4IO9Q

Crystal structure of compound 4d bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4io9Q00
2HGNA 3ZZYA 2MGZA 3FEXB 1BY9A 5LXRA 1A9NB 3VAGA 1M90T 3MDFA 2YWKA 2DGOA 5DDRC 2DGQA 4LMZA 2KM8C 3CPWR 2PE8A 2MQQA 3MOJB 1M5KC 2QEXS 4FXVA 2YTCA 1X5PA 1VQ6S 2CQ0A 1X4GA 3CCVS 1M5PC 1X4DA 3MD1A 1M5VC 3ULHA 2FHOB 2MHNA 2MQLA 3MURP 1WTBA 2KU7A 2KRRA 3VAHA 3IRWP 1N8RT 3MXHP 2M70A 4F02A 2XSFA 2MZ1A 2LKZA 4ZKAA 4IUFA 5GAGU 3CC2S 5GVQA 2CPDA 2VODA 2DISA 2L41A 2KH9A 2MQMA 4BS2A 1OIAA 3Q2SC 2CQPA 5GAEU 2CJKA 2DHXA 2MSSA 3P5TL 1SJQA 3G6ES 4TU8A 2BZ2A 5JVHQ 1WHVA 5LSOA 3EX7B 4RU2A 2OTLS 1JMTA 2G1DA 2D9OA 1W2BR 2DH7A 2MQNA 1U1PA 1VBXA 2VOOA 3U1LA 5DM6Q 4Y0FA 1YIJS 1HL6A 2J0QD 2L08A 3VF0B 3L3CA 2DO4A 5BJRA 1VQKS 2E44A 1CVJA 1B7FA 1VQ9S 2G0CA 1X4BA 2AYEA 1X5TA 2MPUA 2KN4A 4PRFA 1YHQS 4CQ1A 3NNCA 2KXHA 4QU7A 1VC5A 3THTA 1DRZA 4C0OC 3CMES 5D78A 3Q2TC 2U2FA 2MQOA 2M7SA 5DM7Q 3UCZP 1VQMS 2AYMA 1YTYA 3VAKA 1FXLA 2O3DA 2QFJA 2CQBA 2CPJA 3D2WA 4Z2XA 2KXFA 1VQ5S 2DHAA 3HHNB 4M5DB 2DNNA 1N52B 1OWXA 1SJ4P 1WG1A 2NZ4A 3NS6A 1U1NA 5LXYA 5D77A 2FY1A 2XB2D 1NU4A 3UE2A 2ERRA 1SXLA 4EGLA 2DNPA 3CCUS 2CPYA 3H2VE 2MY7A 1U1RA 4TU9A 2OIHA 2E5IA 2DHGA 2DGUA 3TO8A 1RK8A 1DHMA 1H6KX 4QQBA 1HD0A 1G2EA 2HZCA 1L3KA 4P6QA 3PIOQ 3G8SA 1FJ7A 1UW4A 5DDQC 2KYXA 2DK2A 3R1LA 1U1LA 2CQCA 2MKHA 2MB0B 3CD6S 4TLQA 4YUDA 3G71S 2MKKA 2X1FA 3RW6A 1DBDA 3BO4A 2YH0A 2AD9A 1HD1A 1WEZA 2M9KA 3B4MA 4IOAQ 3S01A 2RNEA 2JWNA 3OW2R 2AYGA 3CCRS 2ADBA 3TP2A 3MD3A 2DNLA 1U1OA 2J0SD 1WEYA 2LCWA 4W92B 2QA4S 3DXBA 2DH9A 3PIPQ 2KRBA 2MZRA 1WF1A 2DIVA 5DDOC 2OJ3A 1ZZFA 1JJ4A 3EGNA 2Q79A 2EVZA 3CCSS 3P49B 2DO0A 1ZH5A 1D9AA 3NNHA 2KT5A 2EK6A 2CQ3A 1X4AA 5MLCV 2KG0A 1WI8A 4UY8T 2LYVA 5HO4A 2OSRA 2M0GB 5FJ4A 2LA6A 3MI7X 4IO9Q 1YJNS 2VOPA 4F25A 1WEXA 2MJNA 1F9FA 5CXTA 1YJWS 1FNXH 2DNQA 2JX2A 2X1GA 1S79A 2GHPA 4J5OA 2N3OA 1WELA 4FXWA 3G8TA 2DNYA 2G4BA 3P6YC 1NO8A 1VBZA 3S7RA 4Y00A 2CPHA 2DGSA 2DGXA 3NMRA 1WF2A 2MKCA 2RS8A 4LJMA 1O0PA 4WFBQ 1VQ8S 2BOPA 5DETA 2FC8A 1WHXA 1FT8A 2OTJS 1WG5A 4V19X 2MSTA 4ED5A 2ZJPQ 4C7QA 1VQ4S 3R1HA 1HA1A 1A7GE 3LQVA 1FO1A 2E5GA 1X5OA 2MYFA 1YWXA 1KD1T 3N9UC 3B4DA 1JJHA 1KOHA 3H2UB 1VC6A 1K73T 3IWNC 1U1QA 2N7CA 3FEYB 1N54B 2KXNB 2ADCA 3I56S 4PKDB 2JVRA 3SDEA 4U67Q 4WKRA 2CQGA 5GADU 5H1SV 2CQ2A 2XS2A 2DNOA 5GAHU 2MZJA 3CTRA 1X5SA 2E5JA 2F3JA 2HVZA 1ZZNA 1PGZA 2N82B 2ZJQQ 1IQTA 2LXUA 3CF5Q 3G96A 3CCQS 3S8SA 3TYTA 3NS5A 2XS7A 2RVJA 3V4MA 2RRAA 2I2YA 2K8GA 1U1KA 2DNHA 2MXYA 1U1MA 2A3JA 2MZTA 4C4WA 2RQCA 1FJCA 3SMZA 2ZJRQ 5IQQA 2KI2A 1FJEB 2SXLA 1P27B 2MKIA 1WHYA 2CQ1A 2MKSA 5IFMA 2GO9A 2DHSA 5IM0B 4WFAQ 1Q7YT 1NJIT 1URNA 2KHCA 1X4CA 1Q86T 2MQPA 5CYJA 3VAIA 3UD3P 2MZSA 4TU7A 2F9DA 1AUDA 1Q82T 2DGWA 1K9MT 2D9PA 5ITHA 1H2TZ 1Q81T 2RU3A 1VQOS 2CQ4A 2MZQA 3S6EA 3U1MA 5EN1A 4WIIA 1U6BA 4A8XA 4QPTA 4WCEQ 2YH1A 1KC8T 1DZ5A 2AYBA 3MUTP 2WBRA 2B0GA 2DNRA 5LSLA 1WG4A 1FHTA 2LMIA 2X1BA 1WF0A 1K8AT 3SDEB 3CCJS 4WFNQ 2HGMA 2HGLA 3UCUP 2EK1A 5LJ5Y 1R8HA 2RQ4A 1UFWA 1H2VZ 2U1AA 1X4FA 1SJ3P 2M8HA 4CH1A 1VBYA 2LXIA 4ERDA 2M8DB 2M88A 2CPEA 2I38A 1YI2S 1UP1A 3US5A 2K3KA 2DNZA 2UP1A 4QU6A 1WHWA 2RUGA 3J7ZT 2JVOA 5LJ3Y 2LQ5A 5IM0A 3CCES 3CCLS 2XNRA 2DITA 3ZZZA 2DNGA 2LECA 2LA4A 3UWTA 2RS2A 3P3DA 3CC7S 2DH8A 3R27A 3BO3A 3VAMA 1D8ZA 4CIOA 1VQPS 1RKJA 1PO6A 1R8PA 1YITS 2CPIA 2XNQA 3MUMP 3CUNA 1X0FA 4UQTA 3BO2A 1OO0B 2DB1A 3J7YU 3I55S 3NNAA 3G9CA 1SJFA 2VONA 3CC4S 2M2BA 1U2FA 5JVGQ 2MMYA 2XS5A 2OSQA 2CQDA 2FC9A 3SXLA 2PEHA 1X4HA 3G4SS 4YB1P 2HYIB 2M4MA 3HI9A 1JJ2R 3CCMS 2CPFA 2MJUA 2E5HA 5GMKa 2KM8B 3RW7A 3BEGB 1YJ9S 3JB9k 1N88A 2FPHX 2DGVA 5DDPC 2X1AA 4LIRA 3CMAS 4IOCQ 2RT3A 4PR6A 2MGZB 1KOOA 2RRBA 4WF9Q 2N3LA 3VAFA 1VC0A 1M1KT 2LEAA 2KFYA 3K0JA 2YKAA 2DIUA 2J8AA 2MY8A 4CH0S 4W90B 1H2UX 4OZ0A 2CQHA 2NLWA 5CA5A 1OPIA 2KVIA 3DLLQ 2L9WA 1VQLS 3BS9A 2CPZA 1U6FA 3VAJA 1P1TA 4F26A 1KQSR 2DGTA 3UD4P 2F9JA 1S72S 2MKJA 2DNKA 3CULA 4YOEA 3VALA 1QVFR 2D3OR 2V94A 3LPYA 1WWHA 2LEBA 2CQIA 3CXCR 1QVGR 3EGZA 2CPXA 1XN9A 3THPA 3UCGA 2KG1A 1VQNS 2M52A 1X4EA 2JRSA 4OZ1A 3MUVP 1QM9A 1M5OC 1UAWA 1WI6A 1VQ7S 2DNMA 2J76E 5HL7Q 1SJRA
chains in the Genus database with same CATH superfamily
4JBCA 2UUAF 4FF3A 2BJEA 2B4VA 2POKA 3AB4B 4R5PB 1HI0P 4FXVA 2F5GA 1FNMA 3IBCB 4DPTA 5EHHA 3TEHB 4FS1A 3M32B 3PEJA 2QLXA 4BWJA 4NXMF 2NPIA 4Y2MA 4ZKAA 3M9MB 4P2SA 3OT9A 2D41A 1IBMF 5SUHA 2VODA 4QW8A 1OIAA 4ZJQA 2QTWA 3CJ8A 3IAM9 3P5TL 4RNHA 2AJFE 2BZ2A 4XAKA 5E3PA 2QJ3A 2QL5B 3KLHB 3RBZA 1SVDA 2DXDA 4S0MA 1QY7A 3O8WA 1B70B 3D0HE 3ZNUA 1VQ9S 1K44A 3F73A 4Y28C 5HMXA 3PR5B 2LLZA 1TTHB 3NNCA 4UOGA 4Q8FA 1S57A 4QWDA 2FJBB 3DRRA 2P5VA 5IZHA 1HBMB 4P7VA 2OKQA 3MR2A 2QT7A 3L09A 3W2WB 3U02A 2LU1A 1K1SA 1RT6A 3NGSA 1OY8A 3KUEA 4TLRA 4OZ5A 5F0WA 3KK2A 2R7RA 3E8OA 2NSCA 1SH2A 1XNQJ 1GMVA 3IR7B 3P96A 4KFBB 3PIOQ 4HDHA 2MKHA 1RACB 2F63A 1VJWA 1LXNA 2HVEA 3UNGC 3MD3A 4U8YA 2DNLA 1RT5B 4DUZJ 2LCWA 5D4OA 3EZUA 4K50A 2YNHA 2IYIA 4FYXB 2OJ3A 1N5YB 1ZZFA 4LF8J 1UA0A 4U95A 2RSQA 2HFSA 4QR2A 1BQNA 2PDAA 4ZLLA 2NYIA 2JNJA 