4IOAF

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
71
structure length
71
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 8
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4ioaF00
3J7ZI 1VQLI 2ZJPF 2K3FA 1VQMI 1YI2I 3CCLI 3CC2I 3CJTB 3I55I 3I56I 3CC7I 3CCJI 1FOXA 1VQ4I 1YJ9I 1VQ7I 3CCQI 3CF5F 3CCEI 1VQKI 1YJWI 1FOWA 2OTLI 3CMEI 5DM7F 4IOCF 1HC8A 2E34A 3PIPF 1Y39A 3CCUI 1VQ6I 5GAGJ 5GAHJ 1YITI 2JQ7A 1YHQI 1VQPI 1S72I 3DLLF 1YIJI 5GAEJ 2FOWA 3CCMI 1QA6A 1FOYA 1MMSA 2QEXI 1VQNI 4IOAF 4IO9F 4V19K 2NXNB 4UY8I 2OTJI 3CD6I 1VQ9I 2H8WA 1YJNI 3CCSI 2QA4I 3CCVI 1VQ8I 3G71I 1VQ5I 2ZJRF 1VQOI 3G4SI 3CMAI 3CCRI 5DM6F 5GADJ 3G6EI 3J7YJ 2E35A 2E36A 3CC4I 3PIOF 1ACIA 5JVGF 2ZJQF
chains in the Genus database with same CATH superfamily
5L3GA 3FXJA 3HJEA 4G7ZF 3SEQA 2NNNA 3GZ6A 3KIOA 2X0LA 4PCQA 1MZBA 5DYMA 2EFPA 3I5UA 3R0AA 3H3ZA 1PJRA 1USTA 2HXIA 1IXSB 5D5WB 1SD4A 4OAZA 3H5AA 1QVTA 4YIRX 1X1PA 2CQNA 2P5VA 4Q5SF 4BL0B 4V2FA 2X6XA 1FOXA 2V79A 3IKVA 3ZMSA 1VQ7I 2HWVA 2XAGA 1TW3A 4QPOA 2KZVA 1L0OC 1I1SA 3HG9A 1IJWC 5J3LA 3C3WA 4ZJZA 1MGTA 1B9MA 5M5WJ 2EZHA 1FWZA 4PFPA 2A69F 1GXPA 2BHZA 2MABA 5F64A 4DZJA 1Y8QB 2EFQA 3KETA 1E3OC 3OYNA 1MBHA 2XC7A 5E8GA 3VOEA 3QYEA 3JCUC 4DJAA 2N8GA 5ERIA 1SVOA 4HF2A 4B3AA 3K0LA 3FISA 2WADA 1EA3A 1MSFC 3Q0VA 3KP2A 3GTKJ 4PK4A 2ME6A 1BC7C 3FXMA 1UELB 4XL9A 2DJIA 2DFIA 4HX4A 4FE7A 2DT7B 2EFNA 1NH3A 2HQRA 1FBUA 4A0YA 2W85A 4M6XA 2HDCA 2HOAA 3HC7A 4ZDLA 1LVAA 3FMSA 2FA5A 1D5YA 4FQGA 1F5TA 2R7WA 2HU9A 3HIFA 3WTYC 3R61A 3ROUA 4RGXA 2M4GA 2CJJA 3I4MJ 2QEXI 5IP9J 4HNTA 1BI3A 2NOGA 5DTDA 4BDYA 1H88C 1JKQC 2DOAA 3CP2A 1OQYA 2CS3A 5F0CA 2PI0A 4UUTA 1KYWA 4DQ2A 2QVOA 1IF1A 2VPRA 1I3QJ 1A36A 1U8BA 3FKJA 4JP0A 3JRGA 2IAIA 1FEXA 3F0CA 4G6TB 5LEJA 1HBXG 3BPVA 3RQ4A 5E79C 1ETKA 1EKEA 2FEZA 1B8IB 3GTJJ 4G94A 4XR6A 2KZGA 1VQOI 1FC3A 3TO9A 1S7AA 4A5NA 1QZYA 1R9TJ 1T39A 1AKHB 2L7FP 4LIUA 1GV5A 3IHUA 1J7KA 4W1UA 5JR3A 2HYGD 5GP9A 3BJ6A 2E36A 4ESFA 5A2QK 2GWRA 1K6YA 5BS6A 4KA4A 2ZJQF 1IRFA 1N78A 4CA0A 3F8CA 3J7ZI 1JKOC 2OC6A 2KT0A 2BZTA 2LBFA 2XF7A 1QHGA 3EUHA 2OCCH 3I54A 1R5HA 3ZN0A 4A69C 5K7ZA 3I59A 3KP3A 3MFKA 2H27A 3CZ6A 2RQPA 3BLYA 4M3FA 3LQQA 3KZZA 3AKZA 3OYDA 1H89C 2D1VA 4DZPA 2GAUA 2NS8A 3K4CA 5CJ9A 1BI0A 3E6CC 3K1PA 2Y9ZA 3UR3C 1KU7A 1MSEC 4LFUA 3G1LA 3O3KA 4LLNA 4G8XA 4XLEA 4P55A 2E2IJ 4CZCA 1TT5B 1TWGJ 2D45A 2EA4A 2DO7A 2CQKA 1QPIA 1UJ8A 2HQAA 1DPUA 2KRHA 4BJTA 3HOTA 2HOSA 2QSHX 1V5EA 5HLTA 4BH9A 3BY6A 2EZLA 4WXCA 2H1KA 2JA8J 4LK0F 1DP7P 2K86A 1SMYF 5KAIC 5J8FA 1K78A 2Y0SA 1BM9A 2EIJH 4M9ZA 5F04A 2QQBA 2P81A 2XRLA 4PUSA 4OINF 4BQAA 1F43A 1W5CC 1I27A 4JBAA 5HLHA 2KRCA 1UHSA 2R3SA 3ZQCA 3KFWX 4WX9A 1SFEA 2H94A 2UV1A 2X48A 3AL0B 3PM1A 4C3IJ 5F27A 1T08B 5GAEJ 3IWFA 4RAFA 5B5EC 4HQEA 3DWLE 4OIRF 3H9QA 2QWWA 3HRTA 1E0EA 4FASD 1D0ZA 1FBQA 4KT6A 1SANA 3QPHA 3KYDB 4KT5C 3B6CA 2KKOA 1KU9A 2R5YA 3B6AA 1XPXA 3ESWB 1WGXA 3BCBA 4EQQA 1QVUA 4Y15A 2KFDA 3WU2C 4A3JJ 2LOOA 2OQRA 1YJNI 3WTXC 5CKTA 3PNTA 2HVSA 2RKHA 2ADUA 2GIZA 2NYXA 5EZGA 2PFBA 3COAC 1C0WA 4IQ4A 2L5QA 3U21A 2XAFA 2DAOA 2Z2SB 4PZJA 4XRSG 2M8EA 3J7YJ 3RKYA 3WE2A 3JTHA 2KIFA 4L9NA 1W5TA 4PFOA 3ZQ7A 5BMZA 3I3LA 4M6YA 2V9VA 1PDNC 3BC8A 3ZQFA 3E97A 2JWTA 1G6NA 5J47A 1XS9A 3MKYB 4MHGA 2BY0A 2ECBA 4GO1A 4HX8A 3J80Z 2EFWA 2ZXIA 3FK6A 3CJTB 2COBA 1ETOA 1QO0D 2LYCA 4B8XA 3I56I 2MGQA 3CC7I 2JRTA 3BQYA 2FMLA 5DUKA 4QWQA 4AVPA 4L18B 5LGTA 1HW2A 2HKOA 3VSLA 1X1CA 3GYHX 3CF5F 2NVQJ 2ISYA 1VQKI 2CUEA 3S3NA 1ZG1A 2HDWA 2VXZA 2DN0A 3TEDA 3T8RA 2Y69H 2CH0A 1FT9A 2BYVE 2E19A 2EILH 3KYLA 4CYDA 4UVAA 3DEWA 1WRJA 2K4BA 4AIKA 1BN5A 4MEYF 3ZMDA 2L7KA 2DLLA 1BL0A 3OS0A 2KHMA 2L4MA 3I58A 5JHFA 5LHIA 3SQNA 3GTOJ 1T56A 1P4AA 3V8JA 1FYLA 2XDVA 4XKBA 2OJED 5HS7A 3W2WA 1W7PB 3FHNA 4UVCA 3UNGC 3PO3J 2WAEA 2F5FA 1VI0A 1WVRA 2GIVA 3GW2A 4XKCA 1RNLA 3B73A 5HNFA 3VSKA 3K2AA 4JYKA 5HDKA 4I01A 4KIBA 2VJ5A 3K4BA 1AOYA 4F92B 4Y52J 4A0ZA 3BJAA 3KLOA 3S2WA 4A12A 3CCMI 1K78B 2R7XA 4HX7A 2EQRA 3DKWA 3GWZA 1S7EA 3I53A 1TWCJ 4HPQA 4M9SA 1BJAA 2XUBA 2M1BA 3LSGA 4U0WA 2M30A 5EEAA 3ELKA 4IQJA 2VT2A 2V7FA 4HLXA 3GFIA 4ZYGA 5E3LA 1TTYA 2G7UA 1SMTA 2DA4A 3LQRA 1MJBA 5C4JJ 3ERED 4XMYA 2V9PA 4MQ9F 4I99C 3JRBA 1RUOA 3WHCA 5K1YA 1R36A 4XLPF 2QSGX 2R5YB 2DA1A 3BTLA 4FX4A 3RKWA 5IYCJ 4U0VA 2ESNA 2K40A 3S3MA 3BOQA 1ETYA 3QPSA 1OYIA 2MA3A 5B3SH 4AYBA 4M73A 1Q1VA 5JVGF 4N4NB 5D5XB 4DNCA 3I4PA 1VQLI 4XOTA 2DA6A 2XIGA 3FDYA 3H36A 3SFIA 2LY2A 2XAQA 4IPAA 3BG7A 3TP0A 3ZQQA 4DYRA 2KDZA 1FSHA 5AIPA 1VF9A 1MD0A 4EGZA 1YI2I 3LA3A 1F9NA 3MKWB 3C7JA 3SDBA 2D1HA 3EUAA 1K7AA 1O3TA 3TDZC 2JVGA 5IP7J 2IGKA 4GCVA 5EJCA 3H0DA 3F6OA 3M4OJ 3CCEI 3EYYA 4ASNA 2MC3A 1HSJA 1ZHFA 2F4OB 2EV0A 2IEKA 4XN3A 3CUQC 1YS7A 2DQRA 2NVXJ 3L2WA 1D8JA 5F0FA 4C2TA 4Q48A 4NB5A 4C9YA 3JRAA 4F55A 3WTZA 2AO9A 2HNHA 2RV8A 4LLLA 4DYCA 3R60A 4C30A 5HODA 1JE8A 3FM5A 2JA6J 2IBDA 4HYEA 2IGMA 1REPC 3M8JA 2VONA 3WTTC 1OYYA 1W0UA 3L00A 4FTHA 4CCJA 2FNPA 2K4JA 3HKZN 1R1VA 1YYVA 2BXZA 3DPTA 3QYFA 5H20A 4ZYEA 4Q4ZF 3JTGA 4U0YA 3K1NA 4AC0A 1D0XA 3F8BA 3DBRB 2LRDA 4BXUA 1PUFB 1B4AA 3KEYA 2VKHA 4XLAA 3KLNA 1YE9A 2L3DA 1ZR4A 4PSXA 3A01B 4OMZA 2ZXJA 3KEQA 1HQCA 2NVUB 3Q0UA 3K70D 1OCRH 1BW5A 2PMHA 4IF4A 4XLHA 4A5MA 3K7AJ 1Y1VJ 1WFXA 1PP7U 2LD5A 1OCCH 2TCTA 2D5VA 1IDZA 3RPQA 1YIOA 3OSGA 3AL0C 5AIQA 1HCRA 2JTVA 4I7HA 5CQGA 2F5VA 1M1EB 3PUBA 3ZN1A 4GFBA 5ILSA 3V7RA 4A6DA 1ACIA 1W5SA 1XDSA 2VXDA 1R1TA 