  4YB5 A;  2QSX A;  5KCJ B;  1NV4 A;  1M5D A;  1IEJ A;  2ONR A;  1SDX A;  1ZJL A;  1YZ0 A;  2V25 A;  1WVJ A;  3R6U A;  2I49 A;  5FBP A;  3U92 A;  3V5A A;  3PPO A;  3CHG A;  5AA2 D;  1XHY A;  3O28 A;  3K2D A;  2H98 A;  3E9X A;  1QJM A;  1QUJ A;  3RPL A;  3L6H A;  4U23 A;  1JVX A;  3K6W A;  1MG1 A;  1MXW A;  5A5X B;  3T9H B;  1A8F A;  2Y5L A;  3HFU A;  4ND9 A;  5CMC A;  2HXW A;  4X04 A;  4F39 A;  3CG3 A;  1SVX B;  1FCK A;  1DSN A;  2VGQ A;  3LUY A;  1VFE A;  3U72 A;  4GQO A;  4ELO A;  1Q1K A;  4JVC A;  5DYH A;  3E13 X;  3K6V A;  1NV1 A;  2AYS A;  3KFM A;  2HXR A;  3BBR A;  2FBP A;  5I2K A;  4H6D A;  5L9O A;  3OXN A;  4ECF A;  3LR1 A;  4LN5 A;  5DEX A;  4RA1 A;  1BKA A;  3VLW A;  1NL5 A;  3IOW A;  2UVH A;  1N7X A;  3VLV A;  3GBA A;  4G68 C;  5EHM A;  1UQW A;  1ZKB A;  3BIG A;  4EDP A;  2DWH A;  1B51 A;  4OA4 A;  3CVG A;  3PU5 A;  4YMB A;  4KCC A;  4XXU A;  1TXF A;  1MM7 A;  1RDZ A;  2HFB A;  4X1B A;  1MQI A;  4OXV A;  3IR1 A;  3B7D A;  5I84 A;  3ROJ A;  1OVB A;  3TCH A;  2F3D A;  4PGP A;  1FPF A;  3FIR A;  1EYK A;  1I6B A;  4KYE A;  2RCB A;  3EF7 A;  2VP1 A;  2I3V A;  1LBB A;  1Q35 A;  1PB7 A;  3H6W A;  3A09 A;  3TTN A;  4OTE A;  1GV8 A;  4RY1 A;  2AL4 A;  5T3J A;  2Q2C A;  3W15 C;  3E78 A;  4ZS9 A;  3QIM A;  3EPE A;  4PTK A;  4XKP A;  4X1D A;  4DI4 B;  4XKN A;  4O3C A;  4I8C A;  4NTL A;  5DVF A;  4Z0I A;  4HE2 A;  3O66 A;  4NF5 B;  1WDN A;  2A5T B;  1H43 A;  4GVO A;  3IK6 B;  3JZJ A;  1P1U A;  2CZI A;  1S7Y A;  2Z23 A;  5IKB A;  3RPW A;  4EXL A;  1QW0 A;  3P7I A;  2RIN A;  1B3F A;  4PDD A;  3A3C A;  3TZA A;  2F7B A;  2Q2A A;  3A29 A;  3PMW A;  3QYT A;  5CC2 A;  3T22 A;  3T66 A;  1MPD A;  4RPO A;  1LAH E;  3W9V A;  1EZ9 A;  4BDO A;  4XKR A;  4FEC A;  4PFR A;  4KI0 E;  4R6K A;  2LAO A;  3OO7 A;  3N6T A;  1O64 A;  4O3B A;  2QVV A;  2XXI A;  3HCQ A;  4IGR A;  3DP8 A;  4F22 A;  2KLF A;  1Q9D A;  4R9F A;  4GXA A;  4G68 B;  3SEY A;  2XXT A;  3MP1 A;  2QS3 A;  5I56 B;  1IMF A;  3IOT A;  1LBX A;  3O2A A;  2Q9T A;  4N07 A;  3Q28 A;  3C35 A;  4P1E A;  3AXF A;  3RN8 A;  2CEY A;  3EN3 A;  3KG2 A;  2XWO A;  4XF5 A;  4G8M A;  1ELJ A;  2GHB A;  4FED A;  3FV1 A;  5IZ1 A;  5B70 A;  2ZYO A;  2CZK A;  2PFZ A;  5CBR A;  1TWY