4IO9Q

Crystal structure of compound 4d bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4io9Q00
3OW2R 1L3KA 1VQ4S 4WFAQ 1QVFR 2KHCA 3CTRA 2VOOA 1VBYA 3S8SA 1VC6A 4WKRA 2M8DB 5CYJA 3VF0B 3Q2TC 1PO6A 1ZZNA 1JJ2R 1VQ5S 2MKKA 1X4FA 2LEAA 1VQLS 2DH8A 2DO4A 1M5VC 2MGZA 3VAHA 1K73T 5IQQA 2DO0A 5DDQC 3UD3P 1VQ6S 3IWNC 2MQQA 2I38A 2KVIA 2LXUA 1M5PC 4V19X 1WEZA 2DGSA 2XS7A 1HD0A 3G4SS 1KOHA 2MZRA 2OSQA 3P5TL 3D2WA 1U1OA 1VC5A 1SJQA 1U6BA 1RK8A 1X4HA 2DIVA 3LQVA 3CPWR 1A7GE 3S01A 1W2BR 2J0SD 2KM8C 2N82B 2MJNA 2U2FA 4QPTA 3SXLA 2AYMA 4WFNQ 2FHOB 2LKZA 3TO8A 1UP1A 4FXWA 2MZ1A 4A8XA 4UY8T 3CCES 2HGNA 5CA5A 4TU8A 2MQPA 2KG1A 1U1KA 2F9JA 2N7CA 2LYVA 2DHAA 2EK6A 3PIOQ 3NNAA 2F3JA 3MD3A 3IRWP 1X5TA 3L3CA 2RS2A 1B7FA 1H2TZ 2GHPA 3VAKA 1YHQS 3I55S 1HD1A 3N9UC 2KN4A 3CC7S 1H6KX 2RRBA 3ULHA 1FJEB 2GO9A 2HGMA 5GAEU 2LECA 2MY7A 2B0GA 3CCQS 3CCRS 4PR6A 2G1DA 1DHMA 2J8AA 1U1NA 1M5KC 1ZZFA 1HA1A 2O3DA 3SMZA 2K3KA 1JJ4A 2JX2A 5D77A 2LMIA 1X4EA 4LIRA 3BO4A 3CUNA 2LEBA 4LMZA 3G6ES 2BOPA 1K9MT 2KT5A 3BS9A 1NU4A 1U6FA 3CMES 3HI9A 1YJNS 1U1RA 5LXRA 3DLLQ 3CCLS 1M5OC 2V94A 2X1GA 3MD1A 2MKHA 1SJ4P 4UQTA 3U1LA 4C0OC 3S7RA 3MXHP 1X0FA 2DGWA 5EN1A 3THTA 5LXYA 3SDEB 2OIHA 4P6QA 1G2EA 2CQ1A 2KG0A 1WG4A 2JWNA 1VQKS 3G96A 3EGZA 2MKJA 2M4MA 2D9PA 2MPUA 2KXHA 1R8PA 2D3OR 1VQ8S 2D9OA 1X4DA 2DNLA 3PIPQ 2AYGA 1QM9A 2HZCA 2MZJA 2RUGA 2CQIA 2DB1A 2MZSA 4F25A 1WTBA 1U1MA 2G4BA 2DK2A 1M1KT 2KRBA 2DNGA 1PGZA 2MGZB 3CCMS 5HO4A 4CH0S 1H2UX 2YH1A 2M2BA 1FNXH 2KFYA 3UD4P 3RW7A 2CQ0A 2MY8A 3UCUP 4QU6A 4TU9A 2MB0B 2AYEA 5ITHA 1QVGR 2CPXA 4ED5A 2RS8A 2M8HA 2CQBA 2I2YA 2CPHA 5DDOC 1S79A 2DGXA 2M88A 4IO9Q 3G8SA 2RRAA 1HL6A 2MYFA 3P3DA 2CPDA 1JJHA 1YI2S 5IM0A 2M9KA 3J7YU 4YOEA 2DH7A 2QA4S 4PKDB 1N88A 2ADCA 4TLQA 4OZ0A 2DNOA 2M7SA 2E5HA 5DM7Q 2OTJS 1YWXA 1K8AT 2YKAA 3US5A 4QQBA 4W92B 1D8ZA 3B4DA 1U2FA 3NS6A 5DDPC 3K0JA 1H2VZ 5LSLA 2JRSA 1WHVA 2MQLA 2M52A 4FXVA 2NZ4A 2CQ4A 1KC8T 4C4WA 2E5JA 3UWTA 2HYIB 1N52B 2KU7A 1WHWA 1RKJA 1KD1T 3CMAS 2FY1A 1X4BA 2YWKA 2NLWA 3FEYB 1WHXA 2KRRA 1FJCA 2DNKA 1VBXA 4EGLA 3CF5Q 3NMRA 1URNA 2MQOA 1OWXA 3G8TA 5D78A 1DBDA 4CQ1A 2DNMA 1WELA 3THPA 3P6YC 2MQMA 1FO1A 1OPIA 2CQPA 2ZJQQ 2ZJPQ 4Y00A 2RVJA 1VQNS 3J7ZT 1X5SA 2K8GA 3NNCA 3BO2A 4WCEQ 1BY9A 2Q79A 3I56S 2MHNA 4U67Q 4IOCQ 2L9WA 5CXTA 4ZKAA 2RNEA 1SJRA 2DGTA 3HHNB 2F9DA 2XS2A 2SXLA 2JVOA 2XNQA 3R1LA 5GVQA 1Q81T 1UAWA 1UW4A 1WG1A 1VQMS 1WEYA 5DETA 2EVZA 2KM8B 5DDRC 1SJFA 1M90T 2DNPA 3CC4S 1VC0A 1P1TA 4CIOA 2E44A 2MMYA 5JVHQ 3CULA 1VQOS 4ERDA 2DHXA 1N8RT 2G0CA 4WFBQ 1WHYA 5LJ3Y 1SJ3P 3UCZP 1U1LA 2X1AA 3UCGA 2KI2A 4PRFA 2E5IA 4F26A 3MUTP 3VAFA 2QEXS 3FEXB 1WEXA 3VALA 2EK1A 3MI7X 1FT8A 1YJ9S 2MSTA 2CQ3A 2X1BA 2XSFA 2CPIA 2HVZA 2KXNB 2CQ2A 2JVRA 3Q2SC 1OIAA 3H2UB 1ZH5A 1R8HA 3MUVP 4W90B 2OJ3A 1N54B 2M70A 1WF0A 1FJ7A 3B4MA 1NJIT 2PE8A 1VQPS 2U1AA 2MKSA 2DGUA 3G71S 2PEHA 1VBZA 1F9FA 1WWHA 2MKCA 3CCSS 1U1QA 4Y0FA 2ERRA 3VAMA 2YTCA 4Z2XA 1X5OA 2WBRA 1U1PA 2DITA 2AD9A 1D9AA 2DNRA 2MKIA 1Q7YT 4IOAQ 2LA6A 1WI6A 3R27A 4LJMA 2CPFA 5GAHU 3V4MA 2DIUA 3MOJB 2FC9A 4YUDA 3BEGB 1JMTA 4WIIA 2CQHA 2LXIA 5HL7Q 3MURP 3CCUS 3SDEA 5LJ5Y 1WF2A 2CQDA 3ZZZA 2KH9A 2CPJA 4F02A 2MSSA 1X4CA 2VONA 4RU2A 1KQSR 2LQ5A 2MQNA 3TYTA 3CXCR 5IFMA 1IQTA 2LCWA 2DH9A 2RU3A 1A9NB 2ADBA 3JB9k 2BZ2A 1FXLA 2DNQA 3TP2A 2DHGA 3MUMP 2J76E 2CQGA 1NO8A 3BO3A 1VQ7S 2KYXA 2J0QD 3S6EA 2CQCA 3EX7B 2CPYA 1SXLA 2DNYA 2OTLS 4WF9Q 2XB2D 3VAJA 1S72S 1UFWA 2A3JA 2DGVA 1WG5A 2RQCA 2CPZA 3P49B 2VOPA 2CJKA 1OO0B 3CC2S 2N3OA 1P27B 3ZZYA 2DNZA 2MZQA 1Q82T 1WI8A 1O0PA 5FJ4A 5JVGQ 3MDFA 3LPYA 2DISA 4J5OA 2L41A 2VODA 1YITS 2DHSA 1FHTA 2RT3A 1WF1A 5GADU 2FPHX 2AYBA 4M5DB 3RW6A 5IM0B 1KOOA 2DNNA 3R1HA 3VAGA 5GMKa 1AUDA 2UP1A 1X5PA 2OSRA 3NS5A 2E5GA 4QU7A 2HGLA 3VAIA 1XN9A 4OZ1A 2DNHA 1YJWS 2LA4A 2M0GB 2XNRA 1VQ9S 3H2VE 2ZJRQ 2MJUA 2DGOA 3U1MA 2X1FA 1Q86T 4C7QA 1YIJS 3DXBA 3CCVS 5LSOA 1CVJA 2FC8A 2RQ4A 1DRZA 2KXFA 4BS2A 3UE2A 4YB1P 2YH0A 4IUFA 2MZTA 5H1SV 5MLCV 5BJRA 3CD6S 1X4GA 4CH1A 5GAGU 5DM6Q 1YTYA 2L08A 2MXYA 2N3LA 2QFJA 3G9CA 3CCJS 1X4AA 1DZ5A 2CPEA 3EGNA 4TU7A 3NNHA 2XS5A 2DGQA
chains in the Genus database with same CATH superfamily
3SCIE 2Z8QA 1SKSA 4WP9A 4E98A 4FN5A 3DLHA 1NDCA 5KFZA 3CSKA 4Z7CA 2J9DA 3CEDA 2DPJA 1RP5A 4URQU 3HD1A 1R8CA 3I4HX 1T9YA 3TJ8A 4CZCA 1QVFR 1LW0B 5GMEA 4X64J 2R42A 3QT7A 4RW8B 1I1GA 1NHVA 4LF9J 1FRJA 4EZ9A 3SFGA 1QUPA 3VF0B 3W8PA 1C4AA 1REVA 3OT9A 1IKWA 1IQZA 2NS1B 3ETMA 2FLOA 5F0UA 1ZZNA 1RADB 4LRBA 4M5DA 5HBMB 3JSYA 4KO0A 1HD1A 2LEAA 1GMWD 3UW1A 1NSKL 1Q4RA 1ZM2A 3QAEA 1NLKL 1GMWA 9RUBA 4CLSA 2X1FA 3CDBA 4K2XA 2AIRB 1NK9A 1TL3B 1VS3A 1YK9A 4CLFA 1M5VC 4EI2A 3NBPB 4ZPWR 4EMDA 3KYLA 3ETOA 2ZHAA 3K2YA 4DUTA 2HHHF 3T5LA 2DO0A 2XEXA 1LK7A 4DF8A 1VQ6S 2ZBIA 4L6V3 2R2RA 3BSNA 2HLTA 5KFXA 4Q44A 2KVIA 2LXUA 2WVDA 1JLGA 4ECTA 2RE1A 1M5PC 3DNCA 2UUCF 2VFVA 5LT5A 1KOHA 3KLEB 3D2WA 2N7YA 1UEKA 2OPSA 3D3CJ 4F04B 3LPEA 4R25A 2DIVA 2RHSB 1QSYA 3BR9A 4RNHA 3X3UA 1RT2A 2H9ZA 2V2QA 5HSPA 4FS1A 1W2BR 4H54A 2N82B 1N0UA 