3K4NA 1BIAA 1Z21A 1J2XA 4O3MA 2CUZA 2X9DA 3OYIA 1Z7UA 3E6BA 2IS2A 2Z3YA 4L9TA 3T8TA 1OKRA 3OR1C 2ZJPF 2K3FA 3ZMTA 1JUSA 1VQMI 1QGPA 2TRTA 1TNTA 1XD7A 4BE0A 2ELJA 5M5XJ 5IT9K 1ORKA 1OCPA 2ETHA 2O61A 1XGSA 1WJCA 1X1BA 1WH5A 1Z0XA 2R7RA 2MLKA 1MJ9A 5IY5H 1U0JA 1P9QC 1Y6IA 2E7XA 3IL2A 1K4SA 2VI6A 1U3EM 1KQ0A 5F1JA 3S17J 4KN4X 3O8GA 2GOMA 3H0GJ 5FRNA 4L5IA 3TDUC 5BOXA 4YEJA 3FF5A 2OTLI 4HQMA 1X1DA 4I98B 3HRUA 4IOCF 3JAMK 2LR8A 2JA7J 2VL8A 3EUKL 3GFMA 3K10A 1OR7C 1JXSA 5J6XA 1FSEA 1FX7A 2PG4A 2JA5J 3PIPF 5JFRA 1P2FA 3BZCA 3ERMA 1BIBA 1R23A 4LK1F 1OJLA 2IJLA 1RZ4A 3HOUJ 3HTSB 2DMUA 4RB1A 4EATA 2CV1A 5E3MA 3ECOA 4UB8C 3JRIA 2WAFA 4R79A 3F8MA 1RC9A 4BYYA 1F1ZA 1X4OA 3EUHC 2DYRH 3OY9A 4PJ0C 1FOYA 3MCZA 1MBKA 2CW8A 3HOSA 3MAJA 2C6YA 1FBSA 2NNYA 2CWEA 5J1UA 3BDDA 4IJAA 3LAPA 1XMAA 2L9VA 1SFUA 4E7SA 3W6KB 1TLHB 2Q2EB 4KIGA 4HEA2 5M3FJ 4EEFG 3K69A 3I9V2 1X19A 2DK8A 3FXRA 2HQ5A 4ZDOA 3FBNB 3IV5A 1VQ8I 4ON0A 1IZ1A 4JX5A 1MNEA 2DA2A 4D1QA 2PJRA 2VKVA 3CCRI 4BHCA 1V5FA 2WV1A 1B8IA 4GRIA 3S93A 3OYEA 1UAAA 5FLXK 1HXDA 2DXIA 1IN4A 1MIJA 1G59A 2RN7A 1L3LA 4A3BJ 2O6GE 4YFXF 4KJZA 1IW7F 1R7JA 3DU6A 1IN5A 3RTRA 1OISA 5BQTA 1MMNA 2CQQA 3HYIA 2EIKH 4E7HA 3J81Z 1R49A 3S14J 2RGVA 5M5YJ 2KISA 3D5SC 5TISC 2LF8A 4YFKF 4F93B 5IT9Z 4HLYA 4XN0A 5LBQA 3TGNA 4G9YA 3JREA 1LEBA 3W6JB 1IDYA 2ZO4A 3SZGA 3KEOA 2BY3A 3BG6A 2VPLA 3VPRA 4O5VA 2RNJA 2DA3A 3I0TA 1NHAA 2HYJA 1HKTA 3LOCA 4ZYDA 2M7AA 4MFDA 3ZQGA 2CO5A 2OPTA 2PMZN 2YX7A 1BOAA 3HBLA 3RDIA 5HLGA 3UKGA 3HDDA 4W97A 1FOWA 4E7KA 1U6GA 2ZNYA 3L2RA 2LTPA 1WQ2A 1R4MB 3F6VA 4V2GA 3FXLA 3HGYA 4BAYA 3JAMZ 2X6OA 1T6SA 3ABKH 2WV0A 1HC8A 4HBLA 3LAJA 3SZTA 2M5WA 2EIMH 3NEUA 3PQJA 5CVJA 3BG9A 3BR0A 2X1DA 5GPAA 4NBQA 4BQNA 1Z67A 2F5DA 2JUGA 3QP5A 1HW5A 3W2AA 2J5PA 3JRHA 4EJUA 2IPQX 2K9NA 1HLVA 1ZAOA 3DKXA 1S72I 2AS5F 2O5RA 3A4CA 5EEHA 2VJ4A 1OYWA 1MDMB 3GBGA 1R00A 2DODA 4QPQA 5H6QA 2FQ4A 2QUFA 1MBJA 3ABMH 3P9CA 5DCMB 4U7BA 5D5VB 3DEUA 1ZGAA 2R7OA 4S05A 5FFXA 2E7WA 5B1AH 4NC7A 3M07A 4KNYA 4YG2F 3OL4A 1DU0A 3NARA 4CO8A 1XG1A 2ELKA 1TZLA 3PFIA 4RBOA 3IRRA 3S2HJ 5BPDA 4AVZA 4AYBN 1AHDP 1POGA 4GGGA 1GT0C 3NQOA 1VQ9I 4FETA 4LB6B 3E3VA 3T5XA 2ZBKA 3MEXA 2XAUA 1J75A 2M8GX 2IGOA 2F5EA 2B9SA 2XGDA 2OAZA 2HI3A 2VB6A 4M3BA 5J4YA 2AXLA 4NC8A 4H4KC 1GXQA 3AG4H 1MNMC 1A6QA 3IRQA 1J9IA 1PVEA 3GTQJ 4AWXB 2EH3A 3HPHA 3HTUA 4I02A 3R6SA 2JN6A 3CLOA 2ZB9A 2ID6A 5GTHC 4RM3A 3S3OA 2H1LA 1I5ZA 3EPZA 1ZLKA 2DMPA 3TL4X 2DPUA 1N75A 2Y0MA 2CV0A 2ZNZA 1HKQA 2EK5A 3PL8A 3HOXJ 1KONA 2IA0A 4HDUA 2X1EA 1XSVA 1IUFA 3GZ5A 4D7MA 1NG6A 3M3YJ 3H5NA 4WK8F 1RI7A 3MVPA 4RLQA 2PJRB 1VNDA 4CGZA 3VEPA 4AIHA 4I0BA 4AIDA 1OR7A 3TW6A 3HKZA 2BVMA 4QTRA 2FJ1A 4XNFA 2ZMEB 5D6EA 2BW3B 2ECCA 3ZR8X 2FMYA 1BR2A 4HAMA 3LSJA 3HSFA 1T2KA 1H9GA 2WWYA 4A3LJ 4F52A 1ZREA 2CSOA 1DU6A 1SC7A 3BR3A 5E1XA 4XQFA 3LSRA 4WXDA 3CMMA 1ENHA 1P4WA 1RKWA 1LVKA 3ZOBA 3DQVC 3L1PA 1B72B 4KMFA 2JMWA 3OIQA 5K7HA 4J00A 2G7HA 3PUFA 2E1MB 2L02A 1T33A 4LIVA 2LVSA 4IHVA 2ME0A 1BJZA 2ZSHB 1O3QA 1ON1A 1WHUA 3JSOA 3K70C 4A3FJ 3GLLA 3IUOA 1D5VA 5J1RA 4B48A 3DCFA 4M6VA 4WXHA 4A3GJ 2O0YA 4IKFA 4X0GA 2VE9A 3CF2A 1BW6A 1KU2A 1I1GA 2O3FA 3MWMA 5FKKA 4RGUA 5GAGJ 1S9HA 1X2MA 2CFOA 5F6FA 5FKMA 4JX6A 3WG9A 3OOPA 1OCZH 4LITA 3WODF 3E6MA 1CQTA 2F4MB 2FBIA 3O2PE 1ZRFA 4I2OA 1W7PA 1D8KA 5JLXA 3TOBA 3BR6A 1LDDA 1O4XA 2DTZA 1EJ9A 3GF2A 4ZDPA 2CU7A 2VBWA 3ZXSA 1Z3YA 4GDFA 2LREA 4HA8A 3LFKA 3ECHA 4F3QA 5E18F 2IXSA 2XHKA 4PJMA 3DF8A 1JT0A 3N05A 1ZYRF 1TWHJ 5F08A 2DT6A 3LL7A 1QZEA 3S1RJ 1SAUA 2VJIA 3E5XA 1MH3A 1RESA 2QENA 1T8IA 4MFEA 3Q9VA 2PX9A 2OZUA 3KX2A 4G6QA 1KU3A 3NRVA 2UXNA 3QOPA 1I50J 3TW7A 4KUMA 5CQEA 3DTIA 2UZKA 5J8CA 4JX4A 2XF5A 3P9IA 3E5UA 4RDUA 4MEXF 3RZDJ 4P9UA 1CGPA 2M45A 3PQKA 4CICA 4CUGA 2B63J 2DCEA 1X4PA 2VBYA 2MG4A 3MKZA 1BR1A 3H9GA 3QPLA 5C44J 2E2JJ 4IXAA 2A61A 3OYMA 1JTXA 2ELHA 2HPMA 3CUOA 1HKSA 5GTIC 2DFEA 1E3HA 2VASA 3G73A 2KPMA 2FBKA 3I64A 1LEAA 5IYBJ 4OOIA 1YOVB 4A3CJ 1BR4A 2D2WA 4GYIA 1XN7A 3RPUA 1O57A 5A2QZ 5HNHA 4XLCA 1IGNA 4MIMA 2DOFA 4MO7A 1MBEA 4RAGA 3QAHA 4CZZA 1IN7A 3FBIB 2BVLA 2WA0A 2V4JC 1H9TA 3QPTA 3EDPA 2CW7A 2KRFA 2DQLA 2W4SA 2G0EA 3OYKA 2XPVA 2GA1A 2XGCA 2JK3A 5EDNA 3K6GA 1K61A 1DUXC 3IH3A 2FNAA 3H5RA 4L5EA 3F8FA 4RB3C 2W48A 3BCAA 4BS9A 3S15J 4NNJA 2YU9J 2MW8A 2GXGA 3BTIA 4II2A 5EEGA 1UHWA 5KK1A 3BZ6A 5CVUA 1U8RA 4G7OF 5K5OA 3CJQB 5GAHJ 3OIOA 1IO2A 3S1MJ 1TWAJ 3LWFA 2W7NA 2M0CA 2Y9YA 1LJ9A 3M7GA 1B59A 1W7PD 1RETA 2DMTA 1O7LA 5CVRA 4DW6A 2A3SA 3A0BC 3S1NJ 4D5CA 2IS6A 3KZIC 5LD2C 3DFGA 2R0QC 1H8AC 2V1DA 2XF6A 3H1CA 3KP6A 1UZCA 2NVTJ 1XCVA 1YRNA 2XVCA 4HV6A 3KP4A 1LB2A 2F48A 4CCNA 2W84A 3RYPA 1DP3A 4IO9F 1WWXA 3OYCA 2CV2A 3GTLJ 4BNCA 1PUFA 1S8NA 1S29A 2EPFA 3CDIA 2PMZA 2HR3A 1MJAA 3RI4A 2A6HF 3A01A 1ZELA 2VODA 2DK5A 1VQ5I 1EV7A 4AUXA 2YR2A 4L9VA 4E70A 4J19A 1Z9CA 3MMYB 3BQZA 4XLNF 5JVTA 4YRVA 5FGMA 5E1WA 2DFFA 2O9LA 3RIRA 1SEUA 3QQAA 4YIFA 2E35A 5J40A 2R7SA 4C3HJ 5C4XJ 2FRHA 2B0LA 4BBRJ 2HQNA 2VQCA 1ZGWA 4PJNA 1AWCA 3GFLA 1MBFA 1X3ZB 3IP4B 5K5RA 3HPGA 2VN2A 3K1MA 2VLAA 4EM0B 5IOZA 3S32A 4FCYA 3WU0A 4XIDA 1B6AA 1IRZA 1R22A 1Y0NA 3F23A 3OS2A 3M8EA 2OV7A 3DXJF 2XB5A 3S2DJ 1ULYA 3HRMA 4Z2YA 4ZZLA 2LKXA 1SD5A 4BKXA 1Q1HA 2E2HJ 1ERDA 2BEOA 1ZTRA 3A1YA 3RPUD 3H9JA 1XMKA 5HOOA 2ESHA 2HFHA 2RC4A 2BGCA 3OYFA 3FKIJ 1DDNA 1TBXA 1OLTA 4LOCA 1E2XA 1T38A 3KYCB 3MZYA 4B09A 4A3IJ 3KP5A 4F7ZA 3CO7C 2E71A 4XORA 4M9XA 2ACJA 5FLVA 