A;  4PET A;  5I58 A;  1GTK A;  2R8T A;  2HAU A;  2I3W A;  2O7U A;  4P3L A;  1BK4 A;  1MPC A;  2OZZ A;  3B8B A;  3IOV A;  1QUL A;  4OFO A;  5DVJ A;  2DS9 A;  4I1D A;  3LV0 A;  3H3G A;  3ILT B;  2RKM A;  3QSL A;  4F18 A;  4LZ7 A;  2Z22 A;  1PEB A;  4KD5 A;  1B5I A;  3U94 A;  1B52 A;  2Y7W A;  1LAF E;  1FBE A;  1B3L A;  4P9K A;  4F1Y A;  3K6U A;  1TFA A;  2F35 A;  1LBW A;  5H8N A;  1SYH A;  5I2N B;  5I57 A;  1OQH A;  1FPB A;  1WOD A;  5KZT A;  4NE4 A;  5I59 B;  2O6A A;  5CBS A;  4IR8 A;  3RNN A;  4P0G A;  1AIV A;  4NF8 B;  1MM6 A;  4KR5 A;  1YCJ A;  2PYY A;  1CNQ A;  3MZ1 A;  4YU0 A;  2XXQ A;  3BIH A;  4U22 A;  4ONY A;  3PUY E;  2OWS A;  5TP9 B;  1CE2 A;  3HST A;  1O63 A;  3MP8 A;  1XOC A;  1XS5 A;  3S9E A;  4R2B A;  4IB2 A;  2VHA A;  5LTC A;  2DE4 A;  4N13 A;  2OJT A;  4UAB A;  3N5L A;  1MXU A;  1A99 A;  4HCY A;  3TTR A;  1Y1Z A;  2DP8 A;  3FXR A;  1Z7M E;  1I69 A;  4AQ4 A;  3RGY A;  4F19 A;  4X8R A;  4F2O A;  1LCT A;  1NUW A;  1JW4 A;  1N3W A;  3EKI A;  5A5L A;  1EYJ A;  5DT6 A;  1FBH A;  3TKD A;  1FTA A;  2O69 A;  4NF4 A;  1INP A;  4WKM A;  3KBR A;  1USY E;  3SKP A;  3MPL A;  5EQ7 A;  3SDF A;  3KN8 A;  4EQ7 A;  1FQE A;  4QFP A;  3FGS A;  4GD5 A;  3RT6 B;  4OWD A;  5ITP A;  3ONM A;  1FJ6 A;  2XWV A;  2ZMB A;  1SQY A;  3OEM A;  2Z8F A;  4U1Z A;  1D9V A;  1DK4 A;  1P1W A;  1NFT A;  4YAH X;  2F7C A;  3CG1 A;  5JK4 A;  2ZYN A;  2GFE A;  5H8F B;  2F7A A;  2DWA A;  4F3P A;  3G3J A;  4IO7 A;  4H67 A;  1MXV A;  4ESW A;  1FBD A;  1I6A A;  3SEW A;  4OZ9 A;  1QUK A;  1EU8 A;  2FNC A;  2W7Y A;  3E3K A;  4GWS A;  4H46 A;  4PE3 A;  3IO4 A;  1AH5 A;  3MC2 A;  3ECR A;  5FHO A;  1NNF A;  4U21 A;  1O7T A;  3VLU A;  1SYI A;  3SEV A;  4LVQ A;  3DM0 A;  2OLB A;  4JWX A;  1NUZ A;  3CRB A;  1D9Y A;  3EHS A;  4AS5 A;  4HW8 A;  1JW1 A;  1LB9 A;  2THI A;  5FTI A;  3VV5 A;  1LAG E;  1H45 A;  3SET A;  4YB6 A;  5J1D A;  2H99 A;  3GYY A;  3O9P A;  3C36 A;  3OSR A;  3I6V A;  4WED A;  3MQ9 A;  2L5V A;  4GXS B;  3B6T A;  3OEK A;  4QFO A;  4QSC A;  4LQ2 A;  4H5F A;  3A3U A;  1NV6 A;  4LQ5 A;  2WYP A;  4G8H A;  1B4Z A;  4P56 A;  3NOH A;  3OEL A;  1BTJ A;  1LBY A;  4Z7E A;  3IB0 A;  3TDJ A;  1IXI A;  4MJO A;  4BDL A;  4YKP A;  1R9Q A;  