3AXKA 4GKJF 4C11B 4WYLA 3BYRA 3MPYA 2N3OA 4B02A 5KFVA 1U45A 1Y9OA 3PV8A 2AZ3A 1WKKA 4LJMA 1HNWF 1SH0A 2IVYA 2HW3A 2OTJS 2HHTA 3E01A 4C0HA 1YWXA 4IFYB 2DTJA 2N7CA 3FEYB 3ZFVA 1N5VA 3N4WA 4U67Q 3BPDA 3LALA 2KJVA 2DNOA 2LXFA 4J91A 2VA2A 1BQMA 1WSVA 1RT2A 1GFWB 1FKAF 2W4CA 2J6UA 1TK5A 2K8GA 3MCOA 4OI3A 2DR8A 2A3JA 5K14A 4Q43A 3I6PA 2XY5A 1CPZA 5KFZA 2BXJA 4LQ3A 1S6PB 4BWMA 5HQ8A 1X60A 3QT8A 5A8KA 1GTEA 1R3NA 4OZJA 1N5SA 4JI1J 4CO0A 1HYSA 4RL1A 4BDPA 4IR9A 2OGUA 3Q8SB 2ZM6F 6FD1A 4JI8J 4NWBA 1HKAA 1VRTB 1RU2A 5HROA 4JP8A 3HFZB 2CXEA 8AT1B 3NY0A 2I38A 4JOUA 4PG7A 4Y34A 3FK4A 3PW5A 1ZM2A 3BSAA 1D8YA 3ZXWA 2HKEA 4NE9C 4CIOA 1VQPS 1VJQA 2XHCA 1YJUA 1JLBB 4X4VA 2XNQA 3J7YU 1PC4A 5KG0A 2IA0A 5IXUA 2RKIB 1JJ2R 2EC2A 4M63A 3HPOA 3RW7A 2AMCB 2BM0A 4LR9A 3CDWA 4RKUC 1SL1A 1TFWA 4DG1B 2MGZB 2RRBA 5EX3A 1M1KT 2FLLA 3IWLA 1I3OB 1RTDA 2CVEA 1FDAA 1F5BA 2LQJA 1FE4A 1YJRA 1TZ0A 4K4YA 2DD8S 3DGPA 4HL9A 1CQNA 4B3MJ 4BCAA 3MTKA 1NDPA 2Y0BB 3TR5A 2PMZD 1X5OA 2L9DA 4Y2IA 1M90T 4MFBA 3EWGA 4IH5A 1N36J 2ZH6A 4ZP8A 1JWWA 1VIOA 4CT8A 4USKA 1HHQA 1QSYA 1X5PA 3M2RA 5L1LA 3VHQA 4NLYA 1X4GA 4K7QA 4ZDNA 2H54B 3H90A 3IR5B 3MM9B 2CJBA 1NJYA 4DSLA 3F44A 2HFOA 4RW7B 3CMQA 2UXCJ 1W25A 3CJ4A 4DU8A 3H40A 3GYNA 1G6BA 2A2CA 5DGAA 2CPDA 4DEZA 2V63A 3PJWA 5GAEU 4YS2A 1AROP 4FF2A 1FCAA 3UQSA 1UEVA 3POTA 2ZH4A 2MHEA 5KFYA 1E6YB 2ASDA 1SKRA 2KN4A 4PRFA 8RUCA 2BE9B 4M8LA 4B3SJ 1ZTWA 5ETRA 4QW9A 3K17A 3QSIA 1NK7A 2AYMA 2EBGA 3DDKA 4DV0J 4IYQA 1DTTA 1T9UA 1EETB 3SQGB 4F7VA 2DNNA 1N52B 1FWKA 1SJ4P 1WG1A 4DFJA 3H5UA 2J8SA 3UE2A 2Q1LA 5I3UA 2AKWB 2ZUGA 3H2VE 3M9NB 2W2MP 4WXOA 2PA3A 3TRGA 4DPUA 2BMBA 4P7TA 5J2PB 2ROEA 4H4MA 4YUDA 1EQ0A 2VQEF 3L7OA 1HD1A 1WEZA 3M30B 2RNEA 4NLPA 3K5NA 1JIHA 4NASA 5A8WA 3QBCA 1MN9A 2IBKA 2GQCA 3UFCX 2Q79A 2EVZA 1D9DA 4J9VA 3T1HJ 2BE7D 1S97A 1XMBA 3QAUA 2CADA 2KZZA 2QLWA 4ICLA 4OX8A 4ZVRB 1NHUA 4WFYA 3W62A 2WONA 3C14B 3KLEB 4G3IA 1UVKA 3K89A 3ENAA 3P6YC 4OYMA 3N0VA 1GMUA 3AHPA 2IRYA 4EEYA 1PYTA 2Z8QA 3BM7A 1FRMA 3MCSA 1KD1T 1EJ7L 3B4DA 3KKFA 4NOHA 4C8YA 5KFIA 1NSKL 5KT2A 1MLAA 4NX9A 3QT5A 1T03B 2HQ3A 2B6AA 1HNZJ 5C42A 4O0IA 2Q6CA 2QYCA 2OMLA 3PRBA 5KFSA 1QSSA 2MZTA 3T9ZA 1FJCA 2B8PA 2W7OA 4RW9A 1Q7YT 4XIUA 4IRCA 4GKKJ 1MMDA 3N5FA 3R7SB 4PQUA 2V9WA 3TVKA 1LQ9A 1K0VA 2ZE2B 1RBOB 1IVZA 5L1KA 1X9SA 2YNFA 1KC8T 3BGFA 2DNRA 1DURA 2CDQA 2NXCA 3LGHA 1WF0A 2RAQA 4NI2A 2V4QA 4K0KF 3KNGA 1DQ8A 4K5SA 1F3FA 3RR7A 1YI2S 1RHUB 4OHVA 4YHHJ 4QU6A 3IXQA 3CCLS 4A8WA 5K8NA 4ECRA 4EO8A 2BX6A 5KFQA 2XCAA 4A4JA 5I42B 1N0UA 5I3QA 1HQ2A 3EMTA 5J2NB 1BHNA 1HNXF 2P9EA 3DLGB 3TARA 2F8EX 4F36A 2FC9A 2PEHA 4M5IA 4RW6A 2ZBQA 4QIGA 2DGVA 3NP5A 2UVWA 4WFXA 3O1LA 2J8AA 2VC0A 3AA8A 4LR7A 2ZKUA 1OMSA 3HSJA 3DYAA 3BGLA 4P75A 2QRRA 4OZNA 3GE9A 3EZOA 3MM5B 2CJ9A 1RLDA 2D74B 4DN9A 2BACA 4PUOA 3RAMA 3EGZA 2DT9A 4N76A 3LWLA 1HBUA 1LEOA 3ZC4A 1FFSB 4Y6IA 5HL7Q 1TV6A 1BY9A 3HHLC 3O3LA 1DLOB 3DLJA 1P6TA 4NZ0A 3V81A 1Y10A 2YWKA 3NCPA 1R0AB 3J81U 4CLLA 2UUBF 3RB6A 2O66A 3CJ3A 2HRUA 1H3DA 1OYEA 2CQ0A 3EM1A 5D3GA 5M2PA 1SIZA 2C3PA 4LF4J 3BV8A 3DRRB 2KU7A 3ICLA 1T9WA 4KJIA 4FYWB 4X84A 3CIZA 2QL9B 4RUCA 2XMWA 3KK2B 2ZBIA 4ENOA 3E2EA 4DUYJ 2WOMB 1S10A 4KHRA 2XO7A 3ETMA 1ULRA 1IBCB 2J9DE 2MPUA 4U9RA 2KXHA 1NHVA 3NXZA 2VQFJ 1MWYA 5LMNF 3QATA 2ALZA 2IM2A 2R8KA 2O3DA 1U47A 1MN7A 1TL7A 1HI1A 2A2DA 4M5DB 2DRBA 3VCDA 3BREA 1OWXA 2HLUA 3V6KA 2XB2D 2BRLA 4ED0A 2ERRA 2D69A 3TJ8A 1SCJB 3CCUS 1WC0A 3BQ1A 3IO1A 5FD1A 1ZM3A 1C1CB 1N33J 2LQ8A 4Q2LA 3CSKA 1NSPA 3CJSA 3QNWB 1SUQA 4DV6J 4ZITA 4TQSA 4JI6J 2F1FA 4B9MA 3NAIA 1KDNA 3I32A 1HHSA 3RRKA 3OLAA 4K4UA 3B4MA 5F8IA 1HIYA 3GJRB 3DHXA 3TEGA 2CG8A 3DLBA 2QA4S 3E01B 1M1HA 2P9GA 4DF8A 1RT1B 1A0OB 5DG8A 1RAFB 1S1VA 3GIKA 4EBCA 5AT1B 4CP5A 4ILLA 3CD7A 1BQMB 2LA6A 1RT2B 3BSCA 4ZPDA 2AT1B 3I5CA 3I87A 5JMNA 2GMHA 4NYZA 2IYGA 1VR6A 5KG4A 1V5IB 2DGSA 2K2PA 3K8VA 3M7VA 1VQ4S 3RU0A 3ZTQA 2KO1A 2BUNA 4X62F 1VQSA 1HYSB 3FSXA 4P9SA 2Z2ZA 2WVFA 2V67A 7FDRA 2DR6A 2WTFA 3CF5Q 4A8YA 4F8RA 1UKUA 3PXGa 2BM1A 4ED3A 2FHJA 5HROB 4IG3A 3F0NA 1CJVA 1FJGF 3T6BA 1RCOB 3TQEA 3FGVA 1XR6A 1ZAWA 3DDIA 4JYAF 2PA8D 3MTJA 5BYRA 2J7WA 4OLPA 1FF2A 2AV5A 3W7BA 5KFRA 4NL5A 4KT0C 3QWPA 2A6OA 2MZQA 1RWKB 1U6BA 3NGRA 2FZKB 2B0GA 2CUYA 4JI3J 3P4UB 2AW0A 4Q45A 2X1BA 3DMJA 1JLEA 4WFNQ 3C3LA 1HWJA 4U96A 3G6VA 1X4FA 2HLTA 2QSWA 4RBTA 1T11A 1VQYA 5L38A 2OPQA 3ZZPA 1UPMB 4DSEA 2RUGA 4NLWA 4B3RJ 4ZVHA 1NB7A 3V6HA 1CJUA 2GCFA 3T9NA 1VIXA 5F8MA 1OO0B 2DB1A 5IWAF 3IG1A 4GVBA 3JS9A 1LWFA 2MMYA 4AL6A 1NDKA 2QZ8A 3AAWB 3CDUA 3HI9A 2CPFA 1S1WA 4YB5A 4B3TF 2DVIA 4DX5A 2PIIA 3FBFA 3H4DA 5K5MA 2MTLA 3W66A 1UZDA 4MFBB 1UFLA 4WK1A 2DEIA 1N4LA 3OSPA 5L39A 3M2RB 4LRFA 5E7OB 2XMUA 3PYFA 1P1TA 4AE5A 2AIRB 3RYLA 3FQKA 4K5RA 4LBIA 4MJKA 2D3OR 4H4KC 3OTDA 1T8EA 4I4BA 3CCWA 3Q8YA 2I9SA 3THPA 1X4EA 1UL3A 1UAWA 1WACA 3WQPA 3GIRA 3M6XA 3RR8A 2HAFA 1AFIA 1UVIA 5J1EB 3G87A 4M1KA 2GIQA 2HRYA 1U09A 2KM8C 2PFFB 1XERA 2MQQA 4CO4A 9RUBA 2QEXS 3HFVA 3H5XA 2YTCA 3IRXB 1AA1B 1M5PC 3MD1A 2BJDA 4N77A 2YX1A 2UXDJ 