4IOAF

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
71
structure length
71
Chain Sequence
b'MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 8
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4ioaF00
2E36A 1VQ8I 2OTJI 3CF5F 5GAEJ 2E34A 3CCMI 1S72I 1VQOI 5DM7F 1VQ5I 3CCRI 2JQ7A 1VQ4I 1Y39A 1QA6A 2ZJRF 5GADJ 1MMSA 3PIOF 4IO9F 1YI2I 3CCLI 3DLLF 1YHQI 1VQMI 3J7YJ 1YJNI 3G6EI 3CCEI 1VQNI 1ACIA 3CD6I 2ZJQF 1YITI 5GAHJ 3G4SI 2FOWA 1YJWI 1VQ9I 4V19K 3G71I 1FOWA 5DM6F 1FOYA 2NXNB 2QEXI 3J7ZI 3CC4I 2QA4I 1VQKI 5JVGF 1FOXA 3CMEI 1HC8A 1YIJI 3CCVI 3CC2I 3CCQI 2ZJPF 2H8WA 3CC7I 3I55I 1VQPI 3I56I 2OTLI 3CCUI 3CCJI 3CJTB 4IOAF 1VQLI 4UY8I 1VQ6I 5GAGJ 3CMAI 4IOCF 1VQ7I 1YJ9I 3CCSI 3PIPF 2E35A 2K3FA
chains in the Genus database with same CATH superfamily
3U1DA 4PSWA 5HLTA 3V7RA 5LLQA 5FLMJ 4KN4X 1GUUA 3GYHX 4LITA 2ZC2A 4WXHA 4RB1A 1BW6A 1ZQ3P 5FLXK 3W2AA 2ZMEB 3N05A 2L7FP 2BHZA 3H1CA 4HNVA 1K4SA 4CUGA 4IQ4A 3RDIA 2M30A 4RAFA 1O3SA 1FNNA 4WF2A 2XDVA 4A69C 2FUG2 1TQMA 2V26A 2JRMA 1JI8A 1ZK8A 2ZXJA 2MLGA 1BIBA 2CO5A 4C30A 1MZBA 1NTCA 1IO2A 3SHFA 3A0HC 3DFGA 2EH3A 3KYLA 3RQ4A 1YI2I 1G2HA 2KIUA 5M3MJ 3CCLI 5D4SA 1CF7B 1SANA 3IRRA 2HNHA 1I6XA 2KDZA 3N4MA 2FF4A 2IXSA 4GXOA 1W36C 1IRXA 2DOAA 2HOAA 2OCEA 1S8NA 4JX4A 2A68F 4P5OA 3Q5FA 2DMQA 3MZHA 5E17F 3U1KA 5DCMB 2KRHA 5D5VB 1QPMA 3WU2C 1YX3A 3L2QA 5DD4A 5FFZA 2VQLA 1CGPA 3I9V2 1YW8A 3AKZA 2FJ1A 5K7FA 1FBSA 2PN6A 2EBIA 1ETWA 4EV0A 1Y0UA 4ZYGA 4UUTA 4YIIA 4A3DJ 2EQRA 2KPMA 1FSEA 2QCOA 2ME6A 1JKRC 4CZZA 4DZJA 5DUIA 1J09A 1ODDA 3I4NJ 4I02A 1X1DA 2M1BA 2JWTA 3QPLA 2H6BA 2NS7A 2XAGA 2NVUB 2HZDA 3VFZA 2E5NA 3MZ8A 5IP7J 3K4JA 2RN7A 3GTLJ 5F6FA 2GA1A 3CCVI 3KP4A 1QBJA 2XSDC 3GZ6A 4MEXF 5HNHA 3Q0UA 2AHQA 5CPRB 1LVKA 3EUHC 3BG6A 2WY7Q 2VXDA 2ID3A 5K7ZA 2JZYA 4CCLA 2DT7B 5A2QZ 2PBIA 3JRAA 3OYLA 2ZSIB 3IHUA 2P5LC 1EJ9A 3I3LA 2LLKA 2A61A 2CGPA 4BUPA 1GT0C 4XN3A 5HOOA 4OMYA 3JW4A 1HSTA 2A5WA 1Z6TA 2XGDA 3J81Z 2O8KA 1JXSA 4CHUA 4JBAA 5FB2A 2A6HF 2E7WA 2ESNA 1E0EA 4ESJA 1ZG5A 4ZC3A 3SQNA 2L0KA 2QQ9A 4I0BA 4MLOA 2JVGA 3ZMUA 1YX5A 2FNAA 3ML6A 2Y30A 3IH4A 5TRDA 3W6VA 4GDFA 1DP7P 3KP7A 3A1YA 2I5UA 2LRDA 4A3IJ 3RZDJ 1VQ5I 5EG0A 1TWGJ 3EDPA 1ITYA 1V54H 4EJWA 4X0GA 3HRMA 2LBFA 3I5UA 4BJ5C 2W00A 1I5ZA 2DU9A 4QIWN 1U9OA 1M1EB 2FOKA 3BZCA 3OYEA 2RV8A 3RKQA 4AM3A 1D1CA 5IT9Z 5LGNA 2QQBA 2EK5A 4M3BA 2P6SA 2STTA 1FEXA 1R7JA 1OLTA 3J81K 2BY3A 5JHFA 1ZG1A 2FQ3A 3BG5A 4JX6A 3IP4B 3I54A 4M6VA 4XRSG 2PFBA 5TGTA 1WGXA 1TZLA 1FTZA 1WWXA 2L2OA 2RNGA 1MH3A 1S9HA 3SZTA 3AFHA 4FE7A 5TJJA 5DM6F 2K02A 4MO7A 1YO5C 1RUNA 1GHCA 2JUCA 4F55A 3E6BA 3QU3A 4BGDA 3S32A 3L1PA 3T0YA 4QWQA 2EA4A 4YIRX 2CQNA 2KDOA 1FOXA 2PQ8A 1X19A 4BNCA 1E2XA 2UWMA 1YIJI 4XOPA 3BQZA 3JRIA 4XKVA 2NVYJ 3ECHA 3CP2A 1HXDA 3ZQCA 3LA2A 4X1EA 2ZJPF 2VI6A 4CH7A 1OPCA 3BQYA 5BS6A 2LY9A 4WX9A 2XF5A 3M9AA 4D0PA 4H4KC 4XN0A 1Y6IA 2ID6A 3LSGA 5IT9K 1IGNA 3DKYA 3CJTB 1VTNC 1ZGWA 1R4NB 4BBRJ 2R7DA 2L4MA 3DQVC 4PJ0C 3HOZJ 4CSWA 2R5YB 3CF2A 1WJEA 2G9WA 2WADA 2HXIA 2V79A 3ISPA 4IOCF 2P5VA 5CQGA 3AL0C 3QU6A 2VONA 1F5TA 1K4TA 4D5CA 3PNVA 4PJLA 2PX9A 3IKTA 4Y7NJ 2H27A 3KP2A 2W57A 1NK3P 3PNTA 2DK5A 3BR1A 3K1NA 1SD4A 2XAJA 1R49A 1JKPC 1MBHA 4PGGA 3ULQB 4J19A 2HFHA 3E5QA 1FJLA 2LSOA 1MIJA 3OIQA 3RSNA 3OL4A 3TW6A 1T8IA 1LFUP 4R1HA 3G1MA 3DV8A 2CJJA 2XAFA 2WBMA 3JRCA 2JSCA 5KAIC 3IAS2 1Y39A 3IRQA 1FSHA 1BA5A 2X1DA 3JR9A 4HDVA 1CF7A 5E3LA 5IPAA 1WHUA 3ONQA 3PM1A 2BY1A 5C4JJ 2IJLA 2Y0MA 3QAHA 4LLLA 1U3EM 2VOOA 5LHHA 1D8JA 1OCPA 3GMEA 2W48A 3GTJJ 2X6YA 2BHYA 2VPLA 1C0WA 4OIRF 2BW3A 9ANTA 1WSUA 5HLGA 1D3YA 1FYKA 1WJDA 4M3GA 3G6EI 3ROUA 2AQEA 2IBDA 1B1BA 2QWWA 1POGA 2RC4A 5BPIA 3OY9A 3OYNA 3GTQJ 3BG3A 4HSTA 4XSXF 1HW5A 3BPVA 2KHMA 5J3LA 3BLYA 3OYMA 1O3QA 4LGWA 2DMNA 1A6QA 4JK1X 2NAZA 3E97A 1G8XA 2UXNA 4U0WA 1USTA 2R7FA 4E7JA 2DOFA 1AWCA 3GO5A 2OU2A 3H3VK 1S6LA 2STWA 1IW7F 3KYDB 2EV6A 2NOJB 5F1RA 3EYYA 5L3FA 2LH9A 2XUBA 4A3LJ 1JHFA 1FBUA 2PJPA 5B5EC 1RIOH 1E3HA 3OR2C 3WODF 4G9YA 1BBYA 2F6CA 2XROA 4PSXA 1WJAA 1TNTA 5EZGA 1T0FA 2DMPA 2CQ7A 4YIFA 2F4MB 3ZQ7A 1ZR2A 3CUQC 1F9NA 4NBQA 4BHBA 3HL2A 5E18F 4CYCA 2YU9J 1RI7A 1KONA 3EETA 3RYRA 2WWYA 3EUKL 4CGZA 3GTKJ 5FKNA 1KGSA 1JTXA 1GV2A 2MGQA 4DBQA 3FXMA 1GVDA 1MBJA 1PVEA 3J7AO 5FGMA 1Q1HA 1I6HJ 2H8RA 2VE8A 1T98A 3H9QA 3NRVA 4A0YA 1VQ6I 3H36A 5GAGJ 3S2WA 2P4WA 3UNGC 2CUZA 3K4CA 2OF7A 3S14J 3EUAA 1XCVA 2QSHX 3FMQA 1SVOA 3M8JA 3FF5A 1YG2A 2ZXIA 4HX8A 3K2ZA 4CCOA 5C44J 2V9KA 1YRNB 1FC3A 5LFAA 3C2HA 2HDDA 5K7HA 1WRJA 3ZCOA 3LFUA 2WB1A 1SD7A 2L02A 3ERED 1B9NA 2WAQA 3TP3A 1L3LA 2M45A 4P9UA 2DYRH 1XS9A 1ZRDA 2G7HA 2MA3A 4R8HA 5F04A 4PFOA 3PNYA 3Q9VA 1D0XA 1LDJA 5LGUA 1AA7A 5CVJA 2JQ7A 3HGGA 3CZ6A 3BCBA 2X85A 2I10A 2ECCA 3DBRB 2IP2A 2XKOA 3RPQA 4B3AA 3I0TA 2XGXA 5H6RA 2NRAC 1W7PB 1K78B 2H94A 3F23A 1X3UA 4NDLA 5J6XA 1QHHD 3E5UA 5LD2C 3D1NI 2XHKA 4MNUA 5EJCA 1QO0D 3F8NA 1MJAA 2ZXHA 5M5YJ 2VKHA 2K5CA 4B48A 3N97A 3Q0VA 2K86A 1A04A 2C6YA 4OAZA 3GF2A 2O03A 2JUGA 3UKGA 1OFCX 2ZFUA 2X6WA 1RUOA 2ZO4A 5GAHJ 2E19A 1MBGA 2ETHA 2WB1N 3JTHA 3K1PA 4HNUA 1J75A 1MGTA 1YS7A 3IH3A 3ELKA 1WI9A 1FOWA 4CO8A 2FXAA 2RVCA 2CV1A 3F21A 4BS9A 3MKWB 1PP8F 1SAUA 1W0UA 5H20A 4Q4ZF 4C3IJ 1UHMA 2E1CA 4MGRA 2RQPA 5CVRA 4G7ZF 2KQRA 4QLCU 2CQXA 4AYBA 3DEWA 2X1EA 1ENHA 1NG7A 2Y0SA 1IXCA 1ETOA 3T8TA 2DJNA 1PYVA 2EFQA 3HRSA 2X48A 4BYYA 3BDDA 1VQPI 3WGGA 3O8HA 2PMHA 3KLOA 3FXJA 3CCUI 2R5YA 1P2FA 5FKOA 3P7NA 2YR2A 1SD6A 2MSYA 4EJVA 5ILVA 3I59B 1MKMA 3RKWA 3G1LA 5C3EJ 1YIOA 2BBYA 2V6CA 4HLXA 5IOYA 4IHWA 2QGUA 1TT5B 1RESA 3BG9A 1WCMJ 2DDBA 1OQYA 3S15J 1WJBA 4N4OB 2VKEA 1MD0A 4I0AA 5HS7A 2FRHA 3GZNB 1XGOA 3K9TA 1XMXA 4AIHA 4KIGA 4HF2A 2UV1A 4ZDLA 1UFMA 2JTVA 4WWCA 4OIOF 4FHTA 5CQEA 3C3WA 2XV4S 4AYBN 4DQ2A 4XM3A 1W1WE 2Y0SN 1VQOI 2QBYB 2FQ4A 4CICA 2Y2ZA 1PUEE 2JSPA 2YUSA 1XC5A 4ITVA 2PLYA 3TDZC 2VPRA 2QUFA 2GQQA 1IUFA 2K7LA 3HSEA 1LDKB 3MZYA 4DOZA 3J7YJ 3PO2J 3P5JA 1MBKA 2M87A 3HKZA 1ON2A 1IZ1A 3MN2A 4GGGA 4LMYA 4XRFA 4ENNA 3DPTA 2R3SA 1OCZH 2A07F 2XPVA 2CW7A 5DS9A 2HDCA 3MKYB 4I99C 2P0WA 1JKOC 3VYRB 3J80Z 1JGSA 1USSA 2Z99A 4J01A 4D7NA 2V1UA 1DQUA 3HB9A 5EG0B 3DLAA 4HG2A 1R22A 4MQ9F 2FMLA 3KP6A 4S05A 3QPSA 1LE8B 2OJED 1KYZA 4LB5A 5TISC 5J1UA 3OYGA 1FOYA 1FT9A 2PG4A 3T8RA 3J7ZI 4A3FJ 4R79A 4N0BA 4JP0A 3QYEA 2LYCA 1RNLA 3DTKA 5ICGA 1IUYA 4E7IA 2Z16A 2MC3A 2M0MA 2OZ6A 5J47A 