3C16A 3I96A 3BDPA 4QPTA 2V4JB 2G0JA 2V68A 1UZDA 2Q43A 2AYMA 2IHR1 1MMNA 1S6QB 3HHLC 3KUHA 3NGKA 3SBMA 1HNZJ 2O1PA 1Q8IA 4FYYB 2KTQA 2P2CB 4LF4F 5ETQA 2KJWA 3C14A 5ETRA 3NY0A 1ACMB 1AXQA 2AX0A 5F3ZA 3FBBA 5FIIA 4ETXA 5J2NA 2HGNA 1NSAA 2UXCF 2R7TA 5U47A 4ZVPB 4K59A 4TU8A 4QIEA 1N5VA 2DHAA 3UN2A 3PIOQ 4RW7A 2F3JA 5KFIA 3MD3A 3MECA 4IFYA 3VTIA 1QSSA 3C15B 1H2TZ 2WAQD 1YHQS 3NOGA 2OEKA 2OPRA 1UVJA 3MPDA 3PJ9A 2MHEA 2E9TA 3DCAA 3LWLA 4RUBA 1UW9A 3UPFA 1RE1B 3T6JA 2RRBA 2AGPA 3PRBA 2GO9A 4FZVA 2HHSA 4DL0C 3C15A 1ZAWA 2ILYA 2AF6A 3K8VA 3KUGA 2G1DA 1LQ9A 2J8AA 2P6TA 3NCRA 3OFGA 4OI2A 4LSZB 2VZ9A 3O2IA 4R8UB 3J80U 4OZ5A 3PYFA 2K3KA 2ACMA 1JJ4A 4NEYA 5EUHA 2IVMA 1MWYA 3CJTA 2UXDF 1O8BA 2YPYA 4KE5A 2LEBA 2BOPA 2KT5A 5DRKA 4PXEA 4QYZJ 3HI9A 4XIUA 3AAWB 2YY3A 4RBTA 4USKA 2ZKUA 4ZK7M 3KK3A 4K4TA 5HP1A 1YJNS 5D8HB 3IAM9 1X8DA 1NKBA 2VA2A 3DDIA 3QBCA 3U1LA 3QJPA 3MXHP 4C0BA 1VRTB 2DGWA 2OO4A 3LP0A 3PHTA 4RUCA 5LXYA 4QWDA 4DFKA 1ULRA 1FCAA 3SDEB 2JDJA 4LSLB 4A47A 1H7XA 3J7A1 2AGQA 3DLBA 2CDRB 1NB7A 1KNZA 4LFBF 2ASDA 2CQ1A 2ZDPA 2KG0A 5DGAA 1F5BA 1TAUA 4ZJQA 1XC9A 3CWJA 4U6PA 1HBMB 1S59A 3ZTRA 2XLJA 2RSQA 1NK0A 2JWNA 4F3QA 3C6UB 4LT6A 1TMMA 3G96A 5G0RB 2IFXA 2M4MA 4KFBA 5F8IA 2BQ3A 4L73A 1HNXJ 2B56A 1GXTA 1FI4A 4DPYA 2XGPA 4GRSA 3G6XA 4GO7X 1RA6A 2HHWA 2MPUA 4CNYA 2D3OR 2D9OA 1VYAA 3PIPQ 4OX9F 2AYGA 1QM9A 4NLOA 2ASYA 3F44A 1RT6A 2BANB 4USJC 2HAFA 2V34A 1RWVB 4QR2A 5JJBA 3T5JA 1U1MA 1HI0P 4FNIA 4ETZA 5L38A 4F4YA 1Q5YA 4ZPCA 1SIWB 4J9OA 4ED8A 2WK4A 2DRAA 5THWA 3MM8B 4CH0S 3U1NA 2YH1A 1HWIA 2BV3A 5HROB 4YR0A 4DZDA 1JLAB 3UD4P 3J7YI 4GKJJ 1QJHA 1G4CA 4ALZA 4DU7A 2XYGB 2GJ2A 5E3CA 4KGKA 3EGVA 3J7AN 3Q8YA 2HRUA 3DGPB 4X84A 3IM9A 1JXLA 2VC0A 1S9GA 1UETA 1P9YA 2CPXA 2X3DA 3GJQB 4K4XA 1EX8A 2RS8A 2M8HA 2A6OA 2GQQA 3GCXP 3C6UA 1X31C 1YJ7A 3OUYB 2H51B 1S79A 1S6PA 2AEJA 4DR6J 3BB5A 1B64A 1FTRA 4O3RA 1HL6A 4ATNA 4ECQA 1W25A 3KLGB 3D68A 3PVXA 1SUQB 3BR8A 1UMJA 3P3DA 2HBRB 3O6QA 3R7BB 3SIPB 5IT0A 3GYXB 1C4CA 2QGFB 3IR7B 5HLFA 5C24A 1LWCB 1HPZB 1HI1A 3TA2A 2QA4S 4W4MA 3NGUA 5KT3A 2OKQA 1S1UB 1AW0A 4CT8A 3OL7A 2UXCJ 5I3PA 2V67A 3A8EA 3SCJE 1Y7PA 3GFXA 1F3FA 4QJVA 5KFRA 1I94J 4F2SA 4RR5A 4UF4A 1KS2A 5IWAF 2JC0A 1NJWA 3AQPA 3Q0AA 1HHQA 4USUA 5DM7Q 4A8YA 1HNVB 1MWQA 3IS9A 1Y3JA 1N34J 2YKAA 1K0VA 4QQBA 3HHLA 1Q0NA 3PX4A 4QR1A 5DDPC 2R7WA 3LAKA 2C2EA 4J9MA 4DR1J 4ECUA 4EO8A 4CLKA 3SSQA 3QSYB 4IQMA 2B7BB 2MQLA 2M52A 3MOZA 3QGIA 4ZP7A 3ZNUA 4C0HA 3QZ8A 1X0FA 1KC8T 1RAAB 3H5YA 1NPRA 5E7OB 3TZZA 4FYVB 1LNQA 4NXNJ 2KU7A 1WHWA 3D6MB 4ICLA 1FNMA 2ZD1A 3PJXA 2DTJA 3DM2A 5DS7A 5A2QU 2FY1A 1WC6A 5GAGI 2MKYA 1RYRA 2V2ZA 4OYMA 4DI6A 3HXMA 3T1AA 2RQMA 3M05A 2HW3A 1GXUA 3ZC4A 4OX6A 4DLGA 3W9HA 2BE2A 2RUSA 1R31A 2IAJB 4KYZA 5KFOA 3LWMA 1V5VA 2A2DA 3M9MB 4L72B 5B0CA 4U96A 4LRFA 2RHQB 2QC3A 3G8TA 2YKMB 5D78A 1X9MA 4X4RA 2UUCJ 2DNMA 1U2RA 1WELA 3MPUB 3LW5C 3HF5A 5EX0A 3VHQA 2ZJPQ 2DYAA 4Y00A 4H4MB 3A12A 4MKAA 4ZVTB 4DV1F 4B9TA 2AJ2A 2I0XA 1D3WA 4LSNA 2CJBA 2CNLB 5DGBA 4I68A 2G9OA 3M8PB 3UVJA 2Z56B 2GFFA 1B0PA 1VQYA 1PAUB 1RCXB 4F4AA 3D5MA 1PG5B 1QSLA 1RTJA 3I5BA 1QE1A 2J8SA 4DL4A 4FYDA 2IPOB 1S1TA 5E2QA 2ZEJA 3MEDA 3SYZA 2WVFA 4DHVA 4U67Q 4IOCQ 3VVTA 5CXTA 1UA1A 4M5KA 1TVRA 2W2NP 3JQMA 1VDHA 2DKOB 4HTIA 2XO6A 2Z2YB 2J7WA 2ZDOA 2SXLA 5D15A 4CNZA 3DRXA 3RTVA 3GSIA 4NLVA 1N5YB 2XMWA 5F8JA 5KG0A 3FBFA 3UFCX 1UCNA 2R8KA 2RDIA 2XZWA 4C8YA 5IT9U 4AQYF 1RYSA 1U8SA 2PD1A 1S0MA 1WG1A 5T14A 1RHMB 1VQMS 1UFKA 3QMQA 4JI8F 3OR1A 4OI6A 5DETA 2XGQA 4YS2A 5LMNJ 4JBCA 2WSFC 2GVZB 3TA0A 5DDRC 1RT7B 2HHUA 3FRZA 3R5JB 3MR6A 5A0YA 4WTOB 2QA4G 4AYBD 1VC0A 4WP8A 4CIOA 2B8PA 2MMYA 1IBCB 2QL5B 1R0BG 3HCXA 4KGXB 1HWJA 1N8RT 4C8ZA 1RHJB 1WHYA 3JYTB 4CO4A 5L1IA 1OSDA 1RTIB 3UCZP 4DR4J 3UCGA 2J9CA 1NHUA 3HLUA 2KI2A 2BOAA 3GCWP 1FK9A 5DJBA 1HMVA 1R27B 5C24B 3MUTP 1TQLA 1WEXA 3VAFA 2FJXA 2QEXS 4RW4B 2UU9F 2CADA 3ZZOA 1FT8A 4GO5X 2LDYA 1RAOA 3DHXA 1YJ9S 2X1BA 3UI3A 2CPIA 3I0RA 3QIDA 2LU1A 5H9FJ 3Q2SC 4HH1A 3QO9B 3QPIA 4GVBB 2ZH1A 2VBXA 4MKYA 3OTCA 5DZ7A 3T19A 4ZN3A 2ZH7A 4M5GA 2Z2MA 4DV1J 4ECXA 1WC1A 3GB0A 4LSNB 2Q66A 2NPFA 3EYZA 1JX4A 4LQ3A 1YJVA 1NJIT 3CGIA 2IC3A 2PE8A 1T05B 1SL0A 2U1AA 1D8YA 3NGTA 4BCAA 4U8VA 3G71S 2PEHA 3AT1B 4OLOA 4IDKA 1PILA 4CP5A 3W66A 3VQSA 2RD5C 4DPWA 3MMJA 3GIJA 1U1QA 2BQUA 2YWGA 1L3UA 4E0DA 3DRRA 2UUTA 2FGOA 2ERRA 1IR0A 2GMHA 2DR7A 2CVEA 4Z2XA 1QDUB 2UUWA 3M30A 3B6BA 2YWEA 2HHPA 3BV8A 4B3MJ 2AD9A 1D9AA 2Z58B 3EWGA 3QT6A 4IOBA 1QLNA 4DV5F 2VPXB 3AB2B 4OYAA 1S6UA 2Z57B 1UFLA 1LXNA 3HK2A 2ABYA 2YWWA 1N32F 2JNJA 3R7NB 3BKTA 2PEBA 4LIWA 1U2CA 4LJMA 1RKIA 1S99A 4UUXA 2UUAF 2AQ4A 2YKNA 2FHJD 1AB8A 1S1VA 2FC9A 4TNOA 4UOFA 3BQ2A 1PYOB 3AD8C 5LJ5Y 2L3MA 1WF2A 2CQDA 2PMHA 4U9RA 3HSGA 4WP3A 2MSSA 2KH9A 5LMNF 1S0OA 3UVJB 2ZOMA 1LWFA 5HQ8A 4J9NA 2E1PA 5EWGA 3DRYA 3QLHB 2Y1JA 1U24A 1TKTB 2BX6A 1D09B 2B6AB 4L3NA 4DV7J 1IQTA 3UR0A 3PW2A 3GIKA 1NK5A 2EEYA 3AODA 4DL2A 1WSVA 4HVZA 2BZ2A 4DV3J 2HQCA 2DHGA 1EKRA 3A13A 4PUOA 2CZVC 3GFHA 3MR2A 1JLAA 3RAMA 3BO3A 3ILOA 1JLCB 