3GTPJ 4CH7A 1U2WA 3GFJA 1Z7LA 1EF4A 3PSIA 4ESBA 1LUJB 4RAZA 3K9TA 3GXOA 4ITVA 1VTNC 5HDNA 5FKOA 2LDUA 2V6EA 1XCBA 1HDDC 4HF1A 1R58A 2VKEA 4BEHA 3BT9A 4XBFA 4XSXF 3DU5A 5H2FC 5F0HA 1Y56A 4P96A 2W1OA 1I3AA 2VJJA 2EJRA 1LQ1A 2A07F 1FYKA 4AU7A 3GX4X 2X4HA 5E3OA 4XLFA 1IXRC 2COMA 3QU6A 3GEZA 2XAJA 1WJAA 2L9NA 3MQ0A 3SJMA 1UHMA 5ICGA 1DPRA 5EF6A 2Z33A 4BE2A 2AXTC 1J5YA 2JSPA 4IRGA 1V54H 2OZ6A 1MMSA 1TQPA 3H35A 5ED4A 1TQIA 2E1MC 4LB5A 4V19K 2FU4A 4NQWA 3AG2H 3ZRGA 3BROA 3OSFA 2CQ7A 3M1EA 5D8KB 2TDXA 3EETA 2HTJA 3CCSI 5HVQC 2NS0A 4S0HB 3OYAA 4LJZF 3CCVI 2QA4I 1A31A 2Q2EA 1QZZA 1GVJA 3A02A 5EZHA 1ZN2A 1YRNB 3TO6A 3LSHA 2H6CA 3IWZA 1WJFA 4QLCU 2UXXA 4PGGA 5K5QA 3LA2A 2M4KA 4WCGA 1QPMA 2V26A 5GADJ 3DKYA 3U9GA 1JGGA 2HVRA 2DBBA 4FT8A 2QCOA 3ABLH 1Z6TA 1WI3A 2RVCA 3MKLA 1XSDA 3FM3A 2R5ZA 1PUEE 1BA5A 1R1UA 4AD9A 4KYWA 2ZCWA 3N4MA 3QP6A 4B47A 3HZJA 3DV8A 4Y13A 1YW7A 3E0JB 4CXFA 4RGRA 4WWCA 1RUNA 2L54A 3WTWC 1Z05A 1GUUA 4IVNA 1Y0UA 3F72A 5LLQA 3LSTA 2E5NA 2FBHA 4UB6C 2QZ8A 2XRNA 2PBIA 5E17F 2HYFA 1BOBA 1YLFA 1UG2A 2OCEA 3NWTA 3ZQIA 2BBYA 3TP3A 3CTAA 1NK2P 1FTTA 1FMVA 2Z9OA 3P5JA 2MC4A 1FIPA 1YW8A 3GCMA 5ICEA 2OQGA 5DM7F 2I5UA 3HXLA 5CLSA 4X1EA 4YIIA 3OR2C 4CCKA 2QYOA 3EYIA 4U87A 2L4AA 2JA2A 1D1AA 2F4IA 1LE8B 1IXCA 1Y39A 3VB2A 1JKRC 2BY2A 4IHXA 2JVHA 3VFZA 3SYTA 3RSNA 3SDGA 4KDPA 3KP7A 4BY1J 4JK1X 2HVQA 3ZPLA 3BG3A 2ZXHA 1EH6A 1A04A 1YIJI 1UG0A 2WB1N 2IGNA 4NDLA 3H3VK 3DP7A 1P92A 1R5ID 1X3WB 4G6DA 4LG0A 4BEHB 1TL8A 1MDMA 2QKMB 1X3UA 1TP4A 2E60A 3K4LA 5D4RA 4Y7NJ 1ITYA 5DCMA 3SEZA 4EJVA 2W25A 4RM2A 2OTJI 2PQ8A 1ZK8A 5D4SA 2EZIA 2R7VA 4A3DJ 2M87A 1JKPC 1MMDA 2DW4A 3HOVJ 2F6CA 1ZARA 1DQUA 3IAS2 3HEFA 3BR2A 4M3DA 4BQOA 2LNBA 3U1KA 1HSTA 1VFCA 3ZMUA 1JTYA 4NQWB 4N9HA 4UUSA 4A6EA 2VT3A 3JSPA 1KA8A 5KCMA 3OOUA 3HOZJ 4LD5A 3JW4A 2XPWA 2STTA 4Y33A 3RJPA 3PIOF 1YG2A 3VYSB 4FX0A 3QOEA 2AQEA 4CHUA 5CVVA 1JT6A 4MTEA 4UXNA 2XGEA 1U9OA 1SFXA 2BE5F 2OA4A 2M9HA 3DBHB 4RAYA 4DGWB 3P9KA 5LRSA 4EGYA 3GTMJ 4TV7A 2RREA 3CDLA 4E7JA 3WGGA 2UWMA 1T0FC 3EQLF 2EWNA 2XV4S 2KDOA 2L0KA 1GVDA 5EG0A 4B44A 3Q0WA 2R5ZB 1Y1WJ 2WBMA 2ZMEA 2VBXA 2BW3A 2V1NA 4RGSA 3OS1A 5BPIA 3LSPA 2A68F 2LKSA 4ZTJA 3IH2A 2ICWG 3DTKA 2YX4A 2KQRA 2RNGA 5FJ8J 1XMXA 2E5ZA 1RKTA 4OU0A 2A6TA 3H3UA 3CO6C 2FE3A 2V1XA 1B72A 3BR1A 4U88A 4BXXJ 1ONVA 1SVLA 3V42A 2Z16A 5CVIA 4NHJA 3C2GA 4F91B 4E6KG 1XGNA 2QKLB 1Z1DA 5LEKA 2MD5A 2W24A 4NUBA 2YU3A 5IT3A 3CDHA 1P4XA 5FFZA 4ANJA 1MMAA 2Y31A 5CPRB 5ILVA 3MZHA 3IAM2 3QYBA 1W36D 1R5GA 2W00A 4RA2A 4Y3OA 4XKVA 1JHFA 3B02A 2M2EA 2NRAC 4BACA 2K7LA 3QU3A 2HZDA 5B66C 2MYSA 3ZQLA 1K79A 2CG4A 3CJRB 1ZR2A 4P9FA 3QRFF 4YELA 3VYTB 2P6TA 5H6RA 3HUGA 4MTDA 3J7AO 2XB0X 1VQNI 2OD5A 1PP8F 3QODA 4UY8I 3BPXA 2V1UA 2JZYA 4UV9A 1FYMA 2PEXA 5FKNA 2H09A 1O7FA 1FIAA 4JOMA 2GBYA 1U5TA 2PJPA 1WJEA 3F3XA 4LG0B 5FRMA 1WJBA 2ZC2A 1X1AA 4IHSA 2L01A 2DI3A 1JUMA 2VBZA 2WC2A 4I0AA 4OWRB 2F5CA 3CMAI 1QQIA 1YX5A 2Y48A 1GHCA 3HSRA 1UMQA 2BHYA 2JSCA 1CF7A 1QHHD 4Y17A 3WGIA 3FZVA 4JQFA 2P7CB 3M8FA 3ZP5A 5DUIA 5HLIA 4RB0A 4DBRA 4OIPF 3FX3A 2R7ZJ 2GXBA 1J0RA 1BI2A 3SZPA 2CMPA 4OIQF 4UUSB 3FIWA 2WTEA 1S7OA 2P5KA 3ASNH 3V4GA 1V5GA 4MLOA 1XGOA 3BG5A 4IRHA 5FLXZ 2DFHA 3FXOA 3R4KA 4AIJA 5HDGA 1FTZA 2I8DA 4EM1A 1EH7A 4BHBA 4BQQA 2QSFX 1DGWY 3BWGA 1GDTA 5KHDA 1QRYA 5D8LB 4GYGA 4UVBA 2NAZA 1WJ5A 5E1ZB 5LRRA 3WTSC 5FROA 1YX3A 2FXAA 3MN2A 3VWBA 3KZYA 1IUYA 1SD7A 5EG0B 3FMQA 3L9FA 3DEEA 5DEQA 4B43A 1ZLJA 4HDVA 4I6ZA 4BE1A 3A0HC 4LLGF 3DBLB 3J7AY 4U7DA 3CCUI 3HSEA 4BJ5C 3JRFA 2JT1A 1SD6A 5FD6A 2YUSA 1OFCX 2ZFUA 3C2HA 5M3MJ 5AONA 3FWEA 3NAUA 2DDAA 2W57A 3R0JA 3ZMVA 2PLYA 3LSIA 4L0YB 1FPQA 5ICCA 3L2VA 3AFHA 2VC0A 2NVYJ 4M74A 1HOMA 1XDUA 1ODDA 3KCCA 4KICA 2QQAA 3REOA 3U2RA 5JI6A 2P4WA 3IKTA 1KYZA 2W82A 2O8XA 2BY1A 1BC8C 2EBIA 2OU2A 2HGCA 1K6OA 2GXAA 4X6AJ 4FISA 5ICFA 4LMYA 4MQVA 3O6BB 4CYCA 3CQZJ 3CUQB 2YSRA 1Z6RA 1RR7A 1V3FA 3V8KA 1TW2A 1JUPA 4RLFA 4ZZDA 3OYBA 3CJNA 4HV5A 4CSWA 1J59A 2RQQA 3X2QH 2E1NA 3J80K 1T0FA 3BTJA 3LNQA 1ZG3A 4E7IA 3GVAA 4QIWN 4UHTA 3GUDA 3HUGB 4HSRA 4O6JA 3W3CA 3WHBA 3G4SI 3HM5A 3A03A 3E7LA 2CUFA 2Z99A 1YW9A 5DM6F 1TWFJ 5ILUA 1WJDA 3C1DA 2KLOA 2JUCA 4H0EA 2EFOA 3CC4I 4XOPA 2VC1A 2BOLA 4EM2A 4ZYHA 1U5TB 4D5FA 3DPUA 3TO7A 3ZMZA 2MFZA 4ABZA 2K02A 4QSHA 4A3KJ 2GQQA 1I6HJ 3L7WA 4PSWA 3RCOA 3WG7H 2L9RA 1LFBA 2WB1A 1ZH5A 3FHZA 2QBYA 3FMRA 1A6IA 2Z5UA 5HS8A 2DJNA 3W2VA 5KAFC 2IRFG 3RKQA 1Z3XA 1CF7B 6PAXA 2IS4A 2L2OA 4IHTA 1YJ9I 4BU2A 1XTAA 3CCYA 2XGXA 1JJ8C 2NS7A 3CCQI 5GPCA 2KJBA 1KQ8A 1G4DA 5K7FA 1YJWI 1WKMA 4IHYA 2LSOA 5L3EA 2Y2ZA 5LHGA 4ZC3A 2AQFA 4II3A 3DTEA 1F4KA 1XSXA 3E6DA 4ENKA 3TMOA 3I71A 3V7CA 2ID3A 2PMUA 2ZJ2A 2FX0A 2EA2A 3PNVA 1FP2A 1TNSA 5E8IA 9ANTA 1P6RA 1JI8A 4XM3A 2HEOA 1G8XA 4D7NA 2DOEA 1P7IA 4HNUA 3U1DA 1P7JA 4OIOF 1HDPA 4G12A 4XICA 1GV2A 1VQPI 3C18A 1D0YA 1LFPA 5IPAA 2FUG2 1UCRA 1YTYA 2DPDA 1ZG5A 5JLWA 3BZKA 3O8HA 4BGDA 2KP6A 3P7NA 3QWLA 3GZNB 2LFBA 4BJ6C 2RAEA 1IG7A 1E3PA 2WY7Q 4DOZA 1APLC 2MH2A 4HF0A 2KJCA 1QBJA 3VODA 2JPBA 3GO5A 1B1BA 5D6FA 1SVMA 3RQIA 1ZQ3P 5D5UB 3Q5FA 2HOEA 5CYVA 4ZYAA 3HB9A 1PYVA 2H6BA 1KGSA 4N0BA 4XSZF 1ZRDA 2IS1A 4KMUX 1S6LA 2EINH 3V7SA 2YS9A 1G2HA 4D9JA 4LG3A 1IRGA 2CUJA 2WAQN 4IZZA 4CYCB 3PNYA 4Q47A 2A5YB 4D0PA 2LK2A 4MNUA 4N4OB 4CDGA 2LBFB 3HHHA 1IV8A 2OUMA 3MD2A 2LKPA 2QF7A 3I59B 1FY7A 1UB9A 3DPLC 1MNDA 1YQAA 3IH4A 2FD5A 3WTUC 5DDGA 1R4NB 2FF4A 1W36C 5TRDA 2HXOA 3CC2I 1IC8A 