4I6AA 1E6VA 5CYMA 4F3OA 2MHNA 3O5TB 4DV7F 3MAAA 1DTTB 1FRJA 3KG0A 4DPYA 2FVQA 1D3WA 4EYHB 2L41A 4ES1A 3DLKA 3KG1A 2CKWA 3QAEA 2W8LA 1RCXB 2GA7A 1P1LA 5H9FJ 2VIHA 2VOOA 1YIJS 2FIUA 2IM0A 3VF0B 4EI2A 2C2NA 2NXUA 3BKTA 4P10A 5KFOA 3KLGB 3I9V9 1R7IA 5HK4A 1IQZA 3W5ZA 3W9JA 3UCZP 3R5BA 4ZPWR 4WPAA 5A8WB 2CPJA 3GR0A 1RISA 2QO3A 5KTQA 1SC1B 3R7NB 2Z57B 4NZ6A 2PT0A 1NKCA 1NJZA 1HR0F 2XLIA 4HEA9 5HAOA 1TL3A 1YBUA 4NRUA 4F4WA 3NLCA 2XLKA 1DHMA 3SEOA 1L3KA 2ILZA 1XWLA 1IKWB 2WONB 3HHKA 2MB0B 4D3GA 3UW1A 4U7CA 4Y65A 4IOAQ 3Q8RB 2DPIA 3LAKA 1FKOA 4ZVOB 2ACYA 4NXNJ 2DH9A 1DARA 1S7HA 2BKNA 2WCXA 2IAJA 1AZSA 1JJ4A 3EGNA 5KFMA 2V5HG 1GXLA 2R7UA 2R7WA 2CJXB 1HWUA 4DR5J 4GO7X 3HVAA 4ETXA 4KAIA 1X4AA 2VBXA 3FFIA 1OSCA 3Q83A 5C42B 2I0XA 3HVWA 1NEEA 1S77D 1IKYB 1YJTA 3C6TA 4DXLA 2KFNA 1FNXH 3CWJA 1WELA 3OJUA 1JQGA 2OMOA 2CPHA 5GAEI 4RW9B 2BRKA 1SC4B 1XIQA 4NCBA 2ZJPQ 1JLGA 3MECA 4PQUB 5DQHA 4DV3F 3KDNA 3RGIA 3SDEA 1LWCB 5GADU 2YNFB 3QO9B 2GO8A 4HKQA 4HACA 2W7PA 1S99A 5CYQA 3BH7B 3FSYA 2RE1A 4LR8A 3S8SA 3TYTA 1GNKA 3SCJE 4I64A 1JXEA 3FCHA 5E41A 2MXYA 1JJCB 5IC4B 1U25A 3DOMA 1GX6A 2HHPA 3MCMA 2HURA 1FVSA 4NA2A 1HQEA 2MKSA 4CO3A 3DHWC 4YB6A 1JLCA 1KQFB 3NGTA 3G82A 3FC9A 2D9PA 2OI2A 2Z30B 5KG2A 3TAPA 1N6QA 1K1QA 3Q0AA 4NA1A 4RW6B 4MYTA 3EGWB 4PYDA 3OHAA 1SQGA 1Q0NA 2F4FA 2M8DB 3US5A 2K3KA 3BSNA 1FX4A 5IM0A 2V34A 3EPIA 1GX5A 2LA4A 2QSFA 2VPZB 2AEFA 2JHEA 3AOBA 1EB0A 3EDRB 2VFRA 3MUMP 2XZDB 3MAHA 4DU7A 2HYIB 1U6ZA 3OXGA 5GMKa 1F2GA 3VV2B 1HBUB 2ZC4A 2YNIB 2R42A 2Q3PA 3UO0A 1YLXA 1I51B 3WC0A 4K4SA 5F9NA 1S9FA 5C25A 5CA5A 3O2IA 3DLLQ 1JLAB 1OQ6A 2CPZA 4U7UD 1U6FA 4C6AA 1RHMB 1KQKA 5H9EK 2EFVA 5CZVA 2DGTA 2DNKA 5IT9Y 4KKOA 2F4VJ 1C0UA 1NZAA 3QPIA 3W63A 1FEEA 4CM2A 2CZVC 1N48A 3LO3A 2YBVA 1A9NB 2PC6A 2DGOA 2RJZA 2UUCF 1FXDA 3K5MA 1K0TA 5HJXA 2XI3A 5BXIA 4J9RA 3WDOA 4NLSA 4X65F 3HHEA 1VOMA 3QZ7A 2MQLA 1FKPA 3BGRB 5D4NA 2VL1A 4JI7J 4W98A 2B4UA 2GVDB 3LGNA 4F02A 3KJNB 4U6PA 3JAMY 4OHWA 2MSSA 5KT6A 3MAQA 1JMTA 3CE8A 4RPFA 2ZBRA 2L08A 1VRUB 5A76A 2DO4A 1CJTA 5BJRA 4WK3A 2AYEA 3EDQB 3KLFB 3FDSA 2ZC3A 1DRZA 4CNZA 2KT2A 3J7A1 2OP5A 2FY8A 3GJQB 3HHDA 2XHWA 5I3PA 4F2SA 4Q8EA 2ASYA 4DV2F 4OHXA 1NJWA 3C16A 1UFKA 2DNPA 2WSFC 2J9EA 1S1VB 2MY7A 2CJYB 2XCPA 4QCLA 1U1RA 3OV7A 3AQPA 4O23A 1F0XA 2DGUA 4UOFA 4CTAA 4YB7A 1JLFA 4IQXA 2VBWA 1Q8KA 2KYXA 3EZ5A 4USVA 1W26A 1NHKL 2ZWOA 3CD6S 2FQQB 2ZWPA 4DS4A 3KHLA 4OIXA 2YH0A 2FVSA 1RT4A 2FJXA 4KGKA 2GMLA 3QYYA 5KFXA 2XM3A 2J0SD 5AJ3J 3QJJA 3DI6A 1WUUA 4DR3J 2Z56B 1SKSA 1PJ5A 4E0DA 1B4SA 1ZH5A 2B3TB 4FPRA 2BJ9A 3OSNA 4HI2A 2H5IB 1PCAA 2R2TA 2M0GB 1CULA 2YVSA 3JSRA 4IG3B 1CJVB 2PD1A 5CXTA 2XMVA 2JX2A 2X1GA 1S79A 1YDLA 3T1YJ 1FRIA 2DGXA 4AFFA 3TNVA 1NSQA 3HSDA 2ZHBA 4ECWA 4ED1A 4CYUA 2G9OA 2AEMA 3OR2B 4RBVA 2B4PA 3B54A 2NXEA 1I94J 2V8HA 4DQQA 3N6MA 4WKRA 2HHHJ 2C1EB 2IFXA 1ZZNA 5HBMA 1EIYB 3O6QA 1S9GA 4DR4J 5J2QA 1EKRA 3DMJB 3QFWA 1YZ6A 3U1NA 3GMGA 4URGA 3SSQA 2RQCA 3VGUA 4IQMA 3HXMA 3A8IA 2SXLA 4QYZJ 2DHSA 4IKAA 3DLEB 3PYGA 1NJIT 4CM0A 3S1TA 3MR3A 1RWUA 1YK9A 4CLFA 1CJUB 1GMWD 1RUSA 3KMSA 1MU2A 1ZAVA 3X1LB 2IPOB 1RA6A 1TMMA 1S0VA 3R2DJ 3IG1B 4GVBB 1VLOA 4J9NA 2NUHA 3U1MA 2XSJA 3R5DA 1KVJA 4F4KA 1HNIA 1U0SA 4UZCA 2EK1A 4F3MA 3HF5A 4EBEA 2OLWA 2VZ9A 4NMLA 3RBDA 4ERDA 5KG3A 3KK1A 2CPEA 3DDNA 3BGUA 2Y1LB 3M8WA 3KMQA 4FNIA 1IBMJ 2Y8YA 3NRBA 2DITA 1HARA 4J9KA 5E0OA 2A0FB 3CUNA 3ILLA 4CI0B 4LQ9A 2XGPA 3G9CA 1SJFA 1T02A 2VICA 1KFSA 3BKFA 4ID5B 3HHLB 4I2QB 4LT6A 4X64J 4PG6A 4PXBA 2L9NA 4OQJA 4ZCIA 2XEXA 3CO0P 1X8DA 4AL7A 1KLMB 3L4BC 1VI7A 4J9SA 3M32A 1FD2A 4USWA 1OPIA 3DU6A 2FLOA 1RE1B 2RQKA 1TMJA 1KQSR 3JTOA 1E6VB 1Q79A 5CYMB 2LFVA 4OI1A 2B43A 4PAAA 1XNQF 4RNNA 1EP4A 3QRPA 5EWEA 2JRSA 1S5ZA 3MPWA 1YZ7A 3D67A 1VK8A 3ELHA 2W9AA 3DLKB 3R3TA 4B9LA 3KUHA 3GQCA 2CDRB 5D4PA 1WDTA 3ET6B 4WWSA 1M5KC 2WB1D 3BH6B 4OLOA 4WE1A 4G6VB 4X4RA 2ZZMA 3PRDA 3W2WA 2LDIA 1X4DA 4F4YA 4EYIB 1AT1B 4HLBA 3I0RB 4I6WA 1J27A 3ULHA 5KFKA 4O44A 3VAHA 9ATCB 3AOAA 2M70A 1QE1A 3LP2A 3Q24A 3Q8UA 5GAGU 2Q6BA 4ANDA 2WVDA 3Q2SC 5IT4A 2V4RA 1F9HA 4W4MA 3GSDA 4Z7CA 2ZH5A 1TL3B 3G6ES 5CZXA 3IR6B 5JVHQ 3HVTB 4DSKA 4GRSA 2D9OA 1W2BR 2DH7A 4LF5F 2G2YA 4B9SA 1YHQS 2V68A 2U2FA 3B6BA 2BOAA 1FK9B 5CAAA 1N5YA 5DRKA 3D4JA 3VAKA 2WVCA 3ITHA 1FKOB 2W4PA 1VYAA 1O6XA 2GW8A 4ZCMA 4ZVEA 3GR1A 2IAJB 1AZSB 2IC3A 3L7PA 1T9VA 1TAUA 6AT1B 5HJYA 5KT4A 2ZFHA 1LKZA 3I0SA 2GHWA 4ECTA 4USIA 2JL9A 4HHUA 4M94A 2HZCA 2LQBA 2PI5A 1U1LA 3LP0B 1CBKA 4JI1F 4TLQA 1H0HB 3C6TB 2VV5A 4MT1A 2XLJA 4L73A 1MWZA 4KBIA 1Z2LA 1HWKA 1JLGB 3T41A 1HW9A 3MECB 4FKYA 4NCGB 4ES3A 2VFVA 4OFZA 2XZWA 1IKXA 1QUVA 1WC5A 3P49B 2DO0A 4PWDA 1VGYA 5IC6B 2JLFA 2CG4A 3I4PA 1T05A 4CCHA 4USUA 1ZS6A 2H65B 2IM3A 4DCOB 3PNIA 2PO4A 2HEKA 4UT4A 1WEXA 3J80Y 4WU3A 4FZVA 2D3UA 2I5JB 3DOMB 2DNQA 4J5OA 1HQUA 5K8PA 2DPJA 4NLUA 4USJC 1HQEB 1WF2A 4ZLJA 3H5SA 2C2MB 4FPIA 3G82B 4OYZA 1VC6A 1K73T 1AB8A 3D6MB 2A6MA 3B82A 3LTOA 4NYOA 4Q44A 1KEKA 3V2UC 1XC9A 5KFAA 2OFGX 4WXWA 1TL1B 5HANA 1TKDA 2FJVA 4K4ZA 2HWHA 3H0PA 