3BQ1A 1VQ7S 4LF6F 3V5RA 1S1WB 2Q3PA 4DV6J 2CQCA 1NSPA 2CPYA 1YRUA 5KFPA 1TMJA 4CI0B 4F4ZA 1SXLA 2PN6A 2RQKA 2DNYA 3GR1A 4AE5A 1CEZA 3AXKA 1T9WA 5A8KA 1RT1A 4U8YA 5E3PA 2DGVA 1JK9B 4DV7F 3DYAA 2RQCA 1RHRB 2CPZA 2XI2A 4JV5F 3TUJC 4ILLA 2VOPA 2Y1LB 1T9UA 1KP6A 1ZPVA 3DLKB 3N01A 3SEOA 3NAIA 2RF2A 2DNZA 4PXCA 3GMGA 5HANA 1NK7A 2W9BA 5K8MA 2R8IA 2DD8S 3C8YA 4KTQA 4AD6A 4KBIA 4NXMF 5FJ4A 5JVGQ 1T9TA 1IM4A 1JKHA 1FRKA 2BRKA 1E6VB 1FRXA 2F8HA 2ZWOA 3MDFA 4J9UE 4NE9C 2FGCA 4X65F 2XO7A 2ZM6F 3UQSA 3PW5A 3EMTA 1BUXA 1T03B 3OXFA 1S4EA 1FHTA 2IYGA 4I2PA 2QV6A 2C28A 2VL1A 3LALA 3R97A 5T7LB 4ZCMA 4MK9A 1KBRA 1CQMA 2AP6A 2GJFA 1BE4A 1MG7A 1K1SA 3BZQA 1FXDA 1QUVA 1AUSL 2DNNA 4N7TA 4DS4A 1N34F 3HO1A 1IJFB 2D69A 1FKPB 4DL3A 1T9XA 4G1QA 3J81j 3CD5A 1IUJA 2GMLA 2HWTA 1XR6A 3LTOA 4PPDA 2HGLA 3K59A 4UOHA 1N5QA 1XN9A 1AROP 2WW4A 4OZ1A 4G1IA 3HKWA 1U25A 3DOMA 2QLWA 3WIVA 1FWPA 2LA4A 5M2RA 4ZP9A 3I0RB 3M32B 4CO5A 5J2MA 1XERA 2I5JB 5K5MA 2LU2A 2E29A 2XNRA 1B0TA 4JYAJ 2J0WA 3PFEA 4USTA 4J9KA 3BKUA 3Q24A 2B5JB 4A48A 4DR6F 2MJUA 4NL5A 3MMCB 1HQEB 4QCLA 1TFYA 4RNNA 3EUNA 4C11A 3I32A 2W9CA 1Q5VA 1YIJS 4DU8A 2JZ5A 5ETTA 1CBKA 1GX6A 2QLJB 4CLPA 4C8LA 2IDLA 3TZWA 3KK2B 1GNKA 2J7KA 1DRZA 4HLBA 2QLBB 4LRDA 4YY3F 1JLFB 1TL7A 4YHHF 2V2KA 2XY5A 1SC6A 4I67A 3AOBA 3C14B 2FVCA 4O0IA 1U7LA 3DOKB 1M1GA 2C3MA 4ECZA 2HFUA 1B3TA 4B3RF 2H4YB 4ID5A 1TELA 4IFVA 2ZH5A 2HNDB 2IJFA 2LP4A 3CD6S 3H4BA 1TV6B 4L75A 2YX7A 5DM6Q 3J7Z5 3P4UB 2ZH9A 1YTYA 2MXYA 2W7OA 3FDSA 2VPYB 1X4AA 3CCJS 4DOZA 2C3UA 3KK1A 1SCJB 2W24A 3UNGC 4N77A 2DGQA 1M1HA 2KG1A 4AFFA 4B17A 2HMIB 4HHHA 1L3KA 3TEHB 2FZCB 1TK8A 2QL9B 2GC8A 3WQPA 1NK4A 4PAAA 3UDVA 4GKJF 4R5PB 3G6VA 3OTEA 3CB4A 3TQ1A 4DV4F 4J9PA 1CLFA 3GZ7A 2AJ4A 5F9LA 2D3O1 1VBYA 2QT7A 3BBCA 1S9GB 4IFVB 4WU2A 5IC4B 2YNGA 3KLIA 3ZTPA 4X62J 2PC6A 1Y9OA 1BHNA 4NZ0A 5DLGA 5GADI 1GEHA 2FVRA 4CWBA 2XCPA 1GH8A 2QL7B 2VFRA 2MKKA 3M4XA 1X4FA 3NG8A 1TL7B 3CO0P 2JJ4D 2W2PP 3DN9A 1XBWA 1HBUB 2XMJA 4RWXA 1VQLS 7FDRA 4DV4J 2MLXA 3KJVA 2GVDB 3HJFA 2GV1A 5KFAA 4A8SA 4J9LA 1REVB 3DFEA 1SH0A 5ETMA 5B08A 1PC5A 1F9EB 4P7VA 1RWXB 2IJNA 4OX9J 4IRKA 1K73T 1RWUA 3ZO7A 4QWCA 2ZITA 3FSIA 2ZOGA 1X7VA 2XLIA 2V8GA 1WSRA 5KFJA 4JI7F 3ZZRA 4N5SA 4O3PA 3M2UA 3EPIA 3OL6A 2W9BB 1RU2A 1JQGA 1NH7A 1SC1B 4P10A 3OTBA 5CZXA 2I38A 3GIIA 1U48A 4V19X 5J1NA 3RBDA 4YB7A 5H9FK 2XS7A 1HD0A 2OFHX 2MZRA 3MEDB 3P5TL 4IG0A 4NYZA 3PG9A 1J2VA 4RW7B 1U1OA 4LFBJ 4NYPA 1RK8A 3W8GA 2XMUA 3QJLA 1X4HA 3JQJA 1Y5LB 3KFWX 1HBUA 3HHLB 1ROFA 2UUBJ 3P96A 2KM8C 2J0SD 2HS0A 2OPQB 2L9NA 3SSSA 1ZETA 2HURA 1TUWA 5KG4A 1BWEA 2ILZA 1T3OA 3FNNA 4DJBA 3KLIB 5DQGA 3TI0A 3D0HE 3RRHA 2V4JA 3L9ZA 1HQ2A 1UP1A 2BJ3A 4FXWA 4M1KA 4RW6B 2MZ1A 3J81U 4DR5J 4A8XA 3V6DB 3V81B 1N36J 4JI3F 3AXMA 4PUOB 4OMFG 4R5PA 1S48A 3PV8A 4RU9A 4IR9A 4FF1A 2FJWA 4NLYA 4LR9A 3FBCA 2FUG9 1SKRA 2IBKA 4E2FB 3D6TB 4ED0A 2CNKB 2F9JA 3O5TB 4P9SA 3JSMA 5DLFA 3TAPA 1A6LA 1PSDA 3H0PA 3PACA 3TAMA 3IRWP 2GHVC 1X5TA 2VHGA 1O51A 5IV3A 3VAKA 2E1MC 3FJ2A 1NXIA 1TK0A 2FHKA 4Y28C 1DQ8A 5BYSA 3H90A 1TUGB 4EYIB 4FYWB 4JYAF 1H6KX 1FJEB 2W4CA 1UVMA 2HGMA 2LECA 2CZ9A 3QWUA 2YQ3A 4L76A 1HNIB 3ZTOA 2O67A 4RUHA 3CCQS 3K5PA 1DHMA 2B7CB 2R7UA 1URRA 1NUEA 2QMXA 3VGSA 1M5KC 3TR5A 1FTCA 4KV8A 4OYBA 3TUIC 2IA6A 4PG4A 5ADZA 4ZP8A 3SMZA 2ZVSA 2GMJA 2JX2A 1OY6A 1S6OA 4NCBA 1FVSA 3Q86A 2P8IA 3MM5A 3CUNA 1BC6A 1WNEA 3OHBA 1GFWB 5KG5A 1HWKA 3BS9A 4DSEA 1NU4A 2JSXA 3U02A 3CMES 2ASLA 2J7UA 3M1VB 1MMDA 5C25B 5LXRA 1Y00A 2OAUA 1HNWJ 2HSEB 2X1GA 3MD1A 2MKHA 2PMZD 2WW8A 4RPFA 4YQWA 5HMXA 4C0OC 2Z2ZA 3S7RA 3AJ2A 1Z4UA 3RR8A 3HM9A 1I6JA 3BGLA 4KHRA 3DOLB 3IC1A 3NGSA 2JC1A 1FDNA 2GQ2A 4F50A 2Y9HA 1FESA 4KPYA 3GIMA 3MFHA 5B09A 4KSEB 4JI3J 3M8QA 1VRUB 4J91A 1G2EA 1VIXA 5KFDA 2VC1A 1WG4A 3ET6B 2R2SA 2OGUA 2K1RB 2ZBQA 1J27A 1XQIA 4WWSA 4O3NA 1YVFA 5J2QB 3EGZA 3BH6B 2BMBA 2JL9A 2Y0SD 4X64F 2D9PA 4DN0A 2CG8A 2ZOFA 3HHLD 1N5TA 1FKPA 4D3HA 2ZKTA 2KXHA 3MM7A 4KGZB 2OELA 1I94F 3RUBL 4NXNF 3O1LA 2F7VA 2HZCA 1Q8LA 4U7UK 2MZJA 1TKZB 3BSCA 3GU0A 5KT5A 2G4BA 3HVWA 3KLHB 2UVWA 4DQPA 1HBOB 3IBCB 1AZSB 3IWLA 3TVKA 3NWRA 2Z30B 4DR1F 4CTAA 4RL1A 1N4LA 3CCMS 1OQ6A 2NREA 2E9RX 1HYSB 2Z2LA 1H2UX 3ENWA 1FNXH 2LFVA 5BYQA 3MR5A 2B51A 3HVTA 3ENAA 1PYTA 2BW2A 2MY8A 3UCUP 1FRIA 1RISA 5HI7A 2RJZA 1S1XB 4IDKB 4TU9A 2UXBJ 4M5JA 3MM9B 1R8AA 1S49A 3MHYA 3G2XA 1K47A 4IG0B 5ITHA 1MW7A 1FD2A 3W62A 4IYQA 4KHPF 5FDLB 3CJ2A 4PZVA 4ZLLA 4Y2CA 4DR5F 3L09A 4WKYA 2BJ1A 2CQBA 2RIJA 1RGVA 3HHDA 2DGXA 1TVRB 1N5SA 2M88A 5KFWA 1IBKF 2G2YA 2VPZB 4KHMA 2HHTA 2VG5B 2FVQA 1F5AA 2HMIA 1C1CB 2CZ4A 2UV8G 2R7VA 3CDWA 4LSLA 2MYFA 1DLOA 1KVIA 3DRSA 1ZA1B 2GVDA 2RAQA 4DFJA 1BQNA 3PO5A 4JP8A 1N32J 2HZAA 3PEJA 5IOLA 4LFAJ 4Z37A 4LFCJ 2OEJA 2PDAA 3FMBA 4CO1A 4YOEA 2DH7A 3GE9A 1HHTP 2EG1A 3OR2B 4MIWA 4PG6A 2J9DE 2ADCA 2Q1LA 1Z1ZA 5CYMB 1EP4A 2KZMA 1KR4A 5ETSA 4N8OA 3IR6B 5T41A 2BM0A 1TL4A 2Y1RI 2A18A 5T7LA 1YWXA 1K8AT 2I1RA 3US5A 3NEKA 1RT2B 4W92B 2JFDA 2ZHBA 1TUVA 3B4DA 1U2FA 3CJ5A 4I0WA 2XMAA 3A3OB 3LA0A 3CJ3A 3I6PA 