1G3TA 2R7QA 2HOTA 4C2UA 2R7TA 1S5LC 4YFNF 4BDZA 2L7MP 2DT5A 1G3YA 1MKMA 1OMIA 1JHHA 4P1WA 1VZ0A 2ISZA 1OCOH 3F8NA 3LSKA 4NC6A 3S8PA 4DYQA 2CRGA 2DMQA 4HW0A 4B1RA 4AM3A 4I76A 3Q9SA 2CGPA 1G3SA 2K27A 2X85A 3WTVC 5LHHA 5BNGA 2X1CA 2QBYB 3HHGA 3HOYJ 3CMEI 3AG1H 3SHFA 4ETSA 1AU7A 3WGHA 4UV8A 1WI9A 2X51A 3D5LA 1W4MA 3A2KA 1GLNA 2KIMA 2ZKZA 4R1HA 1OPCA 3E5QA 3NWSA 5E3NA 4XRFA 3C2BA 2XPUA 4EVIA 4ZTFA 1LKXA 3OYGA 2DA7A 2KMUA 1FJLA 3MZ8A 5JHUA 1X58A 2IA2A 1UFMA 1YITI 1LE8A 3BJOA 3OYLA 2J5OA 3OYHA 3ML6A 4BBSJ 4RB2C 3Q3SA 5E20A 2PN6A 2ZXWH 3DLLF 4A93J 2FOKA 1BBYA 1ZGJA 4G7HF 3G3ZA 2OF7A 5F1RA 1LDJA 3GTGJ 1IN6A 1ON2A 2FOWA 4ENMA 3W6VA 3PSFA 2NOJB 2L7ZA 3BR5A 2LH9A 5LGNA 1QNTA 4FHTA 2VQGA 4UNOA 3SXYA 4A0XA 4IOAF 1D1CA 2JRMA 1RRJA 1FLIA 5IP6A 2QM3A 1ETXA 1ETVA 3ZCOA 3OYJA 5KVRA 4HNVA 2Q8KA 1ZRCA 3ASOH 3K4KA 5LFAA 2H8WA 4HSTA 3L2CA 2IT0A 1W1WE 2I10A 2ZMEC 4PJJA 2K85A 2V6CA 4E4HA 2OBPA 4J01A 1NTCA 5HS9A 1BI1A 4XKWA 4L9JA 4A2UA 2HKXA 2LLKA 4KFCA 1ZKGA 2DTRA 4GXOA 2GA2A 5EYRA 3D1NI 4ENNA 2Z1DA 3RYRA 3S1QJ 1TQMA 3KPHA 2EZKA 2R7FA 2O8KA 3FK7A 2DYSH 4HZFA 2M34A 1U9NA 3F22A 5B1BH 3KE2A 2DDBA 2X6WA 5TJJA 3OIPA 2R7DA 1YS6A 2IVMA 3K2ZA 1O3RA 2E1CA 2EV6A 1A5JA 3CESA 2WY8Q 1J09A 2STWA 1WPKA 2ZSIB 1FZPB 2P7VB 2GOXB 4IRIA 4ESJA 2HDDA 1FMWA 1KQ9A 4Z6YA 4EMSA 1DGRM 4DIQA 2CW0F 2X6YA 1IAWA 3OMYA 2DMNA 1T95A 1V55H 3ISPA 2LC2A 1YFHA 4KIFA 2M0MA 2A5WA 4EV0A 1NG7A 2DA5A 1TC3C 2A05A 1MBGA 2EV5A 2R4GA 3L09A 4UUVA 1U5TC 3CLQA 2M7BA 1Z77A 4BHPA 2XAHA 4MGRA 1WSUA 1IV6A 2IA1A 1W0TA 2CQXA 3T1BA 5IYDJ 2QQ9A 3L2UA 1OCTC 2UUZA 2VOOA 2MLGA 4PJLA 2KIUA 2VQHA 1U78A 2Q1ZB 2HZTA 3PO2J 2JQ7A 3AG3H 1YHQI 2HS5A 3LA7A 2R92J 3F21A 2P8TA 2P5LC 1YO5C 1IRXA 4C2MJ 3OV8A 3JRCA 2MD0A 2K9SA 2Q0OA 3FXQA 1R71A 3SFZA 2BV6A 2G9WA 5EGOA 1V4RA 4XRSA 2VIXA 5L3DA 3AAFA 3TKYA 4CCOA 1EH8A 5L3CA 1X2NA 2XKPA 2GLOA 1WZ2A 1FOKA 4IL6C 3HL2A 1O3SA 5KNLA 4ZH4F 4M3GA 3M9AA 3V8LA 2V9KA 2F2EA 5DV5A 3L2QA 4HRIA 1FP1D 2K3PA 2VUMJ 1XC5A 4M72A 3RKXA 2CYYA 4BUPA 3J81K 3G1OA 2P0WA 1G3WA 3FXKA 2YPRA 2MSYA 2VOPA 4Y4RA 5FO5A 3JRDA 4B4CA 3RZOJ 2LY9A 2BXYA 2LF7A 1RIOH 1SFKA 1HA8A 1STZA 4EJWA 4PDKA 1MH4A 4E7ZA 2Y0SN 4ENJA 5FB2A 2KL4A 3G6EI 1HW1A 3E1SA 1WCMJ 2B7EA 3LFUA 1LPQA 3ABUA 3H92A 2XASA 1K4TA 1FNNA 2A6EF 4M71A 3T0YA 3WU1B 1N25A 3LSMA 3I4NJ 3IC7A 5FLMJ 2DU9A 1JGSA 2QGUA 1QU3A 3GMEA 3K4JA 2H8RA 3ONQA 4L5JA 3K4MA 1I6XA 1H0MA 3HGGA 3VYRB 2QLZA 4OAYA 4DBQA 4HOBA 2QQ8A 3D5RC 2IP2A 3CCLI 2CFXA 4BY7J 1HF0A 3ZQHA 3N97A 2HTSA 3PFYA 2L9SA 4N9IA 4S04A 3I55I 2XROA 3CCJI 1N77A 4EJTA 4RS8A 1VQ4I 5L3BA 1ETQA 4HG2A 2KIQA 3F9KA 2GM4A 2R7UA 1RR8C 2M3AA 2O7OA 2MH9A 1IN8A 1Z91A 3OL3A 1A35A 3TBIA 1MMGA 2MBFA 2K9LA 5DCFA 3VDXA 3CP8A 4EJOA 4K2EA 1LDKB 4FE4A 5FD5A 2ZFWA 1JJ6C 4CCMA 3ZGKA 2FSWA 5DD4A 1E17A 3S16J 1F36A 4XK4A 1K83J 2R93J 1LNWA 2LY1A 2HPIA 1R6RA 1B9NA 2VE8A 3FXUA 4CCLA 4KITB 2WAQA 5LGUA 4R8HA 2E34A 4I09A 2Y75A 4A3MJ 1VQ6I 4IEJA 1XB4A 2XSDC 5DD8A 3JR9A 3GLXA 5FKLA 2GZWA 1S3JA 2FQ3A 1I39A 1XGMA 2P6SA 3PJRA 4IHWA 1D3YA 1RPWA 5C3EJ 1XX5A 2K9QA 2K9MA 3BP8A 3ULQB 2RDPA 4BXFA 5DS9A 3VYUB 4OMYA 4IX7A 1KZHA 5IOYA 1WH7A 3WE3A 1AA7A 1QA6A 1TT0A 2VKDA 4LGWA 1SAXA 1SFOJ 2LP0A 2JJ7A 2Y30A 1AKHA 4A3EJ 5J1YA 1USSA 2NXNB 4XONA 1LFUP 3CD6I 2EB7A 2K5CA 2XSJC 2JPCA 4KN7X 2LMDA 3LMMA 3OWTA 2O03A 2AHQA 3CMYA 4WF2A 3CUQA 4KISA 3ABTA 5EGOB 1Y8RB 3G1MA 2IW5A 4B3XA 3G2BA 1NK3P 3G71I 1T98A 3D0SA 3TQNA 5J4VA 2E1OA 3TOAA 4M3EA 3HOWJ 2ZJRF 4C3JJ 4PGHA 4RMNA 2XKOA 4L0ZB 5TGTA 3DLAA 2LG4A 1D1BA 1ETWA 5L3FA 3BTCA 4E7LA 4P5OA 1MW7A 3HRSA 2VQLA 3M1CA 4XRMA
chains in the Genus database with same CATH topology
3J7ZI 1VQLI 2ZJPF 2K3FA 1VQMI 1YI2I 3CCLI 3CC2I 3CJTB 3I55I 3I56I 3CC7I 3CCJI 1FOXA 1VQ4I 1YJ9I 1VQ7I 3CCQI 3CF5F 3CCEI 1VQKI 1YJWI 1FOWA 2OTLI 3CMEI 5DM7F 4IOCF 1HC8A 2E34A 3PIPF 1Y39A 3CCUI 1VQ6I 5GAGJ 5GAHJ 1YITI 2JQ7A 1YHQI 1VQPI 1S72I 3DLLF 1YIJI 5GAEJ 2FOWA 3CCMI 1QA6A 1FOYA 1MMSA 2QEXI 1VQNI 4IOAF 4IO9F 4V19K 2NXNB 4UY8I 2OTJI 3CD6I 1VQ9I 2H8WA 1YJNI 3CCSI 2QA4I 3CCVI 1VQ8I 3G71I 1VQ5I 2ZJRF 1VQOI 3G4SI 3CMAI 3CCRI 5DM6F 5GADJ 3G6EI 3J7YJ 2E35A 2E36A 3CC4I 3PIOF 1ACIA 5JVGF 2ZJQF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Z I;  1VQL I;  2ZJP F;  2K3F A;  1VQM I;  1YI2 I;  3CCL I;  3CC2 I;  3CJT B;  3I55 I;  3I56 I;  3CC7 I;  3CCJ I;  1FOX A;  1VQ4 I;  1YJ9 I;  1VQ7 I;  3CCQ I;  3CF5 F;  3CCE I;  1VQK I;  1YJW I;  1FOW A;  2OTL I;  3CME I;  5DM7 F;  4IOC F;  1HC8 A;  2E34 A;  3PIP F;  1Y39 A;  3CCU I;  1VQ6 I;  5GAG J;  5GAH J;  1YIT I;  2JQ7 A;  1YHQ I;  1VQP I;  1S72 I;  3DLL F;  1YIJ I;  5GAE J;  2FOW A;  3CCM I;  1QA6 A;  1FOY A;  1MMS A;  2QEX I;  1VQN I;  4IOA F;  4IO9 F;  4V19 K;  2NXN B;  4UY8 I;  2OTJ I;  3CD6 I;  1VQ9 I;  2H8W A;  1YJN I;  3CCS I;  2QA4 I;  3CCV I;  1VQ8 I;  3G71 I;  1VQ5 I;  2ZJR F;  1VQO I;  3G4S I;  3CMA I;  3CCR I;  5DM6 F;  5GAD J;  3G6E I;  3J7Y J;  2E35 A;  2E36 A;  3CC4 I;  3PIO F;  1ACI A;  5JVG F;  2ZJQ F; 
#chains in the Genus database with same CATH topology