4DMZA 4ZLNA 4OJ1A 3EYZA 3IGVA 5CH7B 1EZZB 3F41A 2GO9A 3ZTOA 1N34J 2YWWA 5IM0B 1RWPB 2HFNA 4KH1B 1RWMB 1X4CA 4OMFG 1WOPA 1LV5A 4QWBA 2Z2LA 4Z7YA 1TK0A 4PXEA 3OFFA 4A8MP 3S6EA 4G65A 1N36F 4QPTA 2JEJA 4DG1A 5LSLA 1OQ3A 1HLWA 4ZVGA 3SQOP 3QGIA 2IBOA 3CCJS 5E3AA 3UCUP 1R27B 3HCXA 3GPAA 2RD5C 5ETQA 3RB4A 4AUKA 2ZBCA 5C25B 1JLQB 3QZ8A 3J7ZT 1XEZA 2BA9A 2CFXA 2BQRA 4MYUA 4OJHA 1R8PA 3KTQA 2CYYA 1U02A 4O0NA 4NLDA 4HT5A 4ECQA 3H98A 1C0UB 2KM8B 2ZZTA 2YXLA 4O4GA 5C5JA 1UJ5A 4WTYA 3WC2A 3MM9A 2GVZB 2CNLB 2MEWA 4BBYA 4LRAA 4IOBA 3FBCA 4ELUA 4JI4F 1FKPB 4Y3CA 2PMWA 2E66A 2XGQA 3CULA 3AFGA 4QR0A 1WWHA 4MH8A 3GG0A 1YGYA 1FTCA 4C2MA 5DQIA 4BLGA 1J5EJ 3MUVP 3D3CJ 2DNMA 1C4AA 3UDLA 1UVJA 2O67A 1UEUA 1EX8A 3ENVA 4LVNP 4IDKB 5CD4H 2WBMA 4NLVA 3H59A 4RUHA 2FLPA 5F3TA 1EETA 3TI0A 3SQGA 4C3MA 3T1HF 2FHOB 2GJFA 3FZ2A 3MXHP 2RF2B 3HJVA 2J0WA 3HK2A 5GVQA 1X9WA 3JSBA 3C16B 3FUYA 1ZTTA 3W9IA 4DFKA 1HBOA 1J2VA 2DKOB 1FRLA 4CTAB 1VQKS 2HS4A 1JLFB 3BJYA 2BKOA 2G0CA 2R7XA 3P8BB 4CLSA 1QAIA 3HFKA 4OI6A 1RT4B 2JEFA 1EAYC 1DFDA 3W3SA 3MM8A 4OYPA 2V9KA 2KXFA 1HNZF 3KXDA 1VQ5S 1VMBA 2Z58B 4O3OA 2YWGA 3LPEA 2C3UA 3CT9A 4E2FB 3FCWA 4EGLA 3FRYA 3C14A 4TU9A 4KTQA 2G1HA 2R7SA 4RJVA 1KHWA 2EW9A 4KY3A 4DSFA 1TUWA 1CULB 1G2EA 3L9ZA 4GKKF 1NK4A 2B7BB 2VD3A 3ILIA 1M0SA 3H5YA 2EFQA 2HNDB 3KHRA 3BO4A 3AD8C 2Q43A 4DLEA 3EXYA 3MPDA 3DFEA 1F3VA 2B51A 1U1OA 2MQ8A 1NK6A 4RNFA 2XTJP 2JDJA 3AT1B 1P8GA 5T14A 2DRDA 3AODA 1T03A 4M5KA 2DIVA 5F3ZA 1NK9A 4LVOP 2EK6A 1JNZB 3MHYA 5HBMB 3KK3B 2AJ4A 1UA1A 1IBLJ 5FJ4A 1S1UA 4C98A 1S9GB 3WX8A 2CNKB 2FJAB 1UWAA 1AFJA 1VRQC 4HHHA 5HVFA 3OFHA 1HNXJ 3JXOA 2VG6B 3IA0A 3WBZA 2VG5A 2RS8A 1VQ8S 1Q8BA 2AJQA 1QLNA 2V6AA 3SIPB 2MSTA 4ED5A 3LQVA 3G6XA 4NLOA 2XSJB 4UZBA 1R8BA 3AY0A 1S1TA 1HNIB 1XNRJ 2E1PA 4HYKA 3PO4A 2RDDA 3KK1B 1SPBP 5I42A 1FJEB 4ECUA 4LIWA 4PG8A 2R9LA 4DR6J 1JK9B 3DLGA 4DOZA 4TU7A 2E1AA 4TYBA 1R8CA 3M8QB 4ZK7M 1YG0A 2UUBJ 2DR7A 2EKNA 3HKZD 4MK9A 2H4YB 1WOSA 4ED8A 3MR6A 3LAMA 4O3RA 4LF4F 3HULA 1R8HA 4FF4A 4CO1A 4WIQA 3OUYA 4Q2MA 1UP1A 1PYSB 2UP1A 3C2PA 2JVOA 1NH8A 3MM5A 3CCES 2PFDA 2G0JA 2IVMA 4YMEA 4CNYA 1BWVA 4DUYF 4CLWA 2FB0A 3IAS9 3MMAB 2DXEA 3SXLA 2IVFB 1EP4B 4KE5A 1DLOA 3BB5A 1R0AA 4LF7F 1LNQA 2EG2A 4U8VA 4JV5J 2EBEA 3UVJA 4LIRA 4IOCQ 2RT3A 3D1HA 1KOOA 3GCXP 2ZOMA 2ZVIA 1KS2A 4CH0S 1H2UX 4AXIA 2GQQA 3PFOA 4ED7A 4IRKA 4WE1B 2AU0A 5C2GA 3BS9A 1WJ9A 3ZZRA 1QAJA 4FF1A 1RWXB 1TUGB 4HH0A 4O44B 1KN6A 3K5LA 4YOEA 2XWYA 1QE1B 1RT3A 3LP2B 3IN5A 1S0MA 1TP7A 4DV6F 3Q23A 5DG7A 3IFEA 4JI6F 2WOMA 1RP5A 5D6GA 3RG6A 1VQNS 4OV6A 1QAYA 1Q5VA 5KFUA 4YP3A 4QIWD 2HGNA 4CLUA 2YY3A 1WD6A 5KFTA 2DGQA 4M95A 3BBBA 3CPWR 1C2PA 2PE8A 2GV1A 1SL2A 4NA3A 3HP6A 4RX6A 4M5DA 3KG4A 1IKVB 1TK8A 4B9NA 4QBUA 2XI2A 3ITHB 4ANCA 4DJBA 1WTFA 2W2NP 2LKZA 5AXLA 4LSNA 2XWXA 1C1CA 1D09B 2QIFA 3DOLB 4BS2A 2CQPA 5CCLA 2IC3B 4FBTA 1L5UA 1U7LA 2CWKA 3I0SB 5DM6Q 2H9ZA 3TW0A 5K8OA 4X62J 1S7IA 5A8RA 1S59A 2GMJA 4DL6A 1RT1A 2CQBA 3HMJG 3D2WA 1RYRA 2IJRA 2YPZA 2B7CB 4P72A 1VLYA 4OX9J 1IKXB 1S48A 2E5LF 4JYAJ 3HX9A 4PWDB 1RAHB 5EWGA 2YPYA 5F8HA 3HM9A 1TAQA 1OPZA 2E5IA 5HVGA 2HBYB 4I67A 2KVQE 1T05B 5LSRA 2B9XA 3PX0A 2BR0A 1DTQA 3CVKA 5D0HA 4J90A 3GYGA 2AGOA 1SJ1A 1FRHA 3W8GA 1HQUB 4DL5A 3S01A 2JWNA 3OW2R 3N01A 1C0TA 3OL6A 2WK4A 1TQLA 3VQTA 4JI3F 1SIWB 1ZBTA 4X66F 2BE2A 4XO0A 2MZRA 1FFGB 5HMWA 3MPVA 2QMWA 2HK3A 2XO6A 4M5NA 5F8JA 1LXJA 3VGSA 3TVYA 4Y2CA 4FP9A 2BV3A 3SSRA 2KG0A 2F40A 2F65A 2OSRA 3U27A 4B3RF 4C8OA 2FGOA 4ANEA 3ZZOA 1NK0A 4NEYA 2KL8A 3AB2B 5GAGI 2W8KA 1ACMB 1ZPWX 2K7JA 5DJBA 2DCUB 4LRBA 2Y1JA 1Y7PA 1A7GE 4ZOSA 3KJVB 1GAOA 1FXRA 5KFFA 2ADCA 1AUSL 3THVA 2R2RA 2W9BB 2DR5A 2XS2A 2MZJA 1X5SA 2HVZA 3MEEA 3Q22A 2FHJD 2AWZA 1CEZA 2AX1A 4MKVA 3M4XA 2VDIA 2K1RB 3A3OB 4X4SA 2RVJA 1R0CB 4YY3F 2IY5B 3SSSA 1MWQA 5E33A 4DQSA 1MSWD 4PABA 4AXJA 1NZ8A 3W5YA 2CQ1A 4EZ6A 1UETA 3BDEA 1S0OA 4DPOA 4ED6A 5J2MA 1SQEA 4JI0J 2DRAA 4WCEQ 5C7PA 4A8FA 3K7RA 1KP6A 3EE3A 1UVMA 1K8AT 2GJ2A 4J37A 4O4GB 2HGLA 1CS4A 1D0EA 3PG9A 2QX0A 4DV7J 3NEKA 4A46A 1NJXA 1XMOJ 1UVLA 1HMVA 4I6YA 1CLFA 5B0CA 1T9XA 2LVWA 2HVHA 1NNDA 3TA1A 1NDLA 3CC7S 3BO3A 3NMAA 4PZVA 1RWVB 2CIMA 1H98A 3ISZA 4LRCA 2MLYA 1U2FA 4NYPA 5J1EA 3AJ2A 1X4HA 2K7KA 3DRXA 4RNMA 1T94A 3BEGB 2B9EA 2FPHX 4OL8A 1UEKA 4ZP7A 3IRXA 3PTWA 1Y11A 2YKAA 3GCWP 5F0UA 1SBRA 3OXFA 2R7OA 1WDDA 3PEHA 4CO2A 4N7TA 3KYLA 1HR0J 4M5MA 5THWA 2C28A 3QRQA 4FS2A 4RLEA 3N6NA 1V9OA 2IRUA 4NLTA 3LGMA 1YKWA 4KR0B 4X4TA 4DV1J 4DCJB 4K8RA 2J0XA 1LFWA 3QIPB 5BYQA 1XN9A 3HT0A 5AE3A 3KWMA 3QT7A 2HHUA 5B7WA 5H9FK 2O5DA 3ZZYA 3QMQA 1HBOB 3HSGA 3M6UA 1U8SA 3KLGA 4R0JA 4TN2A 4DUTA 3MOJB 1RBAA 4ED2A 3BDPA 2OPRB 1WNEA 1BLUA 4XDDA 2E9ZA 5KAKA 1H7XA 5I4MA 4ZIWA 3K58A 3MM8B 1WTBA 3ADAC 2VFUA 1FWLA 5KOXA 2BKPA 2GGPA 2CJKA 2HQCA 3CIMA 4X4OA 4TU8A 1IKWA 5LSOA 4J9OA 3K57A 1VBXA 4ZN3A 3U1LA 4R8UA 3PW0A 1X5TA 1PAEX 4I69A 3TVZA 5IV4A 4KO0B 4WP9A 2M7SA 4ZS6A 4LF6F 5L1IA 1UJ4A 4B17A 3NS6A 1BD6A 1KHVA 5ETKA 2ZH1A 1QDUB 3DM2B 4EU0A 5A2QU 3R5AA 3T3FA 4M5LA 4XPCA 1RU1A 1LK5A 