4IO9Q

Crystal structure of compound 4d bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
b'SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome/ribosome inhibitor
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4io9Q00
1N52B 2CQIA 3CTRA 2DGUA 1F9FA 3NNCA 2DGVA 1HL6A 3TO8A 3S01A 2VONA 2LA4A 3G4SS 2MY8A 1K8AT 3US5A 2G1DA 1P1TA 4EGLA 2KVIA 3CCQS 2X1FA 2LCWA 2MGZB 3LQVA 2MYFA 2EK1A 2ERRA 4WCEQ 2OTLS 1PO6A 3B4MA 2MJNA 2A3JA 4TU9A 1X4DA 2LXUA 1YHQS 3DXBA 2FC9A 5EN1A 5LJ3Y 1X4GA 4TLQA 2CQGA 2JVOA 3DLLQ 2CQDA 2UP1A 2ADBA 1RKJA 4IOCQ 3VAFA 2G4BA 2DNNA 2CQCA 3NS6A 1UP1A 1WF2A 4OZ0A 3S6EA 2I2YA 2LEBA 1WG4A 2LEAA 1WEZA 2MHNA 3ZZZA 1WG1A 2RU3A 2MZRA 4CH1A 1VQ4S 3NS5A 2V94A 1X4CA 2X1AA 4PKDB 3MDFA 4WF9Q 2MXYA 3THTA 2AYMA 4WFAQ 4V19X 2K8GA 2CPJA 3IRWP 2D9OA 5LXRA 3I56S 2MZJA 1U1QA 3BO3A 2M2BA 3SMZA 2CJKA 2M0GB 4F26A 3NMRA 3NNAA 5HO4A 2JVRA 1A9NB 5IFMA 2RRBA 3Q2TC 3G8TA 1G2EA 3CC2S 2DNQA 1VQLS 2F3JA 3PIOQ 3CUNA 2B0GA 4P6QA 1WWHA 2MGZA 2KM8B 2ZJRQ 2RVJA 4M5DB 3VAMA 4QQBA 2HZCA 1FJCA 2YWKA 2CQ2A 1WG5A 3LPYA 3VAGA 2YKAA 3ULHA 1KQSR 1HD1A 1VQ5S 4IO9Q 5ITHA 3BS9A 1A7GE 1SJ4P 1U1LA 1JJ2R 1H2UX 4FXVA 1YJ9S 2AYEA 4LIRA 5D78A 1KOOA 2JRSA 2YH1A 2VODA 3B4DA 1WHYA 2D9PA 2M9KA 1SJQA 3EGNA 2DH7A 4YUDA 1JJ4A 3VAKA 4W92B 2LA6A 2DIVA 2J0SD 2M88A 3VALA 1PGZA 3TYTA 5GADU 2OIHA 5GAHU 3CD6S 2DB1A 2FPHX 2J76E 5MLCV 1X5OA 2MZQA 2DNLA 2QA4S 1N54B 1X4AA 1YWXA 3G9CA 2MQPA 2DNOA 1ZH5A 3MUMP 4BS2A 3MOJB 4F02A 3SXLA 4YOEA 2KHCA 2M52A 2GO9A 1YIJS 4ERDA 4YB1P 3P6YC 4UQTA 5CA5A 1X4HA 2K3KA 4OZ1A 1VQ8S 3CCSS 1VC0A 1WELA 1O0PA 5GAGU 3CCMS 1ZZNA 4PRFA 3MI7X 2KRBA 4QU7A 2YH0A 1WTBA 2KM8C 5GAEU 2YTCA 5DDRC 5DDPC 3U1MA 2RQ4A 3MD3A 4FXWA 2CPYA 3CF5Q 1CVJA 2CQBA 2NLWA 2M8DB 1U1PA 3K0JA 3CC4S 5LJ5Y 3UD4P 2MKKA 4C7QA 1VQMS 4IOAQ 1OPIA 5DETA 1X4BA 3N9UC 2CQ3A 2KXHA 1VBZA 1OO0B 2XSFA 1L3KA 1H6KX 1DRZA 2FHOB 1N8RT 2HGLA 3CCVS 2MY7A 1KOHA 2CQHA 2LYVA 3G6ES 2MQNA 3S8SA 3R27A 2MKJA 2E5IA 1H2VZ 5IM0A 1HA1A 2BZ2A 2CQPA 2AYGA 2MSTA 2RNEA 2CPZA 3I55S 1NJIT 1R8PA 2DGSA 3L3CA 3S7RA 2D3OR 1DHMA 2BOPA 3P5TL 2KFYA 1QVFR 1M5PC 1FXLA 1UFWA 1BY9A 3G96A 3Q2SC 1M5KC 3V4MA 1SXLA 2G0CA 2MQLA 2KXNB 1U1NA 3CCES 3UE2A 2HGMA 2GHPA 1U6BA 4RU2A 3OW2R 2QEXS 1WHWA 2DGQA 2KI2A 1VQPS 2DK2A 2F9DA 2DO0A 2JWNA 1FJEB 2RT3A 2KG0A 2DNMA 4ZKAA 3R1HA 3UCUP 2XB2D 2VOPA 1VQ9S 4WKRA 3J7ZT 2XNQA 4A8XA 2MMYA 2KT5A 2MZSA 5DDOC 2N7CA 1DZ5A 2MB0B 1KD1T 1JJHA 4CH0S 2EVZA 4TU7A 1SJ3P 1VQKS 2DNKA 1S79A 1H2TZ 2CQ4A 1WEXA 4CIOA 2DHXA 2RUGA 1UW4A 1WF0A 3HI9A 1U2FA 1U1MA 1U1KA 2DHSA 3CCRS 2DNGA 2U2FA 2CPDA 2CPXA 1FT8A 2L9WA 3D2WA 2E44A 3CPWR 3EGZA 5JVHQ 2ZJQQ 5IM0B 3PIPQ 1FHTA 1IQTA 1URNA 3RW6A 4J5OA 2J0QD 3BEGB 5CYJA 3H2UB 4C4WA 2HGNA 2CPEA 2O3DA 1VBXA 1K9MT 1NU4A 2DNHA 2KG1A 2CQ1A 2DNRA 1WEYA 2XS2A 5CXTA 4IUFA 5DDQC 1OIAA 3VAJA 1WI8A 3UWTA 3RW7A 1NO8A 2KYXA 2E5GA 2MQMA 2X1GA 3SDEA 4C0OC 1P27B 2L41A 3G8SA 3CMAS 1YITS 3CMES 5LSOA 3BO4A 2LKZA 4WFBQ 1W2BR 1M5OC 2EK6A 1YJNS 2F9JA 2AYBA 1X5PA 1AUDA 2DHAA 2J8AA 2DH8A 2KU7A 5BJRA 5DM6Q 2LECA 3JB9k 4Z2XA 2MKCA 2PE8A 5GVQA 1Q82T 2DNYA 2OJ3A 1Q86T 1RK8A 2X1BA 2MKHA 4LJMA 4UY8T 3CC7S 5LSLA 5HL7Q 3P49B 1WHVA 2DGTA 1VQ7S 2HVZA 1X5TA 3BO2A 2LMIA 3FEYB 3FEXB 2JX2A 2M70A 4QU6A 3VAIA 2DNZA 2OSRA 3VF0B 2SXLA 1K73T 2U1AA 1U1OA 3UCGA 1VBYA 1VQNS 2ZJPQ 1FNXH 1WI6A 3EX7B 1HD0A 2CPHA 1UAWA 2XNRA 4Y0FA 2XS7A 2Q79A 3VAHA 3CULA 1QVGR 2KRRA 3MUTP 2NZ4A 2MKIA 5JVGQ 2LXIA 2MJUA 1M90T 3TP2A 2KN4A 1Q7YT 1M5VC 2KXFA 3SDEB 2M7SA 3UD3P 2M8HA 1X4FA 1B7FA 2MZ1A 3IWNC 2N3LA 2MKSA 1U1RA 2DO4A 2WBRA 2OTJS 1ZZFA 1X4EA 2L08A 1D9AA 1OWXA 1SJRA 2DHGA 3MXHP 4U67Q 2ADCA 1YI2S 4ED5A 2CQ0A 1JMTA 2E5HA 4CQ1A 2FY1A 3MUVP 1YTYA 1FO1A 1N88A 1Q81T 4TU8A 1VQ6S 2E5JA 4WFNQ 3CCJS 3P3DA 3MD1A 3CXCR 3H2VE 2N3OA 2DISA 2DGOA 2RS8A 1M1KT 5FJ4A 2DNPA 1KC8T 4F25A 2N82B 4LMZA 2MQOA 2RS2A 1VQOS 1VC6A 2FC8A 2QFJA 2I38A 5DM7Q 2CPIA 1DBDA 5LXYA 3R1LA 2DH9A 2MZTA 1YJWS 3HHNB 2DIUA 3UCZP 2DGWA 2DGXA 2MPUA 1U6FA 1X5SA 1XN9A 2MSSA 1R8HA 2M4MA 4Y00A 2AD9A 1SJFA 1QM9A 1X0FA 2RQCA 3U1LA 2MQQA 1WF1A 1S72S 3ZZYA 2XS5A 2KH9A 5GMKa 1D8ZA 2OSQA 4PR6A 3THPA 3MURP 1VC5A 2VOOA 4WIIA 1FJ7A 2CPFA 4QPTA 2LQ5A 5D77A 4W90B 2PEHA 5IQQA 3CCLS 1WHXA 5H1SV 3CCUS 2RRAA 3G71S 2DITA 3J7YU 2HYIB 3NNHA
chains in the Genus database with same CATH superfamily