 5L3G A;  3FXJ A;  3HJE A;  4G7Z F;  3SEQ A;  2NNN A;  3GZ6 A;  3KIO A;  2X0L A;  4PCQ A;  1MZB A;  5DYM A;  2EFP A;  3I5U A;  3R0A A;  3H3Z A;  1PJR A;  1UST A;  2HXI A;  1IXS B;  5D5W B;  1SD4 A;  4OAZ A;  3H5A A;  1QVT A;  4YIR X;  1X1P A;  2CQN A;  2P5V A;  4Q5S F;  4BL0 B;  4V2F A;  2X6X A;  1FOX A;  2V79 A;  3IKV A;  3ZMS A;  1VQ7 I;  2HWV A;  2XAG A;  1TW3 A;  4QPO A;  2KZV A;  1L0O C;  1I1S A;  3HG9 A;  1IJW C;  5J3L A;  3C3W A;  4ZJZ A;  1MGT A;  1B9M A;  5M5W J;  2EZH A;  1FWZ A;  4PFP A;  2A69 F;  1GXP A;  2BHZ A;  2MAB A;  5F64 A;  4DZJ A;  1Y8Q B;  2EFQ A;  3KET A;  1E3O C;  3OYN A;  1MBH A;  2XC7 A;  5E8G A;  3VOE A;  3QYE A;  3JCU C;  4DJA A;  2N8G A;  5ERI A;  1SVO A;  4HF2 A;  4B3A A;  3K0L A;  3FIS A;  2WAD A;  1EA3 A;  1MSF C;  3Q0V A;  3KP2 A;  3GTK J;  4PK4 A;  2ME6 A;  1BC7 C;  3FXM A;  1UEL B;  4XL9 A;  2DJI A;  2DFI A;  4HX4 A;  4FE7 A;  2DT7 B;  2EFN A;  1NH3 A;  2HQR A;  1FBU A;  4A0Y A;  2W85 A;  4M6X A;  2HDC A;  2HOA A;  3HC7 A;  4ZDL A;  1LVA A;  3FMS A;  2FA5 A;  1D5Y A;  4FQG A;  1F5T A;  2R7W A;  2HU9 A;  3HIF A;  3WTY C;  3R61 A;  3ROU A;  4RGX A;  2M4G A;  2CJJ A;  3I4M J;  2QEX I;  5IP9 J;  4HNT A;  1BI3 A;  2NOG A;  5DTD A;  4BDY A;  1H88 C;  1JKQ C;  2DOA A;  3CP2 A;  1OQY A;  2CS3 A;  5F0C A;  2PI0 A;  4UUT A;  1KYW A;  4DQ2 A;  2QVO A;  1IF1 A;  2VPR A;  1I3Q J;  1A36 A;  1U8B A;  3FKJ A;  4JP0 A;  3JRG A;  2IAI A;  1FEX A;  3F0C A;  4G6T B;  5LEJ A;  1HBX G;  3BPV A;  3RQ4 A;  5E79 C;  1ETK A;  1EKE A;  2FEZ A;  1B8I B;  3GTJ J;  4G94 A;  4XR6 A;  2KZG A;  1VQO I;  1FC3 A;  3TO9 A;  1S7A A;  4A5N A;  1QZY A;  1R9T J;  1T39 A;  1AKH B;  2L7F P;  4LIU A;  1GV5 A;  3IHU A;  1J7K A;  4W1U A;  5JR3 A;  2HYG D;  5GP9 A;  3BJ6 A;  2E36 A;  4ESF A;  5A2Q K;  2GWR A;  1K6Y A;  5BS6 A;  4KA4 A;  2ZJQ F;  1IRF A;  1N78 A;  4CA0 A;  3F8C A;  3J7Z I;  1JKO C;  2OC6 A;  2KT0 A;  2BZT A;  2LBF A;  2XF7 A;  1QHG A;  3EUH A;  2OCC H;  3I54 A;  1R5H A;  3ZN0 A;  4A69 C;  5K7Z A;  3I59 A;  3KP3 A;  3MFK A;  2H27 A;  3CZ6 A;  2RQP A;  3BLY A;  4M3F A;  3LQQ A;  3KZZ A;  3AKZ A;  3OYD A;  1H89 C;  2D1V A;  4DZP A;  2GAU A;  2NS8 A;  3K4C A;  5CJ9 A;  1BI0 A;  3E6C C;  3K1P A;  2Y9Z A;  3UR3 C;  1KU7 A;  1MSE C;  4LFU A;  3G1L A;  3O3K A;  4LLN A;  4G8X A;  4XLE A;  4P55 A;  2E2I J;  4CZC A;  1TT5 B;  1TWG J;  2D45 A;  2EA4 A;  2DO7 A;  2CQK A;  1QPI A;  1UJ8 A;  2HQA A;  1DPU A;  2KRH A;  4BJT A;  3HOT A;  2HOS A;  2QSH X;  1V5E A;  5HLT A;  4BH9 A;  3BY6 A;  2EZL A;  4WXC A;  2H1K A;  2JA8 J;  4LK0 F;  1DP7 P;  2K86 A;  1SMY F;  5KAI C;  5J8F A;  1K78 A;  2Y0S A;  1BM9 A;  2EIJ H;  4M9Z A;  5F04 A;  2QQB A;  2P81 A;  2XRL A;  4PUS A;  4OIN F;  4BQA A;  1F43 A;  1W5C C;  1I27 A;  4JBA A;  5HLH A;  2KRC A;  1UHS A;  2R3S A;  3ZQC A;  3KFW X;  4WX9 A;  1SFE A;  2H94 A;  2UV1 A;  2X48 A;  3AL0 B;  3PM1 A;  4C3I J;  5F27 A;  1T08 B;  5GAE J;  3IWF A;  4RAF A;  5B5E C;  4HQE A;  3DWL E;  4OIR F;  3H9Q A;  2QWW A;  3HRT A;  1E0E A;  4FAS D;  1D0Z A;  1FBQ A;  4KT6 A;  1SAN A;  3QPH A;  3KYD B;  4KT5 C;  3B6C A;  2KKO A;  1KU9 A;  2R5Y A;  3B6A A;  1XPX A;  3ESW B;  1WGX A;  3BCB A;  4EQQ A;  1QVU A;  4Y15 A;  2KFD A;  3WU2 C;  4A3J J;  2LOO A;  2OQR A;  1YJN I;  3WTX C;  5CKT A;  3PNT A;  2HVS A;  2RKH A;  2ADU A;  2GIZ A;  2NYX A;  5EZG A;  2PFB A;  3COA C;  1C0W A;  4IQ4 A;  2L5Q A;  3U21 A;  2XAF A;  2DAO A;  2Z2S B;  4PZJ A;  4XRS G;  2M8E A;  3J7Y J;  3RKY A;  3WE2 A;  3JTH A;  2KIF A;  4L9N A;  1W5T A;  4PFO A;  3ZQ7 A;  5BMZ A;  3I3L A;  4M6Y A;  2V9V A;  1PDN C;  3BC8 A;  3ZQF A;  3E97 A;  2JWT A;  1G6N A;  5J47 A;  1XS9 A;  3MKY B;  4MHG A;  2BY0 A;  2ECB A;  4GO1 A;  4HX8 A;  3J80 Z;  2EFW A;  2ZXI A;  3FK6 A;  3CJT B;  2COB A;  1ETO A;  1QO0 D;  2LYC A;  4B8X A;  3I56 I;  2MGQ A;  3CC7 I;  2JRT A;  3BQY A;  2FML A;  5DUK A;  4QWQ A;  4AVP A;  4L18 B;  5LGT A;  1HW2 A;  2HKO A;  3VSL A;  1X1C A;  3GYH X;  3CF5 F;  2NVQ J;  2ISY A;  1VQK I;  2CUE A;  3S3N A;  1ZG1 A;  2HDW A;  2VXZ A;  2DN0 A;  3TED A;  3T8R A;  2Y69 H;  2CH0 A;  1FT9 A;  2BYV E;  2E19 A;  2EIL H;  3KYL A;  4CYD A;  4UVA A;  3DEW A;  1WRJ A;  2K4B A;  4AIK A;  1BN5 A;  4MEY F;  3ZMD A;  2L7K A;  2DLL A;  1BL0 A;  3OS0 A;  2KHM A;  2L4M A;  3I58 A;  5JHF A;  5LHI A;  3SQN A;  3GTO J;  1T56 A;  1P4A A;  3V8J A;  1FYL A;  2XDV A;  4XKB A;  2OJE D;  5HS7 A;  3W2W A;  1W7P B;  3FHN A;  4UVC A;  3UNG C;  3PO3 J;  2WAE A;  2F5F A;  1VI0 A;  1WVR A;  2GIV A;  3GW2 A;  4XKC A;  1RNL A;  3B73 A;  5HNF A;  3VSK A;  3K2A A;  4JYK A;  5HDK A;  4I01 A;  4KIB A;  2VJ5 A;  3K4B A;  1AOY A;  4F92 B;  4Y52 J;  4A0Z A;  3BJA A;  3KLO A;  3S2W A;  4A12 A;  3CCM I;  1K78 B;  2R7X A;  4HX7 A;  2EQR A;  3DKW A;  3GWZ A;  1S7E A;  3I53 A;  1TWC J;  4HPQ A;  4M9S A;  1BJA A;  2XUB A;  2M1B A;  3LSG A;  4U0W A;  2M30 A;  5EEA A;  3ELK A;  4IQJ A;  2VT2 A;  2V7F A;  4HLX A;  3GFI A;  4ZYG A;  5E3L A;  1TTY A;  2G7U A;  1SMT A;  2DA4 A;  3LQR A;  1MJB A;  5C4J J;  3ERE D;  4XMY A;  2V9P A;  4MQ9 F;  4I99 C;  3JRB A;  1RUO A;  3WHC A;  5K1Y A;  1R36 A;  4XLP F;  2QSG X;  2R5Y B;  2DA1 A;  3BTL A;  4FX4 A;  3RKW A;  5IYC J;  4U0V A;  2ESN A;  2K40 A;  3S3M A;  3BOQ A;  1ETY A;  3QPS A;  1OYI A;  2MA3 A;  5B3S H;  4AYB A;  4M73 A;  1Q1V A;  5JVG F;  4N4N B;  5D5X B;  4DNC A;  3I4P A;  1VQL I;  4XOT A;  2DA6 A;  2XIG A;  3FDY A;  3H36 A;  3SFI A;  2LY2 A;  2XAQ A;  4IPA A;  3BG7 A;  3TP0 A;  3ZQQ A;  4DYR A;  2KDZ A;  1FSH A;  5AIP A;  1VF9 A;  1MD0 A;  4EGZ A;  1YI2 I;  3LA3 A;  1F9N A;  3MKW B;  3C7J A;  3SDB A;  2D1H A;  3EUA A;  1K7A A;  1O3T A;  3TDZ C;  2JVG A;  5IP7 J;  2IGK A;  4GCV A;  5EJC A;  3H0D A;  3F6O A;  3M4O J;  3CCE I;  3EYY A;  