5L3GA 1SAXA 4B09A 2AXTC 1JT6A 3I64A 4A3KJ 3ZRGA 2M2EA 2GM4A 4ESFA 4IHSA 4KDPA 2DQRA 1WH5A 3FISA 4YRVA 1QZYA 2YU3A 5CKTA 1IXSB 3MKZA 3HKZN 3OS0A 3RKXA 2KIQA 4M73A 4HPQA 4BACA 3OSGA 3R4KA 4A3EJ 2V7FA 1G3WA 2L7KA 3HYIA 1O3RA 2GLOA 3FBNB 4YELA 4OOIA 1TW3A 2L4AA 5K5QA 3P9CA 1S29A 3J80K 4ZDPA 2KJCA 3D0SA 3SFZA 1ERDA 2BEOA 2KLOA 4XLEA 2F4OB 1U6GA 3LSJA 1XMKA 3S3OA 1X3WB 4C2UA 3HXLA 1SVMA 1TT0A 3KYCB 5LEJA 1JKQC 2V4JC 4B47A 3C2BA 3E6CC 1TQIA 2X0LA 4KN7X 4UVCA 3RIRA 3GFMA 2EA2A 3E0JB 2LMDA 3P9IA 1Z05A 4KA4A 5DM7F 1TWHJ 3HHGA 2XC7A 1BJZA 5HS8A 3BPXA 5CYVA 3VYTB 2G0EA 5GADJ 5J4YA 4W1UA 4FX4A 4NC6A 4B4CA 3FHNA 4KMFA 5LEKA 1JGGA 2JVHA 1T56A 2OV7A 2R7UA 2P5KA 3H9GA 2VBXA 1NH3A 3W2WA 2AS5F 4TV7A 1XGNA 2IS4A 3WHBA 2B63J 3LQQA 3PUFA 4M9SA 4YFKF 1KQ9A 4PZJA 1UJ8A 3CD6I 4MIMA 2YPRA 2CWEA 4Q48A 4HV6A 1IG7A 3VODA 3OIOA 3JRGA 5IOZA 4IHTA 4EGYA 5CVVA 2X1CA 3KCCA 4IXAA 4ABZA 3S2HJ 1IXRC 5DEQA 1DGRM 5FKLA 3PSIA 2VBZA 1D8KA 3PL8A 4FASD 3GTPJ 5HODA 1P4WA 1H9TA 3DBLB 1B4AA 1OKRA 3K6GA 3W2VA 3KETA 3DPUA 3L2WA 4ENMA 3GTMJ 4ZYAA 3LL7A 2IEKA 4N4NB 4N9IA 3FKIJ 4UUVA 2HDWA 3K4LA 2IGNA 3C2GA 1OCTC 3L2UA 4O3MA 4Z6YA 4BQQA 2BW3B 4DYQA 3A01A 2Z5UA 5J1RA 2H1LA 1PJRA 2ELJA 2KP6A 2E60A 2GA2A 2KJBA 4UV9A 5D5XB 4HF0A 4LG0A 2HPMA 4F3QA 3H5RA 2KRFA 1UZCA 1X2NA 4DBRA 2QKMB 4LD5A 2DN0A 2OC6A 3C18A 4RAZA 1FX7A 3I59A 4F92B 4RB2C 3I53A 3CCQI 1QU3A 2A05A 2Z33A 3I56I 3WTYC 3AG1H 3OYHA 3MKLA 1DU6A 4MEYF 2HTSA 2RREA 3S3NA 2L54A 2P7CB 3OWTA 4UNOA 3MD2A 1Z9CA 1TWFJ 4UY8I 3OYIA 3CMAI 5E3OA 2NS0A 3B6CA 4LJZF 4B3XA 1XN7A 3WTWC 2ZB9A 3HPGA 2Q8KA 2L7MP 4HAMA 1FYLA 3LSPA 4FX0A 5E79C 2E36A 1T2KA 2QBYA 4V2GA 2WAFA 3M1CA 1ZAOA 4XKCA 2VKVA 3GFLA 3TDUC 4CYCB 1O57A 1D0ZA 3NWTA 1XPXA 2IRFG 2HPIA 3B02A 4RM2A 1TP4A 4G7HF 2XF6A 5ERIA 5EDNA 4MFEA 3Q9SA 4BJTA 2QQAA 3PJRA 1MNEA 2XGEA 2K3PA 3CO6C 2OBPA 1EV7A 1NK2P 3TEDA 3IWFA 3WTTC 2E2IJ 3OIPA 1R9TJ 3WTUC 1VQNI 2ZJ2A 1ACIA 2K85A 3RQIA 1YE9A 5K5RA 4P96A 3VPRA 4A12A 1JT0A 1MMAA 2GAUA 1B72A 3BP8A 2IAIA 4BXFA 2OD5A 3BJ6A 3JSPA 1LE8A 1ONVA 2M5WA 4OIPF 2XSJC 4IX7A 1LUJB 4IRHA 3K69A 2AO9A 3H92A 1A35A 2CW8A 2ZMEC 2WAEA 2VC0A 4HW0A 3F8CA 5A2QK 3HOSA 1X1CA 3HGYA 2ZCWA 2L7ZA 3OV8A 2DPDA 2NXNB 2K9LA 5E8GA 2QEXI 3SJMA 1HBXG 3O6BB 2CFXA 4JQFA 1ZREA 5KVRA 4EM1A 1J7KA 4RGRA 3IC7A 1SMTA 2ELKA 2CV2A 5FRNA 2MBFA 1XDSA 5LHGA 3QODA 3AG4H 5B1BH 2COBA 2CMPA 3BR0A 2VODA 2M9HA 1L0OC 4DYRA 4P1WA 4QPQA 2CUJA 3HSRA 2J5PA 2QSFX 2DT5A 2EINH 2VC1A 2JT1A 3UR3C 3H5NA 2EZKA 2GOXB 3TO7A 1ZHFA 2HOEA 3D5SC 5KCMA 2GXAA 4M9ZA 1J59A 4EM0B 3BC8A 2KFDA 4HZFA 4BE2A 2HQNA 1IV8A 3ZQFA 4ASNA 1J5YA 3DPLC 3GW2A 4BEHA 1OR7C 1ZR4A 3EUHA 1Y1WJ 4BAYA 3K0LA 4L0YB 2XAUA 1G3SA 1UHWA 3WTZA 4XRSA 2EPFA 4ZZDA 2HYJA 1F4KA 4RLFA 3RPUD 3Q0WA 3FMSA 5LBQA 1VQ8I 3OYKA 2XAQA 2AQFA 2EIJH 2ZNZA 2NS8A 4ZTFA 5KAFC 1SFEA 5F64A 4Y33A 1K83J 3A0BC 4I6ZA 2DQLA 3ABUA 3HSFA 3ZQQA 2RNJA 4U87A 4LK0F 5CVIA 2JA6J 2Z3YA 2DMTA 1VQ4I 1QQIA 2VLAA 1LFPA 1UG2A 5B1AH 3ASNH 4RGSA 5HLHA 2O8XA 3PFYA 1FIAA 2DLLA 1BM9A 1VF9A 4UHTA 3NQOA 4CCMA 4LB6B 2GXGA 4KUMA 3KEQA 2DJIA 2IW5A 4Y13A 1UHSA 1PDNC 2O7OA 3LSMA 2HOTA 3DLLF 3O3KA 3H3ZA 1JUPA 2L9NA 3CUOA 3HBLA 2WY8Q 3ECOA 4M72A 1KQ0A 2F5EA 1BL0A 1EKEA 4XBFA 1MDMA 4BL0B 2XASA 2HVRA 3GLLA 1QPIA 1W5SA 1RR8C 2EJRA 4XNFA 1JTYA 2ECBA 1R5HA 2KIFA 2MABA 2XPUA 1S3JA 2BY0A 3K7AJ 2VUMJ 2HR3A 4PK4A 1LB2A 5J8FA 4V19K 4KMUX 3SEQA 2K40A 4LK1F 5GPCA 2BE5F 1N77A 4M3FA 2DBBA 2K9QA 1Z6RA 4BH9A 3PSFA 1Z0XA 2HQRA 1R1TA 3GXOA 4NNJA 3TO9A 4U0YA 2QSGX 1OYIA 1G3TA 3JCUC 1BI2A 1SEUA 1QNTA 5J1YA 2Z2SB 1B6AA 4CCJA 1V4RA 3BTLA 3OMYA 1XSDA 3ERMA 4M74A 3M4OJ 4V2FA 3S93A 2MFZA 4Y4RA 3I71A 4XLHA 4A6DA 2AXLA 3CC7I 4JYKA 4EQQA 2OTLI 3QWLA 3S2DJ 2R92J 2H1KA 1K6OA 3BZKA 5D6EA 3F8BA 1E17A 4BDYA 2FX0A 4MFDA 5FD6A 1TLHB 3HDDA 2FSWA 1YOVB 2GIZA 1YJ9I 2TCTA 5FKKA 3CDLA 1K6YA 1LQ1A 3FM5A 4KIBA 1B59A 3I4PA 2JA2A 1DP3A 2LD5A 1U5TB 4S0HB 4GFBA 1RPWA 3ZQHA 4B8XA 4XOTA 3M8FA 3OYBA 4GYIA 3CF5F 3GZ5A 1XSXA 3LA7A 2DTRA 2FBKA 2W1OA 5GAEJ 2Q1ZB 1IN4A 4IHXA 1ZARA 5JHUA 1HKQA 5E1XA 2W25A 5K1YA 1AHDP 1S72I 1Y0NA 2JJ7A 4WCGA 2IGMA 2JA5J 2L9RA 3L2RA 3F8MA 4ANJA 4UVAA 1ETXA 2VT3A 2O61A 2RAEA 5GTHC 1X2MA 1H8AC 2PI0A 4XONA 2PMZA 3NAUA 2L9SA 3PFIA 2HZTA 2QVOA 4E4HA 4ESBA 4LLNA 1X1BA 4FT8A 1W7PD 4C2TA 1Q1VA 2DA2A 2Y31A 4QTRA 3R60A 3H0DA 1YJNI 3CTAA 3TW7A 2E2HJ 3F0CA 3COAC 4L9JA 4G6QA 2LG4A 2FE3A 1T39A 1FP2A 1W5TA 1Z77A 1X58A 1XMAA 3B73A 3ZR8X 4U7DA 4XRMA 2NYXA 2LVSA 3F72A 1O4XA 1EF4A 1MJBA 3CQZJ 2MC4A 3FIWA 1BJAA 3DU6A 2GBYA 3NWSA 3HRTA 5AIPA 1VQ9I 2FBIA 3FZVA 1QVUA 3DEEA 5J4VA 1B8IA 1QVTA 1ZKGA 1LPQA 1Z91A 2OA4A 1HDPA 3LA3A 3V8LA 2QA4I 2LKPA 4XICA 2MD0A 4QPOA 1KU7A 2EILH 4M6XA 4OWRB 2PMZN 1I50J 3BTJA 1HCRA 2DODA 3FMRA 5FRMA 2HWVA 2P8TA 3LAJA 2GOMA 3CJRB 2X51A 1OMIA 1XCBA 4I2OA 3LAPA 3JREA 2L01A 1SFUA 1ETVA 2WAQN 1Z7LA 2XB0X 1RC9A 3LMMA 3WTSC 1HDDC 3C1DA 4EJUA 3KEYA 4XMYA 2EFNA 4HSRA 4E70A 3U9GA 2DYSH 2MH9A 2LK2A 1R71A 4ZJZA 3IH2A 4BXXJ 2FNPA 2J5OA 3V8KA 4UB6C 1LDDA 2JA7J 1VNDA 3CCSI 2CW0F 4HA8A 2RQQA 2QM3A 1ETKA 2DFHA 2YSRA 3G2BA 4PUSA 3ZMZA 4BE0A 5HNFA 3A02A 3DP7A 1N78A 4ZYHA 3A01B 2MW8A 3V8JA 4LG0B 5J40A 2EV5A 3WGIA 3FDYA 2DI3A 5EEGA 2W82A 1SMYF 3CCMI 1YQAA 2V1XA 2CH0A 5DD8A 3GWZA 3BCAA 4M3EA 1X1AA 4M71A 5BQTA 1I1SA 5IT3A 3RJPA 1QA6A 3A4CA 2EV0A 4B43A 1H88C 5M5WJ 2ME0A 5FJ8J 2DXIA 2ESHA 2E1MB 3RCOA 2D1HA 4RBOA 2K9NA 3SZGA 4DW6A 5KNLA 3CMMA 2V9VA 2O3FA 3O8GA 3NEUA 5DV5A 4XSZF 1S7OA 5JFRA 3SDBA 1EH7A 2KKOA 2KISA 5EEAA 2OCCH 3U21A 1OISA 4C9YA 1RKWA 3WTVC 3B6AA 2DCEA 4PJMA 2VL8A 3QRFF 2WV1A 3QYBA 2WA0A 3AAFA 4G6DA 2PEXA 2EFPA 2B7EA 4YFXF 1YITI 3FXKA 3C7JA 1QGPA 2IPQX 2IGOA 3GUDA 2HVQA 1WPKA 2EZHA 4I01A 2BVLA 1KZHA 2EZIA 3VYUB 2GIVA 1YJWI 3RTRA 4BY7J 1I1GA 5H6QA 5CJ9A 1APLC 1UAAA 2CYYA 5ILSA 1TQPA 4PGHA 4EGZA 1R5GA 1MSFC 3G1OA 4EVIA 4AIJA 3FK7A 5JVGF 2M4GA 1MBEA 1TWAJ 2EFWA 2FA5A 3HOVJ 4F7ZA 3OYFA 4U7BA 1VZ0A 2FBHA 2UXXA 1IRZA 2LFBA 3E6DA 2Q2EB 4KIFA 4XK4A 2XKPA 5F1JA 3CC2I 3DTEA 4CXFA 4FCYA 2KL4A 4EEFG 1RZ4A 2VBWA 5IYBJ 4IEJA 3CESA 3HM5A 5E3MA 2X6OA 1B72B 5FKMA 3M07A 1S7EA 1OJLA 3S3MA 4MHGA 3LSRA 1MMNA 3RI4A 4LIUA 2VE9A 1XGSA 3GFIA 1MJ9A 3HOWJ 3GBGA 3NARA 3HHHA 2A5YB 4LLGF 1Z3XA 3H5AA 1YYVA 5E1ZB 1I27A 1U5TA 2DT6A 2M7AA 1EH8A 4QSHA 5M5XJ 3SYTA 2VT2A 2WTEA 1HW1A 3KPHA 4ZH4F 4D7MA 1N75A 3Q3SA 4IKFA 4OMZA 4KYWA 4AVPA 1I39A 2XF7A 1MMDA 4A3BJ 