1IKYA 4NPOA 1UMJA 1HD0A 1S1UB 2EFGA 3H7HB 2D3O1 1YRTA 1NPKA 2AD9A 2X3GA 2L3MA 1SV5A 1JX4A 2KJWA 1FDDA 1UW9A 2ADBA 2VG5B 1PJ7A 5HI7A 1LWCA 4W92B 3QO9A 5DDOC 3NKYA 1TELA 5ETPA 4DV5J 4ZP6A 5DO2A 1OJ4A 4L72B 3CCSS 2ZUAA 4I2PA 4ZVQB 1TKZA 3NWRA 1WI8A 4K4WA 2FHKA 1RT7B 4NLGA 1S1TB 4ID8A 4IH6A 4IO9Q 4KIAA 4RNOA 1ZM9A 3VWSA 3N28A 1KTQA 2MKCA 4RW8B 1O0PA 5KFGA 2FC8A 3BR9A 2HQFA 2FVCA 2MYFA 3H2UB 4RWXA 2HBRB 4PPDA 2JVRA 3DC2A 4TY9A 2YWEA 2A10A 2NQPA 5H1SV 2VKRA 3D7SB 2ZNZA 2N82B 5FLXU 2IJNA 1G4CA 1Q16B 2VBZA 3NS5A 1BXNA 2FD2A 1R6VA 1IM4A 3OUYB 5CABA 5BR8F 2BVZA 3IWXA 3MPUB 2QC3A 3ZNJ1 4HTJA 2CNNB 2UVUA 2F4VF 1FNOA 3MMBB 3ZTSA 4WFAQ 1R89A 1NPPA 3VAIA 2AGPA 3PO5A 2MZSA 2F9DA 2AP6A 3GTYX 4WP8A 1TKTA 1K9MT 1IM6A 4KRWA 1JNRB 2HG4A 2CQ4A 2UUCJ 5L46A 2P6SA 1VCTA 2NXJA 2YNIA 2JLEA 2QFIA 4X65J 4OI2A 3FCVA 4RW4A 3UVJB 1RA7A 5LJ5Y 1JLAA 4DHVA 2Q66A 3OTOF 3V4IB 4JI7F 1X31C 4TVAB 2M88A 1B0PA 3BQ0A 2DNZA 2DNGA 3Q89A 2OEJA 3MM6A 3VAMA 3EUNA 3IC1A 3M8ZA 1RT3B 3PR4A 2BJ3A 5KFNA 3G4SS 1REVB 3SFUA 4U7UK 2GZOA 1V6HA 2V50A 3LWMA 5KT5A 4UY85 4NLXA 4PR6A 2QA2A 1N5QA 4WFZA 3JSYA 4J9UE 1O8BA 2CZ9A 1DAXA 1VC0A 1TUVA 5J1NA 1U2CA 2DIUA 2VA3A 1B64A 3BGRA 2BANA 4QZVB 2D3ZA 4H4OA 2GVDA 3RZAA 3UD5A 1Q7LB 2L9WA 2ZD1A 5ETLA 2P8IA 2KHDA 3IS9B 4QPXA 4KHPF 2EI5A 4UUWA 1EHWA 4UW2A 4OYBA 4DQRA 2GAGC 3Q8VA 4LSNB 3J81j 4KV8B 1FX2A 4C8KA 1VRUA 1NB2A 3KLFA 1SJRA 1FFWB 2OH2A 2Y9HA 3GFXA 3GU0A 3SZ2A 1T95A 2BW7A 4OZ2A 4P2FA 4YQWA 1T3OA 4DR3F 4P2XA 1RAGB 4KQZA 5A8RB 3M6VA 4CZCA 1JXVA 2RH3A 2KT3A 3ETOA 2HHVA 1U0HB 4OYWA 2ZH8A 2PGCA 5DS7A 3TWZA 3ILJA 3PYEA 3EJMA 1VBKA 2EC0A 3RBEA 1RB0A 4C8MA 2C3MA 2HFUA 4HHJA 1TVRA 2VASA 3GG1A 3CEDA 3ZZTA 2D1CA 3G86A 4K2XA 2DBBA 4CRJA 1NK5A 1U1PA 2J0QD 3KLIA 1SH3A 1DTQB 3K5OA 4F04B 4DS5A 4QU7A 3THTA 2YKMA 1T9YA 1I94F 3Q2TC 3WX4A 2VDHA 1H74A 4RO0A 1HWIA 1C0TB 1U24A 2YX4A 1Y3JA 4Z2XA 4MIAA 2HS3A 2AGQA 2BE2B 4LF9F 3V6DA 2H5EA 4URQU 5D77A 1Q5YA 4QJVA 1TL5A 2IHR1 1HHTP 1RLCL 4UOHA 3MM7A 4K2JA 3VZHA 5AE1A 1FD8A 2P6TA 3ILOA 2QL7B 2ILYA 1HBNA 1M5HA 1JKHA 4ECSA 2IJFA 2QLFB 3QJPA 4ALZA 4WTOB 1DBDA 2V8DA 4TQRA 4ZPBA 4ZLPA 4ECYA 2EFPA 5IS2A 3OR2A 2AYGA 1HPZB 1XMQF 3TA2A 3TP2A 2PMHA 3NCRA 1RDRA 3I31A 4DI6A 2EG1A 3IMQJ 4TNOA 3DNCA 1WEYA 2ATCB 4PWWA 3BZQA 1CJKA 3MFIA 4DR7J 5T41A 2UVVA 1DY3A 3NNHA 1TL4A 2FJWA 3MEEB 1NSAA 5EWFA 1RHRB 4PPZA 5D0RA 1ZM4A 4LFAF 5B08A 2LP4A 2JC0A 3DLEA 1F9FA 3RRGA 4QYZK 2LDYA 1YJWS 4P71A 5A0YA 2B5JB 2VPWB 2QYGA 4X64F 1YRUA 1WHXA 1FT8A 4ILRA 4V19X 4Y2KA 3K8WA 4I7FB 1FO1A 2UZAA 2WAQD 3W5XA 2RDJA 4GC6A 1PC5A 3GSIA 3D54A 4AD6A 1RAIB 5J2MB 3QFHA 3JQMA 3TJ9A 5GAHU 3NGDA 3BKUA 1HWLA 2LXUA 2VFSA 2V8PA 3CCQS 1C1BA 2E1CA 1ZETA 4C8LA 1CS4B 1G3OA 2HNZA 4UF4A 4CWBA 3BPSP 1SC3B 5DLGA 1RSCA 1LW2A 3JQJA 1HMVB 1RWWB 1KLNA 2DCLA 2MKIA 3PHEA 1RJJA 1DJ0A 3D9BA 4ID5A 3HHLA 4I2QA 1KVKA 4Q7AA 1MNEA 1RXOB 2OEMA 5KFBA 5EDWA 4JUZA 2G2ZA 1VQOS 3EVOA 1KLMA 1HI8A 3LP1B 2DHHA 1CQMA 2F8MA 4EK2A 3A3NB 1H38A 3DU5A 2OFHX 3BR8A 2CAJA 4LFCJ 4C48A 5LMUJ 3NBPA 4KGXB 3EVWA 5FIIA 4DV4F 4RU9A 2XNRA 1ITPA 1FVQA 1RTJB 1D8ZA 3QWUA 2CPIA 4ZPTR 3EXCX 2YKPA 4LF5J 1S9EB 3HZEA 3CC4S 2M2BA 2HWTA 3A3PB 4YB1P 2BW2A 4K4XA 4ZVPB 5B0EA 3SI8A 3ET6A 1F9EB 2BJ8A 3R5CA 4USTA 2R8GA 3FBEA 3FNNA 2X1AA 2ZBPA 3FEZA 2N3LA 2KFYA 2E9RX 4CLKA 3I0RA 1HNVB 1Q95G 1UCNA 3GV5B 5FDLB 3CCTA 3Q8PB 4J7CA 2J5AA 4YR2A 4FDFA 4LFBJ 2HHQA 2YQ1A 3UD4P 3HVTA 1SKWA 1D9FA 3CXCR 1WC3A 2FDNA 2GGPB 5ETNA 4AL5A 1C4CA 1MG7A 2UUWA 3FMBA 3TJAA 2JFDA 2VUGA 2Y1RI 4ZVSB 5KFPA 5KFDA 1MROA 1FK9A 2BDPA 4R8UB 2BQUA 3PZPA 3H4BA 4AQYJ 3MR7A 1QJHA 2H51B 3BQ2A 4ECVA 3VGVA 2XMAA 1PBAA 2HQIA 1KSPA 1GEHA 1T0TV 1IUJA 4P74A 4DCPB 1L3UA 3BN7A 2KRRA 1N8RT 4Q0BB 1Y3KA 4ER8A 2KZMA 4DL3A 3LUYA 4MKAA 1S6QB 5E3QA 2NREA 2DISA 2LEPA 1RBLA 2XBPA 1F5AA 1WHVA 3LP0A 2RB7A 4OHYA 2FYXA 2UU9F 1HL6A 4N8OA 2RHSB 1NRKA 1X4BA 2C2EA 2Y3YA 1B3TA 3R7BB 4J9MA 1SV5B 4NCGA 1X7VA 2ALYB 5HP1A 4J9LA 5SZTA 3AOCA 1UWBA 4DF4A 5KT7A 3V5RA 2HVDA 3KUGA 1WOOA 2BJ1A 3ZZUA 2CA9A 4XK8C 4I2PB 3M2UA 1TKZB 2UUTA 2ATLA 1N34F 3K5PA 2I5JA 4TYAA 1GXTA 5AE2A 3TANA 2ZNYA 2NS1B 1YJ7A 1B0TA 3C19A 2IA6A 3MEKA 2OELA 2MKYA 4FN5A 5DDQC 2CJAA 4HI1A 3GV7B 1IXKA 3MR5A 4DL0C 1BQXA 2VPXB 2CNOB 3D0GE 2JSXA 1L3VA 1LWEA 2ABYA 3JYTA 1FEHA 2AJ2A 2IMOA 3VGTA 1TL1A 3GFHA 1NCLA 1D9AA 1LFPA 1PJ6A 4OYOA 5MLCV 4DX7A 2HHWA 2V2ZA 4N5SA 5AXNA 1F60B 2XYHB 1YJNS 4JI2J 4DFPA 4F25A 4MKBA 4A48A 2FGCA 3S7RA 2HK2A 4DPWA 1IWGA 1B7YB 4CH7A 3MEGA 2BOPA 5DETA 2W24A 2JEGA 2H5JB 3EVMA 3CD5A 3GWCA 2HAIA 1TKTB 4FKXA 3IWNC 1S1XA 2R8HA 2QLJB 2IM1A 4ED4A 1LW0B 2E5JA 2YWFA 4KPYA 3NCQA 3CB4A 3T5LA 3CNQP 3KHHA 3O44A 3DRPA 2ZJQQ 1RHQB 3LF0A 2UV8G 1TR0A 1JLQA 1PSDA 5F8GA 2YWHA 3X3UA 4RW4B 4DR2J 4JI4J 4XPEA 1U1KA 2A1BA 1NXIA 1RYSA 4H4KA 4NLRA 2PI4A 5IQQA 1UPPA 4MTPA 1LWXA 2QA1A 1WHYA 5IFMA 2UVRA 1URNA 1J5EF 1RTHA 5KG1A 3UN5A 4IR1A 3MM6B 4RUBA 5ITHA 2XQCA 2R8IA 1RHJB 1W7WA 4A8XA 3GFZA 2HVIA 2NYHA 2AYBA 3MUTP 3E3XA 1WG4A 2GVZA 1EARA 1S76D 4OZLA 3HD1A 5KG5A 2R2UA 1V3SA 4JV1A 3MOZA 3OTCA 3ZZ0A 1VK3A 