1A7L A;  2ZNU A;  1USY H;  2ZYM A;  3S4U A;  2Y7K A;  4XIG Q;  3VVF A;  3G3K A;  1LLS A;  1SW1 A;  3ZS6 A;  3QXM A;  4DZ1 A;  4OET A;  4U2R A;  5AE4 A;  1B9J A;  3T9V A;  1DCU A;  3JV9 A;  3KZG A;  2RC9 A;  2RC8 A;  1YXI A;  4LA9 A;  4JB7 A;  3OO6 A;  3UK4 A;  3MZB A;  3K6X A;  2XHD A;  3OOA A;  5DTB A;  1URD A;  2VT5 A;  3KSJ A;  4QSD A;  5H8H B;  1BP5 A;  5ET8 A;  2Z8E A;  2DVZ A;  5CMM A;  3OMB A;  2NWJ A;  4JDF A;  4HE1 A;  3H4Z A;  4FOR A;  4N6P A;  3K00 A;  5TPA A;  2G93 A;  3UN6 A;  3F11 A;  4MHF A;  3CFL A;  3OO8 A;  1NKX A;  2D3I A;  2ANJ A;  1UIU A;  2B4L A;  3C4M A;  5M2V A;  1DBZ A;  1VE4 A;  5L8D A;  2IEE A;  3DP4 A;  4ISU A;  2D21 A;  2BJI A;  2UVG A;  3DLN A;  5L9M A;  3HO7 A;  4RJZ A;  5FHN A;  3WAE A;  2QFL A;  4MEV A;  1PC3 A;  4ZZA A;  2XXK A;  5IZ3 B;  1NMU A;  3H03 A;  4QHQ A;  4FJP A;  1B40 A;  3FJM A;  4Q30 B;  3VVE A;  1HSL A;  2ZZX A;  3KJ7 A;  4BLA A;  3LSW A;  4XEQ A;  4JSO A;  1FPJ A;  1LFG A;  4N6K A;  5KCJ A;  4BDM A;  1M5C A;  1XI6 A;  1NUY A;  4NMY A;  3RLF E;  1LGB C;  2KR0 A;  4G77 A;  4YKJ A;  4OVS A;  3QUF A;  2O1L A;  4KXP A;  4QSE A;  4OMB A;  3WAF A;  5H8Q B;  1MY2 A;  2CEX A;  4DXU A;  1SW2 A;  4NAP A;  3UA8 A;  1TFD A;  4IO3 A; 
#chains in the Genus database with same CATH homology
 3D4C A;  4PP0 A;  4QRZ A;  3G3G A;  4DDD A;  3IAZ A;  3MBP A;  2RF1 A;  3RTW B;  1XVY A;  4OYV A;  3MVX A;  1AL3 A;  1B5J A;  3IJX B;  4HS7 A;  4OEU A;  4XKQ A;  1N0T A;  3Q25 A;  3USD A;  2O1M A;  3PGF A;  1SW4 A;  3GZG A;  5KDT A;  1B46 A;  3G3H A;  2FYI A;  1AOV A;  2RCA A;  1VSO A;  1MH4 A;  1Y3P A;  1JW5 A;  3SER A;  1UTH B;  3Q27 A;  3MWB A;  1Y4T A;  4LZ5 A;  4TOZ A;  2O68 A;  1LCF A;  2ZXT A;  4OVJ A;  2REJ A;  1RKM A;  3ZSF A;  4QFN A;  3M8U A;  1RYO A;  3IB2 A;  1OIB A;  4LAT A;  3FD3 A;  5AA2 B;  1B3H A;  3KOT A;  4KHZ E;  3CSB A;  4OES A;  2F97 A;  3OSQ A;  1JQF A;  3I3V A;  3GXA A;  2QPQ A;  3FVG A;  2F5X A;  3TTK A;  3S9L C;  2F36 A;  5CMB A;  3TPA A;  4R74 A;  4IO6 A;  1LFI A;  5CI5 A;  3SES A;  5IAI A;  1YAE A;  5AA4 A;  2XXU A;  1B2H A;  1IXH A;  1PBQ A;  2A5S A;  4KQP A;  1QVS A;  1MY1 A;  4ZZE A;  1P1Q A;  1B32 A;  4KCD A;  1P1N A;  1HSE A;  3GLB A;  4ZEF A;  2E1S