1JJ8C 5K5OA 3CMYA 2OQRA 4C3HJ 3BY6A 1TC3C 1IN6A 1QZZA 2HU9A 3IUOA 3VDXA 2HOSA 4RB0A 1LVAA 2HKXA 4E7KA 3ZMDA 3JRBA 1IF1A 1XX5A 2VXZA 4RGXA 3HTUA 4XLNF 2Y9ZA 2DFEA 3DCFA 1D5YA 4IVNA 2LOOA 2OZUA 4KT5C 3BT9A 4F93B 2LY1A 4A93J 4FISA 2QYOA 1YW7A 2R7WA 2HYGD 3BWGA 3KFWX 3R61A 5AONA 2DA5A 2F2EA 2MYSA 3GX4X 1TL8A 1G59A 1P7JA 1GXPA 4G7OF 2RDPA 4HV5A 4BQAA 2BOLA 3ABKH 4AVZA 1H9GA 4BEHB 5L3DA 2LF8A 1V3FA 2LF7A 4P9FA 3LQRA 4HLYA 3CCYA 4PFPA 5FFXA 3KZYA 3GCMA 2K27A 3AG3H 4IRGA 4DIQA 3BZ6A 3CO7C 2JPCA 2NNNA 2ZNYA 5GP9A 2K9SA 3DBHB 3L7WA 1W5CC 3FWEA 1LEAA 2RKHA 1RETA 3FXOA 2ZJQF 3M3YJ 1G4DA 2JPBA 1W4MA 3LNQA 1FWZA 3FK6A 3DTIA 4ENJA 1DU0A 4DJAA 3FHZA 4BDZA 3HOYJ 4FE4A 4UUSA 1PP7U 1FTTA 3ZMTA 2QLZA 2VJIA 1MBFA 2CUEA 1HF0A 3S8PA 2Z9OA 3KE2A 1YW9A 3BR3A 4AD9A 5CLSA 3K10A 2K9MA 3WG7H 3HOUJ 2I8DA 5D8KB 4GCVA 2F5FA 1T95A 4CCKA 2NVTJ 4AIKA 3OOUA 2HYFA 1VQKI 1QRYA 2LNBA 3BROA 3HUGA 1KA8A 3CJQB 1R58A 4CYDA 1SFXA 1WJ5A 4MTDA 1VFCA 4II2A 1MMGA 3MCZA 2VIXA 1MDMB 4Q5SF 2DA3A 2ELHA 1LNWA 2VQHA 2ZKZA 3HIFA 2R7TA 5M3FJ 4KICA 2A69F 1J2XA 1IV6A 2CRGA 1GXQA 2E1NA 4NQWA 3K70C 3CCJI 4N9HA 4ZYEA 2GWRA 5H2FC 2R4GA 3HOXJ 3A03A 3TGNA 4D5FA 2H09A 4KT6A 2QKLB 1VQLI 4D9JA 3S1QJ 3IKVA 1KU9A 3ABTA 3TOBA 5L3CA 5BOXA 1VQ7I 5EYRA 2EWNA 1DGWY 1UELB 1PUFB 3A2KA 3OSFA 4HDUA 3ZP5A 3ABLH 1EA3A 1JUMA 4A6EA 4BQNA 1S7AA 3OL3A 1IRGA 5JLXA 4XLFA 2YX4A 3KLNA 1T6SA 3S1RJ 1X4OA 4OIQF 4B44A 4HYEA 1HA8A 2HVSA 4G12A 3V7CA 3JRHA 1SFOJ 4L9NA 2ZJRF 1FPQA 2HTJA 2MLKA 3VSKA 1MH4A 4XIDA 4I09A 1WJFA 3TOAA 5IP9J 3ZPLA 2F5VA 2HGCA 2LTPA 3PIOF 2R7SA 1YTYA 5GTIC 5F0HA 2BVMA 1ZN2A 1R5ID 4IZZA 1BOBA 2LC2A 3TKYA 4ZTJA 1FMVA 2IA0A 2R7RA 1X4PA 1YHQI 2O5RA 3T1BA 4B1RA 2M8GX 4HQEA 2LR8A 3SEZA 2KZVA 5EEHA 4OINF 4C3JJ 2D1VA 1SFKA 1AKHB 5AIQA 2VN2A 2EZLA 5DYMA 2JK3A 5BPDA 2B0LA 4Z2YA 3LSTA 2DFFA 3MEXA 3S17J 2KZGA 4L5EA 3AL0B 1D1BA 4RAYA 5HDGA 4CZCA 5D5WB 3BR2A 1HW2A 1REPC 4P55A 3KP3A 3REOA 5IP6A 5J8CA 3QQAA 4JX5A 3OYDA 1Y8RB 3IL2A 1R1VA 2M0CA 4G94A 4HQMA 2D45A 2E7XA 3VYSB 1Z21A 4RM3A 3HRUA 3X2QH 1R4MB 2IVMA 1MW7A 4A5NA 1JUSA 3MQ0A 2BXZA 2HXOA 2OUMA 2Q2EA 2QENA 3R0JA 4Q47A 3RKYA 5E3NA 2Y48A 1OCRH 3ZQGA 4BHCA 3QP6A 2UZKA 2A6EF 5JLWA 1V5FA 3KEOA 3JTGA 1V55H 1BR1A 4EATA 1P4AA 1JJ6C 4ON0A 1W0TA 4EJOA 2PJRB 2W4SA 4CCNA 2N8GA 5FO5A 4IHYA 4XL9A 3HTSB 1MNDA 2XB5A 4JOMA 4YEJA 3KZIC 4G6TB 1R36A 2A6TA 1IAWA 1RR7A 2ICWG 4IOAF 5KK1A 4UVBA 1B8IB 5DDGA 1HSJA 2NNYA 4LG3A 2LY2A 3H0GJ 5FROA 1I3QJ 2R7VA 4I98B 2CG4A 4EMSA 2PMUA 4AWXB 4RS8A 1ON1A 2M7BA 1F1ZA 2D2WA 2HS5A 2JN6A 5JI6A 4E7HA 4NB5A 1K7AA 1FOKA 1DPRA 2DW4A 4BJ6C 2BV6A 4BBSJ 1WJCA 4II3A 1V5GA 1H0MA 3TP0A 1BR4A 5LRSA 3TBIA 4AUXA 2VJ5A 5BNGA 2M34A 2E1OA 3G3ZA 1FP1D 3T5XA 4RDUA 3EYIA 2P7VB 2F4IA 1NG6A 2E34A 3D5RC 6PAXA 1R00A 4HF1A 5BMZA 3VEPA 5IYCJ 4HBLA 2E2JJ 3G73A 3V7SA 3PUBA 2XIGA 1T33A 4KNYA 1JE8A 3DWLE 1WFXA 3BR5A 4M6YA 4IO9F 1H89C 4L0ZB 1G6NA 2XAHA 3CUQB 4FQGA 4AU7A 3LFKA 4NC8A 4NC7A 1LFBA 3WG9A 1CQTA 5B66C 5EF6A 2VOPA 2LKSA 2MG4A 3ABMH 2JRTA 3I4MJ 3QPHA 3AG2H 2BXYA 3MMYB 1WH7A 2OQGA 4RA2A 3VB2A 3F9KA 1P7IA 3PO3J 3VWBA 2DMUA 3V4GA 3FXUA 1A5JA 3PQJA 1U2WA 1D5VA 2LREA 3G4SI 2P6TA 3MWMA 4IF4A 5F0CA 4O5VA 5EGOA 4RGUA 3ZMSA 5DTDA 1T0FC 4C2MJ 2NOGA 1OCCH 4BE1A 1ZELA 1X3ZB 2DAOA 4MQVA 1ULYA 2KRCA 2OAZA 4F91B 2GXBA 3F3XA 2YX7A 1ZRCA 1O7FA 2R0QC 1IJWC 4HNTA 4Y15A 3ASOH 2GZWA 4MTEA 5LRRA 1MNMC 1O7LA 1SC7A 1HC8A 2MH2A 1UMQA 1X1PA 2ZMEA 1OCOH 2ZSHB 3I58A 4G8XA 1ZH5A 1F43A 3I55I 4Y52J 1BI3A 4I7HA 4RB3C 1K61A 1DPUA 4LIVA 4PJJA 2Z1DA 1WZ2A 2W24A 4DGWB 1GLNA 3H35A 1U0JA 2W84A 4IJAA 3D5LA 2P81A 2IS2A 1KQ8A 4ENKA 1PUFA 2VKDA 3H9JA 2HEOA 4KISA 4OU0A 1GVJA 1N25A 1Z3YA 4OAYA 1P9QC 3KX2A 3FXRA 4RLQA 4A3JJ 1ZGJA 1ETQA 3E5XA 3PIPF 3DKXA 2HI3A 2K3FA 4W97A 2R5ZB 3WU1B 3GTGJ 3WE3A 1Y8QB 2K4BA 1U8BA 4BKXA 1V5EA 4ZDOA 2DPUA 2OTJI 5DCMA 1AU7A 1OR7A 1UG0A 2VJJA 1RKTA 2DK8A 1IN8A 5HS9A 2CV0A 2BGCA 2ZBKA 2XPWA 2R7XA 2KT0A 4NUBA 3BJOA 4HX7A 4D1QA 1ZGAA 2F48A 2EFOA 4KITB 3JSOA 3SDGA 2CUFA 1DDNA 3OR1C 2EIKH 4FETA 1A31A 2BZTA 4K2EA 2X6XA 4H0EA 4UV8A 4E6KG 3W6KB 3GTOJ 2IA1A 1D1AA 3HPHA 4HX4A 5ICEA 1AKHA 1IN5A 2E5ZA 1VQMI 3E3VA 3LOCA 2DA4A 1XGMA 4RAGA 4A3CJ 3CCEI 2V6EA 2FEZA 3DU5A 5F27A 1FBQA 3ZXSA 4FTHA 4RMNA 1FLIA 5DUKA 3CDHA 4BU2A 5IY5H 1Z1DA 3OYJA 1XD7A 2LDUA 1G3YA 2FOWA 3R0AA 1J0RA 5D5UB 3CLOA 4WK8F 1P6RA 1XSVA 1XB4A 2DFIA 2K4JA 3TL4X 1Z7UA 1WQ2A 3ZGKA 1LEBA 3GLXA 1IC8A 1ORKA 2IS6A 3CC4I 3SXYA 3BOQA 3HZJA 5ILUA 4L9VA 3WGHA 2PJRA 1TNSA 2VB6A 3OYCA 2COMA 2G7UA 2FU4A 4BXUA 4XLAA 2VQCA 4LFUA 1HQCA 4IL6C 2WV0A 1WKMA 2QZ8A 1R23A 4HEA2 3M8EA 5D8LB 1HLVA 2H8WA 2FMYA 3QOEA 1MSEC 2R7OA 1BW5A 2H6CA 2NVQJ 4Y3OA 2LKXA 4M3DA 3SFIA 1IDYA 4F52A 3ZMVA 4GO1A 2NVXJ 2ZXWH 3V42A 2XRNA 4U88A 3TO6A 2W85A 3J7AY 4L18B 4UUSB 2DA1A 4IRIA 1DUXC 1TWCJ 1D0YA 1SD5A 1VI0A 3QP5A 4L5JA 3GFJA 2O0YA 4XLCA 2DO7A 4PJNA 2F5DA 1ETYA 3VSLA 1R6RA 4E7SA 5LHIA 4A2UA 2E35A 2DA6A 4UB8C 3MVPA 1QZEA 3OS2A 1K79A 3HUGB 2BY2A 4L5IA 2HKOA 2E71A 3GEZA 1FZPB 3M7GA 3OOPA 3EPZA 5F0FA 2QF7A 1GDTA 3WTXC 5B3SH 1BI0A 4ZZLA 3P9KA 5CVUA 4BQOA 3DEUA 1BC7C 5ICFA 2FD5A 4O6JA 4NQWB 1R1UA 2CFOA 3CUQA 3JRDA 4ZYDA 2ZFWA 3FM3A 2YS9A 2XGCA 3FBIB 3F8FA 2VBYA 1A6IA 5D4RA 2IS1A 4J00A 2BYVE 1SVLA 5F08A 2EB7A 3BG7A 3E1SA 4ETSA 4EJTA 2L9VA 3IWZA 3FXLA 3BTIA 3L2VA 3K4NA 3K2AA 1BN5A 1ZLJA 2Y75A 2Y9YA 1I3AA 5LGTA 2W7NA 1IDZA 3HG9A 1FYMA 1UB9A 4XORA 4DZPA 2VQGA 3FXQA 3L09A 2IT0A 2UUZA 2MD5A 1AOYA 4A3MJ 2CS3A 2DOEA 1OYWA 4IPAA 2V1NA 5E20A 4L9TA 4CDGA 4KFCA 1Z67A 2O9LA 1U5TC 3JRFA 1STZA 1P92A 5HDKA 3BR6A 2R7QA 1BC8C 1ZTRA 4DYCA 1B9MA 3ZQIA 1QHGA 4BHPA 3KP5A 1E3PA 1ZYRF 1KU2A 3F6VA 5ED4A 2B9SA 3L2CA 2JA8J 1ZG3A 1YS6A 1J9IA 2F5CA 3RPUA 3ZN1A 1ZRFA 1Y56A 4M9XA 1TBXA 3K70D 1ZLKA 4HOBA 3CMEI 3DXJF 1IRFA 2ACJA 4LOCA 2L5QA 1KU3A 1BI1A 3LSIA 4PCQA 4XR6A 2XRLA 5L3EA 2VASA 2DDAA 2X4HA 5EZHA 1RRJA 5FD5A 1WI3A 1T08B 3MFKA 1BR2A 2KIMA 3S16J 4GRIA 3DF8A 5HDNA 3CP8A 4A3GJ 3E7LA 3QYFA 1BOAA 1FIPA 1NHAA 3BTCA 4AC0A 3EQLF 1XG1A 2R5ZA 1W36D 1FMWA 3L00A 1E3OC 4S04A 1A36A 2DA7A 2TRTA 4X6AJ 1IN7A 3JAMZ 3W6JB 4A5MA 1OYYA 3FX3A 3MAJA 3WU0A 3R6SA 2DTZA 1U8RA 5L3BA 3ZN0A 3K4BA 3LWFA 5IYDJ 1YLFA 2QQ8A 1XTAA 3OS1A 3ESWB 1S5LC 3LSHA 4E7ZA 1U9NA 2IGKA 3CJNA 4WXDA 5HVQC 2X9DA 2M3AA 2KMUA 1GV5A 3QOPA 3FKJA 1P4XA 4CA0A 3HOTA 4XQFA 4E7LA 2TDXA 4HRIA 4EM2A 4GYGA 3CCRI 1YFHA 3WHCA 3CLQA 3E6MA 5E1WA 4I76A 1LJ9A 5GPAA 2V9PA 4BY1J 1MMSA 2CU7A 3WE2A 2L3DA 3HJEA 3W3CA 3HEFA 2WC2A 5C4XJ 1XDUA 1TW2A 1F36A 3DKWA 3SZPA 4NHJA 4AIDA 3KZZA 2M8EA 3TQNA 2LBFB 3ZQLA 5JR3A 5HLIA 3JAMK 2HQ5A 2HQAA 3F6OA 3F22A 3O2PE 4XKWA 3ZOBA 4KJZA 1FY7A 3PQKA 2R93J 3K4KA 3KIOA 3K1MA 3G71I 2ISZA 2ADUA 2Y69H 5ICCA 1HOMA 5E8IA 4Y17A 2CQKA 2O6GE 1EH6A 1LKXA 2Q0OA 2OPTA 5FLXZ 2JMWA 1TTYA 1WVRA 3RYPA 3IV5A 5KHDA 2M4KA 4UXNA 1YRNA 1JHHA 2LP0A 2V1DA 4YG2F 2R7ZJ 3HC7A 4DNCA 4A0ZA 1HKSA 4U0VA 2RGVA 2XVCA 3VOEA 5FLVA 3U2RA 2E1MC 1T38A 3TMOA 1BIAA 2IA2A 1UCRA 3L9FA 3LSKA 1HKTA 4XLPF 3QPTA 1Y1VJ 4IHVA 4PDKA 3CDIA 2A3SA 4XKBA 2VJ4A 2EIMH 4A0XA 5JVTA 4IQJA 5EGOB 2ISYA 1KYWA 3BJAA 3IAM2 2D5VA 3K4MA 3OYAA 1W7PA 2CQQA 1K78A 4WXCA 1O3TA 3M1EA 4YFNF 5D6FA 3RZOJ 3GVAA 3S1MJ 5DCFA 1U78A 2CSOA 3H3UA 3S1NJ