4RO0A 2K7JA 1Q95G 5HK4A 5L8RC 3VVUA 2BQRA 3GV7B 4DUZJ 4A8FA 1VISA 1GXLA 4FXVA 2ZD1B 2APOA 5HVHA 1SL1A 4ED4A 2HQDA 3UWTA 3M2UB 1UZHA 1HI8A 3CMAS 4IKAA 5ETVA 2HNDA 1X4BA 5L1KA 4KY3A 4XPCA 2DEIA 3NBPA 3MM9A 4HI1A 1TU0B 2NLWA 1IJEB 3PTWA 4RNMA 3FEYB 4ECRA 3V4IA 4ZVGA 3G82A 4ECYA 2KRRA 2QA2A 3DXSX 1MMLA 3GYNA 1SVDA 1GK8A 1RAEB 4X4NA 3CF5Q 2G0IA 3S1TA 1KQGB 4BWMA 2NXUA 1IBMJ 1WDDA 3EZ5A 4DSIA 2MQOA 3QGGA 4RNOA 1OWXA 2GS8A 1DBDA 4F3MA 1B99A 1KTVA 2BJEA 3D0IE 3D4JA 4MIAA 3N6MA 4CQ1A 5HMWA 1N56A 1AFIA 3B78A 5BR8J 3R9LA 4DUYJ 1RACB 1FO1A 2MQMA 4M5MA 2ZJQQ 1CJKA 1KHWA 3T1YF 4F0KA 1X5SA 3QNWB 3J7ZT 3KLHA 3MZIA 2KKHA 2C2ZB 1P8GA 2POKA 2K8GA 3PR4A 5A8WB 2HVHA 4AL6A 2HWHA 3CNQP 3QYYA 4WCEQ 1BY9A 1DTTA 2HQIA 3GJSB 3TNVA 4DEZA 4FXDA 3KLEA 3CIMA 2MHNA 1IKXB 4PYDA 4ZITA 2GX8A 3FSXA 4EO6A 3QT8A 2DGTA 1S6PB 2DRBA 1IKVA 1UJ5A 2NZCA 4NRTA 4YY3J 2VQFJ 3M8PA 2VIHA 1YG0A 1NMEB 2JVOA 3QRRA 3CW2C 4OHXA 5GVQA 2F8EX 3RGIA 3NCPA 3DC2A 3IAS9 1FFWB 4LREA 2RKIA 3G87A 3RG6A 4ANDA 4ZIVA 5I3QA 2W2OP 5KFEA 5B0FA 3ENQA 4ES2A 2QX0A 2EFQA 4PQUA 2EVZA 2FY8A 4DQQA 4KKOA 4MYUA 1V9OA 4ED6A 3EPGA 1SJFA 3DDKA 2GAHC 1M90T 2DNPA 2DR8A 1MROB 1RB0A 3CC4S 3HVTB 3LP2B 4MT1A 1FFSB 3M8YA 1EKSA 2HRTA 4QWAA 2AJQA 1VQOS 1U6ZA 4ANEA 4HHUA 3UDCA 4XPEA 2IRUA 2AGOA 4WFBQ 1UTAA 2WB4A 3SXLA 2PFDA 1U1LA 3W7BA 4LF8J 1UVIA 3MMAA 2ZC4A 4PRFA 4X4SA 1FRHA 1XJWB 1HQEA 3MEEB 2UVUA 1TL1B 4UY85 4P74A 1N5YA 3DRPB 1H7WA 1S4FA 1ZTTA 2QTWA 4QR0A 1XTZA 3BGRA 4OZLA 1CULB 2I5JA 1KQKA 5KFQA 3C2PA 3AY0A 2HVZA 2W01A 2W2MP 4UOCA 4ZVUB 3ZZUA 1EETA 2KXNB 2NSCA 2JVRA 1HBNA 1VJQA 1KHVA 5D0GA 3H2UB 3IG1B 2ZBPA 2ZH2A 3CT9A 2VJUA 3R2DJ 4OHYA 2H3EB 4W90B 1K0TA 4OHZA 3CJ0A 4K4ZA 2O01C 2HIQA 4F7VA 2E7VA 2RB7A 1C0UB 4FKYA 4J9VA 5GAEI 5M2UA 4HT7A 1WF0A 3H5SA 5KFFA 1FJ7A 3PEHA 1OPZA 3JTNA 2MKSA 3M8QB 2DGUA 2EFOA 1NCLA 2LQ9A 2R7XA 4TYBA 5CQGA 8ATCB 3IN5A 1XK8A 2BEFA 1F9FA 1WWHA 1U47A 3SSRA 1AZSA 1QAJA 2DR9A 5KFUA 2YKOA 3A4TA 4FP9A 5H9EK 1TZ0A 5DG7A 1WKLA 5IWAJ 1RT3B 4ZPAA 2YTCA 1S0NA 1ICEB 1SV5B 5AE2A 2FQQB 1YZ7A 3EVMA 4O0NA 2B9XA 4DV3F 2DITA 2NUUG 4J9SA 1NB2A 3JAMY 4TXSA 3RBXA 1Q7YT 3K5MA 2FJBB 1CC8A 2YNFA 4DSLA 1FDBA 4WE1A 3R27A 1RT6B 2X7IA 1CS4A 4OYPA 2QYGA 1HFEL 2CPFA 1KDNA 1U02A 4OI3A 3QATA 3V4MA 4DV6F 3SV4A 2IJRA 8RUCA 3MOJB 1RCOB 3BEGB 3JTPA 3MM6B 3W2VB 1JMTA 1RAIB 1KQFB 4LF6J 1EETB 2CQHA 2LXIA 4P2XA 3QQCD 3NL0A 2JEIA 4CO0A 1S0VA 2UZAA 2CVIA 2VG6B 3AA9A 4LQ9A 4OJ3A 2CPJA 4F02A 2ZH3A 1X4CA 5RUBA 5IS2A 3ZTSA 1OSCA 2DR5A 2VONA 1NKCA 1UL3A 4CYUA 4NLSA 3CE8A 2WB1D 5E3RA 3JAMU 3CXCR 4DR3J 5IFMA 5C25A 1RSCA 2LCWA 1M1KT 2VU5A 2D74B 3HT0A 4TY8A 4DPOA 2YVSA 3SFUA 5KOWA 2JEGA 4PXBA 1JLCA 2ALYB 3CJSA 4B3MF 2JFKA 3CJKB 1FXLA 4ELVA 5KFHA 1YJRA 1KTQA 4PABA 2H54B 3JQKA 3L95X 3AH6A 1U0SA 3T41A 2GQCA 2HNYB 4DX5A 1W26A 3WC0A 3TANA 2GGPA 2MTLA 4YP3A 4OI0A 4DR7F 1IBLJ 1VQSA 5C42A 2H65B 1HW9A 2WVBA 2KYXA 2P9CA 3GFZA 2C2NA 4P75A 4A8OA 3BF4A 2J0QD 3EDRB 4PG8A 2F4VF 2ZBCA 4U95A 1JWWA 1NEEA 1BQMA 1RLDA 3C16B 1TR0A 4NEZA 5K8PA 1MN9A 2A6MA 2HNZB 1HKAA 2NYIA 2QG9B 5KFMA 3GFYA 3QLHA 4CLYA 5L46A 2LQBA 3VAJA 1S72S 2XSJA 3IGNA 3MEGA 2BE2B 4A4JA 4EBDA 2FVSA 1RWPB 3RAQA 1O6XA 5A6PA 4NA3A 5MAOA 1FKOB 2HFOA 3D67A 3FCHA 1WKJA 2CJKA 2VKZG 5AE3A 3GQCA 2KZZA 1P27B 3V6KA 3BN4A 1J5EJ 1OYEA 4DS5A 2AW0A 4OQJA 3LGNA 1XIQA 1UEVA 1PC4A 4DG1A 4JUZA 1RT5B 1HNXF 3KLVA 1RWNB 1Y3KA 2B43A 5BYRA 2OPPB 2B8QA 5HMZA 1REGX 3MPWA 2R8GA 3VQTA 2V4RA 3JYTA 3M9NB 4DCOB 1DJ0A 4X66J 2DISA 4J5OA 4QYRA 3GYGA 4X4QA 1L5UA 2LLZA 3T5HA 3Q23A 1UA0A 4JI1F 5C2CA 3LOUA 3D6FB 2WVCA 3EVOA 3OFFA 1RWKB 4QW8A 1ZM9A 3M6WA 1J5OA 2KT3A 3RAXA 2FPHX 2YNIA 4L74A 4M5DB 4OJHA 3RJMB 2AJ1A 5IM0B 1JLEB 3RW6A 1NJYA 4QOTA 5EWFA 4XO0A 1FJGF 3R1HA 4K4UA 1T3NA 4IH6A 5IXUA 2NPIA 4QWBA 4WYLA 2PA8D 2QIFA 2BKOA 3MEKA 1GT8A 1X5PA 3NS5A 2H48B 2ATCB 1PBUA 4QU7A 3BREA 4YMEA 2BE7D 3BBFA 2FJVA 4KHPJ 2FJAB 2E7XA 4MIBA 4NLDA 2CIMA 5K8NA 3O8WA 1X9SA 3H59A 2GJIA 2DNHA 1DURA 1B0VA 2NYHA 3RB6A 1DLOB 2C3OA 3M9OB 5D4PA 1ITPA 1Y11A 1U09A 3FQKA 4FPIA 5B7WA 4JOUA 2BVZA 4J37A 4DMZA 1VQ9S 2ZH6A 1V3SA 1BXNA 3KLFA 3FFIA 3N28A 1G6BA 1Q16B 1IKYB 4KJIA 1OS5A 2DGOA 1FK9B 2EPIA 5J2NB 4FVCA 3U1MA 4RW6A 4LBIA 3ELHA 1BQMB 4JI8J 2K3IA 1VRUA 3ZTQA 1RXOB 3WX8A 1Z2LA 3VGVA 1VBKA 4WJBA 1RTZA 4ECWA 5C42B 4JI2J 1CVJA 2J6SA 2FC8A 3EXYA 2RQ4A 3RB0A 4TN2A 2F1FA 5KT6A 4EFAC 1FDAA 3UE2A 1VI7A 4NX9A 2XTJP 4ILRA 3G82B 1LOUA 2W9AA 3RB3A 1KLMA 1NJZA 1VJWA 4URSA 1YQHA 4H4KA 4B3TF 5BJRA 3O3LA 1R8BA 2EKYA 2ZVIA 1HQUB 3BH7B 3EE3A 4HR2A 4TQRA 3WC2A 3A3PB 5AXLA 3L7UA 3F56A 3N5BA 4KAIA 4LRAA 4F3OA 4X2BA 2L08A 3PYDA 3G9CA 2LXFA 4F36A 2E5LF 3MF5A 2L9DA 1DZ5A 2CPEA 1F2HA 3EGNA 3NNHA 1WJ9A 2ZM6J 2XS5A 4DL6A 1YBUA 3SQGB 2GIQA 1FERA 1SPBP 1SH2A 3OW2R 2NR0A 1RTJB 3SV3A 2HG4A 1VQ4S 4K2JA 4X62F 1UKUA 1S97A 5F9NA 4BHQA 4YR2A 5LSRA 1QAIA 4MFBB 5F8GA 3PW4A 2XM3A 2VOOA 2ATLA 2EFNA 3MMBB 2Z0GA 3GG1A 4HEA9 4MH8A 2RILA 4O4GA 4E8UA 1SQEA 3S8SA 1Q1KA 5BXIA 4WKRA 5CYJA 2PMWA 3Q2TC 3AJDA 1PO6A 2DXDA 3T5KA 2FLLA 3GV8B 4B3SJ 3DOLA 1MWZA 1S1UA 4NOHA 