A;  4JWO A;  3UP9 A;  2I48 A;  4FAT A;  2FA7 A;  3ILU B;  2XX9 A;  1VFD A;  1FQA A;  1PB8 A;  2CMO A;  4JWY A;  5JTY A;  5B7D A;  2VD3 A;  1D3K A;  4GIZ A;  4P11 A;  3RQT A;  5K2Y A;  4GL8 A;  3K1N A;  1ZMG A;  1YTV A;  5CRY A;  1ZBM A;  3O97 A;  1LST A;  3C34 A;  1N3X A;  2GHA A;  3PUZ E;  4DE8 A;  3B6Q A;  4PFT A;  3RUM A;  2CZL A;  4GL0 A;  3C33 A;  4EF2 A;  4IO5 A;  2V84 A;  1MDP 1;  3H7M A;  4ZEK A;  3VE1 B;  3UGW A;  3ZKL A;  4G68 A;  1PB9 A;  1JEU A;  1MY3 A;  3U1O A;  4MLV A;  1N04 A;  4F31 B;  3GBB A;  1FTL A;  3CSG A;  2XXR A;  5ELV A;  1EH3 A;  4FAJ A;  2NVU B;  2BJJ X;  2QL3 A;  2F8D A;  3IO6 A;  1T0K A;  2QRY A;  3T93 B;  1SD3 A;  5BUU A;  3PUV E;  1B1X A;  2DWJ A;  3HV1 A;  1B7H A;  1MQH A;  2WKY A;  1B58 A;  4YMA A;  2H9B A;  1NH7 A;  2HAV A;  1FQC A;  3EQ1 A;  3PPR A;  3Q29 A;  4GFR A;  4NED A;  3HPI A;  3JYR A;  1B7U A;  2XXV A;  3DP6 A;  2PVU A;  4KFQ A;  2M8C A;  4QF9 A;  2V3U A;  2HZL A;  4F29 A;  2XXH A;  3FUZ A;  3PUX E;  2Q8J A;  4O3A A;  4L17 A;  4PFU A;  3FV2 A;  1A40 A;  1Z7N E;  3K01 A;  5I2N A;  4GF8 A;  1I6Q A;  5I59 A;  3FXQ A;  4LON B;  4JSD A;  4NF8 A;  4DCX A;  4R75 A;  2Y84 A;  1FTK A;  3TCF A;  3M3L A;  4R9G A;  2UYE A;  4IY6 A;  4ZDM A;  4EQ9 A;  2ZNT A;  1FW0 A;  5TP9 A;  2XXP A;  2I0C A;  3VXB A;  4H1X A;  2DXR A;  3ODB A;  1LAX A;  3FXU A;  4JBZ A;  2HZK A;  4F3B A;  4ELQ A;  3MUQ A;  1LFH A;  2O7I A;  5FTH A;  3K1P A;  1H76 A;  3I5O A;  3CFX A;  1OLC A;  3KJT A;  4POX A;  5F7V A;  2DSF A;  2VOZ A;  2YPN A;  4BDN A;  4DIG A;  3MP6 A;  2OWT A;  3TYH A;  4M4G A;  1A54 A;  3H6V A;  4LZ8 A;  3THI A;  1H3D A;  2B3B A;  1OVT A;  3PV0 E;  1NNT A;  3MVZ A;  1B4H A;  4NF6 A;  4JXI A;  1A8E A;  3O29 A;  1PBP A;  4PE5 B;  1H44 A;  4GRK A;  2VD2 A;  4TLL B;  1DMB A;  2F6G A;  3RTF B;  1B6H A;  2NXO A;  4IGT A;  5ITO A;  3TEL A;  4NWC A;  4ZE9 A;  1MXZ A;  4IY5 A;  3PPQ A;  4DCY A;  2OK2 A;  3IX1 A;  1KWH A;  5H8F A;  2V3T A;  5LOM A;  5EHS A;  2ONK E;  2P0S A;  3HN0 A;  1P99 A;  2Z8D A;  4U4S A;  4X48 A;  1Y3N A;  1LB8 A;  2ABH A;  5AA1 A;  4C1T A;  1IXG A;  3U93 A;  1II5 A;  4Q0C A;  4MF3 A;  4YKK A;  4BDR A;  4EUO A;  1Y1M A;  4OEV A;  5K2X A;  4F2Q A;  4LUB A;  3FVO A;  