chains in the Genus database with same CATH topology
2E36A 1VQ8I 2OTJI 3CF5F 5GAEJ 2E34A 3CCMI 1S72I 1VQOI 5DM7F 1VQ5I 3CCRI 2JQ7A 1VQ4I 1Y39A 1QA6A 2ZJRF 5GADJ 1MMSA 3PIOF 4IO9F 1YI2I 3CCLI 3DLLF 1YHQI 1VQMI 3J7YJ 1YJNI 3G6EI 3CCEI 1VQNI 1ACIA 3CD6I 2ZJQF 1YITI 5GAHJ 3G4SI 2FOWA 1YJWI 1VQ9I 4V19K 3G71I 1FOWA 5DM6F 1FOYA 2NXNB 2QEXI 3J7ZI 3CC4I 2QA4I 1VQKI 5JVGF 1FOXA 3CMEI 1HC8A 1YIJI 3CCVI 3CC2I 3CCQI 2ZJPF 2H8WA 3CC7I 3I55I 1VQPI 3I56I 2OTLI 3CCUI 3CCJI 3CJTB 4IOAF 1VQLI 4UY8I 1VQ6I 5GAGJ 3CMAI 4IOCF 1VQ7I 1YJ9I 3CCSI 3PIPF 2E35A 2K3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E36 A;  1VQ8 I;  2OTJ I;  3CF5 F;  5GAE J;  2E34 A;  3CCM I;  1S72 I;  1VQO I;  5DM7 F;  1VQ5 I;  3CCR I;  2JQ7 A;  1VQ4 I;  1Y39 A;  1QA6 A;  2ZJR F;  5GAD J;  1MMS A;  3PIO F;  4IO9 F;  1YI2 I;  3CCL I;  3DLL F;  1YHQ I;  1VQM I;  3J7Y J;  1YJN I;  3G6E I;  3CCE I;  1VQN I;  1ACI A;  3CD6 I;  2ZJQ F;  1YIT I;  5GAH J;  3G4S I;  2FOW A;  1YJW I;  1VQ9 I;  4V19 K;  3G71 I;  1FOW A;  5DM6 F;  1FOY A;  2NXN B;  2QEX I;  3J7Z I;  3CC4 I;  2QA4 I;  1VQK I;  5JVG F;  1FOX A;  3CME I;  1HC8 A;  1YIJ I;  3CCV I;  3CC2 I;  3CCQ I;  2ZJP F;  2H8W A;  3CC7 I;  3I55 I;  1VQP I;  3I56 I;  2OTL I;  3CCU I;  3CCJ I;  3CJT B;  4IOA F;  1VQL I;  4UY8 I;  1VQ6 I;  5GAG J;  3CMA I;  4IOC F;  1VQ7 I;  1YJ9 I;  3CCS I;  3PIP F;  2E35 A;  2K3F A; 
#chains in the Genus database with same CATH topology
 3U1D A;  4PSW A;  5HLT A;  3V7R A;  5LLQ A;  5FLM J;  4KN4 X;  1GUU A;  3GYH X;  4LIT A;  2ZC2 A;  4WXH A;  4RB1 A;  1BW6 A;  1ZQ3 P;  5FLX K;  3W2A A;  2ZME B;  3N05 A;  2L7F P;  2BHZ A;  3H1C A;  4HNV A;  1K4S A;  4CUG A;  4IQ4 A;  3RDI A;  2M30 A;  4RAF A;  1O3S A;  1FNN A;  4WF2 A;  2XDV A;  4A69 C;  2FUG 2;  1TQM A;  2V26 A;  2JRM A;  1JI8 A;  1ZK8 A;  2ZXJ A;  2MLG A;  1BIB A;  2CO5 A;  4C30 A;  1MZB A;  1NTC A;  1IO2 A;  3SHF A;  3A0H C;  3DFG A;  2EH3 A;  3KYL A;  3RQ4 A;  1YI2 I;  1G2H A;  2KIU A;  5M3M J;  3CCL I;  5D4S A;  1CF7 B;  1SAN A;  3IRR A;  2HNH A;  1I6X A;  2KDZ A;  3N4M A;  2FF4 A;  2IXS A;  4GXO A;  1W36 C;  1IRX A;  2DOA A;  2HOA A;  2OCE A;  1S8N A;  4JX4 A;  2A68 F;  4P5O A;  3Q5F A;  2DMQ A;  3MZH A;  5E17 F;  3U1K A;  5DCM B;  2KRH A;  5D5V B;  1QPM A;  3WU2 C;  1YX3 A;  3L2Q A;  5DD4 A;  5FFZ A;  2VQL A;  1CGP A;  3I9V 2;  1YW8 A;  3AKZ A;  2FJ1 A;  5K7F A;  1FBS A;  2PN6 A;  2EBI A;  1ETW A;  4EV0 A;  1Y0U A;  4ZYG A;  4UUT A;  4YII A;  4A3D J;  2EQR A;  2KPM A;  1FSE A;  2QCO A;  2ME6 A;  1JKR C;  4CZZ A;  4DZJ A;  5DUI A;  1J09 A;  1ODD A;  3I4N J;  4I02 A;  1X1D A;  2M1B A;  2JWT A;  3QPL A;  2H6B A;  2NS7 A;  2XAG A;  2NVU B;  2HZD A;  3VFZ A;  2E5N A;  3MZ8 A;  5IP7 J;  3K4J A;  2RN7 A;  3GTL J;  5F6F A;  2GA1 A;  3CCV I;  3KP4 A;  1QBJ A;  2XSD C;  3GZ6 A;  4MEX F;  5HNH A;  3Q0U A;  2AHQ A;  5CPR B;  1LVK A;  3EUH C;  3BG6 A;  2WY7 Q;  2VXD A;  2ID3 A;  5K7Z A;  2JZY A;  4CCL A;  2DT7 B;  5A2Q Z;  2PBI A;  3JRA A;  3OYL A;  2ZSI B;  3IHU A;  2P5L C;  1EJ9 A;  3I3L A;  2LLK A;  2A61 A;  2CGP A;  4BUP A;  1GT0 C;  4XN3 A;  5HOO A;  4OMY A;  3JW4 A;  1HST A;  2A5W A;  1Z6T A;  2XGD A;  3J81 Z;  2O8K A;  1JXS A;  4CHU A;  4JBA A;  5FB2 A;  2A6H F;  2E7W A;  2ESN A;  1E0E A;  4ESJ A;  1ZG5 A;  4ZC3 A;  3SQN A;  2L0K A;  2QQ9 A;  4I0B A;  4MLO A;  2JVG A;  3ZMU A;  1YX5 A;  2FNA A;  3ML6 A;  2Y30 A;  3IH4 A;  5TRD A;  3W6V A;  4GDF A;  1DP7 P;  3KP7 A;  3A1Y A;  2I5U A;  2LRD A;  4A3I J;  3RZD J;  1VQ5 I;  5EG0 A;  1TWG J;  3EDP A;  1ITY A;  1V54 H;  4EJW A;  4X0G A;  3HRM A;  2LBF A;  3I5U A;  4BJ5 C;  2W00 A;  1I5Z A;  2DU9 A;  4QIW N;  1U9O A;  1M1E B;  2FOK A;  3BZC A;  3OYE A;  2RV8 A;  3RKQ A;  4AM3 A;  1D1C A;  5IT9 Z;  5LGN A;  2QQB A;  2EK5 A;  4M3B A;  2P6S A;  2STT A;  1FEX A;  1R7J A;  1OLT A;  3J81 K;  2BY3 A;  5JHF A;  1ZG1 A;  2FQ3 A;  3BG5 A;  4JX6 A;  3IP4 B;  3I54 A;  4M6V A;  4XRS G;  2PFB A;  5TGT A;  1WGX A;  1TZL A;  1FTZ A;  1WWX A;  2L2O A;  2RNG A;  1MH3 A;  1S9H A;  3SZT A;  3AFH A;  4FE7 A;  5TJJ A;  5DM6 F;  2K02 A;  4MO7 A;  1YO5 C;  1RUN A;  1GHC A;  2JUC A;  4F55 A;  3E6B A;  3QU3 A;  4BGD A;  3S32 A;  3L1P A;  3T0Y A;  4QWQ A;  2EA4 A;  4YIR X;  2CQN A;  2KDO A;  1FOX A;  2PQ8 A;  1X19 A;  4BNC A;  1E2X A;  2UWM A;  1YIJ I;  4XOP A;  3BQZ A;  3JRI A;  4XKV A;  2NVY J;  3ECH A;  3CP2 A;  1HXD A;  3ZQC A;  3LA2 A;  4X1E A;  2ZJP F;  2VI6 A;  4CH7 A;  1OPC A;  3BQY A;  5BS6 A;  2LY9 A;  4WX9 A;  2XF5 A;  3M9A A;  4D0P A;  4H4K C;  4XN0 A;  1Y6I A;  2ID6 A;  3LSG A;  5IT9 K;  1IGN A;  3DKY A;  3CJT B;  1VTN C;  1ZGW A;  1R4N B;  4BBR J;  2R7D A;  2L4M A;  3DQV C;  4PJ0 C;  3HOZ J;  4CSW A;  2R5Y B;  3CF2 A;  1WJE A;  2G9W A;  2WAD A;  2HXI A;  2V79 A;  3ISP A;  4IOC F;  2P5V A;  5CQG A;  3AL0 C;  3QU6 A;  2VON A;  1F5T A;  1K4T A;  4D5C A;  3PNV A;  4PJL A;  2PX9 A;  3IKT A;  4Y7N J;  2H27 A;  3KP2 A;  2W57 A;  1NK3 P;  3PNT A;  2DK5 A;  3BR1 A;  3K1N A;  1SD4 A;  2XAJ A;  1R49 A;  1JKP C;  1MBH A;  4PGG A;  3ULQ B;  4J19 A;  2HFH A;  3E5Q A;  1FJL A;  2LSO A;  1MIJ A;  3OIQ A;  3RSN A;  3OL4 A;  3TW6 A;  1T8I A;  1LFU P;  4R1H A;  3G1M A;  3DV8 A;  2CJJ A;  2XAF A;  2WBM A;  3JRC A;  2JSC A;  5KAI C;  3IAS 2;  1Y39 A;  3IRQ A;  1FSH A;  1BA5 A;  2X1D A;  3JR9 A;  4HDV A;  1CF7 A;  5E3L A;  5IPA A;  1WHU A;  3ONQ A;  3PM1 A;  2BY1 A;  5C4J J;  2IJL A;  2Y0M A;  3QAH A;  4LLL A;  1U3E M;  2VOO A;  5LHH A;  1D8J A;  1OCP A;  3GME