1N52B 2ZNZA 4NLDA 2CQIA 2LVWA 3RR8A 1YSJA 3CTRA 4GVLA 3TJAA 3TO8A 5I42A 7FDRA 1NKBA 2CG4A 1W2IA 5B0GA 2LA4A 3ZZUA 1U47A 1S10A 4NCAA 2VONA 5I4MA 2RAQA 4U95A 1TUGB 5KG3A 4QBUA 1C1CB 4I6WA 3ZTPA 4F50A 1B70B 2V50A 4C8MA 1RADB 4PWDB 5IQ6A 4LF6F 3LQVA 3LWLA 1RBOB 1XIQA 2EK1A 2IMOA 3AQOA 1PILA 4DR4J 2HS3A 4G1IA 4ITSA 4ZVPB 4IR9A 3KG0A 3OTDA 4C0HA 3Q8UA 2W7PA 4B3OA 4NLOA 4PWUA 1TQLA 1FFSB 3DOMA 1X31C 3FCWA 1N48A 1J5EJ 2FC9A 4LR9A 3NG8A 1UJ5A 5KT5A 1FNXH 4OLOA 2YKMB 2QIFA 1PAEX 3MM6A 2CQGA 2JVOA 4KKOB 1FTCA 1IJFB 2IBOA 3SQOP 1HNWF 4OI1A 3K2YA 4AT1B 4R5PB 1OSCA 3KJQB 1IWAA 2ADBA 3CSKA 2J7WA 1KQFB 2GS8A 4M5NA 1RWOB 3V5RA 3VAFA 1S76D 3IG1A 2PMWA 2B6AA 3LWMA 3Q8SB 1NJXA 2W9CA 2GVDA 1WTFA 4H4OA 4OZ0A 2R7UA 2BKNA 4DI6A 1HHQA 1LKZA 1UZHA 2B8QA 3GJQB 3ISND 1GMWA 3S6EA 2QSWA 4CLWA 5EDWA 2I2YA 3QAUA 3OL6A 2P6SA 3BBCA 4X4OA 4NLSA 5E3CA 4C0BA 3U02A 1C0UA 3GONA 1SI9A 4FPRA 1LWCB 1JLAA 2RU3A 3IGVA 1NMEB 4DWIA 3MMBB 1VQ4S 3NS5A 4EU0A 2ASJA 5AXNA 2Q6CA 5KFWA 3ZTSA 4DR1F 2DR8A 1UVLA 1RYRA 2WVDA 4KR0B 6AT1B 3MDFA 4WFYA 3HCXA 2MXYA 2AYMA 2DHHA 4RO0A 1AA1B 2JC0A 5KFFA 4J9RA 4V19X 1SV5A 4O0IA 3NCRA 1EARA 3SCJE 2ACMA 2D9OA 2BANB 4X4QA 3FQLA 5B0DA 3I56S 4M95A 2HK3A 5D0EA 1JXVA 3H8YA 2VDHA 1KVIA 3P45B 2CJKA 3ILOA 3R6LB 3AAWB 4ZOSA 4ZVFA 4YB7A 5K8OA 4ALZA 1CJVA 4J9LA 3NMRA 2JVRA 3FCVA 5I42B 1SB6A 3D5MA 2Z2YB 3UQSA 2KT2A 3W66A 2HFZA 2XZDB 1Z1ZA 3W1YC 3KK2B 3CC2S 3JSMA 1Y0HA 3HXMA 1C1CA 4GRSA 3UVJA 4JI8J 3KNGA 2WZ1A 2E29A 2MGZA 2LQ8A 3QZ7A 1V3SA 3G87A 3QT7A 4UOFA 1R6VA 1WD6A 1RBAA 3OTOJ 5EX3A 2PI5A 2HZCA 2J9DE 2YWKA 2CQ2A 3N6LA 4ZP7A 4ED6A 1FJCA 1XWLA 4CO1A 3ULHA 1VQ5S 3GJRB 4Y3CA 1NBEB 5D3GB 4IO9Q 5B0BA 1Q95G 2PA3A 2GVZA 1HBUA 2Z2LA 3HHLB 3SBMA 4QWCA 1NK5A 2D1CA 1KRPA 3MTJA 5IC4B 2HHSA 3GFZA 3QRPA 3KHHA 3AJDA 5AE1A 4DV1J 3R5CA 4KKOA 1QE1B 2GJFA 2KO1A 2AYEA 4TNOA 4R5PA 1Z2ZA 5I3PA 3RRKA 1KOOA 1Q5VA 5F9NA 3PNIA 5E3RA 4ZVEA 3ZNUA 2YH1A 2RMLA 3B4DA 2FHJD 2VODA 2D9PA 3B8HA 2ZE2A 2X3DA 1SJQA 4ES3A 1B64A 1JLFB 3EGNA 2B4VA 4USKA 3PFOA 5IXUA 3KHGA 2OAUA 2Y8YA 2A18A 3IRXB 5AXKA 4DV1F 1QTMA 4NRUA 3I0RB 1UW9A 1BD6A 4X4PA 2W25A 1C0UB 4WU2A 5GAHU 3Q86A 2FPHX 4NEZA 2V4QA 2J76E 2J5AA 3CMQA 2XYGB 4OX8A 4RW4A 5LL6d 4B3MJ 2H48B 2MZQA 2G1HA 4J9MA 4RL1A 5IWAJ 2QA4S 1N54B 2OFHX 1ICEB 3QT6A 2OPPA 4IDKB 4YY3J 3K59A 1MWYA 3AHPA 3T5KA 2R7SA 4BS2A 1R6YA 2R2SA 4JI7J 5DG7A 4JI1F 3C19A 4O44B 3RR7A 4IH7A 2AJQA 2O67A 4RJVA 1ZAVA 2FQQB 2HHUA 2QA4G 4ERDA 3MMCA 3TNVA 2J7KA 1X4HA 3HZEA 5G4DA 4ZLJA 5LM7E 2DY1A 3TEHB 5HP1A 5L8RC 1S5ZA 3DLEA 3F41A 3IC1A 3LO3A 1YBUA 4HHHA 3M2VA 1MROA 1WELA 1VC0A 1S99A 1S6QB 3CJ2A 5GAGU 1ZZNA 1CC8A 4O23A 1VK3A 3M1VB 3JAMY 4DV6J 3GTYX 2AKWB 5D4LA 3BF4A 3IGNA 4LIWA 4ZVHA 2ZBIA 2X3GA 4WBFA 4QU7A 2B4PA 2YH0A 1LWFB 1WTBA 4I67A 1SC4B 1AT1B 2FHJA 2V68A 2F4VJ 3QBCA 1AFIA 1WC3A 2YTCA 4QIEA 2B4OA 3MD3A 5HQLA 5HK4A 2XYPB 3ELHA 4HDHA 4Y2IA 3HKWA 4ED4A 2JL9A 2D3O1 1REVA 2BRLA 2HHHJ 1TUVA 4O3PA 4YY3F 3K0JA 2OHDA 2CYYA 3JSYA 5AE2A 1RA7A 2ZBCA 3F44A 1JLEA 3MPWA 4G3IA 3B82A 4DFKA 3ADAC 1RHKB 3MCMA 2KYZA 2LQBA 5KG7A 1KDNA 1LV5A 3PYFA 2XWYA 1VQMS 5DETA 3BSNA 2HQ3A 2LQ9A 4ZVRB 4LREA 3UPFA 1FK9A 1T3NA 3IO1A 5E0OA 2Q43A 2KXHA 2Z0GA 9ATCB 1OO0B 2NYHA 1TFYA 1N36J 1QE1A 2HFOA 1JLBA 1KONA 1S1UB 2GQQA 3MM5A 4R0EA 4ZPTR 5JMNA 1N8RT 1WNEA 3DU5A 2HGLA 1FX4A 3WIVA 2BXJA 4CT9A 2XQCA 1U2CA 1WUUA 2VFSA 2F5GA 3CGIA 3MCSA 4N76A 2MY7A 1KOHA 2LYVA 3EVOA 4S0MA 1QUVA 4RW9B 4X64J 4NASA 2WTFA 1S4FA 2WCXA 4Y2KA 2E5IA 4XO0A 2QN6B 2ZBPA 1YLXA 1HA1A 2Q1LA 4QR0A 1VLYA 5CHCB 2KFNA 2CQPA 2H4WB 2HFNA 1BGXT 2V8VA 2QL9B 2OELA 3NWGA 4DG1B 2XI3A 3TUZC 2MQ8A 2RH3A 3GYGA 2HNYA 3NXZA 4JB8B 4Y34A 4ECTA 1ZETA 2UUBJ 1HNVA 4X66J 3T1YF 5B0AA 1F6TA 3LP2A 3QQCD 5DG9A 3BQ2A 5F3TA 2AEMA 3S7RA 5KFZA 4DBQA 2D3OR 3HSGA 1VDHA 5A8KA 1N5YB 2NREA 2CDQA 1P8GA 4L74A 1UFWA 1FXLA 3FZBA 5T14A 1TV6B 4HEA9 1GH8A 5A8WA 2V34A 1ZM4A 3QMQA 4MK8A 3EPGA 3T1YJ 1YVFA 1U25A 4H54A 4ZHRB 2QE5A 2YPZA 5HP1B 5KFRA 4OYZA 1AW0A 1S9EA 1BQMA 4KGKA 3KLFB 3RB4A 1Q16B 4LFBF 1G1XA 3PDNA 3H42A 4KO0B 4ED1A 1K1SA 4JI2J 4HVZA 1WOOA 3NP5A 4RW7B 5DRKA 4CM2A 5DQGA 3D9BA 3QATA 3QGIA 2NS1B 4J7CA 3LANA 1FJEB 2C2MB 1Q8LA 2KG0A 4ED8A 4PXEA 3IXQA 3R1HA 1Y7PA 3ZC4A 4OJGA 3JTOA 1LFPA 1Y00A 1TP7A 2HNDA 3A1YG 2E1CA 1GEHA 4KHPF 2LFVA 2ZKUA 2XNQA 3DM2B 1RT1A 5DDOC 1MSWD 1S7IA 2VG6A 5DJBA 3RUBL 1IN0A 2HVHA 1XK8A 2YX4A 3PCOB 1DZ5A 2MB0B 4B3SJ 4H4KC 3Q23A 5CCLA 1CJUB 3BPSP 3LF0A 3LPEA 2UZAA 3R97A 2DNKA 3IR7B 3DLKA 4A8OA 1VQKS 1K47A 1H2TZ 2ZVSA 1AROP 1WEXA 4QCLA 3DOKA 4EFAC 4CIOA 3DI6A 1G3OA 2RUGA 2R8KA 1QSSA 2YKNA 3W63A 5K20B 2R7RA 2E5LJ 1HMVB 4ZPDA 2UV8A 2DHSA 4J9PA 4UTGA 1UEKA 2CPDA 2B9WA 3N0VA 3N6NA 2BM1A 5JXSA 1SUQB 3D2WA 1VRUA 1TK0A 1P1LA 4JV5F 1FKPA 5JVHQ 8AT1B 3H5XA 2F8EX 1FHTA 3AD7C 3A8EA 3HD1A 2IM1A 4RUHA 4BCAA 4JI4F 1NNDA 3EZUA 4IG0A 5DLGA 4D3GA 5F9LA 4KV8A 4NOHA 3WDOA 2K1RB 2ZH1A 3BBFA 3BEGB 3SCLE 3LP2B 1PC4A 4FF2A 4TY8A 3MM6B 3IN5A 4Y2CA 3I9ZA 3G6YA 5L1IA 4ECQA 4C97A 3HM9A 4NYZA 4UOGA 5BYSA 2KG1A 2UU9J 2CQ1A 5A8WB 3V6DB 2LQJA 1RAGB 3BKUA 3ISNC 3JSBA 2KKHA 1FXRA 2HIQA 2ZZTA 1H3DA 1LOUA 4PG4A 4P75A 2VA2A 4DSEA 1MW7A 2BW2A 1FF2A 3KLEB 5KFAA 2OEKA 2BABA 2BM0A 3VAJA 2AGQA 2C1EB 2R2TA 1NO8A 1GXUA 4FP9A 4B9MA 2GZOA 5HMYA 3BJYA 1TL7B 2XZWA 3H0PA 5J2MA 2MQMA 1YITS 3OLAA 2IYGA 5KFTA 3CMAS 2FLPA 1LW2B 3BV8A 2VPZB 2JFDA 2ZOGA 1YX2A 4KSEB 5HBMB 2I0XA 2EBGA 3ET6B 4QWDA 3HVRA 2W8KA 1M5OC 2CKWA 4LFAF 4DR7J 2YPYA 2ZKTA 4EYIB 3OJUA 2VBZA 4IRCA 1UTAA 4KGXB 2HHHF 2DD8S 5FLXY 2DHAA 2M3DA 3A13A 2DH8A 3M6XA 4A8MP 1TAUA 2V8GA 4PXBA 4ZJOA 3IR5B 4OV6A 4DUZJ 2MKCA 3BN4A 4PG6A 1I6JA 4YB5A 4OZJA 1Q82T 2R7XA 3HP6A 2WOMB 1RAEB 1CJVB 3MM7A 1DLOB 1BHNA 3FBEA 4Z37A 3I6PA 3W8PA 1KFSA 3MMAB 2IA0A 3GB0A 4LJMA 2K06A 2BJDA 1Z4UA 3WHIA 2YKNB 4DX7A 6FDRA 3BDEA 5KFPA 1JLQB 