1RAOA 2BANB 3MWBA 4H4OB 2LQ5A 5HLFA 3ZZZA 2ZD1B 4PEOA 4QIVA 2C2ZB 1IR0A 5HN0A 1X0FA 1NH7A 3PFEA 4WYWA 4TY8B 5ETMA 2K06A 2GJIA 3NWGA 2Y8WA 2VH7A 3OJSA 4V19J 2UXBJ 2WSEC 4ZCKA 1ROFA 2O01C 1YJ9S 4DL7A 3UN3A 4I0WA 4P2MA 4IDKA 4L3NA 2GC8A 4B9UA 2XMJA 3VQSA 3K0JA 2RU9A 1NDCA 3OPKA 3KNAA 1KRPA 2CQHA 2OAUA 2NLWA 4YEAA 4C0BA 1J5OA 3DRSA 5K9FA 5MAOA 4P52A 2RF2A 5JXSA 3FJ2A 1S72S 1Z1ZA 4USMA 2N7YA 1TVRB 2HIQA 1BC6A 4DPXA 1Z2ZA 3IP0A 4GC7A 1B99A 2C2KB 2J76E 4RUAA 3PJXA 4ECZA 2V2KA 3C15A 1N32F 1U8WA 3KLIB 3M2VB 5DZ7A 4PG5A 4NCAA 1SB6A 2YKMB 4NMXA 4PCQA 5KFHA 3OHBA 3UPFA 4ZCLA 1QAXA 1L3TA 1X9MA 1XR5A 1IBLF 4YR0A 4DR1J 2XMKA 3EPGA 3PW4A 2HHSA 4IUFA 3UDVA 3V6DB 1XTZA 3QLHA 3CJKA 3QJLA 4EBDA 4ILMA 2ASJA 5B09A 4EZ9A 4BHQA 5B0FA 1VHIA 5CCMA 3MM7B 2CWXA 1IBKJ 3QRRA 4F4XA 3M8PB 4C97A 4QWEA 2HNDA 3A1YG 5LOQA 1HBNB 2V69A 2DY9A 5DG9A 1F6TA 1JKHB 2YKOA 4F0KA 5DLFA 3TUZC 4MAKA 1VC5A 5IQ6A 1R0BG 4KSEB 3GJTB 5DZ6A 1YTYA 2QFJA 1UTAA 3AD7C 1RGVA 2DHAA 1N56A 1XNRF 2OO4A 3KK3A 1CJKB 1RI7A 2ZVSA 4GVLA 4IRDA 4M5HA 3N79A 2J6SA 2XY7A 4DL4A 3TO8A 3M9OB 3MMCA 4DR6F 4JI5J 3MEDA 2VG6A 4KB7A 2XC9A 4X4QA 4A8KA 3C6UA 3MZIA 5A0YB 1I1GA 2UUAJ 3MMJA 3KHGA 3T5HA 3TOQA 3N6LA 3DXBA 2ZOFA 1WF1A 3PX6A 3LW5C 2GIRA 5E3CA 4RWWA 1FRXA 4RBUA 5RUBA 2MLXA 1RT6B 1VISA 2LYVA 4ZIVA 1ICEB 4NXMJ 2ZH2A 1C1BB 2J9CA 2HNZB 3RAXA 5IV3A 1PYOB 4YFUA 3SCKE 2DNYA 1LW2B 1NMEB 1NO8A 4OYIA 2K3IA 4LF2A 2BJ7A 3M8QA 1ELOA 3TZWA 1KR4A 4LF7J 2E5GA 1BGXT 2OHDA 4JV5F 3ISND 3LA0A 1YRXA 2YNHB 2ZDOA 4B3OA 1QSLA 2VF3A 2XMTA 2ZH7A 2EXUA 1FE0A 3R6GB 1RADB 1U1MA 4C4WA 1BQNB 2HNYA 3NBPB 2OEKA 1S49A 2R7VA 3R8YA 3BBCA 4IO1A 3OL8A 2RQMA 3MMAA 3UD3P 4LSZB 1FWPA 3G6YA 4F4AA 3G8QA 4H54A 4ES2A 2RU3A 4FNHA 4OI0A 2NZCA 2Z0GA 3CJ0A 2RHQB 2MLZA 2ROGA 4DUZF 4V1Ak 5B0BA 3RRHA 5F9LA 1IN0A 2J7KA 2KKHA 4LF8F 4LF1A 3UN2A 2LXIA 2IIHA 3M1VA 3HD2A 3PKYA 1TKXA 3UWTA 2QV6A 5K14B 2DH8A 3PDNA 3R27A 4GKJJ 3B8HA 3RB3A 1LK7A 2ZOGA 4F0MA 3I55S 1L3SA 3GLJA 5A8KB 1H72C 3MGJA 1HNWJ 1BWEA 2M4MA 3CCMS 2EKYA 4OYXA 4IG0A 4ELVA 3R5GA 1XK8A 1N88A 3CMAS 2YKNA 3VAFA 2P2CB 3A12A 1MROB 2RIJA 1JXLA 4W90B 1PG5B 4HT7A 3FMWA 1IKVA 4KC5A 3DCAA 2J7UA 4NEZA 5HQMA 4OX9F 5GAHI 2E5LJ 2JC1A 2NR0A 3ONQA 3DOLA 4FYYB 3CJRA 2QMXA 2W25A 4ZVTB 1NBEB 4C8ZA 2M52A 4ITSA 4HDGA 1RTZA 1WKJA 1WI6A 4L6V3 2E7XA 2M3DA 3E51A 1GTHA 3AJDA 3NOGA 2ZM6J 3AH6A 4X66J 4JI8F 2ZEJA 3GZ7A 3CCVS 2XYPB 4O3NA 5HP1B 3D6TB 4DQIA 3MURP 4Q5VA 2OD4A 1RTDB 3IRWP 1UWBB 1H73A 2HMIA 2C2RA 4DX6A 3CC2S 2O1PA 3W65A 2HHXA 2MQMA 5EX0A 3RBXA 3DGPB 2V2VA 3A4TA 2Y1IA 4YDDB 3KFWX 5M2UA 4XDCA 3W2VA 3M2UB 2DYAA 4ZJLA 4RU2A 1FA0A 4AT1B 2GFFA 1EQMA 2EFOA 1AYEA 6FDRA 5KFCA 1FRKA 3L3CA 2E44A 3K2YA 2VG7A 4CQ1A 1RWNB 4C0OC 3CMES 3OL9A 2BYCA 3Q86A 5D0EA 3KLVA 3SCLE 3CO9A 4DZDA 3PRVA 5G0RA 1KQGB 4ZHRA 2VU5A 1S6OA 1LWEB 5AXMA 5F41A 2QN6B 1VS3A 3JYTB 2NZ4A 4YY3J 4KGMA 4I56A 1NU4A 3FQLA 3TUPA 1Z4UA 1SXLA 1URRA 2WHOA 2G0IA 3W60A 4Z37A 2OIHA 5ETVA 1T3NA 1WC6A 4C3LA 4JV2A 1H6KX 5M2RA 2HS0A 2ACMA 4B3MF 1UW4A 2DK2A 3R1LA 4FYDA 3POTB 4PXCA 1KTVA 3C46A 3KJVA 1N5TA 4DL2A 4JI0F 3PYDA 2RDIA 3MEGB 3DGVA 2W9BA 1S4EA 3G2XA 3EICA 1S1XB 1M1GA 1RQ0A 4NZ7A 2K1RA 3TAQA 1RAEB 3ENQA 4WKYA 3UDCA 1XMOF 2YKQA 2IDEA 3HJFA 1R31A 2P9CA 3DRPB 5HO4A 3HT3A 4A8QA 5I3UB 2UXCF 2I1RA 1OYDA 3NS7B 2W9CA 2R4FA 1NM2A 4E8UA 4MK8A 2IMWP 2PSZA 2E9TA 4DBQA 3NMRA 3J7YI 3GP9A 4H4MB 1RTHB 1WORA 3R1HA 1JJHA 3I56S 1QUPA 4B3SF 2CQGA 2CQ2A 4PG4A 1EKSA 2ZHOA 5C2CA 2ZZNA 1U2RA 1GXUA 3QIDA 4DV0F 2XY6A 3HVRA 2HQGA 3FZBA 4YN3B 2XS7A 4KH0B 4E98A 1R8AA 3P5BP 2HSEB 1GT8A 5JUMA 4DV1F 3GIIA 2VC1A 2OD6A 2Y0SD 4ICLB 4K4VA 3SV4A 1PILA 3QGHA 2F7VA 5HLFB 2ZDPA 3R97A 1M5SA 1Q86T 2MQPA 4G1QA 1APSA 2XZTB 1NUEA 1GQEA 1Q81T 3BSOA 2VQEJ 3PW2A 5EN1A 4WIIA 4BC9A 5LT5A 1CC7A 1KONA 4DLGA 3MCNA 3TA0A 4OYAA 5ETTA 2BABA 5T7LA 5HMYA 1CSJA 4RZRA 4C3KA 1Q78A 1H2VZ 2B6AB 1SJ3P 3TZXA 3H25A 2GX8A 5B0GA 3NGKA 1J5OB 3DRSB 2QLBB 3QQCD 5CHCB 2LECA 4CO5A 3H8YA 1JB0C 3QIPA 3MFHA 1G1XA 4RR5A 1PO6A 1PBUA 1GK8A 4QYRA 5L9XA 3K59A 2WRMA 3HSZA 1GH8A 2HRTA 2BEFA 2OPSA 4FBUA 4LSLA 4BC7A 2OPRA 1WKLA 4LF6J 2FJEB 2R3VA 5KFLA 3C15B 5EUHA 3IGNA 4OHZA 4NI2B 2KVIA 4K59A 1IR1A 4MKYA 5KT3A 1FI4A 2KFZA 4WJBA 3SYZA 2QG9B 3C66A 2NSBA 3BF4A 4IFVA 2F9JA 5JJBA 1Y4ZB 3CJKB 3QLHB 1SC6A 1Q8IA 3CJTA 4OZ1A 4HH1A 4GMKA 1XJWB 1M5OC 3T19A 5IOLA 1Y5IB 4KO0A 3MDFA 3NGUA 1WSRA 2WVEA 2V8VA 1DQ9A 5KFEA 5GMEA 5F8NA 3RB0A 5DQGA 2XYGB 3FRZA 4DV5F 2KTQA 4ZJOA 4R25A 4O3QA 4OX7A 4K0KJ 3HO1A 3DM2A 2XSFA 2JOQA 3DYAB 2V4JA 4YHHF 2XMMA 2B9WA 2Z2MA 2DHXA 2A18A 2JZ5A 4PUOB 2GS8A 3BGOP 1BUXA 3MMCB 3VVTA 8ATCB 2G2OA 2DY1A 3JSMA 3CCZA 3MEDB 4CLTA 1CVJA 1B7FA 1VDHA 3P45B 3C6UB 1TV6B 2QE5A 3V81B 3CJQA 5D78A 1TFYA 2MQOA 2CRLA 5DM7Q 3W9HA 5LL6d 1K47A 2APOA 2H3EB 4YR3A 3SFGA 4UTGA 3OVSA 3HHNB 5D3GB 2I6WA 2DEJA 5C24A 3RUBL 4N41A 3DRYA 2FY1A 1RT7A 2N4DA 4Y2AA 5BR8J 4DQPA 4NRTA 2KYZA 2CPYA 1YJVA 1O5JA 3AD9C 2NPFA 1Q1KA 2UV8A 1FJ7A 4RW8A 2COLA 3RW6A 2OUGA 5IT9U 2JEIA 1RZMA 1ZYQA 4CLPA 4X4NA 5L8RC 4LBHA 3NAHA 1D1UA 2R7TA 2VJVA 3OFEA 