A;  2W48 A;  3GTJ J;  2X6Y A;  2BHY A;  2VPL A;  1C0W A;  4OIR F;  2BW3 A;  9ANT A;  1WSU A;  5HLG A;  1D3Y A;  1FYK A;  1WJD A;  4M3G A;  3G6E I;  3ROU A;  2AQE A;  2IBD A;  1B1B A;  2QWW A;  1POG A;  2RC4 A;  5BPI A;  3OY9 A;  3OYN A;  3GTQ J;  3BG3 A;  4HST A;  4XSX F;  1HW5 A;  3BPV A;  2KHM A;  5J3L A;  3BLY A;  3OYM A;  1O3Q A;  4LGW A;  2DMN A;  1A6Q A;  4JK1 X;  2NAZ A;  3E97 A;  1G8X A;  2UXN A;  4U0W A;  1UST A;  2R7F A;  4E7J A;  2DOF A;  1AWC A;  3GO5 A;  2OU2 A;  3H3V K;  1S6L A;  2STW A;  1IW7 F;  3KYD B;  2EV6 A;  2NOJ B;  5F1R A;  3EYY A;  5L3F A;  2LH9 A;  2XUB A;  4A3L J;  1JHF A;  1FBU A;  2PJP A;  5B5E C;  1RIO H;  1E3H A;  3OR2 C;  3WOD F;  4G9Y A;  1BBY A;  2F6C A;  2XRO A;  4PSX A;  1WJA A;  1TNT A;  5EZG A;  1T0F A;  2DMP A;  2CQ7 A;  4YIF A;  2F4M B;  3ZQ7 A;  1ZR2 A;  3CUQ C;  1F9N A;  4NBQ A;  4BHB A;  3HL2 A;  5E18 F;  4CYC A;  2YU9 J;  1RI7 A;  1KON A;  3EET A;  3RYR A;  2WWY A;  3EUK L;  4CGZ A;  3GTK J;  5FKN A;  1KGS A;  1JTX A;  1GV2 A;  2MGQ A;  4DBQ A;  3FXM A;  1GVD A;  1MBJ A;  1PVE A;  3J7A O;  5FGM A;  1Q1H A;  1I6H J;  2H8R A;  2VE8 A;  1T98 A;  3H9Q A;  3NRV A;  4A0Y A;  1VQ6 I;  3H36 A;  5GAG J;  3S2W A;  2P4W A;  3UNG C;  2CUZ A;  3K4C A;  2OF7 A;  3S14 J;  3EUA A;  1XCV A;  2QSH X;  3FMQ A;  1SVO A;  3M8J A;  3FF5 A;  1YG2 A;  2ZXI A;  4HX8 A;  3K2Z A;  4CCO A;  5C44 J;  2V9K A;  1YRN B;  1FC3 A;  5LFA A;  3C2H A;  2HDD A;  5K7H A;  1WRJ A;  3ZCO A;  3LFU A;  2WB1 A;  1SD7 A;  2L02 A;  3ERE D;  1B9N A;  2WAQ A;  3TP3 A;  1L3L A;  2M45 A;  4P9U A;  2DYR H;  1XS9 A;  1ZRD A;  2G7H A;  2MA3 A;  4R8H A;  5F04 A;  4PFO A;  3PNY A;  3Q9V A;  1D0X A;  1LDJ A;  5LGU A;  1AA7 A;  5CVJ A;  2JQ7 A;  3HGG A;  3CZ6 A;  3BCB A;  2X85 A;  2I10 A;  2ECC A;  3DBR B;  2IP2 A;  2XKO A;  3RPQ A;  4B3A A;  3I0T A;  2XGX A;  5H6R A;  2NRA C;  1W7P B;  1K78 B;  2H94 A;  3F23 A;  1X3U A;  4NDL A;  5J6X A;  1QHH D;  3E5U A;  5LD2 C;  3D1N I;  2XHK A;  4MNU A;  5EJC A;  1QO0 D;  3F8N A;  1MJA A;  2ZXH A;  5M5Y J;  2VKH A;  2K5C A;  4B48 A;  3N97 A;  3Q0V A;  2K86 A;  1A04 A;  2C6Y A;  4OAZ A;  3GF2 A;  2O03 A;  2JUG A;  3UKG A;  1OFC X;  2ZFU A;  2X6W A;  1RUO A;  2ZO4 A;  5GAH J;  2E19 A;  1MBG A;  2ETH A;  2WB1 N;  3JTH A;  3K1P A;  4HNU A;  1J75 A;  1MGT A;  1YS7 A;  3IH3 A;  3ELK A;  1WI9 A;  1FOW A;  4CO8 A;  2FXA A;  2RVC A;  2CV1 A;  3F21 A;  4BS9 A;  3MKW B;  1PP8 F;  1SAU A;  1W0U A;  5H20 A;  4Q4Z F;  4C3I J;  1UHM A;  2E1C A;  4MGR A;  2RQP A;  5CVR A;  4G7Z F;  2KQR A;  4QLC U;  2CQX A;  4AYB A;  3DEW A;  2X1E A;  1ENH A;  1NG7 A;  2Y0S A;  1IXC A;  1ETO A;  3T8T A;  2DJN A;  1PYV A;  2EFQ A;  3HRS A;  2X48 A;  4BYY A;  3BDD A;  1VQP I;  3WGG A;  3O8H A;  2PMH A;  3KLO A;  3FXJ A;  3CCU I;  2R5Y A;  1P2F A;  5FKO A;  3P7N A;  2YR2 A;  1SD6 A;  2MSY A;  4EJV A;  5ILV A;  3I59 B;  1MKM A;  3RKW A;  3G1L A;  5C3E J;  1YIO A;  2BBY A;  2V6C A;  4HLX A;  5IOY A;  4IHW A;  2QGU A;  1TT5 B;  1RES A;  3BG9 A;  1WCM J;  2DDB A;  1OQY A;  3S15 J;  1WJB A;  4N4O B;  2VKE A;  1MD0 A;  4I0A A;  5HS7 A;  2FRH A;  3GZN B;  1XGO A;  3K9T A;  1XMX A;  4AIH A;  4KIG A;  4HF2 A;  2UV1 A;  4ZDL A;  1UFM A;  2JTV A;  4WWC A;  4OIO F;  4FHT A;  5CQE A;  3C3W A;  2XV4 S;  4AYB N;  4DQ2 A;  4XM3 A;  1W1W E;  2Y0S N;  1VQO I;  2QBY B;  2FQ4 A;  4CIC A;  2Y2Z A;  1PUE E;  2JSP A;  2YUS A;  1XC5 A;  4ITV A;  2PLY A;  3TDZ C;  2VPR A;  2QUF A;  2GQQ A;  1IUF A;  2K7L A;  3HSE A;  1LDK B;  3MZY A;  4DOZ A;  3J7Y J;  3PO2 J;  3P5J A;  1MBK A;  2M87 A;  3HKZ A;  1ON2 A;  1IZ1 A;  3MN2 A;  4GGG A;  4LMY A;  4XRF A;  4ENN A;  3DPT A;  2R3S A;  1OCZ H;  2A07 F;  2XPV A;  2CW7 A;  5DS9 A;  2HDC A;  3MKY B;  4I99 C;  2P0W A;  1JKO C;  3VYR B;  3J80 Z;  1JGS A;  1USS A;  2Z99 A;  4J01 A;  4D7N A;  2V1U A;  1DQU A;  3HB9 A;  5EG0 B;  3DLA A;  4HG2 A;  1R22 A;  4MQ9 F;  2FML A;  3KP6 A;  4S05 A;  3QPS A;  1LE8 B;  2OJE D;  1KYZ A;  4LB5 A;  5TIS C;  5J1U A;  3OYG A;  1FOY A;  1FT9 A;  2PG4 A;  3T8R A;  3J7Z I;  4A3F J;  4R79 A;  4N0B A;  4JP0 A;  3QYE A;  2LYC A;  1RNL A;  3DTK A;  5ICG A;  1IUY A;  4E7I A;  2Z16 A;  2MC3 A;  2M0M A;  2OZ6 A;  5J47 A;  5L3G A;  1SAX A;  4B09 A;  2AXT C;  1JT6 A;  3I64 A;  4A3K J;  3ZRG A;  2M2E A;  2GM4 A;  4ESF A;  4IHS A;  4KDP A;  2DQR A;  1WH5 A;  3FIS A;  4YRV A;  1QZY A;  2YU3 A;  5CKT A;  1IXS B;  3MKZ A;  3HKZ N;  3OS0 A;  3RKX A;  2KIQ A;  4M73 A;  4HPQ A;  4BAC A;  3OSG A;  3R4K A;  4A3E J;  2V7F A;  1G3W A;  2L7K A;  3HYI A;  1O3R A;  2GLO A;  3FBN B;  4YEL A;  4OOI A;  1TW3 A;  2L4A A;  5K5Q A;  3P9C A;  1S29 A;  3J80 K;  4ZDP A;  2KJC A;  3D0S A;  3SFZ A;  1ERD A;  2BEO A;  2KLO A;  4XLE A;  2F4O B;  1U6G A;  3LSJ A;  1XMK A;  3S3O A;  1X3W B;  4C2U A;  3HXL A;  1SVM A;  1TT0 A;  3KYC B;  5LEJ A;  1JKQ C;  2V4J C;  4B47 A;  3C2B A;  3E6C C;  1TQI A;  2X0L A;  4KN7 X;  4UVC A;  3RIR A;  3GFM A;  2EA2 A;  3E0J B;  2LMD A;  3P9I A;  1Z05 A;  4KA4 A;  5DM7 F;  1TWH J;  3HHG A;  2XC7 A;  1BJZ A;  5HS8 A;  3BPX A;  5CYV A;  3VYT B;  2G0E A;  5GAD J;  5J4Y A;  4W1U A;  4FX4 A;  4NC6 A;  4B4C A;  3FHN A;  4KMF A;  5LEK A;  1JGG A;  2JVH A;  1T56 A;  2OV7 A;  2R7U A;  2P5K A;  3H9G A;  2VBX A;  1NH3 A;  3W2W A;  2AS5 F;  4TV7 A;  1XGN A;  2IS4 A;  3WHB A;  2B63 J;  3LQQ A;  3PUF A;  4M9S A;  4YFK F;  1KQ9 A;  4PZJ A;  1UJ8 A;  3CD6 I;  4MIM A;  2YPR A;  2CWE A;  4Q48 A;  4HV6 A;  1IG7 A;  3VOD A;  3OIO A;  3JRG A;  5IOZ A;  4IHT A;  4EGY A;  5CVV A;  2X1C A;  3KCC A;  4IXA A;  4ABZ A;  3S2H J;  1IXR C;  5DEQ A;  1DGR M;  5FKL A;  3PSI A;  2VBZ A;  1D8K A;  3PL8 A;  4FAS D;  3GTP J;  5HOD A;  1P4W A;  1H9T A;  3DBL B;  1B4A A;  1OKR A;  3K6G A;  3W2V A;  3KET A;  3DPU A;  3L2W A;  4ENM A;  3GTM J;  4ZYA A;  3LL7 A;  2IEK A;  4N4N B;  4N9I A;  3FKI J;  4UUV A;  2HDW A;  3K4L A;  2IGN A;  3C2G A;  1OCT C;  3L2U A;  4O3M A;  4Z6Y A;  4BQQ A;  2BW3 B;  4DYQ A;  3A01 A;  2Z5U A;  5J1R A;  2H1L A;  1PJR A;  2ELJ A;  2KP6 A;  2E60 A;  2GA2 A;  2KJB A;  4UV9 A;  5D5X B;  4HF0 A;  4LG0 A;  2HPM A;  4F3Q A;  3H5R A;  2KRF A;  1UZC A;  1X2N A;  4DBR A;  2QKM B;  4LD5 A;  2DN0 A;  2OC6 A;  3C18 A;  4RAZ A;  1FX7 A;  3I59 A;  4F92 B;  4RB2 C;  3I53 A;  3CCQ I;  1QU3 A;  2A05 A;  2Z33 A;  