2I58 A;  3UOR A;  3C32 A;  4HCW A;  5H8S A;  1SI1 A;  5TPA B;  1ZTY A;  3SEU A;  1IUD A;  4Q8R A;  3KSX A;  4DXB A;  1NNK A;  5L9S A;  4MFI A;  4P0I A;  1MRP A;  3TQL A;  2UVI A;  3M3F A;  1NNP A;  2QS4 A;  4EQB A;  3M3K A;  5ICQ A;  1ATG A;  2Y7I A;  1OQG A;  1R6Z A;  1MXX A;  1D4N A;  1NH8 A;  1UTB A;  2XXX A;  2GH9 A;  2XXW A;  3K0V A;  1GVC A;  1IZ1 A;  3CI8 A;  1B1H A;  2ZYK A;  3TAJ A;  3OD7 A;  5I2K B;  1QKB A;  1MY4 A;  3QUJ A;  5DEX B;  3BFU A;  1B3E A;  1US4 A;  2Q88 A;  3R26 A;  4TLM B;  4YKI A;  3RY3 A;  4RYA A;  2GRV A;  3CIJ A;  3VXC A;  2OCU A;  3T96 B;  3TEP A;  2NOO A;  3G7W A;  1OMP A;  3TMG A;  2V93 A;  4KYS A;  3KEI A;  2IA4 A;  3VDF A;  3PMX A;  2PX1 A;  3FAS A;  3VFJ A;  3MVW A;  3N6U A;  2F78 A;  3O6H A;  2NUV A;  3MZ9 A;  1N76 A;  5H8H A;  4YIC A;  2DE2 A;  2X7P A;  2YJP A;  2HEU A;  5KDT B;  5ICT A;  2DOJ A;  3PPP A;  3E4R A;  1L5T A;  1AMF A;  2AIX A;  2G29 A;  1TT1 A;  3S2V A;  5HBC A;  1JEV A;  5A5X A;  4GWO A;  4R2F A;  1XT8 A;  3W9W A;  2DE3 A;  2HCA A;  2DXY A;  1GR2 A;  3KN3 A;  4NWD A;  3L6G A;  2X7Q A;  3BKI B;  3PD8 A;  4DLD A;  2V3Q A;  1DPE A;  1Y3Q A;  2F6P A;  1B5H A;  4I9D A;  1M5E A;  4LP2 B;  1POY 1;  4EF1 A;  4FIM A;  4G8N A;  4H65 A;  1Y4C A;  4PFY A;  2O51 A;  1CB6 A;  4IO2 A;  4GOT A;  4H8I A;  3EHU A;  3FJG A;  2XD2 A;  2B65 A;  3PD9 A;  3MJN A;  1S9T A;  1MXY A;  2ONS A;  4FE8 A;  2DYX A;  2I6E A;  3O6G A;  4OHN A;  1FTM A;  3H6T A;  4K3F A;  4IO4 A;  1B05 A;  5AA4 B;  2ALU A;  4KPT A;  3KN7 A;  4RNS A;  5H8Q A;  4C0R A;  3K1M A;  3LSL A;  1ZLQ A;  1IIT A;  3H06 B;  4RPN A;  4E0X A;  4X9T A;  3TCG A;  4M1V A;  2D5W A;  5ISU A;  4DXC A;  4F1V A;  1Y9U A;  1DPP A;  5EYF A;  5FHM A;  1JET A;  4UA8 A;  3TFL A;  1A55 A;  4OER A;  2Q89 A;  4H0W A;  3TTM A;  2R6G E;  5JTY B;  4ZEC A;  2DWI A;  2H4I A;  1XC1 A;  1N84 A;  3DEL B;  4F3G A;  1YPN A;  4GLI A;  4MBP A;  3N26 A;  1UTH A;  4MLQ A;  1QKA A;  1GGG A;  3LSF B;  2R71 A;  1FQB A;  3FVN A;  2PBW A;  1F9B A;  4THI A;  5I58 B;  4R6Y A;  4R72 A;  3T9X B;  2PT2 A;  4QFL A;  1XVX A;  4R73 A;  5AA2 A;  2UYF A;  4UAC A;  4F3S A;  1N7W A;  3C9H A;  1MQG A;  1US5 A;  4WXJ A;  1R1N A;  1FTO A;  4NF5 A;  3V89 B;  2A5T