5LSLA 5IWAF 3UVJB 4LSLA 4G65A 4IR1A 1VQ7S 4NA3A 2HVZA 1HFEL 3FMWA 2FUG9 1KQKA 3D6FB 3PW7A 4HL9A 2AW0A 3QYYA 3DRRB 2OMLA 3HHDA 2ZWOA 3MPUB 3MAAA 2IAJB 4L72B 2C42A 4DFMA 1TMMA 5IT9U 3VF0B 2NYIA 3CW2C 2GVZB 3HHLA 4GO5X 4WYWA 5HJYA 5EWEA 2E7VA 1LFWA 4C8YA 1NXIA 1RXOB 1VBYA 1M5SA 4K4ZA 1RACB 4NLUA 2BJ3A 4AXJA 4DJBA 4YDXA 3PV8A 2DPIA 1WI6A 3TUPA 2B9YA 4ILRA 1HD0A 2CPHA 2B5JA 4F3OA 1U48A 3DLHA 2F4VF 3HO1A 2UXBF 4U8VA 3LH2S 4XDDA 4ZPCA 3V6DA 3CULA 4NZ7A 1RT3A 2GGPA 2RE1A 5EX0A 1HYSB 2KRRA 3MUTP 3TWZA 1Y4ZB 2MKIA 1GQEA 4M5JA 1IBLF 3KLEA 4ZCIA 1RTDB 4WXOA 2KFZA 2A2CA 3PW0A 1N5VA 2VPWB 1RHJB 3RB6A 4MKBA 3M8PA 2IJNA 4LR7A 3TP2A 1TKTB 3V6HA 4NXMF 1RAIB 4LFBJ 1HWKA 3OR1B 5KFHA 1M5VC 2M7SA 1U0SA 1MWZA 4OMFG 1B7FA 2MZ1A 3LP1B 1QD1A 4CTAB 2OPPB 1U8WA 3ZTRA 1N6QA 4TYBA 2V2ZA 3D67A 4W98A 3TZZA 5KFVA 5HATA 3JYTA 1RWWB 4CLZA 1VHFA 2L08A 1D9AA 4Q0BA 4Q2LA 1SJRA 1YG0A 2DHGA 4M1KA 3W65A 2VC0A 4LRAA 1SQGA 2E5HA 4OX6A 3ENVA 4PPZA 2IJRA 1UWAA 2YY3A 5KFGA 2BJ8A 4CQ1A 3MUVP 3BR8A 1U0HB 3P5BP 2MHEA 1S0OA 3J81Y 2DY9A 5I3QA 3NCPA 3MM7B 1IBMJ 1Q81T 1UVMA 5C2GA 4WE1A 1DLOA 4KGZB 1SC1B 3M1VA 1PJ5A 4C8ZA 1FRIA 4QYZK 2C2KB 2MEWA 2P9CA 1FTRA 1GXLA 3EGVA 3NGUA 5ETNA 2XZTB 1ROFA 1JXLA 3ETOA 4KB7A 5IV4A 1LWFA 2DISA 1AXQA 3OHAA 3Q8VA 4B17A 2DCUB 3B6BA 1C0TB 3ZTOA 4JYAF 4K4VA 4LQ9A 4F25A 3MCOA 2N82B 2MQOA 3HLUA 4RNMA 4PXCA 3CB4A 2FC8A 2WVBA 4IKAA 2Y9HA 3ENWA 1ITPA 2W9AA 3FBBA 5F3ZA 3DRRA 2JH3A 1DBDA 2ZOMA 3KK1A 4E0DA 3KJVA 2EBEA 3HT3A 3ZZPA 3HHNB 3MEGB 2DIUA 3GG0A 3VGVA 3BN7A 4Q2MA 5A0YA 3WX8A 1HI0P 2JZ5A 2FLNA 2XY5A 4JI2F 1KLMA 2WSCC 1S9GA 1U6ZA 3IS9A 5K8MA 5D3GA 5C5JA 2B5JB 3C6UA 4B08A 2VBYA 4OZ2A 2QFIA 4U7UK 1CLFA 1EQ0A 2GO8A 3PHEA 3VGUA 2F1FA 1U7LA 4C8LA 4ZP6A 1HWLA 1VMBA 3D0HE 1RT3B 2GGPB 3KUHA 3QWPA 1NHKL 4I2QA 1FD2A 1QM9A 4PWWA 3KMSA 1SJFA 5DO2A 3CCTA 1H72C 1L3VA 4B9NA 5D0GA 1AYEA 1OS5A 2OEJA 3W8GA 2MQQA 4DV2F 1HW8A 3A8KA 1YJ7A 2LLZA 2XS5A 5EUHA 3MURP 1RUSA 3OFEA 2GIFA 3PVXA 1VC5A 3AH6A 4WIIA 1FJ7A 2CPFA 4CLKA 1KLNA 4DUYF 1WOPA 4LRFA 4O0NA 5GAEI 3MR3A 2DCLA 2E1MC 4DPUA 4OZ5A 2BDPA 2PEHA 4ICLB 3CDEA 5ETOA 3UNYA 2N4DA 2RHQB 5KFDA 4IRDA 5H1SV 3JYTB 2GMJA 3BYRA 2J9DA 5A8RA 3RU0A 1IJEB 5L1JA 1TV6A 1UEVA 3C14B 5DZ6A 5SZTA 3MM9A 1FDBA 1NK7A 3RB0A 4ZVSB 1JLCB 4L76A 4LF6J 6FD1A 3R3TA 1S48A 4QW9A 5A6PA 3DRSB 3G4SS 1FA0A 4V1Ak 2R2RA 1BQMB 3KLFA 4F4WA 1VHIA 2KVIA 2OPRB 3PYGA 5HVHA 3SV3A 2BW7A 1JKHA 2X1FA 3FZ2A 3DRXA 2MYFA 4P72A 2JEGA 3ONQA 1ZA1B 4MYUA 3RAMA 3MEEB 4ZPWR 3PHTA 2MJNA 2HNDB 2HQIA 4OQJA 1EP4A 4TU9A 5ETPA 4ECRA 2KZZA 2ROGA 4HI1A 1PJ6A 4EEYA 3TQEA 4NPOA 3MPYA 4YDDB 3KLVA 2W9BA 3ICLA 2VQEF 2VHGA 4A8YA 2AGPA 1RQ0A 2PSZA 4QIWD 8ATCB 3H90A 4YFUA 2OFGX 1H74A 1H7XA 3OBIA 4DMZA 1X4GA 2F40A 3H7HB 1RAAB 4DQRA 4DX6A 3DLKB 3U1NA 2FJVA 4UF4A 2BRKA 4ZPVR 1OQ6A 1UMJA 2PGCA 2CQDA 1WACA 2A2DA 1UVNA 1WC0A 3DOKB 1HQUB 1EKSA 3IS9B 2XYHB 1FRHA 5A6WA 3BGRA 3TEGA 2ZH3A 3OTCA 4CO3A 4ED0A 1HNZJ 4NLWA 2C2OB 4FNIA 1S1XB 1FRJA 2GA7A 2AX0A 2CQCA 2YKQA 3EGWB 3WZ0A 4P73A 4R8UB 1UP1A 1WF2A 2J0XA 4E8UA 3OL7A 1U45A 2BOAA 1U4BA 2HQDA 2QRRA 1XEZA 3SCKE 5C25A 4J9KA 1ELOA 4F4ZA 2LEBA 1RT6B 4J91A 3MTKA 1BC6A 1XR5A 2NXEA 3VHQA 3I5AA 2FD2A 1VLOA 1RJJA 2RSQA 3EZ5A 4JI7F 3W3SA 1WG1A 4DCJB 4RW8B 4M5IA 1GTEA 2V94A 1UWBA 5IZHA 2HMIB 1IVZA 2AU0A 3AFGA 4ZJQA 2Y0SD 4I1TA 4YEAA 4WF9Q 4TY8B 1M1HA 2HHVA 1FXDA 3PACA 4KFBA 4YR0A 2R7VA 2CPJA 1CC7A 3T5JA 4K0KJ 4CP5A 4L3NA 4K4XA 2HRTA 2YKOA 3T9NA 3TA2A 3QGGA 2M2BA 4OYPA 4U6PA 2M0GB 2E1RA 1EETA 3W5YA 4ENOA 2GHVC 3NNAA 3Q2TC 2VH7A 3TJ9A 1T3OA 3DLJA 4CLSA 4LBHA 3QIPA 2DNQA 1AUSL 5AE3A 4UT4A 2F3JA 4UOHA 2H5IB 3OTOF 4K4TA 5B7WA 4DS5A 2F63A 1FFGB 2ZNYA 4GC6A 4DDFA 4BHQA 4PWDA 1R27B 2BE9B 2KM8B 2ZJRQ 4NXMJ 3TZYA 4LFCF 1LW2A 2GX8A 3VAMA 2OUGA 1GXTA 2J6UA 5ADZA 1WG5A 2EC2A 3LPYA 1F9HA 2I5JB 2A6MA 2YKAA 3LOUA 4KIAA 1SJ1A 2A6OA 4LF7J 3DNCA 1R31A 1FKOB 4DLEA 2J9CA 1RAJA 1XMOJ 1T03B 4OJ1A 2ZM6J 2FVSA 2VBWA 5KFKA 1NH7A 3D1QA 1SJ4P 1U1LA 2YKMA 5L1LA 2J8SA 4FXVA 3I82A 3AB4B 4I7FA 2A0FB 2MLYA 4IOBA 5D78A 1FEEA 4LRCA 2H1YA 3MMAA 4F4KA 1K0VA 1T7PA 3DC2A 2HBRB 2DH7A 2E1AA 1NPRA 3ENQA 4YUDA 2GVDB 4KJIA 4ZIWA 1IM4A 2AT1B 4NLVA 2J0SD 3CNQP 4UQGA 3NL0A 3D7SB 4ED3A 1H7WA 4NWBA 5GADU 2OIHA 4ECSA 3O6QA 3JQJA 5T41A 4USMA 4P52A 3CD6S 5IT4A 3CO9A 3KXDA 5ETSA 2APOA 2HQFA 2QG9B 5IS2A 3BH7B 3OVSA 3CJQA 1MLAA 5CYMB 3H4BA 3NWRA 2VPYB 1TU0B 2DNLA 1CG2A 3OFFA 1X4AA 5J2PB 1MG7A 2OPSA 3IAS9 2HQGA 5KT2A 1QLNA 5F8IA 1EJ7L 3BH6B 1RWMB 5IC6B 3OQ2A 5J2QA 4RNFA 3SXLA 1NRKA 2FHKA 3T41A 2KHCA 3BDPA 2GO9A 3M6WA 3FDSA 3C8YA 3QJJA 4IQMA 3PRBA 1OMSA 1S6OA 2JSXA 1T94A 2ALYB 2BE7D 2K3KA 2HVIA 1JLGA 3AOBA 4OZ1A 3W5ZA 3J7AN 4ETXA 1CQNA 1O0PA 1TL5A 3CCMS 1SQEA 2W4DA 3TJ8A 4GVBA 2DR5A 3W2VB 3EGZA 1V3ZA 2KRBA 3JSMB 2YNGA 5H9FK 4EWTA 3M8PB 1RTHB 2W24A 4JI0J 1MNEA 4X62J 3C3LA 1QDUB 4WJBA 3W2WA 5KFMA 5DDPC 3U1MA 4FXWA 3UDVA 3CF5Q 2CPYA 1F2HA 1HPZA 1CVJA 2CQBA 3LAKA 3MM8A 2HLTA 1I3OB 3MAQA 3O8WA 1TKXA 4I68A 2JLEA 1O8BA 2ZBQA 4RBUA 3CJ3A 4ZMMA 2I5JA 2ZVIA 5AXMA 1U1PA 1K1QA 4DSKA 1IWGA 3EDQB 4KBIA 2MKKA 