4ASN A;  2MC3 A;  1HSJ A;  1ZHF A;  2F4O B;  2EV0 A;  2IEK A;  4XN3 A;  3CUQ C;  1YS7 A;  2DQR A;  2NVX J;  3L2W A;  1D8J A;  5F0F A;  4C2T A;  4Q48 A;  4NB5 A;  4C9Y A;  3JRA A;  4F55 A;  3WTZ A;  2AO9 A;  2HNH A;  2RV8 A;  4LLL A;  4DYC A;  3R60 A;  4C30 A;  5HOD A;  1JE8 A;  3FM5 A;  2JA6 J;  2IBD A;  4HYE A;  2IGM A;  1REP C;  3M8J A;  2VON A;  3WTT C;  1OYY A;  1W0U A;  3L00 A;  4FTH A;  4CCJ A;  2FNP A;  2K4J A;  3HKZ N;  1R1V A;  1YYV A;  2BXZ A;  3DPT A;  3QYF A;  5H20 A;  4ZYE A;  4Q4Z F;  3JTG A;  4U0Y A;  3K1N A;  4AC0 A;  1D0X A;  3F8B A;  3DBR B;  2LRD A;  4BXU A;  1PUF B;  1B4A A;  3KEY A;  2VKH A;  4XLA A;  3KLN A;  1YE9 A;  2L3D A;  1ZR4 A;  4PSX A;  3A01 B;  4OMZ A;  2ZXJ A;  3KEQ A;  1HQC A;  2NVU B;  3Q0U A;  3K70 D;  1OCR H;  1BW5 A;  2PMH A;  4IF4 A;  4XLH A;  4A5M A;  3K7A J;  1Y1V J;  1WFX A;  1PP7 U;  2LD5 A;  1OCC H;  2TCT A;  2D5V A;  1IDZ A;  3RPQ A;  1YIO A;  3OSG A;  3AL0 C;  5AIQ A;  1HCR A;  2JTV A;  4I7H A;  5CQG A;  2F5V A;  1M1E B;  3PUB A;  3ZN1 A;  4GFB A;  5ILS A;  3V7R A;  4A6D A;  1ACI A;  1W5S A;  1XDS A;  2VXD A;  1R1T A;  3K4N A;  1BIA A;  1Z21 A;  1J2X A;  4O3M A;  2CUZ A;  2X9D A;  3OYI A;  1Z7U A;  3E6B A;  2IS2 A;  2Z3Y A;  4L9T A;  3T8T A;  1OKR A;  3OR1 C;  2ZJP F;  2K3F A;  3ZMT A;  1JUS A;  1VQM I;  1QGP A;  2TRT A;  1TNT A;  1XD7 A;  4BE0 A;  2ELJ A;  5M5X J;  5IT9 K;  1ORK A;  1OCP A;  2ETH A;  2O61 A;  1XGS A;  1WJC A;  1X1B A;  1WH5 A;  1Z0X A;  2R7R A;  2MLK A;  1MJ9 A;  5IY5 H;  1U0J A;  1P9Q C;  1Y6I A;  2E7X A;  3IL2 A;  1K4S A;  2VI6 A;  1U3E M;  1KQ0 A;  5F1J A;  3S17 J;  4KN4 X;  3O8G A;  2GOM A;  3H0G J;  5FRN A;  4L5I A;  3TDU C;  5BOX A;  4YEJ A;  3FF5 A;  2OTL I;  4HQM A;  1X1D A;  4I98 B;  3HRU A;  4IOC F;  3JAM K;  2LR8 A;  2JA7 J;  2VL8 A;  3EUK L;  3GFM A;  3K10 A;  1OR7 C;  1JXS A;  5J6X A;  1FSE A;  1FX7 A;  2PG4 A;  2JA5 J;  3PIP F;  5JFR A;  1P2F A;  3BZC A;  3ERM A;  1BIB A;  1R23 A;  4LK1 F;  1OJL A;  2IJL A;  1RZ4 A;  3HOU J;  3HTS B;  2DMU A;  4RB1 A;  4EAT A;  2CV1 A;  5E3M A;  3ECO A;  4UB8 C;  3JRI A;  2WAF A;  4R79 A;  3F8M A;  1RC9 A;  4BYY A;  1F1Z A;  1X4O A;  3EUH C;  2DYR H;  3OY9 A;  4PJ0 C;  1FOY A;  3MCZ A;  1MBK A;  2CW8 A;  3HOS A;  3MAJ A;  2C6Y A;  1FBS A;  2NNY A;  2CWE A;  5J1U A;  3BDD A;  4IJA A;  3LAP A;  1XMA A;  2L9V A;  1SFU A;  4E7S A;  3W6K B;  1TLH B;  2Q2E B;  4KIG A;  4HEA 2;  5M3F J;  4EEF G;  3K69 A;  3I9V 2;  1X19 A;  2DK8 A;  3FXR A;  2HQ5 A;  4ZDO A;  3FBN B;  3IV5 A;  1VQ8 I;  4ON0 A;  1IZ1 A;  4JX5 A;  1MNE A;  2DA2 A;  4D1Q A;  2PJR A;  2VKV A;  3CCR I;  4BHC A;  1V5F A;  2WV1 A;  1B8I A;  4GRI A;  3S93 A;  3OYE A;  1UAA A;  5FLX K;  1HXD A;  2DXI A;  1IN4 A;  1MIJ A;  1G59 A;  2RN7 A;  1L3L A;  4A3B J;  2O6G E;  4YFX F;  4KJZ A;  1IW7 F;  1R7J A;  3DU6 A;  1IN5 A;  3RTR A;  1OIS A;  5BQT A;  1MMN A;  2CQQ A;  3HYI A;  2EIK H;  4E7H A;  3J81 Z;  1R49 A;  3S14 J;  2RGV A;  5M5Y J;  2KIS A;  3D5S C;  5TIS C;  2LF8 A;  4YFK F;  4F93 B;  5IT9 Z;  4HLY A;  4XN0 A;  5LBQ A;  3TGN A;  4G9Y A;  3JRE A;  1LEB A;  3W6J B;  1IDY A;  2ZO4 A;  3SZG A;  3KEO A;  2BY3 A;  3BG6 A;  2VPL A;  3VPR A;  4O5V A;  2RNJ A;  2DA3 A;  3I0T A;  1NHA A;  2HYJ A;  1HKT A;  3LOC A;  4ZYD A;  2M7A A;  4MFD A;  3ZQG A;  2CO5 A;  2OPT A;  2PMZ N;  2YX7 A;  1BOA A;  3HBL A;  3RDI A;  5HLG A;  3UKG A;  3HDD A;  4W97 A;  1FOW A;  4E7K A;  1U6G A;  2ZNY A;  3L2R A;  2LTP A;  1WQ2 A;  1R4M B;  3F6V A;  4V2G A;  3FXL A;  3HGY A;  4BAY A;  3JAM Z;  2X6O A;  1T6S A;  3ABK H;  2WV0 A;  1HC8 A;  4HBL A;  3LAJ A;  3SZT A;  2M5W A;  2EIM H;  3NEU A;  3PQJ A;  5CVJ A;  3BG9 A;  3BR0 A;  2X1D A;  5GPA A;  4NBQ A;  4BQN A;  1Z67 A;  2F5D A;  2JUG A;  3QP5 A;  1HW5 A;  3W2A A;  2J5P A;  3JRH A;  4EJU A;  2IPQ X;  2K9N A;  1HLV A;  1ZAO A;  3DKX A;  1S72 I;  2AS5 F;  2O5R A;  3A4C A;  5EEH A;  2VJ4 A;  1OYW A;  1MDM B;  3GBG A;  1R00 A;  2DOD A;  4QPQ A;  5H6Q A;  2FQ4 A;  2QUF A;  1MBJ A;  3ABM H;  3P9C A;  5DCM B;  4U7B A;  5D5V B;  3DEU A;  1ZGA A;  2R7O A;  4S05 A;  5FFX A;  2E7W A;  5B1A H;  4NC7 A;  3M07 A;  4KNY A;  4YG2 F;  3OL4 A;  1DU0 A;  3NAR A;  4CO8 A;  1XG1 A;  2ELK A;  1TZL A;  3PFI A;  4RBO A;  3IRR A;  3S2H J;  5BPD A;  4AVZ A;  4AYB N;  1AHD P;  1POG A;  4GGG A;  1GT0 C;  3NQO A;  1VQ9 I;  4FET A;  4LB6 B;  3E3V A;  3T5X A;  2ZBK A;  3MEX A;  2XAU A;  1J75 A;  2M8G X;  2IGO A;  2F5E A;  2B9S A;  2XGD A;  2OAZ A;  2HI3 A;  2VB6 A;  4M3B A;  5J4Y A;  2AXL A;  4NC8 A;  4H4K C;  1GXQ A;  3AG4 H;  1MNM C;  1A6Q A;  3IRQ A;  1J9I A;  1PVE A;  3GTQ J;  4AWX B;  2EH3 A;  3HPH A;  3HTU A;  4I02 A;  3R6S A;  2JN6 A;  3CLO A;  2ZB9 A;  2ID6 A;  5GTH C;  4RM3 A;  3S3O A;  2H1L A;  1I5Z A;  3EPZ A;  1ZLK A;  2DMP A;  3TL4 X;  2DPU A;  1N75 A;  2Y0M A;  2CV0 A;  2ZNZ A;  1HKQ A;  2EK5 A;  3PL8 A;  3HOX J;  1KON A;  2IA0 A;  4HDU A;  2X1E A;  1XSV A;  1IUF A;  3GZ5 A;  4D7M A;  1NG6 A;  3M3Y J;  3H5N A;  4WK8 F;  1RI7 A;  3MVP A;  4RLQ A;  2PJR B;  1VND A;  4CGZ A;  3VEP A;  4AIH A;  4I0B A;  4AID A;  1OR7 A;  3TW6 A;  3HKZ A;  2BVM A;  4QTR A;  2FJ1 A;  4XNF A;  2ZME B;  5D6E A;  2BW3 B;  2ECC A;  3ZR8 X;  2FMY A;  1BR2 A;  4HAM A;  3LSJ A;  3HSF A;  1T2K A;  1H9G A;  2WWY A;  4A3L J;  4F52 A;  1ZRE A;  2CSO A;  1DU6 A;  1SC7 A;  3BR3 A;  5E1X A;  4XQF A;  3LSR A;  4WXD A;  3CMM