A;  3HHG A;  3K4U A;  2F34 A;  2ESN A;  5HM4 B;  3QAX A;  1MH3 A;  4MH5 A;  4ELP A;  1BLF A;  1FQF A;  5H8N B;  2H5Y A;  4KYD A;  2UVJ A;  1MDQ A;  2Y7R A;  1EZP A;  5I57 B;  1SW5 A;  3SEX A;  1QUI A;  1SI0 A;  1M5B A;  4FEB A;  1HSJ A;  3G3I A;  3LSX A;  4ESX A;  1POT A;  1SBP A;  4OFJ A;  2I4C A;  4R6H A;  1URS A;  3O6I A;  2H25 A;  2QMX A;  4Q5T A;  1URG A;  3UIF A;  5I56 A;  2RC7 A;  1MQD A;  1MQJ A;  1S50 A;  2UXA A;  2XXY A;  4YZZ A;  4RXL A;  1IIW A;  4XTC Q;  4C1U A;  2QS2 A;  3D4G A;  3EHT A;  1J1N A;  1LBC A;  3FAT A;  1EZO A;  4AB6 A;  1VR5 A;  3IL1 B;  4ZE8 A;  3PPN A;  3MAM A;  3TUS A;  3K02 A;  1IXC A;  1P1O A;  2ZNS A;  4NF4 B;  3G3F A;  1JVY A;  3U8Q A;  3R7X A;  1ZIU A;  4OEN A;  3VVD A;  3FJ7 A;  3S9M C;  5TU0 A;  4AB5 A;  4U1O A;  3H6U A;  4HTG A;  2AL5 A;  1JNF A;  3RT8 A;  2B3F A;  2I0B A;  3OO9 A;  3BFT A;  3PMV A;  2DQV A;  4OFL A;  1DTZ A;  1PDA A;  1B3G A;  1MS7 A;  2QJE A;  1M5F A;  3MW0 A;  3CFZ A;  2P2A A;  2QS1 A;  2QMW A;  4F1U A;  1B0L A;  1RYX A;  2HQ0 A;  3FVK A;  1MY0 A;  4NF6 B;  3V8X B;  4ZED A;  2R9J A;  1OLA A;  3MPK A;  3S9N C;  3HHF A;  3IB1 A;  2PT1 A;  3C31 A;  3N94 A;  3ZKK A;  2XX7 A;  4TQU Q;  4RK9 A;  2O84 X;  4POW A;  3TTL A;  1BIY A;  1ZU0 A;  3IOU A;  3V83 A;  1Y20 A;  2REG A;  4H5G A;  5CM6 A;  5DVI A;  4H8J A;  4OQO A;  2XD3 A;  1DOT A;  4YB7 A;  2Y7P A;  3T9U A;  2E0S A;  1FQD A;  2OBG A;  1B7Z A;  1DTG A;  4QFK A;  2DVC A;  3QK6 A;  3CR9 A;  3FZV A;  2PMS A;  2XX8 A;  3IJO B;  4WEP A;  4RK2 A;  2P1S A;  2X26 A;  1ANF A;  3MVY A;  1IQ7 A;  5JEI A;  3LBS A;  1UTB B;  3KGC A;  4G4P A;  1FTJ A;  2YLN A;  1B0H A;  4G2Z A;  1MPB A;  3LC8 A;  4ZEB A;  3TOD A;  5HPQ A;  3Q26 A;  4EXK A;  2I4B A;  3KOS A;  1UIV A;  4BDQ A;  3PUW E;  5BWJ A;  3TQW A;  3OEN A;  4PQJ A;  3B6W A;  4I62 A;  5AA3 A;  3IOR A;  5CMK A;  4ZEI A;  4E0W A;  4U4X A;  4ELR A;  4PFW A;  5F1Q A;  1R9L A;  4YB5 A;  2QSX A;  5KCJ B;  1M5D A;  1IEJ A;  2ONR A;  1SDX A;  1ZJL A;  2V25 A;  1WVJ A;  3R6U A;  2I49 A;  3U92 A;  3V5A A;  3PPO A;  5AA2 D;  1XHY A;  3O28 A;  3K2D A;  2H98 A;  3E9X A;  1QJM A;  1QUJ A;  3L6H A;  4U23 A;  1JVX A;  3K6W A;  1MG1 A;  1MXW A;  5A5X B;  3T9H B;  1A8F A;  4ND9 