3OTOJ 3PW7A 3GONA 2HIYA 1TL7B 3TAMA 4M5JA 2W2PP 4WZMA 4B3OB 3KJQB 3D6HB 3JQKA 1RAAB 4MIWA 2ZITA 3NG8A 4QWAA 3MMBA 2W4DA 1YVFA 2HNYB 2GQ2A 3DXSX 4TXSA 5KOWA 1SUQB 3OTBA 3PJ9A 1IJFB 2X7IA 4C7QA 3JAMU 1HA1A 5HVHA 2JFKA 3N9UC 4O3PA 4OX6A 2VQFF 1R6YA 5LMNJ 3D1QA 4ETZA 1REGX 3Q8QB 3V4IA 3VTIA 1IQTA 2V8GA 2B9YA 1X0PA 7AT1B 2RRAA 4KHPJ 4F0HA 3I4HX 2IDLA 1I5OB 2ZJRQ 3M1VB 3AQOA 2AEJA 4DX8H 2C42A 1N33F 2AZ1A 4QR1A 3FBBA 1TKXB 3CGIA 1AUDA 3I9ZA 1REVA 1H2TZ 2VHGA 1U26A 3IBWA 2JH3A 3A13A 3DOKA 4F2RA 1FESA 3IBFB 2KDOA 4IG0B 4CDIA 1FHTA 4DZ6A 5AXKA 1RAJA 2HGMA 1KKHA 2YKNB 4FVMA 5HMZA 2AX0A 4EO6A 3IS9A 1NAQA 3QGPA 1WHWA 5LJ3Y 4LREA 1KWMA 4LUBA 2R2SA 2WW4A 5L9NA 1WC4A 4FYVB 3WIVA 4DFMA 4KV8A 2FJDB 3C8YA 3OVAA 4ZA1A 1FTRA 2EWHA 4KHMA 4HVZA 3QT6A 2YQ0A 3W61A 2OSQA 4X2BA 1OY6A 1TU0B 2E5HA 1NKEA 3D3BJ 2M5YA 2YX7A 3PVXA 3GB0A 4YDXA 4DWIA 1I6JA 1U0HA 1Y5LB 4LF9J 1RHKB 2HQDA 5HQLA 3TQ1A 5IT0A 1JLEB 2HPUA 1MW7A 4HTIA 4CLYA 3PKMA 3D66A 3OD2A 1RTIA 1VQLS 1FJGJ 3T6JA 1YBAA 3UI3A 2OPQB 5J1PA 3OQ2A 1T9TA 2CZ4A 2HMIB 2ZH9A 3PM9A 2LEBA 4OI4A 1QTNB 1N0VC 2CPXA 2KG1A 2EEYA 2YNGA 3H42A 2R8JA 4JV0A 3A8EA 3UCGA 1UZHA 1V3ZA 2FUG9 3GYXB 3W2VB 1LWFB 3D68A 3HLUA 4ZVFA 3L7UA 3FEXB 1XMQJ 5LXRA 3VAGA 2HFVA 1DQAA 5DDRC 1S1WB 4LMZA 3I5AA 4X4PA 2DR9A 1VHFA 2VG7B 1H7WA 4QWCA 4DR7F 4IH7A 2BQ3A 5K8MA 1SL0A 3ZO7A 2C2DA 4EUVA 3KOAA 1HW8A 3HDSA 5G0RB 3JTNA 3OR1A 4ZHRB 4LFAJ 2FLNA 5KFWA 5U47A 2C3OA 1SJQA 1OY9A 2F8HA 4G1PA 1S4FA 3EX7B 2OPPA 2Z4PA 1F5CA 2OTLS 2G1DA 5IWAJ 2VBYA 3GFYA 2MQNA 3M05A 4KYZA 1HPZA 4R5PA 1Q8LA 3FKBA 4MMOA 4C9DA 1O51A 3RAQA 4J9QA 4B3TJ 3CDEA 3TUIC 4TKTA 1Q4RA 1VQMS 4GO5X 1FXLA 1NLKL 4KGVB 2E1MC 5B0AA 3CD0A 1R43A 3M8YA 3SBMA 4A8SA 5CQGA 3W8PA 3MAAB 3T5JA 3VVUA 3KLHA 1RK8A 4JB8B 2B5JA 1F1BB 2V2QA 1Y5NB 2DJWA 3G8SA 4I1TA 5ETOA 2W9CB 2CQCA 3D5MA 5BYSA 2AF6A 3G71S 2MKKA 3H20A 2X1FA 4I7FA 1ZA1B 1P9QC 1PAUB 2M9KA 4D3HA 4EMDA 3CCRS 1HBMA 4R0EA 2QA4G 4ZVUB 3VR1A 3ZTPA 4LFCF 1YQHA 1QTMA 5LMUF 2VB6A 4F67A 2VPYB 2KT5A 2UXDF 4B9TA 2CQ3A 4DV4J 4XTTA 4OJGA 2N4CA 4X4UA 4KFBA 3TUJC 1KFDA 2HBZB 2MJNA 5L1JA 2RMLA 3G8TA 4FXWA 2G4BA 1VBZA 1XR7A 3W64A 2ROPA 4Y00A 1BE4A 4WFBQ 2L48A 3U7JA 1RT5A 2ZKTA 4G1QB 3LP1A 3HZGA 4ATNA 4NLQA 4CLZA 3DLHA 1KOHA 1KVIA 1N54B 3D6FB 3HKWA 2F3JA 4QOTA 4EFAC 1PGZA 3ZTRA 3AXMA 5T7LB 2FHMA 3AA9A 3CDAA 3V4MA 4LFBF 4C11A 2I2YA 5GMDA 2DNHA 1YBTA 5G4DA 2AJ0A 3BYPA 1RTJA 3MF5A 3FFIB 2KI2A 3TX8A 1P27B 1S9EA 3HHLD 2J9DA 3TZYA 2AJ1A 5CYJA 2W2OP 1PIEA 1Q82T 2DGWA 2WZ1A 4IFYA 4N47A 3I96A 3R6LB 5HSPA 1G7CB 2YH1A 5HATA 4AQYF 2OPSB 1XQIA 4LSLB 1S12A 2V0NA 4N56A 4NXNF 1HNVA 2Z2YB 3CJ5A 1SQFA 3SDEB 2FZGB 3A8KA 3BBFA 5FDLA 2ASLA 2RQ4A 4HACB 3T5KA 2U1AA 5F8LA 5CYQB 4CT9A 2HWIA 3A8JA 2M8HA 4KPCA 4CH1A 1VBYA 2EFNA 4DR5F 1V3RA 3GJSB 3CJ2A 1S6PA 3NL0A 3F56A 2PEBA 2RS2A 1RABB 4LRDA 1U4BA 2XG8A 4PWUA 1U48A 1YITS 4IFVB 3IM8A 3M8SA 3PY8A 4ZPAA 3LANA 2UU9J 1JLCB 5JVGQ 3R5JB 2XS5A 3GILA 2MJUA 1VRTA 3UNYA 2VKZG 3J80U 2I8EA 3JB9k 1N6QB 5KG6A 4DV3J 3GIMA 5A2QY 2E7WA 3RJMB 2MY8A 1MMNA 3ISNC 3I5BA 4Q0BA 3VAJA 4F26A 4DSIA 4F4ZA 4PXDA 1CG2A 1S6QA 1JLBA 1HFEL 2AHOB 5EGYA 3OFGA 3D0IE 1QD1A 1Y00A 3VALA 3J7AN 3ENWA 2V94A 2JLGA 4WU2A 1UJ6A 4L74A 2V4JB 3TZZA 2RKIA 4WZQA 4FXDA 4URSA 1QM9A 3UDEA 2FZCB 2FVPA 2MGZA 3NOCA 1V5VA 2GAHC 3B78A 1UVNA 2IRXA 3M8RA 2CVIA 3JSMB 3PCOB 5DGBA 4PYAA 1VQ6S 4I68A 3CW2C 5B0DA 2MDAA 3WZ0A 2E29A 5LM7E 2WW8A 1M5VC 2NXNA 4B08A 2JJ4D 3DKDA 2QGFB 3D1OA 1OS5A 5H9EJ 1ZA2B 2MZ1A 2R7QA 5C24B 1VFJA 4JI2F 2KH9A 2X51A 5ADZA 4KKOB 2VJUA 2RILA 4PQAA 3OVBA 4ZPCA 1RWOB 1PKUA 4Y0FA 4C8NA 4B9VA 3BN4A 3T1AA 5FLXY 4HR2A 2FVRA 2KB2A 4A47A 4O4RA 2W7AA 3OTEA 5E5NA 3OBIA 3GV8B 3J7Z5 2G13A 2ZHAA 4WBFA 1S6UA 5GADI 4RW7A 2BBEA 4DR2F 1U1NA 2QMUB 5LXYA 1IJEB 5ETSA 4UOCA 3QGGA 5CD4A 3R2CJ 1FDBA 3TAMB 2X3DA 2AQ4A 4MK7A 3D28A 1A6LA 2DHGA 1KNZA 3KJFB 2EPIA 3JTPA 1E6YA 4QQBA 2W1BA 2J6TA 2WB4A 4P6QA 4LBPA 3J81Y 3R9LA 3WIUA 2WVBA 1CJTB 1IR2A 2GIFA 1B0VA 1AW0A 5E3RA 1T7PA 3QSYB 2H4WB 1LW0A 4MIBA 3PIPQ 2KRBA 2HFZA 3L95X 1NK8A 2NUUG 4KGZB 1P9YA 4L3KA 1KBRA 5A6WA 4N8NA 2E7VA 5E2QA 4UY8T 3TX0A 4OJ3A 3MI7X 3UR0A 1MMLA 4OV1A 5J2PA 3PACA 2WSCC 2VOPA 4USHA 4ELTA 2NCKL 4EWTA 7FD1A 2ZH3A 2GHPA 4WP3A 3M30A 1ZOTA 1WC1A 2PN6A 3GIJA 4DDFA 1WG5A 3CDBA 2C2OB 2UXBF 2HZAA 3WHIA 2YQ3A 5D8HB 1U1QA 1OSDA 2KXNB 4PKDB 4G1IA 1LOUA 3W1YC 3DOKB 5KG7A 3CTRA 3DI6B 4K4TA 4M5GA 1Q53A 3SV3A 3VZIA 4DV2J 3G96A 4ECXA 3SCIE 4UQGA 3FVYA 2B8QA 3AJ1A 3KLEA 2GHVC 3SMZA 1S0NA 2C3YA 5A6PA 1SI9A 4ZMMA 4TY8A 4FVCA 5KFJA 3OL7A 2CJQA 3DN9A 2KHCA 2D7SA 2LQ9A 2RUSA 4QIEA 1F2HA 1GMWA 1YX2A 3M6WA 3LOUA 1NPRA 2W01A 1N32J 2XULA 1BMQB 3PHTA 3PX4A 4CYUB 1DZ5A 2WBRA 2LU2A 3OLBA 2LMIA 5AJ3F 2H1YA 5D4LA 1ZPVA 1Y0HA 1UFWA 3N5BA 3V6JA 4P73A 5D0GA 2FTRA 4DR1F 3FSIA 3IM9A 5K20B 5J2QB 4AYBD 4O3SA 1W2IA 2B56A 1RTIB 1RKIA 4UUXA 3P3DA 4L75A 2C22A 1NKBA 1SKUB 1RKJA 1IBKF 4UQTA 3BO2A 3NNAA 4ZPVR 2VONA 2ZE2A 1FERA 2HBQB 2CQDA 3T1YF 3LH2S 1MU2B 2YNGB 4L76A 2W2QP 4J9PA 3M2VA 4F50A 4A8OA 5DDPC 4ZP9A 4OZ3A 4WF9Q 1CC8A 2LEAA 3I82A 2H48B 3EGVA 3RTVA 2HHHF 4OZ0A 2GNKA 2HZVA 2DXFA 3H2LA 4ZN1A 4DR4F 1XBWA 2B4OA 2VFTA 3UR3C 1FDNA 2MKJA 1AXQA 5J2NA 4DSJA 1QVFR 3OR1B 2RRNA 3LPYA 4F3QA 4JI5F 2CQIA 1YSJA 4QIFA 1QVGR 3M8PA 3KDOA 2E1RA 5D15A 3OXLA 1VQ7S 1IWAA 1ZAXA 4DN0A 1U49A 2OPPB