A;  1ENH A;  1P4W A;  1RKW A;  1LVK A;  3ZOB A;  3DQV C;  3L1P A;  1B72 B;  4KMF A;  2JMW A;  3OIQ A;  5K7H A;  4J00 A;  2G7H A;  3PUF A;  2E1M B;  2L02 A;  1T33 A;  4LIV A;  2LVS A;  4IHV A;  2ME0 A;  1BJZ A;  2ZSH B;  1O3Q A;  1ON1 A;  1WHU A;  3JSO A;  3K70 C;  4A3F J;  3GLL A;  3IUO A;  1D5V A;  5J1R A;  4B48 A;  3DCF A;  4M6V A;  4WXH A;  4A3G J;  2O0Y A;  4IKF A;  4X0G A;  2VE9 A;  3CF2 A;  1BW6 A;  1KU2 A;  1I1G A;  2O3F A;  3MWM A;  5FKK A;  4RGU A;  5GAG J;  1S9H A;  1X2M A;  2CFO A;  5F6F A;  5FKM A;  4JX6 A;  3WG9 A;  3OOP A;  1OCZ H;  4LIT A;  3WOD F;  3E6M A;  1CQT A;  2F4M B;  2FBI A;  3O2P E;  1ZRF A;  4I2O A;  1W7P A;  1D8K A;  5JLX A;  3TOB A;  3BR6 A;  1LDD A;  1O4X A;  2DTZ A;  1EJ9 A;  3GF2 A;  4ZDP A;  2CU7 A;  2VBW A;  3ZXS A;  1Z3Y A;  4GDF A;  2LRE A;  4HA8 A;  3LFK A;  3ECH A;  4F3Q A;  5E18 F;  2IXS A;  2XHK A;  4PJM A;  3DF8 A;  1JT0 A;  3N05 A;  1ZYR F;  1TWH J;  5F08 A;  2DT6 A;  3LL7 A;  1QZE A;  3S1R J;  1SAU A;  2VJI A;  3E5X A;  1MH3 A;  1RES A;  2QEN A;  1T8I A;  4MFE A;  3Q9V A;  2PX9 A;  2OZU A;  3KX2 A;  4G6Q A;  1KU3 A;  3NRV A;  2UXN A;  3QOP A;  1I50 J;  3TW7 A;  4KUM A;  5CQE A;  3DTI A;  2UZK A;  5J8C A;  4JX4 A;  2XF5 A;  3P9I A;  3E5U A;  4RDU A;  4MEX F;  3RZD J;  4P9U A;  1CGP A;  2M45 A;  3PQK A;  4CIC A;  4CUG A;  2B63 J;  2DCE A;  1X4P A;  2VBY A;  2MG4 A;  3MKZ A;  1BR1 A;  3H9G A;  3QPL A;  5C44 J;  2E2J J;  4IXA A;  2A61 A;  3OYM A;  1JTX A;  2ELH A;  2HPM A;  3CUO A;  1HKS A;  5GTI C;  2DFE A;  1E3H A;  2VAS A;  3G73 A;  2KPM A;  2FBK A;  3I64 A;  1LEA A;  5IYB J;  4OOI A;  1YOV B;  4A3C J;  1BR4 A;  2D2W A;  4GYI A;  1XN7 A;  3RPU A;  1O57 A;  5A2Q Z;  5HNH A;  4XLC A;  1IGN A;  4MIM A;  2DOF A;  4MO7 A;  1MBE A;  4RAG A;  3QAH A;  4CZZ A;  1IN7 A;  3FBI B;  2BVL A;  2WA0 A;  2V4J C;  1H9T A;  3QPT A;  3EDP A;  2CW7 A;  2KRF A;  2DQL A;  2W4S A;  2G0E A;  3OYK A;  2XPV A;  2GA1 A;  2XGC A;  2JK3 A;  5EDN A;  3K6G A;  1K61 A;  1DUX C;  3IH3 A;  2FNA A;  3H5R A;  4L5E A;  3F8F A;  4RB3 C;  2W48 A;  3BCA A;  4BS9 A;  3S15 J;  4NNJ A;  2YU9 J;  2MW8 A;  2GXG A;  3BTI A;  4II2 A;  5EEG A;  1UHW A;  5KK1 A;  3BZ6 A;  5CVU A;  1U8R A;  4G7O F;  5K5O A;  3CJQ B;  5GAH J;  3OIO A;  1IO2 A;  3S1M J;  1TWA J;  3LWF A;  2W7N A;  2M0C A;  2Y9Y A;  1LJ9 A;  3M7G A;  1B59 A;  1W7P D;  1RET A;  2DMT A;  1O7L A;  5CVR A;  4DW6 A;  2A3S A;  3A0B C;  3S1N J;  4D5C A;  2IS6 A;  3KZI C;  5LD2 C;  3DFG A;  2R0Q C;  1H8A C;  2V1D A;  2XF6 A;  3H1C A;  3KP6 A;  1UZC A;  2NVT J;  1XCV A;  1YRN A;  2XVC A;  4HV6 A;  3KP4 A;  1LB2 A;  2F48 A;  4CCN A;  2W84 A;  3RYP A;  1DP3 A;  4IO9 F;  1WWX A;  3OYC A;  2CV2 A;  3GTL J;  4BNC A;  1PUF A;  1S8N A;  1S29 A;  2EPF A;  3CDI A;  2PMZ A;  2HR3 A;  1MJA A;  3RI4 A;  2A6H F;  3A01 A;  1ZEL A;  2VOD A;  2DK5 A;  1VQ5 I;  1EV7 A;  4AUX A;  2YR2 A;  4L9V A;  4E70 A;  4J19 A;  1Z9C A;  3MMY B;  3BQZ A;  4XLN F;  5JVT A;  4YRV A;  5FGM A;  5E1W A;  2DFF A;  2O9L A;  3RIR A;  1SEU A;  3QQA A;  4YIF A;  2E35 A;  5J40 A;  2R7S A;  4C3H J;  5C4X J;  2FRH A;  2B0L A;  4BBR J;  2HQN A;  2VQC A;  1ZGW A;  4PJN A;  1AWC A;  3GFL A;  1MBF A;  1X3Z B;  3IP4 B;  5K5R A;  3HPG A;  2VN2 A;  3K1M A;  2VLA A;  4EM0 B;  5IOZ A;  3S32 A;  4FCY A;  3WU0 A;  4XID A;  1B6A A;  1IRZ A;  1R22 A;  1Y0N A;  3F23 A;  3OS2 A;  3M8E A;  2OV7 A;  3DXJ F;  2XB5 A;  3S2D J;  1ULY A;  3HRM A;  4Z2Y A;  4ZZL A;  2LKX A;  1SD5 A;  4BKX A;  1Q1H A;  2E2H J;  1ERD A;  2BEO A;  1ZTR A;  3A1Y A;  3RPU D;  3H9J A;  1XMK A;  5HOO A;  2ESH A;  2HFH A;  2RC4 A;  2BGC A;  3OYF A;  3FKI J;  1DDN A;  1TBX A;  1OLT A;  4LOC A;  1E2X A;  1T38 A;  3KYC B;  3MZY A;  4B09 A;  4A3I J;  3KP5 A;  4F7Z A;  3CO7 C;  2E71 A;  4XOR A;  4M9X A;  2ACJ A;  5FLV A;  3GTP J;  4CH7 A;  1U2W A;  3GFJ A;  1Z7L A;  1EF4 A;  3PSI A;  4ESB A;  1LUJ B;  4RAZ A;  3K9T A;  3GXO A;  4ITV A;  1VTN C;  5HDN A;  5FKO A;  2LDU A;  2V6E A;  1XCB A;  1HDD C;  4HF1 A;  1R58 A;  2VKE A;  4BEH A;  3BT9 A;  4XBF A;  4XSX F;  3DU5 A;  5H2F C;  5F0H A;  1Y56 A;  4P96 A;  2W1O A;  1I3A A;  2VJJ A;  2EJR A;  1LQ1 A;  2A07 F;  1FYK A;  4AU7 A;  3GX4 X;  2X4H A;  5E3O A;  4XLF A;  1IXR C;  2COM A;  3QU6 A;  3GEZ A;  2XAJ A;  1WJA A;  2L9N A;  3MQ0 A;  3SJM A;  1UHM A;  5ICG A;  1DPR A;  5EF6 A;  2Z33 A;  4BE2 A;  2AXT C;  1J5Y A;  2JSP A;  4IRG A;  1V54 H;  2OZ6 A;  1MMS A;  1TQP A;  3H35 A;  5ED4 A;  1TQI A;  2E1M C;  4LB5 A;  4V19 K;  2FU4 A;  4NQW A;  3AG2 H;  3ZRG A;  3BRO A;  3OSF A;  2CQ7 A;  3M1E A;  5D8K B;  2TDX A;  3EET A;  2HTJ A;  3CCS I;  5HVQ C;  2NS0 A;  4S0H B;  3OYA A;  4LJZ F;  3CCV I;  2QA4 I;  1A31 A;  2Q2E A;  1QZZ A;  1GVJ A;  3A02 A;  5EZH A;  1ZN2 A;  1YRN B;  3TO6 A;  3LSH A;  2H6C A;  3IWZ A;  1WJF A;  4QLC U;  2UXX A;  4PGG A;  5K5Q A;  3LA2 A;  2M4K A;  4WCG A;  1QPM A;  2V26 A;  5GAD J;  3DKY A;  3U9G A;  1JGG A;  2HVR A;  2DBB A;  4FT8 A;  2QCO A;  3ABL H;  1Z6T A;  1WI3 A;  2RVC A;  3MKL A;  1XSD A;  3FM3 A;  2R5Z A;  1PUE E;  1BA5 A;  1R1U A;  4AD9 A;  4KYW A;  2ZCW A;  3N4M A;  3QP6 A;  4B47 A;  3HZJ A;  3DV8 A;  4Y13 A;  1YW7 A;  3E0J B;  4CXF A;  4RGR A;  4WWC A;  1RUN A;  2L54 A;  3WTW C;  1Z05 A;  1GUU A;  4IVN A;  1Y0U A;  3F72 A;  5LLQ A;  3LST A;  2E5N A;  2FBH A;  4UB6 C;  2QZ8 A;  2XRN A;  2PBI A;  5E17 F;  2HYF A;  1BOB