3I56 I;  3WTY C;  3AG1 H;  3OYH A;  3MKL A;  1DU6 A;  4MEY F;  2HTS A;  2RRE A;  3S3N A;  2L54 A;  2P7C B;  3OWT A;  4UNO A;  3MD2 A;  1Z9C A;  1TWF J;  4UY8 I;  3OYI A;  3CMA I;  5E3O A;  2NS0 A;  3B6C A;  4LJZ F;  4B3X A;  1XN7 A;  3WTW C;  2ZB9 A;  3HPG A;  2Q8K A;  2L7M P;  4HAM A;  1FYL A;  3LSP A;  4FX0 A;  5E79 C;  2E36 A;  1T2K A;  2QBY A;  4V2G A;  2WAF A;  3M1C A;  1ZAO A;  4XKC A;  2VKV A;  3GFL A;  3TDU C;  4CYC B;  1O57 A;  1D0Z A;  3NWT A;  1XPX A;  2IRF G;  2HPI A;  3B02 A;  4RM2 A;  1TP4 A;  4G7H F;  2XF6 A;  5ERI A;  5EDN A;  4MFE A;  3Q9S A;  4BJT A;  2QQA A;  3PJR A;  1MNE A;  2XGE A;  2K3P A;  3CO6 C;  2OBP A;  1EV7 A;  1NK2 P;  3TED A;  3IWF A;  3WTT C;  2E2I J;  3OIP A;  1R9T J;  3WTU C;  1VQN I;  2ZJ2 A;  1ACI A;  2K85 A;  3RQI A;  1YE9 A;  5K5R A;  4P96 A;  3VPR A;  4A12 A;  1JT0 A;  1MMA A;  2GAU A;  1B72 A;  3BP8 A;  2IAI A;  4BXF A;  2OD5 A;  3BJ6 A;  3JSP A;  1LE8 A;  1ONV A;  2M5W A;  4OIP F;  2XSJ C;  4IX7 A;  1LUJ B;  4IRH A;  3K69 A;  2AO9 A;  3H92 A;  1A35 A;  2CW8 A;  2ZME C;  2WAE A;  2VC0 A;  4HW0 A;  3F8C A;  5A2Q K;  3HOS A;  1X1C A;  3HGY A;  2ZCW A;  2L7Z A;  3OV8 A;  2DPD A;  2NXN B;  2K9L A;  5E8G A;  2QEX I;  3SJM A;  1HBX G;  3O6B B;  2CFX A;  4JQF A;  1ZRE A;  5KVR A;  4EM1 A;  1J7K A;  4RGR A;  3IC7 A;  1SMT A;  2ELK A;  2CV2 A;  5FRN A;  2MBF A;  1XDS A;  5LHG A;  3QOD A;  3AG4 H;  5B1B H;  2COB A;  2CMP A;  3BR0 A;  2VOD A;  2M9H A;  1L0O C;  4DYR A;  4P1W A;  4QPQ A;  2CUJ A;  3HSR A;  2J5P A;  2QSF X;  2DT5 A;  2EIN H;  2VC1 A;  2JT1 A;  3UR3 C;  3H5N A;  2EZK A;  2GOX B;  3TO7 A;  1ZHF A;  2HOE A;  3D5S C;  5KCM A;  2GXA A;  4M9Z A;  1J59 A;  4EM0 B;  3BC8 A;  2KFD A;  4HZF A;  4BE2 A;  2HQN A;  1IV8 A;  3ZQF A;  4ASN A;  1J5Y A;  3DPL C;  3GW2 A;  4BEH A;  1OR7 C;  1ZR4 A;  3EUH A;  1Y1W J;  4BAY A;  3K0L A;  4L0Y B;  2XAU A;  1G3S A;  1UHW A;  3WTZ A;  4XRS A;  2EPF A;  4ZZD A;  2HYJ A;  1F4K A;  4RLF A;  3RPU D;  3Q0W A;  3FMS A;  5LBQ A;  1VQ8 I;  3OYK A;  2XAQ A;  2AQF A;  2EIJ H;  2ZNZ A;  2NS8 A;  4ZTF A;  5KAF C;  1SFE A;  5F64 A;  4Y33 A;  1K83 J;  3A0B C;  4I6Z A;  2DQL A;  3ABU A;  3HSF A;  3ZQQ A;  2RNJ A;  4U87 A;  4LK0 F;  5CVI A;  2JA6 J;  2Z3Y A;  2DMT A;  1VQ4 I;  1QQI A;  2VLA A;  1LFP A;  1UG2 A;  5B1A H;  3ASN H;  4RGS A;  5HLH A;  2O8X A;  3PFY A;  1FIA A;  2DLL A;  1BM9 A;  1VF9 A;  4UHT A;  3NQO A;  4CCM A;  4LB6 B;  2GXG A;  4KUM A;  3KEQ A;  2DJI A;  2IW5 A;  4Y13 A;  1UHS A;  1PDN C;  2O7O A;  3LSM A;  2HOT A;  3DLL F;  3O3K A;  3H3Z A;  1JUP A;  2L9N A;  3CUO A;  3HBL A;  2WY8 Q;  3ECO A;  4M72 A;  1KQ0 A;  2F5E A;  1BL0 A;  1EKE A;  4XBF A;  1MDM A;  4BL0 B;  2XAS A;  2HVR A;  3GLL A;  1QPI A;  1W5S A;  1RR8 C;  2EJR A;  4XNF A;  1JTY A;  2ECB A;  1R5H A;  2KIF A;  2MAB A;  2XPU A;  1S3J A;  2BY0 A;  3K7A J;  2VUM J;  2HR3 A;  4PK4 A;  1LB2 A;  5J8F A;  4V19 K;  4KMU X;  3SEQ A;  2K40 A;  4LK1 F;  5GPC A;  2BE5 F;  1N77 A;  4M3F A;  2DBB A;  2K9Q A;  1Z6R A;  4BH9 A;  3PSF A;  1Z0X A;  2HQR A;  1R1T A;  3GXO A;  4NNJ A;  3TO9 A;  4U0Y A;  2QSG X;  1OYI A;  1G3T A;  3JCU C;  1BI2 A;  1SEU A;  1QNT A;  5J1Y A;  2Z2S B;  1B6A A;  4CCJ A;  1V4R A;  3BTL A;  3OMY A;  1XSD A;  3ERM A;  4M74 A;  3M4O J;  4V2F A;  3S93 A;  2MFZ A;  4Y4R A;  3I71 A;  4XLH A;  4A6D A;  2AXL A;  3CC7 I;  4JYK A;  4EQQ A;  2OTL I;  3QWL A;  3S2D J;  2R92 J;  2H1K A;  1K6O A;  3BZK A;  5D6E A;  3F8B A;  1E17 A;  4BDY A;  2FX0 A;  4MFD A;  5FD6 A;  1TLH B;  3HDD A;  2FSW A;  1YOV B;  2GIZ A;  1YJ9 I;  2TCT A;  5FKK A;  3CDL A;  1K6Y A;  1LQ1 A;  3FM5 A;  4KIB A;  1B59 A;  3I4P A;  2JA2 A;  1DP3 A;  2LD5 A;  1U5T B;  4S0H B;  4GFB A;  1RPW A;  3ZQH A;  4B8X A;  4XOT A;  3M8F A;  3OYB A;  4GYI A;  3CF5 F;  3GZ5 A;  1XSX A;  3LA7 A;  2DTR A;  2FBK A;  2W1O A;  5GAE J;  2Q1Z B;  1IN4 A;  4IHX A;  1ZAR A;  5JHU A;  1HKQ A;  5E1X A;  2W25 A;  5K1Y A;  1AHD P;  1S72 I;  1Y0N A;  2JJ7 A;  4WCG A;  2IGM A;  2JA5 J;  2L9R A;  3L2R A;  3F8M A;  4ANJ A;  4UVA A;  1ETX A;  2VT3 A;  2O61 A;  2RAE A;  5GTH C;  1X2M A;  1H8A C;  2PI0 A;  4XON A;  2PMZ A;  3NAU A;  2L9S A;  3PFI A;  2HZT A;  2QVO A;  4E4H A;  4ESB A;  4LLN A;  1X1B A;  4FT8 A;  1W7P D;  4C2T A;  1Q1V A;  2DA2 A;  2Y31 A;  4QTR A;  3R60 A;  3H0D A;  1YJN I;  3CTA A;  3TW7 A;  2E2H J;  3F0C A;  3COA C;  4L9J A;  4G6Q A;  2LG4 A;  2FE3 A;  1T39 A;  1FP2 A;  1W5T A;  1Z77 A;  1X58 A;  1XMA A;  3B73 A;  3ZR8 X;  4U7D A;  4XRM A;  2NYX A;  2LVS A;  3F72 A;  1O4X A;  1EF4 A;  1MJB A;  3CQZ J;  2MC4 A;  3FIW A;  1BJA A;  3DU6 A;  2GBY A;  3NWS A;  3HRT A;  5AIP A;  1VQ9 I;  2FBI A;  3FZV A;  1QVU A;  3DEE A;  5J4V A;  1B8I A;  1QVT A;  1ZKG A;  1LPQ A;  1Z91 A;  2OA4 A;  1HDP A;  3LA3 A;  3V8L A;  2QA4 I;  2LKP A;  4XIC A;  2MD0 A;  4QPO A;  1KU7 A;  2EIL H;  4M6X A;  4OWR B;  2PMZ N;  1I50 J;  3BTJ A;  1HCR A;  2DOD A;  3FMR A;  5FRM A;  2HWV A;  2P8T A;  3LAJ A;  2GOM A;  3CJR B;  2X51 A;  1OMI A;  1XCB A;  4I2O A;  3LAP A;  3JRE A;  2L01 A;  1SFU A;  1ETV A;  2WAQ N;  1Z7L A;  2XB0 X;  1RC9 A;  3LMM A;  3WTS C;  1HDD C;  3C1D A;  4EJU A;  3KEY A;  4XMY A;  2EFN A;  4HSR A;  4E70 A;  3U9G A;  2DYS H;  2MH9 A;  2LK2 A;  1R71 A;  4ZJZ A;  3IH2 A;  4BXX J;  2FNP A;  2J5O A;  3V8K A;  4UB6 C;  1LDD A;  2JA7 J;  1VND A;  3CCS I;  2CW0 F;  4HA8 A;  2RQQ A;  2QM3 A;  1ETK A;  2DFH A;  2YSR A;  3G2B A;  4PUS A;  3ZMZ A;  4BE0 A;  5HNF A;  3A02 A;  3DP7 A;  1N78 A;  4ZYH A;  3A01 B;  2MW8 A;  3V8J A;  4LG0 B;  5J40 A;  2EV5 A;  3WGI A;  3FDY A;  2DI3 A;  5EEG A;  2W82 A;  1SMY F;  3CCM I;  1YQA A;  2V1X A;  2CH0 A;  5DD8 A;  3GWZ A;  3BCA A;  4M3E A;  1X1A A;  4M71 A;  5BQT A;  1I1S A;  5IT3 A;  3RJP A;  1QA6 A;  3A4C A;  2EV0 A;  4B43 A;  1H88 C;  5M5W J;  2ME0 A;  5FJ8 J;  2DXI A;  2ESH A;  2E1M B;  3RCO A;  2D1H A;  4RBO A;  2K9N A;  3SZG A;  4DW6 A;  5KNL A;  3CMM A;  2V9V A;  2O3F A;  3O8G A;  3NEU A;  5DV5 A;  4XSZ F;  1S7O A;  5JFR A;  3SDB A;  1EH7 A;  2KKO A;  2KIS A;  5EEA A;  2OCC H;  3U21 A;  1OIS A;  4C9Y A;  1RKW A;  3WTV C;  3B6A A;  2DCE A;  4PJM A;  2VL8 A;  3QRF F;  2WV1 A;  3QYB A;  2WA0 A;  3AAF A;  4G6D A;  2PEX A;  2EFP A;  2B7E A;  4YFX F;  1YIT I;  3FXK A;  3C7J A;  1QGP A;  2IPQ X;  2IGO A;  3GUD