3RYLA 1U8SA 4ZK7M 2YWWA 2DVIA 2XI2A 1IKYA 1IKXA 3BGUA 5J1EA 2UUAJ 1OPIA 2WAQD 3LGMA 3NCQA 1TUWA 2NUHA 3N9UC 3R6GB 2GIRA 3THVA 5HMXA 5ETVA 2XSFA 2XMAA 2DXDA 1RT2A 4DL5A 1IUJA 2FHOB 5EWGA 4MKAA 3DLBA 3W5XA 1JNRB 2XCAA 1WKJA 3GV7B 4DR1J 4PG7A 1LW0A 4CLFA 3TA0A 2IIHA 2YNHB 1W26A 1I94F 3G6ES 2ZC3A 2MQNA 5U47A 3DDKA 3S8SA 3CDUA 2YNFA 4AQYF 3LP0A 4URQU 3UW1A 2BBEA 3GFYA 4B9LA 4WTYA 1RBLA 1RAHB 1OYEA 2AYGA 3CJKB 2MKYA 3A8IA 4TLRA 2DR9A 4DOZA 3I55S 2H5JB 3IAM9 4FPIA 3KK1B 1TTHB 3K8WA 4GKJJ 1S97A 4OLPA 2VF3A 3DCAA 5CYMA 3GIKA 3X3UA 2DGSA 3OTEA 4A8QA 5A0YB 3OL9A 2WVFA 4ILLA 2V2KA 4KGMA 3FQKA 2R7TA 4OYWA 2O5DA 1M5PC 3QFWA 3VGTA 3G96A 1FI4A 1Q79A 3H59A 2FVCA 4NLXA 4ANEA 1NK0A 4EO8A 3KHRA 2QMXA 4DCOB 1S0VA 2H9ZA 4OYXA 4JI0F 3TAQA 2PFFB 1RTZA 2B43A 2KXNB 4G1QA 3POTA 2XSJA 3CCES 1GNKA 2ROPA 1L3SA 2GHPA 1Y5LB 2C3UA 2V4JB 4DR3F 1S4EA 4FYWB 3FRYA 2DGQA 1JNZB 3MHYA 3Q8YA 1UVJA 2DK2A 1CULB 1RTHA 2DO0A 2F9DA 4HI2A 4KC5A 4QOTA 4EZ6A 2HS0A 2VA3A 5KFSA 3CWJA 3EYZA 3CVKA 1SH0A 5E3AA 3UCUP 2VOPA 3QO9B 3MM8B 3F73A 2HURA 5E5NA 1REVB 4F36A 2IRUA 1B0VA 2MMYA 2AIRB 5KOWA 3CD0A 1L3UA 2UXDJ 4QWAA 1M1GA 2JNJA 4TU7A 2K3IA 5HQ8A 4MIBA 4JI5J 4C8OA 1JLCA 1UFLA 1ZTTA 3F56A 1FK9B 3I32A 2R8IA 3SSRA 2DHXA 4PZVA 3P96A 2AJ2A 2QYCA 2VASA 3HVAA 1U2FA 1S1VA 1S1UA 1SKUB 3HJVA 2ASYA 2HHXA 3BR9A 3VV2B 4X66F 3TAPA 1DY3A 1PKUA 1FT8A 1LW0B 1X8DA 2L9WA 2QC3A 3DKDA 4IFVB 2H51B 1NSPA 2XGPA 4KQZA 4DV4J 4FKXA 5HLFB 5G0RA 2ABYA 3K89A 3CPWR 4PQUA 2YNFB 3J80Y 4TQSA 1N32F 2VG5A 1UFKA 3KNAA 3KOAA 2EW9A 1B0PA 2WBMA 3KJFB 3Q83A 3U27A 1URNA 5RUBA 3HULA 5CH7B 3RW6A 2GJ2A 3DOLA 2CJBA 4U96A 3B54A 1FRLA 5CYJA 3M30B 2C2ZB 4ZDNA 4ZCKA 2HGNA 1X9WA 3E2EA 2O3DA 3D0GE 3TAMA 1P6TA 2HKEA 3LGNA 3PRDA 1S59A 4YS2A 4I64A 1HQUA 1SKSA 2O01C 3BGRB 2L48A 2YX1A 4ZPAA 2UXBJ 4EK2A 2XS2A 1S57A 5CXTA 4RBTA 1X9SA 4TY9A 2Q3PA 5DDQC 5C25B 3KLHB 2VG7A 1KN6A 3HT0A 2OMOA 5HROA 4X4VA 1KBRA 2V4JA 3EM1A 3RW7A 1VIXA 3MEDA 4F4XA 2KYXA 3DYAB 4MKYA 1MU2B 2AEJA 1LWCA 3OR2A 4NMLA 2VDIA 4RW7A 1DTTB 4JI3J 2QTWA 2WW4A 3GV5B 5H9FJ 4OJHA 3WBZA 4FBTA 2EFGA 3M4XA 1BLUA 1XMBA 1HBOB 3R5GA 1YJTA 4MH8A 4RR5A 7AT1B 3QO9A 3OSPA 1YJNS 2F9JA 4CO0A 1ZTWA 1RT1B 1VYAA 2NR0A 3X1LB 2JEJA 1GK8A 1NK4A 1U09A 5DM6Q 2Z57B 2FYXA 1BUXA 1ZS6A 1HR0F 4AQYJ 1ZM3A 4Z2XA 2PE8A 2UXDF 2BQRA 1CJUA 4ECVA 1D0EA 3SFUA 3TVZA 4RU9A 1EETB 2IFXA 4NCGA 3M2RA 4LF9F 2CVIA 1AB8A 3RJMB 1RK8A 1FRXA 3UR3C 3Q8RB 4USJC 3VQTA 1S1VB 3VZHA 3N28A 4NE9C 5E33A 1QAXA 4DZ6A 2VQFF 5IV3A 3SYZA 1XNRJ 1L3TA 5IT9Y 2FJDB 2NPIA 4IFVA 1GFWB 3BZQA 3G86A 3JQKA 4K4UA 3D6MB 1RYSA 3DHXA 2FB0A 1GX5A 1HWUA 2HBQB 1PG5B 4FF1A 2V69A 2VB6A 4A4JA 2HBZB 1HNXF 4QU6A 2KZMA 1NCLA 1BE4A 2AHOB 2GMLA 3A3OB 4J9NA 4E98A 4QYRA 4NA1A 1FVQA 3T3FA 5CZXA 3DOLB 2BJ1A 2K1RA 2W01A 3R8YA 2ZJPQ 3GIMA 2V4RA 4KH1B 1SL2A 4ZN1A 2XCPA 5CZVA 3EX7B 4DL3A 5B08A 3TAMB 2OP5A 4H4MA 3ILIA 3W9IA 2UV8G 4AL7A 2VJVA 1OY6A 4LVOP 2Z58B 4NMXA 3AOCA 2EG1A 4RUCA 5C2CA 7FD1A 1QVGR 1N34J 4CYUB 1JLFA 1TMJA 1NEEA 1Q53A 2V8HA 3M9NB 1GT8A 1FFWB 5EGYA 4OI3A 4LF5J 3UDCA 5JVGQ 2AMCB 1KEKA 3I0RA 1P9YA 4JV5J 4K8RA 3PX6A 2CFXA 4B3RF 3M6UA 3KTQA 2F4FA 3MEDB 1NJWA 3RB3A 2UUAF 2H4YB 3RBEA 2KN4A 5D4NA 1Q7YT 1DTTA 2KXFA 1CSJA 2QMUB 3NGDA 3E01B 2XLJA 2P5VA 2M8HA 4DFJA 4JI1J 2WB1D 4LF4F 2BKOA 2XULA 4KHRA 2Y1JA 4K5RA 1R8AA 4X2BA 2N3LA 2MKSA 3M32A 1Q8BA 1HBOA 1VCTA 2DO4A 4USWA 2LDIA 2HHPA 3J81j 1ZZFA 5MAOA 2VU5A 5F8LA 5J2QB 1NDKA 4WK1A 1TAQA 5DGBA 2ZC4A 1YRUA 1T05A 2K7KA 1YI2S 4Y65A 2FJXA 2XBPA 3FEZA 3EWGA 3NY0A 2AEFA 2FY1A 2Z2MA 2QSFA 4I6YA 4P10A 4ECUA 2IC3A 2E7XA 1VI7A 4DR3J 1KHWA 1WDTA 2HFVA 4NCGB 1RDRA 2CNNB 4FBUA 4K59A 1VQ6S 3CCJS 3GJSB 4DZDA 4ED7A 2KJWA 3MR5A 3HKZD 3PTWA 1JLQA 1ZA2B 2RIJA 2RS8A 1VK8A 1YBAA 4B3RJ 2PT0A 3MEKA 5FJ4A 2DNPA 4M5KA 1RZMA 4B9VA 3I5CA 2IM3A 1R8CA 1RT5B 1FJGJ 4LMZA 2FJWA 2OPQB 5GMDA 1HQ2A 2Y0BB 4M5HA 3GIIA 4EZ9A 2RJZA 1HARA 2GJIA 3KWMA 2DPJA 3C46A 4AUKA 3MPDA 2AJ0A 4LF1A 2HZVA 4HHUA 2MZTA 4YR2A 4LF8F 4JBCA 2UUBF 5J1EB 4U8YA 3IMQJ 4DUZF 2FVRA 3EPIA 2ZZNA 2MPUA 2CNKB 4EBDA 4WK3A 1HQEB 1NDPA 3UFCX 5M2RA 1AZSA 3PY8A 2YWGA 4FKYA 2FZGB 4CZCA 1RT2B 3HVWA 5KFXA 3FBCA 4PAAA 4H4MB 4N8OA 2CDRB 3TX8A 4DLGA 1RHRB 1I94J 1IM6A 5KG6A 3GFHA 4CM0A 5KFBA 1HYSA 1RWKB 1VRQC 2QJ3A 3ISZA 4LF2A 4JUZA 3U1LA 3LP0B 2JLFA 1WF1A 1SQFA 2GQCA 1RTDA 2NQPA 1NSAA 3BSAA 1KP6A 2OSQA 3THPA 2WONA 1EAYC 5K14B 1EKRA 3V6KA 2F8MA 4HH0A 2UVRA 3HFZB 1RT4B 1WJ9A 3I4PA 3PJWA 3Q89A 4XIUA 3E01A 4K4YA 2R7OA 4KE5A 1T02A 1SCJB 3CCWA 2O1PA 2ZDPA 1NHVA 1WHXA 5KT6A 3CCUS 1NH8A 3G71S 2DITA 1CQMA 1RTJA 4N47A 3CJRA 3T1HF 3I5BA 2HYIB 4FF4A 3HK2A 2FJEB 2FJAB 2G9OA 3PW4A 4Q0BB 5E2QA 4ID5A 2NCKL 4PABA 2DGUA 1F9FA 2FGCA 2HHQA 1HL6A 3IR6B 3QIDA 2FJBB 4NLQA 2BKPA 4OI4A 2MY8A 1SL1A 4QYZJ 4FVMA 2XSJB 2G1DA 3NKYA 4RKUC 2MDAA 1WORA 3T6BA 3US5A 4DF8A 4YR3A 3ZNJ1 4EGLA 4WFZA 1OY8A 4Q44A 4PQAA 3CCQS 3N6MA 4ZIVA 1KS2A 1FJGF 3HDSA 1IR1A 3AQPA 1HIYA 1T0TV 1CULA 2ZFHA 1SH2A 3VQSA 2VJUA 2XMKA 3JTNA 3JXOA 3PX4A 4WCEQ 1C0TA 1X60A 1RWVB 1RT5A 2WK4A 3B4MA 2BJ7A 1T9WA 1YQHA 2A3JA 2B3TB 4PPDA 3SSQA 