chains in the Genus database with same CATH topology
3ZZYA 2E7XA 1A9NB 3QMQA 1HBOB 2PC6A 4JBCA 2UUAF 3M6UA 2M3DA 1U8SA 3E51A 2DGOA 4FF3A 3KLGA 1GTHA 2BJEA 2RJZA 4R0JA 2UUCF 4TN2A 3AH6A 3MOJB 2B4VA 4ED2A 3BDPA 1FXDA 2POKA 2OPRB 1WNEA 1BLUA 3AB4B 4XDDA 4R5PB 1HI0P 3K5MA 4FXVA 1K0TA 4JI8F 1FNMA 2XI3A 3GZ7A 2E9ZA 4J9RA 5KAKA 3CCVS 3WDOA 1H7XA 5I4MA 4NLSA 5EHHA 4X65F 3HHEA 4FS1A 4O3NA 1VOMA 3M32B 5HP1B 3QZ7A 3K58A 3PEJA 4DQIA 2MQLA 3MM8B 3MURP 1FKPA 4Q5VA 2OD4A 1WTBA 3BGRB 1RTDB 5D4NA 2VFUA 2VL1A 3IRWP 1UWBB 2B4UA 2QLXA 3LGNA 2HMIA 4BWJA 4F02A 4NXMF 2NPIA 4Y2MA 4U6PA 5KOXA 4ZKAA 3M9MB 2C2RA 4P2SA 2D41A 3CC2S 2O1PA 2GGPA 1IBMF 5SUHA 2HHXA 2VODA 4QW8A 2MQMA 5EX0A 1OIAA 3JAMY 2CJKA 4OHWA 2Y1IA 4YDDB 2MSSA 3KFWX 3IAM9 3CIMA 3P5TL 5M2UA 4XDCA 4X4OA 4RNHA 2AJFE 3W2VA 3M2UB 4TU8A 1IKWA 2BZ2A 4XAKA 5LSOA 5KT6A 4RU2A 3MAQA 1JMTA 3CE8A 5E3PA 3KLHB 1FA0A 4J9OA 3K57A 2GFFA 1VBXA 2EFOA 1QY7A 3O8WA 3U1LA 6FDRA 3D0HE 2L08A 1VRUB 5KFCA 1FRKA 2DO4A 4R8UA 5BJRA 2E44A 4WK3A 3L3CA 1VQ9S 3PW0A 2AYEA 1X5TA 3K2YA 3F73A 3KLFB 4Y28C 5HMXA 2VG7A 2LLZA 3PR5B 4I69A 3TVZA 3FDSA 4CQ1A 3NNCA 4Q8FA 2ZC3A 4KO0B 1DRZA 4C0OC 4CNZA 2KT2A 3CMES 4QWDA 3J7A1 2OP5A 3OL9A 2M7SA 2BYCA 2FJBB 4ZS6A 3HHDA 3DRRA 2XHWA 2P5VA 5I3PA 3KLVA 4LF6F 4F2SA 3SCLE 3CO9A 5L1IA 5IZHA 1HBMB 4P7VA 4Q8EA 2OKQA 3MR2A 2ASYA 5G0RA 1KQGB 2QT7A 4DV2F 3L09A 3W2WB 3U02A 2LU1A 4ZHRA 1UJ4A 1S6OA 1K1SA 1LWEB 5AXMA 5F41A 4B17A 1RT6A 1VS3A 4OHXA 3JYTB 2NZ4A 3NS6A 1BD6A 4KGMA 1NJWA 1KHVA 4I56A 1NU4A 3FQLA 2ZH1A 1Z4UA 3DM2B 4EU0A 1SXLA 2DNPA 4TLRA 1URRA 2WSFC 2J9EA 3R5AA 1S1VB 2WHOA 4OZ5A 3T3FA 4XPCA 2MY7A 5F0WA 2XCPA 3KK2A 1U1RA 4QCLA 3OV7A 4Z37A 2OIHA 1LK5A 2R7RA 3AQPA 1T3NA 4O23A 1IKYA 1F0XA 3E8OA 2DGUA 4NPOA 4C3LA 2NSCA 1SH2A 4JV2A 1H6KX 5M2RA 1UMJA 3IR7B 4CTAA 1HD0A 1S1UB 2EFGA 3P96A 4YB7A 2HS0A 1JLFA 4KFBB 4IQXA 4B3MF 2VBWA 3PIOQ 1UW4A 2KYXA 2DK2A 3EZ5A 4HDHA 3R1LA 2MKHA 4FYDA 3CD6S 3POTB 1YRTA 4DS4A 3KHLA 4OIXA 2YH0A 1VJWA 2X3GA 4PXCA 2AD9A 1KTVA 2FVSA 1RT4A 2L3MA 3KJVA 3C46A 1SV5A 1LXNA 1JX4A 1N5TA 4DL2A 4JI0F 2KJWA 3UNGC 1FDDA 2RDIA 2FJXA 2ADBA 2VG5B 4KGKA 3MEGB 2GMLA 3MD3A 3QYYA 5KFXA 2DNLA 5HI7A 1LWCA 1RT5B 2J0SD 2W9BA 2LCWA 5D4OA 4W92B 3QO9A 3QJJA 3EZUA 3DI6A 4K50A 2YNHA 5DDOC 1SKSA 3NKYA 2IYIA 1N5YB 2OJ3A 4ZP6A 1S1XB 5DO2A 1ZZFA 4E0DA 1UA0A 1RQ0A 4NZ7A 2K1RA 4L72B 3CCSS 1ZH5A 2B3TB 4FPRA 4I2PA 3TAQA 2RSQA 3ENQA 4WKYA 3UDCA 3OSNA 1XMOF 1TKZA 2YKQA 4HI2A 4QR2A 3HJFA 1WI8A 1R31A 2P9CA 1BQNA 4K4WA 3DRPB 2PDAA 2FHKA 5HO4A 3HT3A 2R2TA 1RT7B 4A8QA 4NLGA 1S1TB 2M0GB 4ID8A 4IH6A 2YVSA 2NYIA 5I3UB 3JSRA 4IG3B 2UXCF 2I1RA 4IO9Q 4GKJF 4C11B 4WYLA 2W9CA 4KIAA 2PD1A 2R4FA 4RNOA 5CXTA 3MPYA 1ZM9A 3VWSA 4E8UA 2XMVA 2JX2A 2X1GA 1S79A 2N3OA 4B02A 4MK8A 2IMWP 5KFVA 3N28A 2PSZA 1U45A 2E9TA 1Y9OA 1KTQA 4DBQA 1FRIA 3NMRA 2DGXA 3PV8A 4AFFA 3J7YI 2MKCA 4LJMA 4RW8B 1O0PA 1HNWF 1SH0A 3TNVA 2IVYA 2FC8A 4H4MB 5KFGA 2HW3A 2OTJS 3BR9A 1RTHB 2ZHBA 2HHTA 3R1HA 3E01A 4ECWA 4C0HA 2FVCA 4ED1A 2MYFA 1YWXA 2G9OA 4IFYB 1JJHA 3H2UB 4RWXA 3OR2B 4RBVA 2DTJA 2B4PA 2N7CA 3FEYB 3ZFVA 3I56S 1N5VA 1QUPA 4PPDA 2V8HA 4B3SF 2JVRA 4DQQA 3N4WA 3DC2A 3N6MA 4TY9A 2YWEA 4U67Q 4WKRA 2CQGA 3LALA 2A10A 2KJVA 2NQPA 5H1SV 2CQ2A 2DNOA 2VKRA 4PG4A 2IFXA 2ZHOA 1ZZNA 5HBMA 2ZNZA 2N82B 2ZZNA 2LXFA 1U2RA 1GXUA 2IJNA 2VA2A 3QIDA 1BQMA 4DV0F 3HVRA 2XY6A 1Q16B 2VBZA 3O6QA 1S9GA 3FZBA 5J2QA 1RT2A 3DMJB 3NS5A 2XS7A 1FKAF 2W4CA 3U1NA 2J6UA 1TK5A 4E98A 1R8AA 2K8GA 3GMGA 2FD2A 4OI3A 1GT8A 4URGA 1IM4A 2DR8A 2A3JA 3SSQA 3OUYB 2RQCA 5BR8F 5K14A 5JUMA 3GIIA 4DV1F 2VC1A 2BVZA 4Q43A 3IWXA 4IQMA 3HXMA 2OD6A 3I6PA 4HTJA 2Y0SD 2XY5A 4ICLB 1CPZA 5KFZA 4K4VA 2SXLA 2BXJA 3SV4A 1PILA 2UVUA 4LQ3A 2F4VF 4QYZJ 1FNOA 3QGHA 1S6PB 2F7VA 3MMBB 2DHSA 4IKAA 3DLEB 4BWMA 4WFAQ 5HLFB 1NJIT 2ZDPA 5HQ8A 1M5SA 3S1TA 1RWUA 1R89A 3MR3A 1Q86T 5A8KA 2MQPA 1GTEA 4G1QA 3VAIA 2AGPA 3PO5A 2MZSA 1APSA 3KMSA 2F9DA 1MU2A 1R3NA 2AP6A 1ZAVA 1GQEA 1TKTA 1K9MT 3X1LB 4OZJA 1RA6A 1N5SA 3BSOA 1Q81T 4CO0A 1S0VA 4KRWA 1HYSA 1JNRB 2HG4A 3IG1B 4J9NA 2NUHA 3PW2A 2CQ4A 3U1MA 4BDPA 2XSJA 5EN1A 3R5DA 4WIIA 4IR9A 4BC9A 5LT5A 3Q8SB 2ZM6F 1CC7A 2P6SA 2YNIA 1KONA 6FD1A 1KVJA 4NWBA 4DLGA 2JLEA 4F4KA 1VRTB 3TA0A 2BABA 5T7LA 1HNIA 5HMYA 1CSJA 5HROA 4OI2A 4RW4A 4RZRA 4C3KA 1RA7A 2EK1A 5LJ5Y 1JLAA 1Q78A 4DHVA 2Q66A 3OTOF 1H2VZ 4F3MA 3V4IB 3HF5A 4JI7F 4EBEA 2B6AB 1SJ3P 2OLWA 2VZ9A 4NMLA 3RBDA 4ERDA 5KG3A 3KK1A 2M88A 1B0PA 2CPEA 2I38A 3DDNA 4JOUA 3BGUA 3H25A 3BQ0A 4PG7A 3KMQA 2DNZA 2GX8A 4FNIA 4Y34A 5B0GA 3NGKA 3PW5A 1J5OB 3DRSB 2DITA 3NRBA 1ZM2A 2DNGA 5CHCB 2LECA 1HARA 3BSAA 3H8YA 4CO5A 4J9KA 1JB0C 3QIPA 1D8YA 3MM6A 3MFHA 3VAMA 4CIOA 3EUNA 1VQPS 1G1XA 1PO6A 4QYRA 5E0OA 1YJUA 3IC1A 1JLBB 4X4VA 2XNQA 3CUNA 5L9XA 4CI0B 3K59A 3J7YU 1PC4A 2WRMA