2ZUAA 4UQGA 1JJ2R 1LW0A 4NLXA 1I51B 1VQ5S 2HS4A 3TEGA 3OSPA 1T11A 2HS3A 3MWBA 1IKYA 5JUMA 3CJQA 3HD2A 3MR7A 3C46A 1WACA 4CLTA 4FF4A 2DH8A 2R3VA 5B0AA 4LR7A 5L39A 2DO4A 3KK3B 2A2CA 4FS2A 2BJ7A 3F73A 2KHDA 5DG9A 2MGZA 3VAHA 4YDXA 1RTDA 4NMXA 3GTYX 4A46A 2B4UA 5IQQA 5DDQC 4DX7A 3Q8PB 2BA9A 2GW8A 3IR5B 3MM5B 3HFVA 3UD3P 4ZMMA 3I4PA 2PA3A 4OLPA 3KG1A 1LW2B 1OY8A 2BKPA 2MQQA 4DFMA 3MCSA 4DSJA 3ET6A 2ZZNA 2QLXA 4P72A 3ZZ0A 2DGSA 3LP1A 3RRKA 5CAAA 3G4SS 2OSQA 3TOQA 2MLZA 5BR8F 1SJQA 4DUYF 5CZVA 4QPXA 1UVNA 4P71A 2JLFA 2XLKA 1DAXA 4NLRA 5J1EA 3BGRB 4KFBB 3LQVA 3CPWR 3DMJA 1N36F 3S01A 1OQ3A 3K57A 1RTHB 4I69A 2MJNA 3KK2A 5KG1A 1YZ6A 1Z2ZA 1OY9A 3B82A 4H4KC 3J81Y 3M1VA 2Y8YA 4GVLA 3W2WB 1FF2A 2LKZA 2X51A 3A3NB 1F2GA 3H5UA 2Q6BA 3OXLA 1R43A 4V1Ak 4UOGA 4ZVRB 4TKTA 3MAHA 3PCOB 5I3UA 1VFJA 3TVZA 4UY8T 3O44A 4ZJOA 1OJ4A 3D1QA 5F41A 3H8YA 3V81A 4WK3A 1LFWA 2N7CA 4ES1A 4LR8A 3KHLA 4N56A 3BM7A 4X66F 1VHIA 2RS2A 1B7FA 3MMBA 2C2OB 4O4GB 4WYWA 3ILJA 5KFSA 3N9UC 3QAUA 4NWBA 2VB6A 4QIGA 4XK8C 3CC7S 5F8LA 3RB4A 1H72C 3P5BP 1J5EF 1KFSA 3THVA 4B9SA 5GAEU 2XI3A 4ZJLA 1FE0A 4PPZA 5AJ3F 1D9DA 3R2CJ 1PYSB 4DX8H 2GNKA 2YNHA 4CO3A 1NAQA 3EICA 4Q2LA 3GV5B 1TAQA 4LF7F 5EGYA 3GIRA 2VBYA 3HULA 4X65J 1B4SA 1D9FA 5D77A 2KDOA 2LMIA 4K50A 1SKUB 2AU0A 1X4EA 2IMOA 4LVOP 4EWTA 2ASJA 3CJKA 3EDQB 3G6ES 1P9QC 2JHEA 4BDPA 1YX2A 3ZNJ1 3E2EA 2QZ8A 1U6FA 3MM8A 4PXDA 5CCLA 3QZ7A 1U1RA 1R6YA 3OQ2A 1M5OC 2V94A 4B9NA 4WK1A 5HATA 5F0WA 1LEOA 5KFKA 7AT1B 2EBGA 1HW8A 5EN1A 2YPZA 4NCGA 1UPMB 4DR4F 4P52A 2W4PA 4K8RA 4GC7A 1WORA 4ZDNA 4DPXA 4QYZK 1N33F 5KAKA 2ZZMA 1VCTA 1LW2A 2VUGA 1CS4B 2BR0A 3PX0A 1JXVA 3D54A 1VQKS 3CIZA 2MKJA 1LXJA 3ONQA 1V3RA 4RWWA 4GVBA 2VKRA 4C97A 4ZPTR 4ECVA 1PJ6A 1R8PA 1VQ8S 4CT9A 1FKOA 2QLFB 1X4DA 3M30B 5EHHA 3OL8A 3QIPA 3JSMB 3CULA 1RQ0A 1N33J 1E6YA 4J9RA 4R0EA 2RUGA 3TZYA 2CQIA 2DB1A 4WFXA 4F25A 1WTBA 3OLBA 1MLAA 3NS7B 1CJKB 5K14A 5FLXU 4AXIA 2FVPA 2KRBA 5F3TA 3OPKA 2QN6B 3UDLA 2UXBF 3I5AA 1GMUA 2HQ3A 2R7OA 3PFOA 4ZCKA 5HO4A 1XMQF 1APSA 2YKMA 4NRUA 4ID8A 2FTRA 1RHUB 2DR6A 4QZVB 5B0EA 1XWLA 2AT1B 2A0FB 1RDRA 4HH0A 5K9FA 2A10A 2ZE2B 5HVFA 4B9UA 1RBLA 2CQ0A 2HFSA 3OLAA 1VIOA 2HK2A 4KH1B 4OV6A 3H25A 4FF3A 4QU6A 4LVNP 5A8RA 3OL9A 2MB0B 1FX4A 4TY8B 2QSFA 4K4YA 4Q45A 5CYQB 3RR7A 3FGVA 3BGFA 1QVGR 4LF7J 1F0XA 4RW8A 3KHRA 4F67A 2C2MB 2V9KA 2CWXA 3MAAB 4NASA 2F8MA 5E41A 4RW9B 1ZYQA 3HX9A 1RU1A 1YSJA 2CPHA 4M5NA 1QTNB 3BPDA 1U0HB 1HWUA 3PJWA 3VZHA 4C2MA 2BACA 3G8SA 4FNHA 3B54A 4LF2A 3MECB 1YKWA 3J80Y 2RRAA 4KR0B 3KDOA 1K1QA 1NSQA 2V8PA 3MM6A 3W2VA 1UVLA 2CPDA 3CO9A 4NCGB 1HNZF 2R7SA 1YLXA 4NPOA 5IM0A 5CD4H 3J7YU 2XYHB 3MAQA 2VF3A 3NP5A 3TX8A 4B02A 5EX3A 3B8HA 2HBZB 1JLFA 2VD3A 2WOMB 2HBQB 4RNFA 5CH7B 3UD5A 5A8KB 3IBWA 3BPSP 4RJVA 2BUNA 3QT5A 4PKDB 4PWDB 4N41A 5KOXA 2ZH4A 4ZVEA 1SJ1A 2Y0BB 1S1WA 1S6QA 4LBHA 4O3OA 3KWMA 1LV5A 4OZ0A 2DNOA 2EFGA 1SQFA 3BKFA 3OR2A 4FPRA 3QRQA 3Q8SB 3KG4A 2DHHA 1M5SA 1BGXT 4DCPB 1RT5A 2OTJS 2KYZA 1SIZA 2VJVA 4X4UA 1D8ZA 3MCMA 1ZA2B 1BD6A 1U26A 1E6YB 2PSZA 3NS6A 3OJSA 3QJJA 1H2VZ 1IKXA 3NKYA 3BGUA 3CCTA 1L3SA 2JRSA 3T1HF 1XMQJ 2VFUA 2PI5A 5E33A 5A76A 2NZ4A 4USVA 5ETPA 5SZTA 2E5JA 2HYIB 2HHXA 4IO1A 2EI5A 5B0DA 1N52B 1RKJA 2ZWPA 4OYWA 4NLUA 4O44B 1GTEA 4UZBA 2I9SA 2V8HA 1SH3A 2AWZA 3DLGB 1KD1T 4L3KA 3SI8A 5IQ6A 5LMUF 1PJ5A 3P45B 3MR3A 1S1XA 3R6LB 2CAJA 3EVWA 3OJUA 2FD2A 1WHXA 2NSBA 4I6WA 1FJCA 5DQHA 3ENVA 1VBXA 4YFUA 3DI6A 3ITHA 4H4OB 1L3TA 1FEHA 3NMRA 1YRXA 3K58A 5HN0A 3OFEA 3GR0A 2E7WA 1WKKA 1EHWA 1NJXA 2HQFA 3MTJA 4NMLA 2VPWB 3THPA 2Y1IA 1QY7A 1NK6A 3L7PA 3LO3A 1OPIA 1SV5A 2CQPA 2ZBRA 1VQNS 3D9BA 4RX6A 3HSDA 1MROA 1C0TA 4M8LA 4QW9A 3ZFVA 4YN3B 4KPCA 3VZIA 4KV8B 4OZ3A 3OBIA 4DV0J 2ZNYA 4A8KA 1EQMA 1YBAA 3NCQA 3TW0A 4DX6A 4O3SA 2L9WA 2VG7A 4NLQA 4ZKAA 3OFHA 2C42A 3W61A 3HHNB 2EW9A 1MU2B 3Q8UA 1RT1B 3R5GA 1ZAXA 4AXJA 1T94A 3Q8VA 4B9VA 5I42B 1EAYC 3AQOA 1UAWA 3ILIA 2FZGB 2QJ3A 2ZH8A 2EC0A 3ZZTA 2AJ0A 4YB6A 3TAMB 1WEYA 2K06A 5LM7E 4F4KA 3CJ4A 1HWLA 4ZP6A 2YKNB 1WOPA 4JI6F 4C3MA 1HPZA 1R3NA 4DL5A 1FDDA 5AE1A 1TL1A 4ZLPA 3V2UC 4DQRA 2W7PA 2CG4A 2E44A 5JVHQ 1Q8KA 2LVWA 2G0CA 1YBTA 3KG0A 2GIRA 3JS9A 5A2QY 2X1AA 2QRRA 5ETKA 2OI2A 3DM2B 1TKTA 3G8QA 4C3LA 1HHSA 2E5IA 3LP2A 4F26A 1JNRB 5EDWA 3FEXB 4DUZF 4Q8FA 2EK1A 4WFZA 3MI7X 3BYPA 3F41A 2V4QA 2F4VJ 1Q7LB 2MSTA 2XMVA 2CQ3A 3D3BJ 2WTFA 2XSFA 1HR0F 5KT7A 1NDKA 4JI4J 2BYCA 2CQ2A 2XMKA 1ZTWA 3I0SB 1TK5A 4EU0A 3OTOF 1CULA 3TARA 3HT3A 1Y5NB 2F40A 4EUVA 4WE1B 2YXLA 1N54B 3HSZA 1TKDA 2OJ3A 3TAQA 3B4MA 4TLRA 4JI0F 3QGPA 5KG6A 5HROA 1VQPS 3QO9A 3PX6A 3PY8A 4C8KA 2B9WA 3HP6A 4Y6IA 2RU9A 4IRDA 4P2FA 3M2VB 1DTTB 2IBOA 2VDHA 3OTOJ 2DBBA 3MFIA 4I64A 3FBEA 2JLGA 2YWHA 1FEEA 3PDNA 1IM6A 2KL8A 2DXFA 1S5ZA 1VRQC 4QIWD 4RLEA 3E01A 3DLEA 4M63A 4PQAA 2Q6CA 3W5XA 2WBRA 3IBFB 1U1PA 4JI5J 3KMQA 4OZ2A 2DNRA 1X9WA 1O5JA 2B6AA 4IOAQ 1JIHA 1XMBA 1R0AA 4BLGA 1WI6A 1RWWB 3PRDA 1R0CB 1RLCL 5HVGA 1QTMA 1C0UA 3IMQJ 3L4BC 5ETNA 3W63A 4M5HA 3TZXA 1YGYA 2BJ8A 3PW0A 1HBMA 1MU2A 5GAHU 3PZPA 1DQAA 