A;  5CMC A;  2HXW A;  4F39 A;  3CG3 A;  1SVX B;  1FCK A;  1DSN A;  2VGQ A;  3LUY A;  1VFE A;  3U72 A;  4GQO A;  4ELO A;  1Q1K A;  5DYH A;  3E13 X;  3K6V A;  2AYS A;  3KFM A;  3BBR A;  5I2K A;  4H6D A;  5L9O A;  3OXN A;  4ECF A;  3LR1 A;  5DEX A;  4RA1 A;  1BKA A;  3VLW A;  1NL5 A;  3IOW A;  2UVH A;  1N7X A;  3VLV A;  3GBA A;  4G68 C;  5EHM A;  1UQW A;  1ZKB A;  4EDP A;  2DWH A;  1B51 A;  3CVG A;  3PU5 A;  4YMB A;  4KCC A;  4XXU A;  1TXF A;  1MM7 A;  2HFB A;  4X1B A;  1MQI A;  4OXV A;  3IR1 A;  3B7D A;  5I84 A;  1OVB A;  3TCH A;  3FIR A;  1I6B A;  4KYE A;  2RCB A;  3EF7 A;  2VP1 A;  2I3V A;  1LBB A;  1Q35 A;  1PB7 A;  3H6W A;  3A09 A;  3TTN A;  4OTE A;  1GV8 A;  4RY1 A;  2AL4 A;  2Q2C A;  3W15 C;  4ZS9 A;  3QIM A;  3EPE A;  4XKP A;  4X1D A;  4XKN A;  4O3C A;  4I8C A;  4NTL A;  5DVF A;  4Z0I A;  3O66 A;  4NF5 B;  1WDN A;  2A5T B;  1H43 A;  4GVO A;  3IK6 B;  3JZJ A;  1P1U A;  1S7Y A;  2Z23 A;  5IKB A;  3RPW A;  4EXL A;  1QW0 A;  3P7I A;  2RIN A;  1B3F A;  3A3C A;  3TZA A;  2F7B A;  2Q2A A;  3PMW A;  3QYT A;  5CC2 A;  3T22 A;  3T66 A;  1MPD A;  4RPO A;  1LAH E;  3W9V A;  1EZ9 A;  4BDO A;  4XKR A;  4FEC A;  4KI0 E;  4R6K A;  2LAO A;  3OO7 A;  3N6T A;  1O64 A;  4O3B A;  2XXI A;  3HCQ A;  4IGR A;  3DP8 A;  4F22 A;  2KLF A;  4R9F A;  4GXA A;  4G68 B;  3SEY A;  2XXT A;  3MP1 A;  2QS3 A;  5I56 B;  3IOT A;  3O2A A;  2Q9T A;  4N07 A;  3Q28 A;  3C35 A;  3AXF A;  3RN8 A;  3EN3 A;  3KG2 A;  4G8M A;  1ELJ A;  2GHB A;  4FED A;  3FV1 A;  5B70 A;  2ZYO A;  5CBR A;  1TWY A;  4PET A;  5I58 A;  1GTK A;  2HAU A;  2I3W A;  2O7U A;  1MPC A;  2OZZ A;  3IOV A;  1QUL A;  4OFO A;  5DVJ A;  2DS9 A;  4I1D A;  3H3G A;  3ILT B;  2RKM A;  3QSL A;  4F18 A;  4LZ7 A;  2Z22 A;  1PEB A;  4KD5 A;  1B5I A;  3U94 A;  1B52 A;  2Y7W A;  1LAF E;  1B3L A;  4F1Y A;  3K6U A;  1TFA A;  2F35 A;  5H8N A;  1SYH A;  5I2N B;  5I57 A;  1OQH A;  1WOD A;  5KZT A;  4NE4 A;  5I59 B;  2O6A A;  5CBS A;  3RNN A;  4P0G A;  1AIV A;  4NF8 B;  1MM6 A;  4KR5 A;  1YCJ A;  2PYY A;  3MZ1 A;  4YU0 A;  2XXQ A;  4U22 A;  4ONY A;  3PUY E;  2OWS A;  5TP9 B;  1CE2 A;  3HST A;  1O63 A;  3MP8 A;  1XOC A;  1XS5 A;  3S9E A;  4R2B A;  4IB2 A;  2VHA A;  2DE4 A;  4N13 A;  2OJT A;  