3HFKA 3DRPB 4XPCA 2LXUA 4K7QA 4V19J 4OHYA 2EWHA 2VG6B 5EN1A 3MCNA 4JOUA 4F0KA 1B4SA 4Q45A 4N41A 4DR6F 5L9XA 1PYTA 4TLQA 1DARA 3LGHA 2CZVC 4IFYB 3PKMA 2AX1A 3ILLA 1OSDA 4A46A 3DLLQ 1SIWB 4AL6A 1KLMB 4BC7A 2UP1A 3R5JB 2PD1A 4EUVA 4IOCQ 2G4BA 4DL4A 4DL7A 1XMOF 2XS7A 5ETMA 1WC6A 3D54A 3NS6A 5AXLA 3M8ZA 5K9FA 3D3BJ 4YQWA 2ILYA 2RKIB 4DUTA 5HLFA 1SUQA 2RB7A 3CD7A 1JJCB 1DQ9A 4HR2A 2RDIA 2LEAA 2ATLA 3BQ1A 2MLZA 1HR0J 1TKZB 1WEZA 3ZZZA 2BACA 4C11A 4RUAA 3KK3A 1BQNA 1UL3A 2MZRA 4WKYA 4CH1A 5K14A 2VIHA 5F8GA 2DEJA 1R0CB 3G82A 2KB2A 4MT1A 2RQKA 4KV8B 3V4IB 3KLIA 4PKDB 1IBMF 1KSPA 2H54B 5E7OB 3UN2A 4OHWA 2BUNA 3RAQA 5CABA 3M30A 4ZN3A 4WFAQ 3LALA 2K8GA 5GAHI 1VOMA 2XC9A 1W7WA 5LXRA 2KHDA 2MZJA 3L4BC 3TX0A 3K5NA 3BO3A 1D1UA 1HBMB 4PCQA 1YGYA 3SMZA 4CLUA 3GZ7A 2PFDA 4F26A 4J9VA 4P7TA 1EHWA 3I96A 4DL6A 2Z2ZA 5IFMA 2D74B 2RRBA 4ZP8A 1HHSA 2Y1LB 3G8TA 2IRXA 3DRSA 3FVYA 1NLKL 2E5LF 2BMBA 3WQPA 1YBTA 3PIOQ 3FCHA 3PG9A 4WWSA 4ELTA 2JEIA 2OPRA 3DYAA 3LUYA 1NAQA 2EFOA 5J2MB 1ZM2A 3CUNA 2A10A 2B0GA 4JV2A 1REGX 1WWHA 4TYAA 1NPPA 3CJ5A 3Q8QB 4JI6F 3TA1A 3M8QB 5HBMA 4ZA1A 4A8SA 3D28A 4UY85 1IBCB 1ZPVA 1VJQA 3DLGB 1WOSA 3MEEA 1DTQA 4OHVA 2ZD1B 3OUYB 2E9ZA 1HW9A 4ER8A 2V5HG 2GC8A 1D9FA 3DRPA 2LU2A 3EVMA 2AQ4A 2VBXA 3O3LA 3VVUA 4C3MA 4F04B 5ITHA 2ZH7A 3GCXP 3PJ9A 3BS9A 4OYMA 1FESA 1KTQA 3AJ1A 1VS3A 4DPXA 4CWBA 1YJ9S 2R2UA 3AB2B 4C48A 3M2RB 1PCAA 2C2RA 4F3MA 4K2JA 2JJ4D 4WP9A 4C98A 3HF5A 2QX0A 1OPZA 4ID8A 2AD9A 4DFPA 1WHYA 1TL4A 5KFIA 4RWXA 1N0VC 2M9KA 4LSLB 4OI2A 3HSDA 1JJ4A 4R8UA 3VAKA 3M9MB 3VR1A 4W92B 1FWLA 3HVTB 3K7RA 3TYTA 3VALA 1FNMA 2WHOA 4B3TF 3QGHA 3J7A1 3R2CJ 1FRMA 1SKWA 1Q78A 2GQ2A 2Y3YA 2DR7A 3C16B 2DB1A 4NX9A 4DCPB 4PXDA 5L9NA 1YZ6A 2Y1IA 4A8FA 4LF8J 5MLCV 3MAAB 2RF2A 2NPFA 5J1PA 2B4UA 2UUCJ 3PW5A 1RWPB 2NZCA 3G8QA 1YWXA 2VQEJ 2HNZA 1RWUA 2OI2A 3QLHB 4X4RA 1ZH5A 3E8OA 3MUMP 2AGOA 3MOJB 3AA9A 3T1AA 2KDOA 2UVVA 1Q7LB 2M52A 5CAAA 1VJWA 2YWEA 5CA5A 2QGFB 4AD6A 2C2DA 1UETA 2WB4A 1MN9A 2HFSA 4CDIA 2R8GA 5L38A 1N33F 2HFUA 2YX7A 4K4WA 2NSCA 4QIGA 1IKWA 2DEIA 4ZVGA 1XR6A 1S1TA 4ZS6A 4PRFA 2XHWA 5ETKA 3QIPB 3EMTA 4X65F 1NPKA 1RI7A 3NBPB 4WZQA 3KG4A 3N79A 5AT1B 5GMEA 4MFBB 1SC3B 3RRGA 4CO4A 3OR1A 5GAEU 2KM8C 1J5OB 5DDRC 2D3ZA 1RWNB 2RQ4A 4NXNF 4K5SA 3LP1A 4N77A 4CTAA 3UR0A 1RHUB 1DQAA 2EEYA 2NLWA 2QA1A 4DR2J 1UA1A 1DTQB 2M8DB 2OLWA 4FXDA 3MMJA 3UD4P 5HANA 2PMHA 3PYDA 1B99A 3H2LA 1FKOA 4WIQA 1T03A 1JX4A 4DQIA 4OJ3A 4LRDA 1A6LA 3TVYA 1VIOA 4IOAQ 3CT9A 1X4BA 4OFZA 1TVRB 4ZCLA 1NJYA 4EO6A 4JI3F 2D7SA 3S1TA 2CQ3A 1U0HA 1HNIB 3IA0A 4HT5A 2DRAA 2VKRA 5KFUA 3FBFA 1YDLA 1L3KA 4NL5A 5HVFA 4I7FB 1WKKA 1R3NA 2VC1A 3DDNA 3L7UA 4HLBA 3M8RA 1DRZA 4DV6F 4LVNP 2B56A 3HSJA 3L09A 2CWXA 1ZAXA 4IG3A 2CQHA 1U02A 4M63A 1S6UA 2MKJA 4WXWA 5B0FA 4XPEA 4ELVA 3M2UA 3D0IE 3HVTA 2R42A 3T1HJ 4B9SA 3OXLA 2OPQA 2ZH8A 3CE8A 1IBLJ 4CCHA 1KKHA 2P6TA 4DV3J 1F1BB 1FX2A 4KPYA 1KR4A 3C16A 4TKTA 1NSQA 4NZ6A 3K17A 1BXNA 1NJIT 1NZ8A 4HHJA 3RGIA 3SSSA 5D4PA 3C15A 3HJFA 2CJQA 1R8PA 2NXNA 2OD4A 5C24A 3T6JA 3VTIA 1S77D 2HRUA 2V8DA 5KT7A 5B09A 3SCIE 1NK8A 2VFTA 3P5TL 3JAMU 2KFYA 1E6YB 3MR7A 1HWJA 3TARA 1AZSB 2CNLB 1XR7A 3FGVA 3GR1A 2ZHBA 4HACA 3C6UB 4WP3A 1V3RA 2C3PA 4EYHB 1KVJA 1HNXJ 1OQ3A 3RRHA 1EZZB 3A4TA 1KTVA 2G0CA 2MQLA 2ASLA 3A12A 1JLGB 1QY7A 1RU2A 3QZ8A 1ULRA 2JC1A 4CNZA 1R0AA 3VGSA 1Q8IA 1Y5NB 1IKWB 2JHEA 2UU9F 1KQGB 3OW2R 2E66A 1WHWA 5HN0A 1KFDA 2IDLA 2KI2A 2N7YA 2FY8A 2YNGB 4JV0A 3GG1A 4L6V3 3NBPA 2ZH4A 2JWNA 2ZH2A 1VQPS 1PJ7A 4Z7CA 2XO6A 2G13A 2RDJA 2RT3A 4ANCA 2W2NP 5KG4A 2VV5A 4ZKAA 1ZYQA 1T11A 3ZXWA 3W2WB 1QTNB 2QLFB 2XB2D 2CAJA 2M5YA 2QZ8A 3QPIA 4ICLA 3CO0P 1NK6A 4JI4J 1O51A 4FS2A 3DOMB 2BA9A 1IR0A 3J7ZT 2E9TA 1CPZA 5LMUF 2N7CA 4RWWA 1RTJB 5AJ3F 4AL5A 2ALZA 3GR0A 5DZ7A 4DN0A 1KD1T 4G1PA 4CH0S 2EVZA 3C14A 3GMGA 1SJ3P 2FTRA 3MM9B 3MPVA 4R25A 1S79A 4ZPBA 1TL1A 4OZ3A 2HVEA 1TVRA 4P2SA 2AP6A 3ILJA 2CQ4A 2RD5C 4F3QA 4GKKJ 1UCNA 2IM2A 4HKQA 3J80U 1M5HA 3G6XA 2HG4A 1EX8A 1UW4A 1S1WA 1N34F 3HI9A 1VBKA 5JUMA 4B3OB 4O3SA 5FLXU 1U1KA 4DV0J 1WSVA 2DNGA 1JKHB 3UN3A 1RA6A 5D6GA 3CCRS 3NRBA 3QSYB 2CPXA 4IG3B 1UZDA 3K5MA 2UXCF 2YNHA 5K8NA 2ZWPA 4X62F 1MMLA 2VL1A 1U26A 2E44A 3JTPA 2YQ3A 1FDDA 3BGFA 3M2UB 4UZCA 4ZLLA 3C66A 4P9SA 4KT0C 1FCAA 1T8EA 2V67A 4O3QA 4ECWA 4DV5F 1NKCA 1IQZA 1IQTA 1JLAB 3CEDA 3CJKA 2GNKA 3AD9C 2DR6A 2KTQA 4FYYB 2GIQA 4ECXA 3EICA 5LMUJ 3TW0A 4N5SA 4J5OA 1N56A 2J0QD 1F2GA 1LWEB 2IVYA 4UUWA 2W7OA 4N7TA 2UUWA 5C24B 2KL8A 3H2UB 4C4WA 4IFYA 2XMUA 4TVAB 3QWUA 3M8YA 2X7IA 1WC5A 4F4AA 1NU4A 3PR5B 4GMKA 2BANA 2P9EA 4LRBA 4MAKA 4F7VA 3MFIA 1QAIA 4LF5F 2KVQE 2W2PP 2CRLA 1WEYA 2DNRA 1VQSA 4HACB 4J90A 4BDPA 1Y5IB 4GO7X 1S1XA 2IRYA 4LUBA 1WSRA 5HROB 4QJVA 3CJTA 1VGYA 3PYEA 4IUFA 4OZLA 4ILMA 3IBWA 4G1QB 1RISA 4C2MA 1OIAA 3D6HB 1RT6A 1TZ0A 2HPUA 4LFAJ 5F8JA 4N56A 4UW2A 2XWXA 3ZTQA 1TKZA 2P8IA 3LTOA 2CADA 2E5GA 2QA2A 5LT5A 2LP4A 1FERA 4F8RA 1FE4A 3AT1B 1JXEA 2X1GA 3M05A 3SDEA 5L39A 2L41A 3OL8A 3GV8B 3R7BB 4DQQA 1UWBB 3G82B 4XK8C 2LKZA 4QW8A 3HHKA 5LSOA 3H40A 4KRWA 3BO4A 