3H40A 5A6WA 2R2UA 2VFTA 2KFNA 2D7SA 2W7AA 5DO2A 3V4IB 3P8BB 3EGWB 2OD6A 2CDQA 4WIIA 1M5HA 4CM0A 3MURP 2DCLA 3H5XA 3LGHA 2EWHA 4NI2B 2M5YA 2H4WB 1U0HA 1CJVB 1UPPA 3LP0B 3V6JA 5J2PB 2V9WA 2E66A 2BABA 2CJQA 2QSWA 2YX4A 4OI4A 4RW9A 3BBBA 4KIAA 4B9LA 4RU2A 5HQMA 3AJ1A 4K4WA 2LQ5A 1RBOB 1PCAA 2V50A 2WSCC 3MEEA 5LL6d 3TYTA 2FLPA 5HP1B 1U4BA 4EBEA 4Y3CA 3KKFA 3Q8QB 4OZJA 1LWEA 1ZAVA 1UEUA 1A9NB 3H4DA 5DQIA 3M8SA 3JB9k 1NM2A 3ISNC 1S77D 3TP2A 5K20B 3MUMP 2YNIB 3GLJA 3W64A 2OUGA 4NZ6A 2J76E 2GHWA 2WOMA 2CQGA 3VWSA 4NXMJ 2XULA 3A8JA 1FNOA 1UJ4A 2XZTB 1FXRA 3OR1B 2HRYA 4KQZA 4X4TA 3UDEA 3S6EA 3EX7B 1WD6A 4KRWA 3DLGA 4OV1A 5K14B 4Y2IA 2OTLS 4ERDA 3A8IA 1LWCA 4WF9Q 4HDHA 2B5JA 1UFWA 2QMWA 3ZXWA 4DG1B 3R8YA 4RUAA 2A3JA 3AHPA 4FYXB 4EBCA 2D41A 1WG5A 2B9EA 2HZVA 5JXSA 1S7IA 2ZNZA 1EQ0A 4NLPA 2VG5A 3P49B 4YEAA 2HFNA 2DCUB 3CC2S 2VFSA 2W1BA 4CDIA 2N3OA 3ZZYA 3BQ0A 2V69A 4MAKA 4C8OA 2MZQA 3UO0A 3TWZA 2XSJB 3LUYA 3MEGB 1Q82T 1NDPA 2J0XA 3T6BA 3N5FA 1SB6A 4JV0A 5FDLA 4USHA 4M5IA 2YKQA 3HZEA 3OD2A 3TQEA 1RWMB 2HQGA 4CLZA 1R0AB 2WBMA 4HL9A 1SC4B 4Y34A 3AB4B 3LPYA 3PR5B 4KGMA 5IT4A 2L41A 2VODA 1YITS 4PWDA 1F3VA 5KT2A 1A0OB 2AZ3A 2DHSA 3AD9C 1MSWD 1JLEA 2J6UA 4I2QB 1CG2A 2EBEA 2IAJA 3E8OA 2AEMA 2PFFB 1I3OB 2VBZA 2KT2A 2LDIA 3K8WA 5D4NA 2VQEF 2FYXA 2WVEA 1KEKA 4IRCA 5AXNA 1HYSA 3M2VA 2Z4PA 2HKEA 4C6AA 1Q53A 3DDNA 5GMKa 2XG8A 4PYAA 3W2WA 2R8HA 4ED7A 1AUDA 4C11B 2W9CB 1BMQB 2OSRA 2BW7A 3N6NA 2E5GA 3JTOA 3PKYA 2BRLA 4I7FA 2BANA 3VAIA 1ZH5A 1Y0HA 1CJTA 2G2ZA 1VLOA 3UR3C 5J2PA 4IH5A 2VG6A 3K89A 2C3PA 3T1HJ 4J9QA 4G1PA 1GAOA 5KFTA 1QD1A 2I8EA 3MM7B 2DRDA 2M0GB 3KJVB 3DU5A 5L9NA 1H3DA 3FEZA 1N0VC 2PIIA 2YQ1A 3I9V9 5D0RA 4NA2A 3OUYA 3GG0A 4JI7J 5HAOA 1Q86T 3OSNA 3N0VA 4C8NA 4C7QA 7FD1A 3EM1A 2IA0A 3AOCA 5CYMA 4JV1A 2KVQE 1JLBA 2N4CA 1EARA 3CCVS 3W5ZA 4DWIA 4G3IA 4DPUA 2GGPB 3DHWC 4XDCA 4ED3A 1KSPA 3NRBA 5HLFB 5IT9Y 4DV5J 5IV4A 3L7OA 4CRJA 2E5LJ 4OYOA 5I3UB 4YB1P 2HHVA 2OMOA 3H20A 4NYOA 1N48A 4IUFA 1UWBB 2B3TB 3GJTB 3IRXB 4DPTA 5H1SV 1HNWF 5MLCV 2NQPA 4DR2F 4EYHB 3T9ZA 3IA0A 4ZHRA 1X4GA 4ICLB 5GAGU 3N6LA 4CH1A 2HAIA 4A8MP 4CYUB 1G1XA 3RBEA 1CJUA 1JLQB 4LF5J 1LWFB 1IWAA 2IM1A 2RF2B 4K5RA 2FB0A 3WX4A 1T02A 1S9EB 3DGVA 4UT4A 2FIUA 4TU7A 4OX7A 6FD1A 2VQFF 4OJGA 1TL5A 2ZFHA 1S9FA 4N8NA 3QFWA 5JMNA 4EEYA 1S76D 1HLWA 2OFGX 2H5EA 3ZZPA 2FJDB 2J6TA 4WFAQ 4HYKA 4AL5A 4C9DA 3FUYA 1MNEA 3DRPA 3EXCX 5HBMA 2KHCA 3CTRA 2BDPA 5E3AA 1CPZA 3K7RA 3MAAA 4N76A 1XNRF 3LANA 3PXGa 4B3RJ 5CYQA 4ED2A 1VC6A 4GC6A 3WHIA 2M8DB 1PBAA 4WTYA 3LH2S 4OX8A 4PEOA 2HIYA 4GMKA 2PT0A 3DRRB 3ITHB 4PCQA 4EK2A 4Q0BB 2IVYA 3KMSA 2OH2A 2UXDJ 3R5BA 2FJEB 4NZ7A 2DY9A 1C2PA 1BQXA 3HJVA 2CJYB 5KFGA 5L9XA 2YNHB 3KLGA 4G6VB 4DR3F 3LP1B 4I6AA 3K5LA 4A8WA 1DFDA 5IC6B 3DOMB 1WC3A 4C3KA 2LQ8A 5I42A 5D6GA 1UVKA 3M8WA 4MFBA 1CJUB 1JLQA 2J5AA 3CD7A 2V63A 2R9LA 1HR0J 3RRGA 2D1CA 2K1RA 1F5CA 2DPIA 4TVAB 5SUHA 3FK4A 3VGTA 1C1BB 3UN5A 2UUBF 1WEZA 2WHOA 1RTDB 2MEWA 1U6BA 3NWGA 4HHJA 1VC5A 4HDGA 2E1AA 1P6TA 1NHKL 2J9EA 3H42A 3AOAA 4OHWA 1A7GE 2BBEA 1CJTB 1VK3A 1FWLA 4NLWA 4ZLNA 1D0EA 1RAJA 1NK8A 3R6GB 3VCDA 4OFZA 4DCJB 1YRTA 2R4FA 2U2FA 3FZBA 2CUYA 2PO4A 2HEKA 3NGDA 4DQIA 3M6VA 4WFNQ 2FHOB 4JI6J 4DN9A 4P2MA 2V2VA 4DR2J 1JKHB 1RA7A 3Q22A 3TO8A 2C2RA 3M2RA 2GZOA 3LAMA 3RZAA 2OPQA 4AUKA 2OEMA 1RTHA 3CCES 5ETLA 2QA1A 5CA5A 1S10A 4OJ1A 2MQPA 3Q89A 2CNOB 3PNIA 1T9VA 1U1KA 2LYVA 1LWEB 2EK6A 3NNAA 5K8OA 2YNGB 3Q8RB 4R8UA 2RKIB 5AJ3J 3L3CA 1S9EA 1HNIA 2GHPA 2V8VA 5FD1A 3FCWA 3T9NA 4DZ6A 3I55S 1K44A 3M6XA 3GONA 4ZIWA 4HT5A 1LWXA 1V5IB 2KN4A 3DU6A 4PG5A 5KG2A 2C2DA 2IYIA 1RT4B 1NDLA 1RJJA 4TYAA 3JSBA 5J1PA 1U45A 1NKEA 5KG3A 3ULHA 2DY1A 2MY7A 2B0GA 4BC7A 4C48A 2XBPA 4PR6A 5CCMA 4IFYB 3CCRS 2VDIA 4OYIA 2OMLA 1U1NA 2A1BA 3Q83A 2VA3A 4DSFA 1ZZFA 2D3ZA 3IXQA 3MCNA 5E5NA 1HA1A 1SC3B 2O3DA 2ROGA 2W2QP 1AFJA 4OZNA 2CJ9A 4LIRA 3BO4A 1RHKB 3KJQB 2CNNB 2KO1A 4ZPVR 1U49A 4LMZA 3NXZA 2YKPA 4KB7A 1LFPA 4LF1A 4ZA1A 3G6YA 1TKXB 3C19A 1K9MT 1VK8A 4Z7YA 1SI9A 2F4FA 3H98A 4B9MA 3X1LB 4HKQA 1AT1B 3DOKA 2KFZA 5LOQA 5GAHI 2QFIA 3DLLQ 3D7SB 3CCLS 1GQEA 1R6VA 4I6YA 4I4BA 1SJ4P 1F6TA 4LUBA 4P73A 4UQTA 5E0OA 6AT1B 3KOAA 2RH3A 2OP5A 1RAGB 2ZZTA 1RT7A 3KLFB 3THTA 3WBZA 2OIHA 2C3YA 5C5JA 1C1CA 2CWKA 4AT1B 4P6QA 3W1YC 1PIEA 3HFKA 4XDDA 4B3SF 3TX0A 3CDUA 3PYEA 1XEZA 2DT9A 5CABA 1RT4A 1WTFA 3GP9A 4R0JA 1XMOF 2LEPA 2R7QA 4ECSA 2HVDA 3LGMA 3EZOA 2XQCA 3OVBA 1IN0A 4X4PA 5D0EA 4JV2A 3SZ2A 1S1TB 2DNLA 1KLMB 1TP7A 1JNZB 1VHFA 2AJFE 3M6UA 1WOSA 3WDOA 4EZ6A 3T1YJ 4B3OB 1F60B 3IFEA 9ATCB 2HVEA 5AXMA 1RAFB 1PJ7A 2MZSA 3RYLA 1J5OB 3OVSA 2BXJA 2G13A 4H4MA 3QGHA 1RZMA 2DK2A 3FSYA 3IP0A 2W8KA 1KKHA 2DNGA 2WONA 1PGZA 2R7RA 4OYZA 2MGZB 1DQ9A 3OTDA 4PG7A 2IMWP 3TUPA 4F0HA 4F4XA 3FC9A 2FLNA 1HBOA 1U8WA 1VMBA 2HNYA 2M2BA 3MMCA 3D1HA 1H98A 4UUWA 3RU0A 2KFYA 4UTGA 4M95A 3VV2B 3RW7A 1BQNB 3KHGA 3ADAC 3W9IA 1T03A 3D1OA 4BWJA 3SQOP 2B9YA 4CLLA 1OMSA 2OPSB 1GX5A 1FE4A 2AYEA 2IVFB 1PKUA 2BJDA 5KFCA 3OHAA 4HTJA 2OLWA 1UJ6A 4ZVOB 2H1YA 3R5AA 4JI2F 5M2PA 