3N5L A;  1MXU A;  1A99 A;  4HCY A;  3TTR A;  1Y1Z A;  2DP8 A;  3FXR A;  1Z7M E;  1I69 A;  4AQ4 A;  3RGY A;  4F19 A;  4F2O A;  1LCT A;  1JW4 A;  1N3W A;  5DT6 A;  3TKD A;  2O69 A;  4NF4 A;  4WKM A;  3KBR A;  1USY E;  3SKP A;  3MPL A;  3SDF A;  3KN8 A;  4EQ7 A;  1FQE A;  4QFP A;  3FGS A;  4GD5 A;  3RT6 B;  4OWD A;  5ITP A;  3ONM A;  2ZMB A;  1SQY A;  3OEM A;  2Z8F A;  4U1Z A;  1D9V A;  1P1W A;  1NFT A;  4YAH X;  2F7C A;  3CG1 A;  5JK4 A;  2ZYN A;  2GFE A;  5H8F B;  2F7A A;  2DWA A;  4F3P A;  3G3J A;  4IO7 A;  4H67 A;  1MXV A;  4ESW A;  1I6A A;  3SEW A;  4OZ9 A;  1QUK A;  1EU8 A;  2FNC A;  2W7Y A;  3E3K A;  3IO4 A;  1AH5 A;  3MC2 A;  3ECR A;  5FHO A;  1NNF A;  4U21 A;  1O7T A;  3VLU A;  1SYI A;  3SEV A;  4LVQ A;  3DM0 A;  2OLB A;  4JWX A;  3CRB A;  1D9Y A;  3EHS A;  4HW8 A;  1JW1 A;  1LB9 A;  2THI A;  5FTI A;  3VV5 A;  1LAG E;  1H45 A;  3SET A;  4YB6 A;  5J1D A;  2H99 A;  3O9P A;  3C36 A;  3OSR A;  3I6V A;  4WED A;  3MQ9 A;  4GXS B;  3B6T A;  3OEK A;  4QFO A;  4QSC A;  4LQ2 A;  4H5F A;  3A3U A;  4LQ5 A;  4G8H A;  1B4Z A;  3OEL A;  1BTJ A;  4Z7E A;  3IB0 A;  3TDJ A;  1IXI A;  4BDL A;  4YKP A;  1R9Q A;  1A7L A;  2ZNU A;  1USY H;  2ZYM A;  3S4U A;  2Y7K A;  4XIG Q;  3VVF A;  3G3K A;  1LLS A;  1SW1 A;  3ZS6 A;  3QXM A;  4DZ1 A;  4OET A;  4U2R A;  5AE4 A;  1B9J A;  3T9V A;  3JV9 A;  3KZG A;  2RC9 A;  2RC8 A;  4LA9 A;  4JB7 A;  3OO6 A;  3UK4 A;  3MZB A;  3K6X A;  2XHD A;  3OOA A;  5DTB A;  1URD A;  3KSJ A;  4QSD A;  5H8H B;  1BP5 A;  2Z8E A;  2DVZ A;  5CMM A;  3OMB A;  2NWJ A;  4JDF A;  3H4Z A;  4FOR A;  4N6P A;  3K00 A;  5TPA A;  2G93 A;  3UN6 A;  3F11 A;  3CFL A;  3OO8 A;  1NKX A;  2D3I A;  2ANJ A;  1UIU A;  3C4M A;  5M2V A;  1VE4 A;  5L8D A;  2IEE A;  3DP4 A;  4ISU A;  2D21 A;  2UVG A;  3DLN A;  5L9M A;  3HO7 A;  4RJZ A;  5FHN A;  3WAE A;  1PC3 A;  4ZZA A;  1NMU A;  3H03 A;  4QHQ A;  4FJP A;  1B40 A;  3FJM A;  4Q30 B;  3VVE A;  1HSL A;  3KJ7 A;  4BLA A;  3LSW A;  4JSO A;  1LFG A;  5KCJ A;  4BDM A;  1M5C A;  4NMY A;  3RLF E;  1LGB C;  4G77 A;  4YKJ A;  3QUF A;  2O1L A;  4QSE A;  4OMB A;  3WAF A;  5H8Q B;  4DXU A;  1MY2 A;  1SW2 A;  3UA8 A;  1TFD A;  4IO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...