4CI0B 1RHQB 3W64A 4CO5A 4M5LA 2QLBB 4I2PA 4OI6A 2HAFA 4DPOA 4NXNJ 1RTIA 2HS4A 2E9RX 1CJKB 4NI2B 1X5PA 3UD5A 9RUBA 1N5SA 5KFLA 1JWWA 5BJRA 4LF9J 2LECA 2QV6A 3GYNA 1S0NA 4P7VA 3JB9k 4Y6IA 3KLGB 2AV5A 4B9TA 1LQ9A 5GVQA 1NJZA 2FHMA 2DNYA 4NZ0A 2V8PA 4G6VB 1OY9A 5HI7A 5D0HA 4FZVA 2LEPA 4OYAA 1Y3KA 4WPAA 3M9OB 2R8HA 1Q86T 2OJ3A 1YJUA 2R4FA 4L73A 2X1BA 1ZAWA 1ZM9A 3PJXA 3PX0A 4UY8T 2W2OP 5CYQA 1FKAF 3CC7S 4ATNA 2L3MA 4Y28C 2G2YA 5JJBA 2J6SA 3P49B 3PXGa 3MF5A 4CLLA 4FVCA 2DGTA 3I0SB 4RPFA 3M8QA 1R43A 1X5TA 3W7BA 3J81U 5G0RB 1Y9OA 2LMIA 3E3XA 5D4OA 3FEYB 3PKYA 2WVEA 1RP5A 2ZD1A 3OUYA 2JX2A 2XMVA 4C3LA 2HK2A 2M70A 3I9V9 5KFCA 3VAIA 4Y2MA 3PZPA 1Z2LA 2CWKA 4XTTA 3OPKA 2DNZA 3FFIB 4A47A 3V81B 4JV1A 2OSRA 1R8BA 3M6VA 5D15A 1K73T 1SH3A 2DT9A 3JS9A 4IDKA 4TQRA 3BREA 3NGKA 1U1OA 4NLYA 1VQNS 4DSLA 4X4NA 1RLDA 1LXNA 2GHWA 4P2XA 4YB6A 4JI5F 3MWBA 4LFCJ 4IO1A 4FS1A 1T9YA 1UAWA 4DPYA 3MR6A 3WIUA 1NM2A 2N4CA 1RCOB 3MMCB 4FNHA 1S7HA 2Q79A 4BWJA 4DHVA 2XLIA 3VAHA 4EBCA 1K9MT 2XLKA 1DFDA 5FDLA 3VWSA 4CT8A 4QWEA 3DLEB 1LK5A 4DV7F 2NZ4A 3KHLA 1M0SA 1MROB 2ILZA 2ZOFA 4KHPJ 1YJRA 2X51A 1CJTB 2B9XA 2JFKA 3KLHA 2CUYA 2LXIA 2FGOA 3GLJA 5LOQA 3R5DA 2ZDOA 2RQMA 1PSDA 1UVIA 1H98A 2MJUA 1M90T 1S6PB 4QIVA 5KT4A 2XGQA 3SV4A 2YQ0A 3AXKA 3QSIA 2AWZA 3UD3P 3NMAA 2HAIA 1X4FA 3TI0A 1N36F 4RBVA 5J2PA 1BWVA 2OEMA 3TRGA 5FD1A 3L7PA 1RB0A 2D3UA 4OHXA 2DXEA 4C6AA 4DU7A 5HQMA 1E6VA 4U7CA 4RLEA 2OTJS 3D1OA 1X4EA 3P4UB 1RTIB 1JLEB 1V6HA 1CJKA 4NI2A 3G6VA 3FSYA 3O1LA 4NLTA 2J6TA 1OWXA 1XBWA 4Q8FA 3MXHP 4U67Q 2ADCA 4DR6J 1UPPA 2HWIA 2IVMA 1C1BB 2CQ0A 1JMTA 2HEKA 1F5BA 4NEYA 4NLRA 3OFHA 4LSNB 3K57A 5H9EJ 1PBAA 4RZRA 1S9FA 1XERA 5HSPA 3FSIA 5LMNJ 3CCZA 5K8PA 2E5JA 5E3QA 1RT7A 1FWPA 3EDRB 3H20A 3P3DA 4I4BA 4GVBB 4MYTA 4QR2A 3Q22A 3LAMA 2ZUAA 2ZEJA 3MD1A 3MOZA 5DQHA 2HWHA 3H2VE 5ETLA 2N3OA 2VPXB 5CYQB 3H4DA 3GIRA 2W4CA 4MFBA 4RW9A 3K8VA 3AOAA 5B0EA 3RBZA 2FVPA 4M5MA 3I0SA 3KDNA 3ZO7A 1LK7A 3SIPB 2H3EB 3TZXA 2DRDA 4CLTA 2VFVA 4DR5F 1HPZB 2BJEA 1LNQA 3SFGA 2RS2A 5KG1A 1TKDA 2EKYA 1VC6A 3FUYA 2QFJA 4KTQA 1FNOA 1VRTB 2E7WA 5DM7Q 2IY5B 2AZ1A 2CPIA 2NXCA 1CS4A 5SUHA 5LXYA 2HNYB 3J7Z5 3DFEA 2DH9A 3GJTB 2Z56B 3OT9A 3AY0A 2ZBRA 1YJWS 4YMEA 3Q0AA 1APSA 4USVA 1H73A 4EMDA 3UCZP 2CG8A 3KFWX 2XMWA 2DXFA 1J2VA 2DGWA 2DKOB 3DGVA 2DGXA 3MR2A 3HPOA 1U6FA 3R5BA 3MAHA 1X5SA 3IM8A 1XN9A 2BVZA 3NAIA 5KFOA 3UO0A 2VFRA 3C6TB 3N5FA 2MSSA 2VKZG 5BYRA 4GKKF 2B6AB 1NSKL 3EZOA 4CO2A 4X64F 1KNZA 2W9CB 1YKWA 2M4MA 2ZUGA 3QAEA 5FDLB 2PC6A 2XMJA 4IH6A 4CYUA 2K7JA 1NDCA 4DV5J 3KUEA 1RWXB 1X0PA 2PN6A 5KTQA 4MJKA 4BBYA 4L3KA 1S72S 1N4LA 3FRZA 4P2FA 3VVTA 4I56A 3F0NA 4F2RA 2AJ1A 1HLWA 1RAFB 1Y11A 4WP8A 4F0HA 3KYLA 4W90B 5L46A 2C2NA 2QLXA 1WKLA 5IQQA 3VCDA 4C9DA 1LEOA 3M32B 2YVSA 4F0MA 1E6VB 3MECA 5THWA 2KT3A 2W1BA 2WRMA 3A8JA 3EUNA 3ITHA 4OYBA 4RW6A 2IDEA 1V5VA 5D0RA 3FKBA 3GP9A 3MFHA 2HSEB 5ETTA 3GYXB 2XTJP 3NS7B 5AJ3J 2JOQA 2DGVA 1NKEA 3NNCA 4LSNA 4D3HA 2EFNA 5DGAA 2UUCF 3S01A 1T9TA 1K8AT 1BQXA 3DI6B 5FIIA 1P1TA 2HBYB 4FF3A 3CJ4A 4USHA 5BYQA 4KH0B 4J9QA 2LCWA 1UKUA 2MGZB 3PR4A 1TFWA 2R7QA 1ZOTA 2ZH9A 2ERRA 1IBKF 2HW3A 2FDNA 3R7SB 4YHHF 1ZPWX 1VRUB 3UDEA 4FDFA 4DSFA 3HZGA 2OTLS 4LQ3A 3PEJA 1VFJA 1WDDA 2V63A 1PO6A 3QRRA 3UNGC 3RBDA 1X4DA 1WC4A 4DL2A 1YHQS 4B3MF 3BPDA 2FZCB 1VRTA 3DXBA 4IG0B 5KFJA 4ES2A 4Q5VA 5M2UA 4KGVB 3ETMA 5LJ3Y 3T5HA 3HX9A 3DHWC 3RAXA 3OVBA 2FLLA 1TL1B 2IA6A 1T9UA 3KKFA 3K5OA 3OD2A 4A8WA 4NCBA 1RKJA 1S1WB 4F2SA 3P8BB 4J9SA 2DNNA 4ECYA 3T5LA 2QT7A 4ZLNA 3SI8A 4DX5A 1PYOB 3CJ8A 4DEZA 4K4SA 3BSCA 2NUUG 2LDYA 4P71A 1H38A 1PBUA 3ZFVA 3IRXA 3T9ZA 3M8SA 1WG4A 2BR0A 2IM0A 3H25A 4MTPA 3GCWP 2OH2A 1CEZA 3IFEA 1YK9A 5C7PA 2MHNA 3OXFA 2VG5B 1TL7A 5D8HB 4RW4B 5E41A 3IM9A 2ZHOA 3Q8PB 2WONB 1HWIA 1X4CA 2EPIA 5L1KA 2X1AA 5LMNF 5GAGI 4DR2F 3EXCX 2POKA 1GX6A 2R3VA 3THTA 1O6XA 5KG2A 5H9EK 1F3VA 2B7CB 3HSZA 3WC0A 5IT0A 4DR7F 3BQ0A 4RX6A 3IRWP 3MECB 4AXIA 4DX8H 1U1QA 1RHMB 2XMTA 4RW6B 4ZJLA 2IMWP 2C3OA 4DN9A 3TR5A 4YN3B 2WSFC 4X65J 4USUA 3DRYA 1DJ0A 1P9QC 3GSDA 4JI8F 4ES1A 2WOMA 3TUJC 5HO4A 3SZ2A 1A9NB 3SQGB 3DN9A 4HH1A 4CRJA 4DF4A 1RE1B 3QT5A 3LW5C 1S49A 1FRKA 1YRTA 4OYIA 2G0IA 2QYGA 2VG7B 1G2EA 2PO4A 2OO4A 1VQLS 3GSIA 5DLFA 4OL8A 3NGTA 3ZZRA 3NAHA 1MU2A 3OR2B 2AJ4A 4MMOA 2PI4A 4P6QA 4HYKA 1I5OB 2RVJA 4M5DB 2JEFA 1IR2A 4QQBA 2EXUA 3UN5A 4IQXA 2EKNA 1RU1A 4ZLPA 4ZVOB 3GIJA 3VAGA 5DS7A 4DPTA 4LSZB 1IKVB 4I2PB 3AD8C 1KQSR 1HD1A 4IRKA 3GWCA 4QIFA 2IAJA 4WYLA 3CJSA 4O4RA 1G6BA 1NUEA 4AFFA 1A7GE 1U24A 1HNZF 1N0UA 4IH5A 1TK5A 1FE0A 2CNOB 4URGA 1H2UX 1JJ2R 1Q5YA 1W25A 4QWBA 1GMWD 1JLBB 3MM5B 4LIRA 2BJ9A 2JDJA 3CD5A 2JRSA 4DUYJ 3DGPB 2FVQA 2UVUA 2YWFA 4MIAA 3OXGA 5BR8J 2ZZMA 1YJVA 1RCXB 1XNQF 1BWEA 1N5TA 4JP8A 2AJFE 4DR5J 2LA6A 2DIVA 2M88A 3HD2A 2RKIA 1PGZA 2EI5A 4F67A 4FYDA 2BYCA 4FYXB 4DG1A 2R7WA 3IBCB 1IXKA 1XMQJ 4XDCA 3BM7A 5BR8F 2VFUA 4C11B 1S12A 1JIHA 1HNVB 1X5OA 4HT7A 4AE5A 1OYDA 3AJ2A 1NZAA 3HFVA 2W8LA 3I87A 2UVWA 2FZKB 2DNOA 2MQPA 2QMWA 5I3UA 2HZAA 1N6QB 3G9CA 5A8KB 1N5YA 1AFJA 1XJWB 4ZITA 