3KK1B 2E1CA 2RMLA 3TVYA 3UNYA 2UVRA 4ED5A 4DV2J 1Y10A 3R5CA 4DDFA 2I2YA 2QE5A 3GJRB 5DDOC 2JEJA 1EJ7L 1X60A 4KGVB 4RKUC 4G1QB 5HJXA 4CO2A 3NOCA 5D4OA 4IO9Q 3ISZA 4ID5B 4DL7A 3FKBA 2GCFA 2Y8WA 1ZOTA 1KLNA 3H2LA 1TL3A 2AV5A 2CXEA 5C7PA 1N6QA 2FDNA 1RI7A 2YBVA 4W98A 1JJHA 5KFYA 1YI2S 1WOOA 2M9KA 5G4DA 1IWGA 1NH8A 3BSOA 4DFPA 2DXEA 3W9JA 1T7PA 3AFGA 3IM8A 4O4RA 4K4SA 4UW2A 4X4OA 3TUZC 2GVZA 4F2RA 1N88A 4LBPA 1IKWB 1SKWA 1T0TV 2EXUA 1KN6A 3W65A 5B0BA 2FHJA 2W25A 3U7JA 3C3LA 1JJCB 4TLQA 4WXOA 1IBLF 2M7SA 6FDRA 2E5HA 3QWPA 3PRVA 2AMCB 1TKZA 1FJGJ 3M8ZA 3DMJB 2HPUA 2ROEA 3POTA 1IR1A 4NI2A 3K0JA 1N6QB 1NZ8A 3PHEA 4I1TA 2FHMA 3CMQA 3D0GE 1YJTA 4O23A 3KHHA 2LQJA 5LSLA 3UN3A 1WHVA 2UU9J 4ITSA 2IC3B 3PYGA 4RZRA 1S12A 1T05A 2CQ4A 4O44A 4DSKA 4C4WA 1RUSA 5J2QA 2ZC3A 2EFPA 3HVAA 2C22A 1CC7A 5KFLA 3V6HA 4NLTA 1WC4A 4ELTA 2K2PA 5KT4A 3AA8A 4ANCA 1GMVA 1HBNB 2I6WA 2WSEC 4WZMA 4Y2KA 4ZVHA 4QWEA 2YWKA 3DGPA 4J7CA 1FD8A 3W60A 2GIFA 3DLEB 3M7VA 4ENOA 5FLXY 2R8JA 1XNRJ 4U7CA 2DNKA 2CKWA 2B4VA 1NNDA 3BSAA 3IWXA 4MYTA 4EGLA 4URGA 1CQNA 2MDAA 3CDAA 2V8DA 2X3GA 3OV7A 3BJYA 4FBTA 2HVIA 1URNA 1YJUA 2ROPA 4ZVFA 5KFNA 2JEFA 4ZN1A 4ZPBA 3SCKE 3FZ2A 1RTIA 2XC9A 4AQYJ 3BYRA 1JLBB 2M3DA 4DQSA 3OVAA 4JI1J 2AX1A 2YX1A 5IZHA 2IY5B 4ZCIA 1KWMA 2WZ1A 3P6YC 2KJVA 1S7HA 4ZCLA 3E3XA 2RVJA 2XMTA 3G86A 1G3OA 2NUHA 3IGVA 3K5OA 5AT1B 1NRKA 1DTQA 3E51A 3MPVA 4H4OA 4ZVQB 4K0KJ 1SQGA 5A0YB 2P9GA 4Q0BA 3NNCA 1UWAA 4OIXA 5CD4A 1PAEX 2GO8A 3BO2A 3CCWA 1T8EA 2QYCA 3DLKA 2Q79A 3I0SA 3I56S 2HHHJ 1P1LA 2COLA 1WUUA 2HFVA 2N4DA 2XHCA 3TA1A 3I82A 4OHVA 4YDDB 1Q78A 4JI0J 4Q2MA 2RNEA 1S1VB 1SJRA 4GKKJ 2F9DA 3KUEA 1I5OB 2MLYA 2XS2A 2P9EA 2WRMA 2IIHA 2HFZA 2BKNA 2XNQA 1YDLA 4NCAA 2XWXA 3R1LA 2JH3A 1OYDA 4KT0C 1Q81T 1CJVA 2KB2A 2YNFB 4USIA 1UW4A 2V6AA 3TJ9A 3VR1A 1H0HB 1ZM3A 4LFAF 4LFCF 3DLJA 3I87A 4IH7A 2EFVA 1GTHA 3HMJG 2KM8B 3PO4A 2B4PA 4M5LA 1VRTA 5A8WA 4K5SA 4ELUA 1FX2A 2ZE2A 1WC0A 1Q79A 4F0MA 1IXKA 1FVQA 1HMVB 1P1TA 1S57A 2NXJA 4DF4A 3V6DA 1D1UA 3GWCA 3EZUA 3H7HB 4FVMA 2Y3YA 4PWWA 4KKOB 3RBZA 5C2GA 4YHHJ 1EP4B 1XR7A 2DHXA 4MTPA 1FRMA 1JB0C 4Y2MA 4YB5A 4OI1A 5LJ3Y 1SJ3P 5DZ6A 2JOQA 4MMOA 1V6HA 3HVRA 3NMAA 2XHWA 4MK7A 4Q5VA 3T3FA 4IG3A 4M94A 4Q8EA 3VALA 1M0SA 4K7QA 1SL2A 4JI5F 4CH7A 4B3OA 4CLUA 3OXGA 2UVVA 3QIPB 4LF9F 5LMUJ 3FCVA 3IWNC 4ILMA 3KNAA 2EC2A 1DARA 1OIAA 1W7WA 4NA1A 1XMOJ 1EB0A 3LF0A 3D6HB 1R8HA 3I5CA 2DJWA 2UV8A 3ILLA 3MUVP 1FWKA 3HKZD 3PM9A 5HQLA 5H9EJ 4RW4A 2AEFA 2XCAA 4I7FB 4KH0B 1NZAA 2EG2A 4USWA 5KFVA 1WC5A 1TV6A 2B4OA 2M70A 4ZVSB 3U27A 4D3GA 3C6TA 1HQUA 2IDEA 4CLWA 4UZCA 4AL7A 1RAHB 4ED1A 4TQSA 3GILA 1L3VA 1IBMF 1ELOA 1VBZA 1QE1B 2VH7A 3BGOP 3I9ZA 3CCSS 2MKCA 5I4MA 4P7TA 3W5YA 4Q43A 3NAHA 4HACA 4KO0B 3K5NA 1RBAA 1RWOB 2C1EB 2GA7A 3MTKA 4Y0FA 5L1LA 2DEJA 3VAMA 4WU3A 3KDNA 3D66A 1R89A 1X5OA 3HSJA 1Y4ZB 1B70B 2MKIA 4KC5A 2CA9A 5D3GA 1ZPWX 2HHQA 3E01B 3FRYA 2IM0A 2LA6A 2OPPA 1RHQB 2MQ8A 4ER8A 1KVKA 3FQLA 3N79A 1EIYB 3FMWA 4GKKF 3FFIB 1SBRA 1IKVB 5B0GA 1WDTA 2IRYA 2DIUA 4YUDA 4YR3A 3SCLE 1SUQA 1H38A 3PKMA 4OL8A 1AYEA 2K7KA 1LKZA 4C98A 4U7UD 5HL7Q 2FZKB 3CCUS 2E9ZA 1F9HA 4ES3A 1XNQF 3SDEA 2H5IB 4B3TJ 1JLGB 4Y2AA 3ZZZA 5D4LA 3MGJA 3GPAA 2QO3A 4JB8B 4IG3B 1B7YB 2CJXB 4F4WA 4K0KF 1KQSR 2HNZA 2MQNA 3CD0A 2F63A 2XYPB 3JSRA 2C2KB 4F8RA 3QSIA 2NCKL 4DBQA 5D3GB 4CCHA 2DH9A 2IM2A 3KTQA 5HJYA 3HZGA 2RU3A 3A8KA 1EZZB 2DVIA 1VLYA 2WONB 3CVKA 2ADBA 3POTB 4J90A 1BWVA 2HLUA 2JLEA 2DNQA 4A8QA 2EKNA 1TTHB 1C0TB 1FA0A 1XR5A 4HACB 4RBVA 4X4VA 1H73A 1DTQB 1IVZA 3JXOA 1CSJA 2NXEA 1NO8A 3CJ8A 4WIQA 4XAKA 2ACYA 3CJRA 3HFZB 3VGUA 5F8MA 2ALZA 2F65A 3TRGA 4JV5J 3A1YG 1E6VA 1TFWA 4CTAB 1HIYA 3IO1A 3I31A 3C6TB 3BN7A 4FF2A 4O3QA 3W3SA 2GAGC 2XZDB 4K4VA 2XB2D 5CHCB 1FFGB 4DXLA 2P6SA 1R7IA 4WZQA 2NXCA 1NPKA 2G1HA 2OPRB 4C8MA 2VV5A 3HDSA 3M32A 5J2MB 3C66A 2F5GA 2E1RA 1KRPA 4FDFA 4B08A 1HARA 1OO0B 4FKXA 5A8RB 3DYAB 1QAYA 2OD4A 4CM2A 1NBEB 1JXEA 1WI8A 1HNVA 1VOMA 2AKWB 1O0PA 1VR6A 2BJ9A 3IS9B 2PI4A 4WBFA 3WZ0A 4IR1A 1ZBTA 4MKVA 2UUAJ 2CYYA 1NPPA 3MCOA 3M2RB 4BBYA 2R2TA 3TJAA 5F8NA 3K17A 1AA1B 2AZ1A 2W4DA 3EJMA 1TKXA 3KJNB 3ICLA 2G2OA 4TY9A 2O66A 5GMDA 1RT3A 1KFDA 2RT3A 2RRNA 2HK3A 2AHOB 1WF1A 2RDDA 3KNGA 4HI2A 5KFBA 5GADU 4DLEA 2AYBA 2W8LA 1KOOA 4I2PB 3AD7C 4Q7AA 2PGCA 3DRSB 4WPAA 3PW7A 4LRCA 4JI4F 2IRXA 4LF4J 3VAGA 2RDJA 2HWIA 5F8HA 2HBYB 1XNQJ 2L48A 2H5JB 2P5VA 2YWFA 1C1BA 2V0NA 1FKAF 3NGRA 2UP1A 4FBUA 2CJAA 3DI6B 4PWUA 5E3QA 1DY3A 5AXKA 4MKBA 4USMA 1ZM4A 3M8RA 4DV2F 4WFYA 1Y5IB 3QFHA 2ZUGA 3HHEA 2VG7B 4ZOSA 5DG8A 1MN7A 1YJWS 3SQGA 1T95A 2CFXA 3KXDA 3R3TA 5EWEA 3ISND 4MK8A 4LF5F 2ZHOA 2CRLA 4S0MA 3H2VE 4BC9A 1W2IA 2XMMA 2ZJRQ 2OHDA 4ZPDA 4N47A 3N4WA 4RBUA 1IBKJ 3WIUA 4DR7J 2BE9B 3DKDA 3MMAB 3D28A 3KJFB 3F0NA 4NLGA 1V3ZA 2XY7A 1Q8BA 3DXBA 1UWBA 3IRXA 4QIFA 2WCXA 2XWYA 5L1JA 5LSOA 3NLCA 2V5HG 3FVYA 4OYXA 1G7CB 2BM1A 2QMUB 2KXFA 1KVJA 3CDEA 2VASA 4MJKA 4WXWA 5D0HA 4LF8F 2NXNA 3R5DA 4QIVA 4I2QA 4BS2A 4IQXA 4V19J 5KG7A 2VBWA 4I56A 5J1EB 2YH0A 3HHKA 1IR2A 1ZS6A 3BDEA 4PQUB 2D3UA 1VGYA 2MZTA 4QBUA 5ETOA 4Y65A 2XY6A 2VICA 4DV0F 4G65A 5HMYA 4XTTA 5G0RA 2YQ0A 3MPYA 1RABB 1FRLA 4ZLJA 2N3LA 5KTQA 1KONA 2QFJA 2VQEJ 2O5DA 1X0PA 4ZHRB 3GSDA 3R7SB 3IG1A 4P2SA 1BLUA 3HPOA 1H74A 1LK5A 4ZS6A 2IM3A 8AT1B 3QRPA 1QAXA 3CCZA 1F1BB