A;  2HVQ A;  1WPK A;  2EZH A;  4I01 A;  2BVL A;  1KZH A;  2EZI A;  3VYU B;  2GIV A;  1YJW I;  3RTR A;  4BY7 J;  1I1G A;  5H6Q A;  5CJ9 A;  1APL C;  1UAA A;  2CYY A;  5ILS A;  1TQP A;  4PGH A;  4EGZ A;  1R5G A;  1MSF C;  3G1O A;  4EVI A;  4AIJ A;  3FK7 A;  5JVG F;  2M4G A;  1MBE A;  1TWA J;  2EFW A;  2FA5 A;  3HOV J;  4F7Z A;  3OYF A;  4U7B A;  1VZ0 A;  2FBH A;  2UXX A;  1IRZ A;  2LFB A;  3E6D A;  2Q2E B;  4KIF A;  4XK4 A;  2XKP A;  5F1J A;  3CC2 I;  3DTE A;  4CXF A;  4FCY A;  2KL4 A;  4EEF G;  1RZ4 A;  2VBW A;  5IYB J;  4IEJ A;  3CES A;  3HM5 A;  5E3M A;  2X6O A;  1B72 B;  5FKM A;  3M07 A;  1S7E A;  1OJL A;  3S3M A;  4MHG A;  3LSR A;  1MMN A;  3RI4 A;  4LIU A;  2VE9 A;  1XGS A;  3GFI A;  1MJ9 A;  3HOW J;  3GBG A;  3NAR A;  3HHH A;  2A5Y B;  4LLG F;  1Z3X A;  3H5A A;  1YYV A;  5E1Z B;  1I27 A;  1U5T A;  2DT6 A;  2M7A A;  1EH8 A;  4QSH A;  5M5X J;  3SYT A;  2VT2 A;  2WTE A;  1HW1 A;  3KPH A;  4ZH4 F;  4D7M A;  1N75 A;  3Q3S A;  4IKF A;  4OMZ A;  4KYW A;  4AVP A;  1I39 A;  2XF7 A;  1MMD A;  4A3B J;  1JJ8 C;  5K5O A;  3CMY A;  2OQR A;  4C3H J;  3BY6 A;  1TC3 C;  1IN6 A;  1QZZ A;  2HU9 A;  3IUO A;  3VDX A;  2HOS A;  4RB0 A;  1LVA A;  2HKX A;  4E7K A;  3ZMD A;  3JRB A;  1IF1 A;  1XX5 A;  2VXZ A;  4RGX A;  3HTU A;  4XLN F;  2Y9Z A;  2DFE A;  3DCF A;  1D5Y A;  4IVN A;  2LOO A;  2OZU A;  4KT5 C;  3BT9 A;  4F93 B;  2LY1 A;  4A93 J;  4FIS A;  2QYO A;  1YW7 A;  2R7W A;  2HYG D;  3BWG A;  3KFW X;  3R61 A;  5AON A;  2DA5 A;  2F2E A;  2MYS A;  3GX4 X;  1TL8 A;  1G59 A;  1P7J A;  1GXP A;  4G7O F;  2RDP A;  4HV5 A;  4BQA A;  2BOL A;  3ABK H;  4AVZ A;  1H9G A;  4BEH B;  5L3D A;  2LF8 A;  1V3F A;  2LF7 A;  4P9F A;  3LQR A;  4HLY A;  3CCY A;  4PFP A;  5FFX A;  3KZY A;  3GCM A;  2K27 A;  3AG3 H;  4IRG A;  4DIQ A;  3BZ6 A;  3CO7 C;  2JPC A;  2NNN A;  2ZNY A;  5GP9 A;  2K9S A;  3DBH B;  3L7W A;  1W5C C;  3FWE A;  1LEA A;  2RKH A;  1RET A;  3FXO A;  2ZJQ F;  3M3Y J;  1G4D A;  2JPB A;  1W4M A;  3LNQ A;  1FWZ A;  3FK6 A;  3DTI A;  4ENJ A;  1DU0 A;  4DJA A;  3FHZ A;  4BDZ A;  3HOY J;  4FE4 A;  4UUS A;  1PP7 U;  1FTT A;  3ZMT A;  2QLZ A;  2VJI A;  1MBF A;  2CUE A;  1HF0 A;  3S8P A;  2Z9O A;  3KE2 A;  1YW9 A;  3BR3 A;  4AD9 A;  5CLS A;  3K10 A;  2K9M A;  3WG7 H;  3HOU J;  2I8D A;  5D8K B;  4GCV A;  2F5F A;  1T95 A;  4CCK A;  2NVT J;  4AIK A;  3OOU A;  2HYF A;  1VQK I;  1QRY A;  2LNB A;  3BRO A;  3HUG A;  1KA8 A;  3CJQ B;  1R58 A;  4CYD A;  1SFX A;  1WJ5 A;  4MTD A;  1VFC A;  4II2 A;  1MMG A;  3MCZ A;  2VIX A;  1MDM B;  4Q5S F;  2DA3 A;  2ELH A;  1LNW A;  2VQH A;  2ZKZ A;  3HIF A;  2R7T A;  5M3F J;  4KIC A;  2A69 F;  1J2X A;  1IV6 A;  2CRG A;  1GXQ A;  2E1N A;  4NQW A;  3K70 C;  3CCJ I;  4N9H A;  4ZYE A;  2GWR A;  5H2F C;  2R4G A;  3HOX J;  3A03 A;  3TGN A;  4D5F A;  2H09 A;  4KT6 A;  2QKL B;  1VQL I;  4D9J A;  3S1Q J;  3IKV A;  1KU9 A;  3ABT A;  3TOB A;  5L3C A;  5BOX A;  1VQ7 I;  5EYR A;  2EWN A;  1DGW Y;  1UEL B;  1PUF B;  3A2K A;  3OSF A;  4HDU A;  3ZP5 A;  3ABL H;  1EA3 A;  1JUM A;  4A6E A;  4BQN A;  1S7A A;  3OL3 A;  1IRG A;  5JLX A;  4XLF A;  2YX4 A;  3KLN A;  1T6S A;  3S1R J;  1X4O A;  4OIQ F;  4B44 A;  4HYE A;  1HA8 A;  2HVS A;  4G12 A;  3V7C A;  3JRH A;  1SFO J;  4L9N A;  2ZJR F;  1FPQ A;  2HTJ A;  2MLK A;  3VSK A;  1MH4 A;  4XID A;  4I09 A;  1WJF A;  3TOA A;  5IP9 J;  3ZPL A;  2F5V A;  2HGC A;  2LTP A;  3PIO F;  2R7S A;  1YTY A;  5GTI C;  5F0H A;  2BVM A;  1ZN2 A;  1R5I D;  4IZZ A;  1BOB A;  2LC2 A;  3TKY A;  4ZTJ A;  1FMV A;  2IA0 A;  2R7R A;  1X4P A;  1YHQ I;  2O5R A;  3T1B A;  4B1R A;  2M8G X;  4HQE A;  2LR8 A;  3SEZ A;  2KZV A;  5EEH A;  4OIN F;  4C3J J;  2D1V A;  1SFK A;  1AKH B;  5AIQ A;  2VN2 A;  2EZL A;  5DYM A;  2JK3 A;  5BPD A;  2B0L A;  4Z2Y A;  3LST A;  2DFF A;  3MEX A;  3S17 J;  2KZG A;  4L5E A;  3AL0 B;  1D1B A;  4RAY A;  5HDG A;  4CZC A;  5D5W B;  3BR2 A;  1HW2 A;  1REP C;  4P55 A;  3KP3 A;  3REO A;  5IP6 A;  5J8C A;  3QQA A;  4JX5 A;  3OYD A;  1Y8R B;  3IL2 A;  1R1V A;  2M0C A;  4G94 A;  4HQM A;  2D45 A;  2E7X A;  3VYS B;  1Z21 A;  4RM3 A;  3HRU A;  3X2Q H;  1R4M B;  2IVM A;  1MW7 A;  4A5N A;  1JUS A;  3MQ0 A;  2BXZ A;  2HXO A;  2OUM A;  2Q2E A;  2QEN A;  3R0J A;  4Q47 A;  3RKY A;  5E3N A;  2Y48 A;  1OCR H;  3ZQG A;  4BHC A;  3QP6 A;  2UZK A;  2A6E F;  5JLW A;  1V5F A;  3KEO A;  3JTG A;  1V55 H;  1BR1 A;  4EAT A;  1P4A A;  1JJ6 C;  4ON0 A;  1W0T A;  4EJO A;  2PJR B;  2W4S A;  4CCN A;  2N8G A;  5FO5 A;  4IHY A;  4XL9 A;  3HTS B;  1MND A;  2XB5 A;  4JOM A;  4YEJ A;  3KZI C;  4G6T B;  1R36 A;  2A6T A;  1IAW A;  1RR7 A;  2ICW G;  4IOA F;  5KK1 A;  4UVB A;  1B8I B;  5DDG A;  1HSJ A;  2NNY A;  4LG3 A;  2LY2 A;  3H0G J;  5FRO A;  1I3Q J;  2R7V A;  4I98 B;  2CG4 A;  4EMS A;  2PMU A;  4AWX B;  4RS8 A;  1ON1 A;  2M7B A;  1F1Z A;  2D2W A;  2HS5 A;  2JN6 A;  5JI6 A;  4E7H A;  4NB5 A;  1K7A A;  1FOK A;  1DPR A;  2DW4 A;  4BJ6 C;  2BV6 A;  4BBS J;  1WJC A;  4II3 A;  1V5G A;  1H0M A;  3TP0 A;  1BR4 A;  5LRS A;  3TBI A;  4AUX A;  2VJ5 A;  5BNG A;  2M34 A;  2E1O A;  3G3Z A;  1FP1 D;  3T5X A;  4RDU A;  3EYI A;  2P7V B;  2F4I A;  1NG6 A;  2E34 A;  3D5R C;  6PAX A;  1R00 A;  4HF1 A;  5BMZ A;  3VEP A;  5IYC J;  4HBL A;  2E2J J;  3G73 A;  3V7S A;  3PUB A;  2XIG A;  1T33 A;  4KNY A;  1JE8 A;  3DWL E;  1WFX A;  3BR5 A;  4M6Y A;  4IO9 F;  1H89 C;  4L0Z B;  1G6N A;  2XAH A;  3CUQ B;  4FQG A;  4AU7 A;  3LFK A;  4NC8 A;  4NC7 A;  1LFB A;  3WG9 A;  1CQT A;  5B66 C;  5EF6 A;  2VOP A;  2LKS A;  2MG4 A;  3ABM H;  2JRT A;  3I4M J;  3QPH A;  3AG2 H;  2BXY A;  3MMY B;  1WH7 A;  2OQG A;  4RA2 A;  3VB2 A;  3F9K A;  1P7I A;  3PO3 J;  3VWB A;  2DMU A;  3V4G A;  3FXU A;  1A5J A;  3PQJ A;  1U2W A;  1D5V A;  2LRE A;  3G4S I;  2P6T A;  3MWM A;  4IF4 A;  5F0C A;  4O5V A;  5EGO A;  4RGU A;  3ZMS A;  5DTD A;  1T0F C;  4C2M J;  2NOG A;  1OCC H;  4BE1 A;  1ZEL A;  1X3Z B;  2DAO A;  4MQV A;  1ULY A;  2KRC A;  2OAZ A;  4F91 B;  2GXB A;  3F3X A;  2YX7 A;  1ZRC A;  1O7F A;  2R0Q C;  1IJW C;  4HNT A;  4Y15 A;  3ASO H;  2GZW A;  4MTE A;  5LRR A;  1MNM C;  1O7L A;  1SC7 A;  1HC8 A;  2MH2 A;  1UMQ A;  1X1P A;  2ZME A;  1OCO H;  2ZSH B;  3I58 A;  4G8X A;  1ZH5 A;  1F43 A;  3I55 I;  4Y52 J;  1BI3 A;  4I7H A;  4RB3 C;  1K61 A;  1DPU A;  4LIV A;  4PJJ A;  2Z1D A;  