4LF4J 4IYQA 2A1BA 2XHCA 4CH7A 4F02A 2RILA 2V9KA 4YOEA 2DBBA 3N4WA 1YIJS 2B9EA 2HVDA 5EWFA 4YB1P 2XMMA 3KUGA 1TR0A 4UQTA 4YHHJ 3P6YC 3CDWA 2BV3A 1XQIA 4LR8A 1HBMA 3R7NB 1FDAA 4J37A 3VZIA 1B3TA 1GMUA 1VQ8S 5J2NA 3CCSS 1S9EB 2WVCA 5K5MA 4J9UE 3ZZOA 2C3MA 2CIMA 3MGJA 3SQGA 2CZ4A 1CJTA 2G2ZA 3OTBA 2C22A 1QSLA 4KO0A 3MI7X 1YRXA 4ELUA 2GAGC 2Z4PA 4M8LA 2UXCJ 5KFEA 2CJAA 4O4GB 1S6PA 1QAJA 5ETQA 1HKAA 1QSYA 2IPOB 3QJLA 1SL0A 1UVKA 1HNWJ 4USTA 2G0JA 3K5PA 2ZH5A 3QNWB 4I69A 2XG8A 5BXIA 1URRA 1F0XA 2OD6A 3FK4A 3DM2A 4MK7A 3R9LA 5CCMA 4GKJF 2COLA 3BSOA 2JLGA 1ACMB 1CBKA 2P2CB 5KAKA 4P2MA 5LJ5Y 3KJVB 3CC4S 2R9LA 4OX9F 4ZVTB 2F65A 3EJMA 4NLPA 2W2QP 4PG5A 2RUSA 4C7QA 1C1BA 4QR1A 4MKVA 2FIUA 1I1GA 1U2RA 2EFQA 4W4MA 4QPXA 5KOXA 4H4KA 2IC3B 3DU6A 1S9GB 3D3CJ 1VBZA 1SPBP 5CQGA 4ZCMA 1H6KX 2CVEA 2GCFA 4DQSA 1RT7B 1HMVA 2VQFJ 1SC6A 4X4UA 3CCVS 1UJ4A 2PMZD 1N5QA 1RAOA 4X4SA 3OSNA 1EB0A 1NDLA 1R0BG 2CJ9A 4USIA 5HAOA 3FNNA 2BX6A 3W62A 2E1PA 2VZ9A 1C4CA 3R27A 1FKPB 3TZWA 1H2VZ 5IM0A 4KHMA 4XAKA 2BZ2A 4B02A 3H5UA 1BMQB 4EI2A 1SIZA 3DDIA 4C3KA 2B7BB 2MSTA 1FVSA 4CLYA 4ECZA 2RNEA 3SEOA 3CIMA 2C28A 3KDOA 2CPZA 3AODA 4M94A 4UZBA 2UUTA 1CS4B 3BBBA 2ACYA 4A48A 4ETZA 2IHR1 2RF2B 2LU1A 2ZITA 4NA2A 5A2QU 2VUGA 3L3CA 4HDGA 1DHMA 2BOPA 3WC2A 3H98A 1MN7A 4GC7A 1Q8KA 1QVFR 4P74A 5A8RB 1HQEA 2QL5B 1BY9A 5GADI 2YXLA 3C6TA 4URSA 1T95A 1MWQA 3PEHA 3Q2SC 4MIWA 4Q8EA 1F9EB 5EHHA 4X4TA 1M5KC 4K50A 2HHTA 3RG6A 1G7CB 3V4MA 1SXLA 2AF6A 2BEFA 1U1NA 3GPAA 1FD8A 4OYOA 3W60A 3UE2A 2HGMA 2RDDA 2NXUA 3BKFA 3EXYA 4DS4A 1U6BA 2HHWA 4RU2A 1S1TB 4O3NA 2QEXS 1TK8A 5KT3A 3V2UC 3D66A 2ZH6A 2DRBA 5KG0A 3N5BA 1PC5A 3RBXA 4PG8A 1MMDA 2CA9A 2DNMA 2L9NA 3ET6A 1RT4A 1J5OA 3L95X 1HHTP 1UA0A 4PYAA 4Q7AA 1VQ9S 4WKRA 1DQ8A 1EP4B 5F8HA 2I9SA 3L9ZA 2J9EA 4A8XA 3D1HA 2KT5A 2MZSA 4CLPA 3MZIA 2W9BB 5F41A 2G2OA 3ITHB 4NLGA 4FYVB 5DG8A 2DYAA 2EFVA 1JJHA 3EE3A 4DSIA 3GU0A 3W9HA 5F8MA 4ID5B 2RRNA 3O5TB 1YZ7A 2V0NA 1KHVA 3GQCA 1XMQF 1OJ4A 1HI1A 3WX4A 4CNYA 1HNIA 1FWKA 1RGVA 2ZM6F 8RUCA 4KY3A 1JK9B 1RABB 2D69A 1WF0A 1V9OA 2IJFA 1U1MA 2QLJB 5ETRA 3IG1B 4DSJA 4N8NA 4DV7J 3D68A 1PAUB 3BGLA 3I31A 3TOQA 5CD4H 2U2FA 1WC1A 3FJ2A 3V6JA 2EC0A 2BE2B 2HWTA 4U7UD 3RZAA 2YBVA 2IVFB 2I6WA 2VICA 3QJPA 4I0WA 3J7YI 2ZJQQ 5IM0B 3PIPQ 3EVWA 2CZ9A 3CDBA 2QLWA 4WZMA 1T9XA 4RW8A 1JQGA 2ROEA 2XY6A 2QL7B 1UEUA 4QZVB 4DXLA 3OHBA 1NK9A 3IWLA 4HTIA 3OJSA 1U49A 3BB5A 1R7IA 1RSCA 2EFPA 3C15B 1UJ6A 3DMJA 4J9OA 4OI0A 4Y2AA 4DL0C 1QJHA 2CPEA 2YNIA 1QAYA 3QGPA 2HQCA 3HMJG 1E6YA 1VBXA 4B9UA 2DNHA 2F8HA 3QFHA 1XTZA 5HMWA 1HBNA 5C42B 3PFEA 2YQ1A 3BGOP 3TUIC 2RU9A 4OV1A 4L75A 3CIZA 3I4HX 2B8PA 4PEOA 2XEXA 3KK2A 1WI8A 4O3OA 3UWTA 1R0AB 2Y8WA 4RNNA 3IP0A 5E3PA 1TELA 3M7VA 1TKTA 1PYSB 1ZBTA 2GFFA 2IBKA 1X7VA 5F0WA 3KK3B 3PW2A 1BQNB 3G8SA 4C0OC 3CMES 1P27B 2W7AA 5A76A 2HLUA 1HI8A 4WFBQ 3V4IA 1W2BR 3KLIB 1LXJA 4KYZA 2EK6A 1F3FA 2MTLA 2CJYB 1XC9A 1B7YB 2C3YA 2AYBA 3A3PB 4WFXA 1F60B 3H5SA 2D41A 1AUDA 4BC9A 1HBUB 2J8AA 2KU7A 1TL3B 4AYBD 4C8KA 1XNRF 2GV1A 2H5EA 5IOLA 1K0TA 1SBRA 4WE1B 3LA0A 4OZNA 3GFXA 4OX7A 1RLCL 5CD4A 2O66A 2MKHA 2YWHA 2PIIA 1SKRA 1FEHA 2B51A 4K2XA 4JI6J 2ZE2B 2ASDA 3OV7A 5HL7Q 3NGSA 2Q6BA 2GW8A 1QUPA 1WHVA 3PRVA 2QO3A 3K58A 4PQUB 2BE2A 4DV2J 3BKTA 1R89A 4M5DA 1KVKA 4LT6A 2XM3A 4M5GA 4ANDA 3BO2A 5F0UA 2YKPA 3DLGA 2KJVA 4B3TJ 1C4AA 3GILA 3FEXB 3C2PA 1NB7A 1IKVA 2LXFA 5F8NA 5M2PA 2W4PA 3MEGA 4X84A 4WTOB 2F7VA 1DURA 3AA8A 2BQ3A 2SXLA 2PDAA 3UDLA 2PA8D 2U1AA 2OPSB 5KFYA 1FDNA 1LWEA 3UCGA 3IWXA 3OVAA 2NSBA 1Q0NA 1K44A 2AZ3A 2K2PA 3DMJB 4ZVQB 4O44A 4OIXA 4C8NA 3UI3A 2BQUA 3QRQA 4DR4F 4FN5A 3B78A 4JYAJ 2YNIB 3E51A 3H5YA 2XNRA 4Y0FA 3W9JA 3Q24A 3IBFB 3DGPA 4ZP9A 1HBNB 3QT8A 1Q4RA 4PUOA 5C42A 2V9WA 1NB2A 1Y10A 4I2QB 1J5EF 5LSRA 4DV0F 4HTJA 3M2VB 4F4YA 4Q43A 2GMHA 1S6QA 2WW8A 2NXJA 3M8WA 2XO7A 2XY7A 3PO5A 4LBPA 4U9RA 3R2DJ 1N33J 3U7JA 3W2VA 3PM9A 1VR6A 4RUBA 5T7LA 3JSRA 4B3SF 4DPWA 4DU8A 1IBKJ 2HRYA 2H65B 1H0HB 2EG2A 3G2XA 2Z30B 3SDEB 4A8KA 2RHSB 4Z7YA 1Q1KA 1X9MA 3CDAA 3FMBA 3N01A 2HNZB 3KG1A 5I3UB 3IWNC 3QLHA 2GAHC 1TKXB 2L9DA 4NYOA 4R0JA 3L7OA 1MMNA 2V2VA 3O2IA 4KAIA 4ZVUB 2WBRA 1U1RA 3TVKA 4MK9A 2DTJA 2VD3A 1GMVA 2FLOA 2C2EA 3R5AA 4LBIA 4ED2A 1F5AA 2Q66A 2WSEC 4ED5A 2HIYA 5HVGA 1IKXB 1IKYB 4BLGA 4PYDA 1TL3A 3KLGA 1G4CA 4OX9J 3CJ0A 5HJXA 3D6TB 2OGUA 5J2NB 3AXMA 1YTYA 3NOGA 1FO1A 1N88A 3ZZ0A 4TXSA 4RNOA 3KJNB 4TU8A 5DQIA 1J27A 5KFQA 4WFNQ 4TN2A 1VQYA 4NRTA 3CXCR 1SVDA 2I8EA 3ENAA 1DAXA 1PIEA 2DGOA 4O4GA 1M1KT 3OFGA 2R8JA 4E2FB 1A0OB 3HHLD 3NOCA 1KC8T 4WU3A 3FC9A 2MLXA 1EQMA 2J7UA 1VQOS 5KG5A 1GAOA 2I38A 4OHZA 2V6AA 1S0MA 2OKQA 3R1LA 1RKIA 2ATCB 4EBEA 3FFIA 2V2QA 3V81A 1JB0C 4UUXA 1D9DA 3T19A 2DJWA 1O5JA 5HMZA 4KPCA 1KWMA 2W2MP 3O44A 4DQPA 3TQ1A 3NEKA 3JQMA 3PO4A 1UPMB 1D8YA 3OLBA 1R8HA 3RTVA 3DXSX 1NHUA 1T05B 1I51B 2I1RA 4LF7F 4ZHRA 3A3NB 1F5CA 1VISA 4O3RA 4H4OB 4PUOB 3KMQA 4Y00A 3BYPA 2J0WA 3W61A 1X0FA 3POTB 1GTHA 2IYIA 4YP3A 4DV3F 3K5LA 2RQCA 4I6AA 1LWXA 4DV4F 1N32J 3ZZTA 2Z8QA 2P9GA 4RNHA 1Y3JA 3ZZYA 5B0CA 2KH9A 5J1NA 5GMKa 1EIYB 1D8ZA 5T7LB 3MMBA 4PR6A 3NGRA 1C2PA 4BWMA 2VOOA 1D09B 4K0KF 4NYPA 3GE9A 2HMIA 4QPTA 2LQ5A 5D77A 1B0TA 1T9VA 1V5IB 2CXEA 3HHLC 3NLCA 4UOCA 5A2QY 2ZHAA 2CJXB 3TANA 1XNQJ 1SV5B 4KFBB 2Y1RI 2PEBA 5KFNA 3CCLS 1D3WA 2RRAA 3D4JA 1L5UA 3FSXA 3J7YU 3NNHA 3HHEA