chains in the Genus database with same CATH topology
3SCIE 2Z8QA 1SKSA 4E98A 4FN5A 3DLHA 5KFZA 3CSKA 2J9DA 3CEDA 2DPJA 1RP5A 4URQU 3I4HX 1R8CA 4CZCA 1QVFR 1LW0B 4RW8B 1I1GA 1NHVA 1FRJA 4EZ9A 3SFGA 1QUPA 3VF0B 1C4AA 1REVA 1IKWA 1IQZA 2NS1B 1ZZNA 2FLOA 5F0UA 4M5DA 5HBMB 3JSYA 4KO0A 2LEAA 3UW1A 1Q4RA 1ZM2A 3QAEA 3CDBA 4K2XA 1NK9A 1TL3B 1VS3A 1M5VC 3NBPB 4ZPWR 3KYLA 3ETOA 2ZHAA 3K2YA 2HHHF 3T5LA 2DO0A 2XEXA 1LK7A 4DF8A 1VQ6S 2ZBIA 4L6V3 2R2RA 3BSNA 2HLTA 5KFXA 4Q44A 2KVIA 2LXUA 4ECTA 1JLGA 1M5PC 2RE1A 3DNCA 2UUCF 2VFVA 5LT5A 1KOHA 3KLEB 3D2WA 2N7YA 2OPSA 4R25A 2DIVA 1QSYA 3BR9A 4RNHA 3X3UA 1RT2A 2H9ZA 4FS1A 1W2BR 4H54A 2N82B 1N0UA 3I96A 3BDPA 4QPTA 2V4JB 3SXLA 4HKQA 2Q43A 2AYMA 2IHR1 1MMNA 1S6QB 3HHLC 3NGKA 2O1PA 1Q8IA 2KTQA 4LF4F 2KJWA 5F3ZA 1AXQA 2AX0A 5FIIA 4ETXA 5J2NA 2HGNA 2UXCF 2R7TA 5U47A 4TU8A 4K59A 4QIEA 1N5VA 2DHAA 3PIOQ 4RW7A 2F3JA 5KFIA 3MD3A 3MECA 4IFYA 3VTIA 1QSSA 1H2TZ 2WAQD 1YHQS 2OPRA 1UVJA 2MHEA 2E9TA 3DCAA 3LWLA 3UPFA 3T6JA 2RRBA 2AGPA 3PRBA 2GO9A 4FZVA 2HHSA 4DL0C 1ZAWA 2ILYA 2AF6A 3K8VA 5DLGA 2G1DA 1LQ9A 2J8AA 2P6TA 3NCRA 3OFGA 4OI2A 4R8UB 2VZ9A 3O2IA 4OZ5A 2K3KA 1JJ4A 5EUHA 2IVMA 1MWYA 2UXDF 1O8BA 4KE5A 2LEBA 2BOPA 2KT5A 5DRKA 4PXEA 4QYZJ 3HI9A 4XIUA 3AAWB 2YY3A 4RBTA 3KK3A 2ZKUA 4ZK7M 4K4TA 5HP1A 1YJNS 5D8HB 3IAM9 1X8DA 1NKBA 2VA2A 3U1LA 3QJPA 3MXHP 4C0BA 1VRTB 2DGWA 2OO4A 3LP0A 4RUCA 4QWDA 5LXYA 1X0FA 4DFKA 1ULRA 1FCAA 3SDEB 2JDJA 4LSLB 4A47A 1H7XA 3J7A1 2AGQA 3DLBA 1NB7A 1KNZA 4LFBF 2ASDA 2CQ1A 2ZDPA 2KG0A 5DGAA 1F5BA 1TAUA 1XC9A 3CWJA 4U6PA 1HBMB 2XLJA 2RSQA 1NK0A 2JWNA 4F3QA 3C6UB 4LT6A 3G96A 5G0RB 2IFXA 2M4MA 4KFBA 5F8IA 2BQ3A 2B56A 1GXTA 2HHWA 2XGPA 3G6XA 4GO7X 1RA6A 2MPUA 4CNYA 2D3OR 2D9OA 2AYGA 3PIPQ 4OX9F 1QM9A 4NLOA 2ASYA 3F44A 1RT6A 2BANB 4USJC 1U1MA 4QR2A 5JJBA 3T5JA 1HI0P 4FNIA 4ETZA 5L38A 4F4YA 4ED8A 4ZPCA 1SIWB 4J9OA 2WK4A 2DRAA 5THWA 3MM8B 4CH0S 3U1NA 2YH1A 1HWIA 2BV3A 5HROB 4YR0A 1JLAB 3UD4P 3J7YI 1QJHA 4ALZA 2GJ2A 5E3CA 4KGKA 2HRUA 4X84A 1JXLA 2VC0A 1S9GA 1UETA 2CPXA 4K4XA 2RS8A 2M8HA 2GQQA 3C6UA 3OUYB 1S79A 1S6PA 3BB5A 1B64A 1FTRA 4O3RA 1HL6A 4ATNA 4ECQA 1W25A 3KLGB 3PVXA 1SUQB 3BR8A 1UMJA 3P3DA 5IT0A 3O6QA 3GYXB 1C4CA 3IR7B 5HLFA 5C24A 1LWCB 1HPZB 1HI1A 3TA2A 2QA4S 5KT3A 2OKQA 1S1UB 1AW0A 4CT8A 3OL7A 5I3PA 3A8EA 3SCJE 1Y7PA 3GFXA 4QJVA 5KFRA 4F2SA 1KS2A 5IWAF 2JC0A 1NJWA 3AQPA 3Q0AA 5DM7Q 4A8YA 1HNVB 3IS9A 1Y3JA 1K0VA 2YKAA 4QQBA 3HHLA 3PX4A 4QR1A 5DDPC 2R7WA 3LAKA 2C2EA 4J9MA 4ECUA 4EO8A 3SSQA 4IQMA 2B7BB 2MQLA 2M52A 3MOZA 3QGIA 4ZP7A 4C0HA 3QZ8A 1KC8T 3H5YA 5E7OB 2KU7A 1WHWA 4ICLA 1FNMA 2ZD1A 3PJXA 2DTJA 3DM2A 5DS7A 2FY1A 5GAGI 1RYRA 3HXMA 3T1AA 2RQMA 3M05A 2HW3A 1GXUA 3ZC4A 4OX6A 4DLGA 2BE2A 1R31A 2IAJB 5KFOA 3LWMA 2A2DA 3M9MB 4L72B 5B0CA 3G8TA 2YKMB 5D78A 1X9MA 4X4RA 2DNMA 1U2RA 1WELA 3LW5C 3HF5A 5EX0A 2ZJPQ 4Y00A 4H4MB 4MKAA 4DV1F 4B9TA 2I0XA 1D3WA 4LSNA 2CJBA 5DGBA 4I68A 2G9OA 3M8PB 2GFFA 1B0PA 1VQYA 3D5MA 1QSLA 1RTJA 3I5BA 1QE1A 4DL4A 4FYDA 1S1TA 5E2QA 3MEDA 3SYZA 5CXTA 4DHVA 4U67Q 4IOCQ 1UA1A 1TVRA 4HTIA 2J7WA 2ZDOA 2SXLA 4CNZA 3RTVA 3DRXA 4NLVA 1N5YB 2XMWA 5F8JA 5KG0A 2R8KA 3UFCX 2RDIA 2XZWA 4AQYF 1RYSA 1U8SA 2PD1A 1S0MA 1WG1A 5T14A 1VQMS 3QMQA 4JI8F 5DETA 3OR1A 4OI6A 2XGQA 4JBCA 2WSFC 5DDRC 3TA0A 1RT7B 3FRZA 3MR6A 5A0YA 2QA4G 4AYBD 1VC0A 4CIOA 2MMYA 1HWJA 1N8RT 4C8ZA 1WHYA 3JYTB 4CO4A 5L1IA 1OSDA 1RTIB 3UCZP 3UCGA 2J9CA 1NHUA 3HLUA 2KI2A 1FK9A 5DJBA 1HMVA 1R27B 5C24B 3MUTP 1TQLA 1WEXA 3VAFA 2QEXS 2UU9F 4RW4B 3ZZOA 1FT8A 4GO5X 2LDYA 1YJ9S 3DHXA 2X1BA 3UI3A 2CPIA 3I0RA 3QIDA 2LU1A 5H9FJ 3Q2SC 4HH1A 3QO9B 3QPIA 2ZH1A 2VBXA 4MKYA 3OTCA 3T19A 2ZH7A 4ECXA 2Z2MA 4LSNB 3GB0A 2Q66A 2NPFA 3EYZA 1JX4A 4LQ3A 1YJVA 1NJIT 3CGIA 2IC3A 2PE8A 1T05B 1SL0A 2U1AA 1D8YA 4BCAA 3G71S 2PEHA 4OLOA 4IDKA 1PILA 3VQSA 2RD5C 3GIJA 3MMJA 1U1QA 1L3UA 2BQUA 2YWGA 4E0DA 3DRRA 2UUTA 2FGOA 2ERRA 1IR0A 2GMHA 2DR7A 2CVEA 4Z2XA 2UUWA 3M30A 2YWEA 2HHPA 2AD9A 1D9AA 1QLNA 4IOBA 4DV5F 3AB2B 2VPXB 1S6UA 1UFLA 1LXNA 3HK2A 2ABYA 1N32F 4LJMA 4LIWA 4UUXA 1RKIA 1S99A 2UUAF 4DWIA 2AQ4A 2YKNA 2FHJD 1S1VA 2FC9A 4TNOA 3BQ2A 5LJ5Y 2L3MA 1WF2A 2CQDA 2PMHA 4U9RA 2KH9A 2MSSA 5LMNF 1S0OA 2Y1JA 2ZOMA 1LWFA 5HQ8A 4J9NA 5EWGA 2OH2A 3DRYA 3QLHB 1U24A 1TKTB 1IQTA 2B6AB 4L3NA 3UR0A 3PW2A 3GIKA 1NK5A 4DL2A 4HVZA 2BZ2A 2DHGA 4PUOA 2CZVC 3GFHA 3MR2A 1JLAA 3RAMA 3BO3A 1JLCB 3BQ1A 1VQ7S 4LF6F 3V5RA 1S1WB 2Q3PA 2CQCA 4F4ZA 2CPYA 1YRUA 5KFPA 4CI0B 1SXLA 2PN6A 2RQKA 2DNYA 3GR1A 4AE5A 1CEZA 5A8KA 1RT1A 5E3PA 2DGVA 1JK9B 4DV7F 3DYAA 2RQCA 2XI2A 2CPZA 4JV5F 3TUJC 4ILLA 2VOPA 1ZPVA 3DLKB 3N01A 3SEOA 3NAIA 2RF2A 2DNZA 4PXCA 3GMGA 1NK7A 2W9BA 5K8MA 2R8IA 2DD8S 3C8YA 4KTQA 4KBIA 4NXMF 5FJ4A 5JVGQ 1IM4A 1JKHA 1FRKA 2BRKA 1E6VB 1FRXA 2F8HA 3MDFA 2XO7A 4X65F 2ZM6F 2FGCA