1WZ2 A;  2W24 A;  4DGW B;  1GLN A;  3H35 A;  1U0J A;  2W84 A;  4IJA A;  3D5L A;  2P81 A;  2IS2 A;  1KQ8 A;  4ENK A;  1PUF A;  2VKD A;  3H9J A;  2HEO A;  4KIS A;  4OU0 A;  1GVJ A;  1N25 A;  1Z3Y A;  4OAY A;  1P9Q C;  3KX2 A;  3FXR A;  4RLQ A;  4A3J J;  1ZGJ A;  1ETQ A;  3E5X A;  3PIP F;  3DKX A;  2HI3 A;  2K3F A;  4W97 A;  2R5Z B;  3WU1 B;  3GTG J;  3WE3 A;  1Y8Q B;  2K4B A;  1U8B A;  4BKX A;  1V5E A;  4ZDO A;  2DPU A;  2OTJ I;  5DCM A;  1AU7 A;  1OR7 A;  1UG0 A;  2VJJ A;  1RKT A;  2DK8 A;  1IN8 A;  5HS9 A;  2CV0 A;  2BGC A;  2ZBK A;  2XPW A;  2R7X A;  2KT0 A;  4NUB A;  3BJO A;  4HX7 A;  4D1Q A;  1ZGA A;  2F48 A;  2EFO A;  4KIT B;  3JSO A;  3SDG A;  2CUF A;  1DDN A;  3OR1 C;  2EIK H;  4FET A;  1A31 A;  2BZT A;  4K2E A;  2X6X A;  4H0E A;  4UV8 A;  4E6K G;  3W6K B;  3GTO J;  2IA1 A;  1D1A A;  3HPH A;  4HX4 A;  5ICE A;  1AKH A;  1IN5 A;  2E5Z A;  1VQM I;  3E3V A;  3LOC A;  2DA4 A;  1XGM A;  4RAG A;  4A3C J;  3CCE I;  2V6E A;  2FEZ A;  3DU5 A;  5F27 A;  1FBQ A;  3ZXS A;  4FTH A;  4RMN A;  1FLI A;  5DUK A;  3CDH A;  4BU2 A;  5IY5 H;  1Z1D A;  3OYJ A;  1XD7 A;  2LDU A;  1G3Y A;  2FOW A;  3R0A A;  1J0R A;  5D5U B;  3CLO A;  4WK8 F;  1P6R A;  1XSV A;  1XB4 A;  2DFI A;  2K4J A;  3TL4 X;  1Z7U A;  1WQ2 A;  3ZGK A;  1LEB A;  3GLX A;  1IC8 A;  1ORK A;  2IS6 A;  3CC4 I;  3SXY A;  3BOQ A;  3HZJ A;  5ILU A;  4L9V A;  3WGH A;  2PJR A;  1TNS A;  2VB6 A;  3OYC A;  2COM A;  2G7U A;  2FU4 A;  4BXU A;  4XLA A;  2VQC A;  4LFU A;  1HQC A;  4IL6 C;  2WV0 A;  1WKM A;  2QZ8 A;  1R23 A;  4HEA 2;  3M8E A;  5D8L B;  1HLV A;  2H8W A;  2FMY A;  3QOE A;  1MSE C;  2R7O A;  1BW5 A;  2H6C A;  2NVQ J;  4Y3O A;  2LKX A;  4M3D A;  3SFI A;  1IDY A;  4F52 A;  3ZMV A;  4GO1 A;  2NVX J;  2ZXW H;  3V42 A;  2XRN A;  4U88 A;  3TO6 A;  2W85 A;  3J7A Y;  4L18 B;  4UUS B;  2DA1 A;  4IRI A;  1DUX C;  1TWC J;  1D0Y A;  1SD5 A;  1VI0 A;  3QP5 A;  4L5J A;  3GFJ A;  2O0Y A;  4XLC A;  2DO7 A;  4PJN A;  2F5D A;  1ETY A;  3VSL A;  1R6R A;  4E7S A;  5LHI A;  4A2U A;  2E35 A;  2DA6 A;  4UB8 C;  3MVP A;  1QZE A;  3OS2 A;  1K79 A;  3HUG B;  2BY2 A;  4L5I A;  2HKO A;  2E71 A;  3GEZ A;  1FZP B;  3M7G A;  3OOP A;  3EPZ A;  5F0F A;  2QF7 A;  1GDT A;  3WTX C;  5B3S H;  1BI0 A;  4ZZL A;  3P9K A;  5CVU A;  4BQO A;  3DEU A;  1BC7 C;  5ICF A;  2FD5 A;  4O6J A;  4NQW B;  1R1U A;  2CFO A;  3CUQ A;  3JRD A;  4ZYD A;  2ZFW A;  3FM3 A;  2YS9 A;  2XGC A;  3FBI B;  3F8F A;  2VBY A;  1A6I A;  5D4R A;  2IS1 A;  4J00 A;  2BYV E;  1SVL A;  5F08 A;  2EB7 A;  3BG7 A;  3E1S A;  4ETS A;  4EJT A;  2L9V A;  3IWZ A;  3FXL A;  3BTI A;  3L2V A;  3K4N A;  3K2A A;  1BN5 A;  1ZLJ A;  2Y75 A;  2Y9Y A;  1I3A A;  5LGT A;  2W7N A;  1IDZ A;  3HG9 A;  1FYM A;  1UB9 A;  4XOR A;  4DZP A;  2VQG A;  3FXQ A;  3L09 A;  2IT0 A;  2UUZ A;  2MD5 A;  1AOY A;  4A3M J;  2CS3 A;  2DOE A;  1OYW A;  4IPA A;  2V1N A;  5E20 A;  4L9T A;  4CDG A;  4KFC A;  1Z67 A;  2O9L A;  1U5T C;  3JRF A;  1STZ A;  1P92 A;  5HDK A;  3BR6 A;  2R7Q A;  1BC8 C;  1ZTR A;  4DYC A;  1B9M A;  3ZQI A;  1QHG A;  4BHP A;  3KP5 A;  1E3P A;  1ZYR F;  1KU2 A;  3F6V A;  5ED4 A;  2B9S A;  3L2C A;  2JA8 J;  1ZG3 A;  1YS6 A;  1J9I A;  2F5C A;  3RPU A;  3ZN1 A;  1ZRF A;  1Y56 A;  4M9X A;  1TBX A;  3K70 D;  1ZLK A;  4HOB A;  3CME I;  3DXJ F;  1IRF A;  2ACJ A;  4LOC A;  2L5Q A;  1KU3 A;  1BI1 A;  3LSI A;  4PCQ A;  4XR6 A;  2XRL A;  5L3E A;  2VAS A;  2DDA A;  2X4H A;  5EZH A;  1RRJ A;  5FD5 A;  1WI3 A;  1T08 B;  3MFK A;  1BR2 A;  2KIM A;  3S16 J;  4GRI A;  3DF8 A;  5HDN A;  3CP8 A;  4A3G J;  3E7L A;  3QYF A;  1BOA A;  1FIP A;  1NHA A;  3BTC A;  4AC0 A;  3EQL F;  1XG1 A;  2R5Z A;  1W36 D;  1FMW A;  3L00 A;  1E3O C;  4S04 A;  1A36 A;  2DA7 A;  2TRT A;  4X6A J;  1IN7 A;  3JAM Z;  3W6J B;  4A5M A;  1OYY A;  3FX3 A;  3MAJ A;  3WU0 A;  3R6S A;  2DTZ A;  1U8R A;  5L3B A;  3ZN0 A;  3K4B A;  3LWF A;  5IYD J;  1YLF A;  2QQ8 A;  1XTA A;  3OS1 A;  3ESW B;  1S5L C;  3LSH A;  4E7Z A;  1U9N A;  2IGK A;  3CJN A;  4WXD A;  5HVQ C;  2X9D A;  2M3A A;  2KMU A;  1GV5 A;  3QOP A;  3FKJ A;  1P4X A;  4CA0 A;  3HOT A;  4XQF A;  4E7L A;  2TDX A;  4HRI A;  4EM2 A;  4GYG A;  3CCR I;  1YFH A;  3WHC A;  3CLQ A;  3E6M A;  5E1W A;  4I76 A;  1LJ9 A;  5GPA A;  2V9P A;  4BY1 J;  1MMS A;  2CU7 A;  3WE2 A;  2L3D A;  3HJE A;  3W3C A;  3HEF A;  2WC2 A;  5C4X J;  1XDU A;  1TW2 A;  1F36 A;  3DKW A;  3SZP A;  4NHJ A;  4AID A;  3KZZ A;  2M8E A;  3TQN A;  2LBF B;  3ZQL A;  5JR3 A;  5HLI A;  3JAM K;  2HQ5 A;  2HQA A;  3F6O A;  3F22 A;  3O2P E;  4XKW A;  3ZOB A;  4KJZ A;  1FY7 A;  3PQK A;  2R93 J;  3K4K A;  3KIO A;  3K1M A;  3G71 I;  2ISZ A;  2ADU A;  2Y69 H;  5ICC A;  1HOM A;  5E8I A;  4Y17 A;  2CQK A;  2O6G E;  1EH6 A;  1LKX A;  2Q0O A;  2OPT A;  5FLX Z;  2JMW A;  1TTY A;  1WVR A;  3RYP A;  3IV5 A;  5KHD A;  2M4K A;  4UXN A;  1YRN A;  1JHH A;  2LP0 A;  2V1D A;  4YG2 F;  2R7Z J;  3HC7 A;  4DNC A;  4A0Z A;  1HKS A;  4U0V A;  2RGV A;  2XVC A;  3VOE A;  5FLV A;  3U2R A;  2E1M C;  1T38 A;  3TMO A;  1BIA A;  2IA2 A;  1UCR A;  3L9F A;  3LSK A;  1HKT A;  4XLP F;  3QPT A;  1Y1V J;  4IHV A;  4PDK A;  3CDI A;  2A3S A;  4XKB A;  2VJ4 A;  2EIM H;  4A0X A;  5JVT A;  4IQJ A;  5EGO B;  2ISY A;  1KYW A;  3BJA A;  3IAM 2;  2D5V A;  3K4M A;  3OYA A;  1W7P A;  2CQQ A;  1K78 A;  4WXC A;  1O3T A;  3M1E A;  4YFN F;  5D6F A;  3RZO J;  3GVA A;  3S1M J;  5DCF A;  1U78 A;  2CSO A;  3H3U A;  3S1N J; 
#chains in the Genus database with same CATH homology
 2E36 A;  1VQ8 I;  2OTJ I;  3CF5 F;  5GAE J;  2E34 A;  3CCM I;  1S72 I;  1VQO I;  5DM7 F;  1VQ5 I;  3CCR I;  2JQ7 A;  1VQ4 I;  1Y39 A;  1QA6 A;  2ZJR F;  5GAD J;  1MMS A;  3PIO F;  4IO9 F;  1YI2 I;  3CCL I;  3DLL F;  1YHQ I;  1VQM I;  3J7Y J;  1YJN I;  3G6E I;  3CCE I;  1VQN I;  1ACI A;  3CD6 I;  2ZJQ F;  1YIT I;  5GAH J;  3G4S I;  2FOW A;  1YJW I;  1VQ9 I;  4V19 K;  3G71 I;  1FOW A;  5DM6 F;  1FOY A;  2NXN B;  2QEX I;  3J7Z I;  3CC4 I;  2QA4 I;  1VQK I;  5JVG F;  1FOX A;  3CME I;  1HC8 A;  1YIJ I;  3CCV I;  3CC2 I;  3CCQ I;  2ZJP F;  2H8W A;  3CC7 I;  3I55 I;  1VQP I;  3I56 I;  2OTL I;  3CCU I;  3CCJ I;  3CJT B;  4IOA F;  1VQL I;  4UY8 I;  1VQ6 I;  5GAG J;  3CMA I;  4IOC F;  1VQ7 I;  1YJ9 I;  3CCS I;  3PIP F;  2E35 A;  2K3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...