chains in the Genus database with same CATH topology
1N52B 2ZNZA 4NLDA 2CQIA 2LVWA 3RR8A 1YSJA 3CTRA 3TO8A 5I42A 7FDRA 1NKBA 2CG4A 1W2IA 5B0GA 2LA4A 3ZZUA 1U47A 1S10A 4NCAA 2VONA 5I4MA 5KG3A 4QBUA 1C1CB 4I6WA 4F50A 4C8MA 4PWDB 5IQ6A 4LF6F 3LQVA 3LWLA 2EK1A 2IMOA 3AQOA 1PILA 2HS3A 4G1IA 4ITSA 4IR9A 3KG0A 3OTDA 4C0HA 2W7PA 4NLOA 4PWUA 1TQLA 3DOMA 1N48A 2FC9A 3NG8A 1UJ5A 5KT5A 4OLOA 2YKMB 2QIFA 3MM6A 2CQGA 2JVOA 4KKOB 1FTCA 1IJFB 2IBOA 1HNWF 4OI1A 3K2YA 4R5PB 1OSCA 2ADBA 3CSKA 2J7WA 1KQFB 3VAFA 3V5RA 1S76D 3IG1A 2B6AA 3LWMA 1NJXA 2W9CA 1WTFA 4H4OA 4OZ0A 2R7UA 4DV1F 1LKZA 3ISND 3S6EA 2I2YA 5EDWA 2QSWA 2XLKA 3QAUA 3OL6A 2P6SA 4X4OA 4NLSA 5E3CA 4C0BA 3U02A 1C0UA 1SI9A 4FPRA 1LWCB 1JLAA 2RU3A 3IGVA 4DWIA 3MMBB 1VQ4S 3NS5A 4EU0A 2ASJA 5AXNA 2Q6CA 5KFWA 4DR1F 2DR8A 1UVLA 1RYRA 4KR0B 3MDFA 4WFYA 2MXYA 2AYMA 5KFFA 2JC0A 4J9RA 4V19X 1SV5A 4O0IA 3NCRA 3SCJE 2D9OA 2BANB 4X4QA 3FQLA 5B0DA 3I56S 4M95A 3H8YA 1KVIA 2CJKA 4ZVFA 3AAWB 4ZOSA 4YB7A 5K8OA 4ALZA 3NMRA 4J9LA 2JVRA 5I42B 1SB6A 3D5MA 3UQSA 2KT2A 2HFZA 1Z1ZA 3CC2S 3KK2B 3JSMA 1Y0HA 3HXMA 1C1CA 3KNGA 2E29A 2MGZA 3QZ7A 1V3SA 1WD6A 2PI5A 5EX3A 2HZCA 2J9DE 2YWKA 2CQ2A 3N6LA 4ZP7A 4ED6A 1FJCA 1XWLA 4CO1A 3ULHA 1VQ5S 4Y3CA 4IO9Q 5B0BA 2PA3A 1HBUA 2Z2LA 3HHLB 1KRPA 4QWCA 1NK5A 2D1CA 3MTJA 2HHSA 3GFZA 3KHHA 5AE1A 3R5CA 4KKOA 1QE1B 2KO1A 4TNOA 2AYEA 4R5PA 1Z2ZA 5I3PA 3RRKA 1KOOA 5F9NA 3PNIA 5E3RA 4ZVEA 2YH1A 2VODA 2RMLA 3B4DA 2FHJD 2D9PA 3B8HA 2ZE2A 1SJQA 4ES3A 1B64A 1JLFB 3EGNA 2B4VA 3PFOA 5IXUA 3KHGA 2OAUA 2A18A 3IRXB 5AXKA 1QTMA 4NRUA 3I0RB 1BD6A 4X4PA 2W25A 1C0UB 4WU2A 5GAHU 2FPHX 2V4QA 2J76E 2J5AA 4OX8A 5LL6d 4RW4A 2MZQA 4J9MA 2QA4S 1N54B 2OFHX 2OPPA 4IDKB 3K59A 1MWYA 3AHPA 3T5KA 2R7SA 4BS2A 1R6YA 2R2SA 5DG7A 4JI1F 4O44B 3RR7A 4IH7A 2AJQA 2O67A 1ZAVA 2HHUA 2QA4G 4ERDA 3MMCA 3TNVA 2J7KA 1X4HA 3HZEA 5G4DA 5HP1A 5L8RC 3LO3A 3DLEA 3F41A 3IC1A 1VC0A 3M2VA 1MROA 1WELA 1S99A 1S6QB 3CJ2A 5GAGU 1ZZNA 1CC8A 4O23A 1VK3A 3M1VB 3JAMY 5D4LA 3BF4A 3IGNA 4LIWA 4ZVHA 2ZBIA 2X3GA 4QU7A 2B4PA 2YH0A 1LWFB 1WTBA 4I67A 2FHJA 1AFIA 2YTCA 4QIEA 2B4OA 3MD3A 4Y2IA 4HDHA 3HKWA 2JL9A 1REVA 2BRLA 1TUVA 4O3PA 4YY3F 3K0JA 3JSYA 2CYYA 5AE2A 1RA7A 2ZBCA 3F44A 1JLEA 3MPWA 4G3IA 3B82A 4DFKA 2KYZA 2LQBA 5KG7A 1LV5A 1VQMS 2XWYA 5DETA 3BSNA 2HQ3A 2LQ9A 1T3NA 3UPFA 1FK9A 3IO1A 5E0OA 2Q43A 2KXHA 2Z0GA 1OO0B 1TFYA 1QE1A 2HFOA 1JLBA 1KONA 1S1UB 2GQQA 3MM5A 4R0EA 4ZPTR 1N8RT 1WNEA 3DU5A 2HGLA 2BXJA 4CT9A 4N76A 2VFSA 3MCSA 3CGIA 2MY7A 1KOHA 2LYVA 1QUVA 4RW9B 2WTFA 1S4FA 2WCXA 4Y2KA 2E5IA 4XO0A 5A2QY 4PQUB 1HA1A 2Q1LA 4QR0A 1VLYA 5CHCB 2KFNA 2CQPA 2HFNA 2V8VA 1BGXT 4DG1B 3TUZC 3NWGA 2XI3A 2RH3A 4ECTA 4Y34A 2HNYA 1ZETA 1HNVA 3T1YF 5B0AA 3BQ2A 3LP2A 5DG9A 5F3TA 3S7RA 5KFZA 4DBQA 2D3OR 5A8KA 1N5YB 2NREA 2CDQA 1P8GA 1FXLA 1UFWA 3FZBA 5T14A 1TV6B 4HEA9 1GH8A 5A8WA 1ZM4A 3QMQA 4MK8A 3EPGA 1YVFA 1U25A 4H54A 4ZHRB 2QE5A 5HP1B 5KFRA 1AW0A 1S9EA 1BQMA 4KGKA 3KLFB 3RB4A 1Q16B 4LFBF 1G1XA 3PDNA 4KO0B 4ED1A 1K1SA 4HVZA 4RW7B 3NP5A 5DRKA 5DQGA 3QGIA 1FJEB 2NS1B 3LANA 1Q8LA 2KG0A 4PXEA 3IXQA 3R1HA 1Y7PA 3ZC4A 4OJGA 3JTOA 1LFPA 1Y00A 1TP7A 2HNDA 3A1YG 2E1CA 4KHPF 2ZKUA 2XNQA 3DM2B 1RT1A 5DDOC 1MSWD 2VG6A 5DJBA 1IN0A 1XK8A 2YX4A 1DZ5A 2MB0B 4H4KC 3Q23A 5CCLA 3LF0A 1VQKS 2UZAA 2DNKA 3IR7B 3DLKA 4A8OA 1H2TZ 2ZVSA 1AROP 1WEXA 4QCLA 3DOKA 4EFAC 4CIOA 3DI6A 1G3OA 2RUGA 2R8KA 1QSSA 2YKNA 2R7RA 1HMVB 4ZPDA 2UV8A 2DHSA 4J9PA 2CPDA 2B9WA 3N0VA 3N6NA 2BM1A 5JXSA 1SUQB 3D2WA 1VRUA 1TK0A 1P1LA 4JV5F 1FKPA 5JVHQ 3H5XA 2F8EX 1FHTA 3A8EA 2IM1A 4RUHA 4BCAA 4JI4F 1NNDA 3EZUA 4IG0A 5DLGA 4D3GA 5F9LA 4KV8A 4NOHA 3WDOA 2K1RB 2ZH1A 3BEGB 3SCLE 3LP2B 1PC4A 4TY8A 3MM6B 3IN5A 4Y2CA 3I9ZA 3G6YA 5L1IA 4ECQA 4C97A 3HM9A 4NYZA 5BYSA 2KG1A 2CQ1A 5A8WB 3V6DB 2LQJA 3JSBA 3ISNC 2KKHA 1FXRA 2HIQA 1H3DA 1LOUA 4PG4A 2VA2A 4DSEA 1MW7A 2BW2A 1FF2A 3KLEB 5KFAA 2BABA 2BM0A 3VAJA 2AGQA 2R2TA 1NO8A 1GXUA 4FP9A 4B9MA 5HMYA 5J2MA 3BJYA 2XZWA 2MQMA 1YITS 3OLAA 2IYGA 5KFTA 3CMAS 2FLPA 1LW2B 4LF9F 2VPZB 2JFDA 2ZOGA 4KSEB 5HBMB 3HVRA 2I0XA 2EBGA 4QWDA 1M5OC 2W8KA 4LFAF 2CKWA 2ZKTA 4EYIB 3OJUA 2VBZA 4IRCA 2HHHF 2DD8S 5FLXY 2DHAA 2M3DA 2DH8A 3M6XA 4A8MP 1TAUA 2V8GA 4PXBA 3IR5B 2MKCA 3BN4A 1I6JA 4YB5A 4OZJA 1Q82T 2R7XA 3HP6A 2WOMB 3MM7A 1DLOB 4Z37A 3I6PA 1KFSA 3MMAB 2IA0A 3GB0A 4LJMA 6FDRA 2BJDA 1Z4UA 2YKNB 5KFPA 5IWAF 3BDEA 1JLQB 5LSLA 4LSLA 4IR1A 1VQ7S 4NA3A 2HVZA 1HFEL 3FMWA 2FUG9 1KQKA 3PW7A 4HL9A 2AW0A 3QYYA 3DRRB 2OMLA 3HHDA 2IAJB 4L72B 2C42A 4DFMA 3VF0B 2NYIA 3HHLA 4GO5X 4WYWA 5EWEA 1LFWA 4C8YA 1VBYA 1M5SA 4K4ZA 2DPIA 4NLUA 4DJBA 4AXJA 4YDXA 3PV8A 1WI6A 2B9YA 4ILRA 1HD0A 2CPHA 2B5JA 4F3OA 1U48A 3DLHA 2F4VF 3HO1A 3LH2S 4XDDA 4ZPCA 3V6DA 3CULA 4NZ7A 1RT3A 2GGPA 2RE1A 5EX0A 1HYSB 2KRRA 3MUTP 1Y4ZB 2MKIA 1GQEA