A;  1YLF A;  1UG2 A;  2OCE A;  3NWT A;  3ZQI A;  2BBY A;  3TP3 A;  3CTA A;  1NK2 P;  1FTT A;  1FMV A;  2Z9O A;  3P5J A;  2MC4 A;  1FIP A;  1YW8 A;  3GCM A;  5ICE A;  2OQG A;  5DM7 F;  2I5U A;  3HXL A;  5CLS A;  4X1E A;  4YII A;  3OR2 C;  4CCK A;  2QYO A;  3EYI A;  4U87 A;  2L4A A;  2JA2 A;  1D1A A;  2F4I A;  1LE8 B;  1IXC A;  1Y39 A;  3VB2 A;  1JKR C;  2BY2 A;  4IHX A;  2JVH A;  3VFZ A;  3SYT A;  3RSN A;  3SDG A;  4KDP A;  3KP7 A;  4BY1 J;  4JK1 X;  2HVQ A;  3ZPL A;  3BG3 A;  2ZXH A;  1EH6 A;  1A04 A;  1YIJ I;  1UG0 A;  2WB1 N;  2IGN A;  4NDL A;  3H3V K;  3DP7 A;  1P92 A;  1R5I D;  1X3W B;  4G6D A;  4LG0 A;  4BEH B;  1TL8 A;  1MDM A;  2QKM B;  1X3U A;  1TP4 A;  2E60 A;  3K4L A;  5D4R A;  4Y7N J;  1ITY A;  5DCM A;  3SEZ A;  4EJV A;  2W25 A;  4RM2 A;  2OTJ I;  2PQ8 A;  1ZK8 A;  5D4S A;  2EZI A;  2R7V A;  4A3D J;  2M87 A;  1JKP C;  1MMD A;  2DW4 A;  3HOV J;  2F6C A;  1ZAR A;  1DQU A;  3IAS 2;  3HEF A;  3BR2 A;  4M3D A;  4BQO A;  2LNB A;  3U1K A;  1HST A;  1VFC A;  3ZMU A;  1JTY A;  4NQW B;  4N9H A;  4UUS A;  4A6E A;  2VT3 A;  3JSP A;  1KA8 A;  5KCM A;  3OOU A;  3HOZ J;  4LD5 A;  3JW4 A;  2XPW A;  2STT A;  4Y33 A;  3RJP A;  3PIO F;  1YG2 A;  3VYS B;  4FX0 A;  3QOE A;  2AQE A;  4CHU A;  5CVV A;  1JT6 A;  4MTE A;  4UXN A;  2XGE A;  1U9O A;  1SFX A;  2BE5 F;  2OA4 A;  2M9H A;  3DBH B;  4RAY A;  4DGW B;  3P9K A;  5LRS A;  4EGY A;  3GTM J;  4TV7 A;  2RRE A;  3CDL A;  4E7J A;  3WGG A;  2UWM A;  1T0F C;  3EQL F;  2EWN A;  2XV4 S;  2KDO A;  2L0K A;  1GVD A;  5EG0 A;  4B44 A;  3Q0W A;  2R5Z B;  1Y1W J;  2WBM A;  2ZME A;  2VBX A;  2BW3 A;  2V1N A;  4RGS A;  3OS1 A;  5BPI A;  3LSP A;  2A68 F;  2LKS A;  4ZTJ A;  3IH2 A;  2ICW G;  3DTK A;  2YX4 A;  2KQR A;  2RNG A;  5FJ8 J;  1XMX A;  2E5Z A;  1RKT A;  4OU0 A;  2A6T A;  3H3U A;  3CO6 C;  2FE3 A;  2V1X A;  1B72 A;  3BR1 A;  4U88 A;  4BXX J;  1ONV A;  1SVL A;  3V42 A;  2Z16 A;  5CVI A;  4NHJ A;  3C2G A;  4F91 B;  4E6K G;  1XGN A;  2QKL B;  1Z1D A;  5LEK A;  2MD5 A;  2W24 A;  4NUB A;  2YU3 A;  5IT3 A;  3CDH A;  1P4X A;  5FFZ A;  4ANJ A;  1MMA A;  2Y31 A;  5CPR B;  5ILV A;  3MZH A;  3IAM 2;  3QYB A;  1W36 D;  1R5G A;  2W00 A;  4RA2 A;  4Y3O A;  4XKV A;  1JHF A;  3B02 A;  2M2E A;  2NRA C;  4BAC A;  2K7L A;  3QU3 A;  2HZD A;  5B66 C;  2MYS A;  3ZQL A;  1K79 A;  2CG4 A;  3CJR B;  1ZR2 A;  4P9F A;  3QRF F;  4YEL A;  3VYT B;  2P6T A;  5H6R A;  3HUG A;  4MTD A;  3J7A O;  2XB0 X;  1VQN I;  2OD5 A;  1PP8 F;  3QOD A;  4UY8 I;  3BPX A;  2V1U A;  2JZY A;  4UV9 A;  1FYM A;  2PEX A;  5FKN A;  2H09 A;  1O7F A;  1FIA A;  4JOM A;  2GBY A;  1U5T A;  2PJP A;  1WJE A;  3F3X A;  4LG0 B;  5FRM A;  1WJB A;  2ZC2 A;  1X1A A;  4IHS A;  2L01 A;  2DI3 A;  1JUM A;  2VBZ A;  2WC2 A;  4I0A A;  4OWR B;  2F5C A;  3CMA I;  1QQI A;  1YX5 A;  2Y48 A;  1GHC A;  3HSR A;  1UMQ A;  2BHY A;  2JSC A;  1CF7 A;  1QHH D;  4Y17 A;  3WGI A;  3FZV A;  4JQF A;  2P7C B;  3M8F A;  3ZP5 A;  5DUI A;  5HLI A;  4RB0 A;  4DBR A;  4OIP F;  3FX3 A;  2R7Z J;  2GXB A;  1J0R A;  1BI2 A;  3SZP A;  2CMP A;  4OIQ F;  4UUS B;  3FIW A;  2WTE A;  1S7O A;  2P5K A;  3ASN H;  3V4G A;  1V5G A;  4MLO A;  1XGO A;  3BG5 A;  4IRH A;  5FLX Z;  2DFH A;  3FXO A;  3R4K A;  4AIJ A;  5HDG A;  1FTZ A;  2I8D A;  4EM1 A;  1EH7 A;  4BHB A;  4BQQ A;  2QSF X;  1DGW Y;  3BWG A;  1GDT A;  5KHD A;  1QRY A;  5D8L B;  4GYG A;  4UVB A;  2NAZ A;  1WJ5 A;  5E1Z B;  5LRR A;  3WTS C;  5FRO A;  1YX3 A;  2FXA A;  3MN2 A;  3VWB A;  3KZY A;  1IUY A;  1SD7 A;  5EG0 B;  3FMQ A;  3L9F A;  3DEE A;  5DEQ A;  4B43 A;  1ZLJ A;  4HDV A;  4I6Z A;  4BE1 A;  3A0H C;  4LLG F;  3DBL B;  3J7A Y;  4U7D A;  3CCU I;  3HSE A;  4BJ5 C;  3JRF A;  2JT1 A;  1SD6 A;  5FD6 A;  2YUS A;  1OFC X;  2ZFU A;  3C2H A;  5M3M J;  5AON A;  3FWE A;  3NAU A;  2DDA A;  2W57 A;  3R0J A;  3ZMV A;  2PLY A;  3LSI A;  4L0Y B;  1FPQ A;  5ICC A;  3L2V A;  3AFH A;  2VC0 A;  2NVY J;  4M74 A;  1HOM A;  1XDU A;  1ODD A;  3KCC A;  4KIC A;  2QQA A;  3REO A;  3U2R A;  5JI6 A;  2P4W A;  3IKT A;  1KYZ A;  2W82 A;  2O8X A;  2BY1 A;  1BC8 C;  2EBI A;  2OU2 A;  2HGC A;  1K6O A;  2GXA A;  4X6A J;  4FIS A;  5ICF A;  4LMY A;  4MQV A;  3O6B B;  4CYC A;  3CQZ J;  3CUQ B;  2YSR A;  1Z6R A;  1RR7 A;  1V3F A;  3V8K A;  1TW2 A;  1JUP A;  4RLF A;  4ZZD A;  3OYB A;  3CJN A;  4HV5 A;  4CSW A;  1J59 A;  2RQQ A;  3X2Q H;  2E1N A;  3J80 K;  1T0F A;  3BTJ A;  3LNQ A;  1ZG3 A;  4E7I A;  3GVA A;  4QIW N;  4UHT A;  3GUD A;  3HUG B;  4HSR A;  4O6J A;  3W3C A;  3WHB A;  3G4S I;  3HM5 A;  3A03 A;  3E7L A;  2CUF A;  2Z99 A;  1YW9 A;  5DM6 F;  1TWF J;  5ILU A;  1WJD A;  3C1D A;  2KLO A;  2JUC A;  4H0E A;  2EFO A;  3CC4 I;  4XOP A;  2VC1 A;  2BOL A;  4EM2 A;  4ZYH A;  1U5T B;  4D5F A;  3DPU A;  3TO7 A;  3ZMZ A;  2MFZ A;  4ABZ A;  2K02 A;  4QSH A;  4A3K J;  2GQQ A;  1I6H J;  3L7W A;  4PSW A;  3RCO A;  3WG7 H;  2L9R A;  1LFB A;  2WB1 A;  1ZH5 A;  3FHZ A;  2QBY A;  3FMR A;  1A6I A;  2Z5U A;  5HS8 A;  2DJN A;  3W2V A;  5KAF C;  2IRF G;  3RKQ A;  1Z3X A;  1CF7 B;  6PAX A;  2IS4 A;  2L2O A;  4IHT A;  1YJ9 I;  4BU2 A;  1XTA A;  3CCY A;  2XGX A;  1JJ8 C;  2NS7 A;  3CCQ I;  5GPC A;  2KJB A;  1KQ8 A;  1G4D A;  5K7F A;  1YJW I;  1WKM A;  4IHY A;  2LSO A;  5L3E A;  2Y2Z A;  5LHG A;  4ZC3 A;  2AQF A;  4II3 A;  3DTE A;  1F4K A;  1XSX A;  3E6D A;  4ENK A;  3TMO A;  3I71 A;  3V7C A;  2ID3 A;  2PMU A;  2ZJ2 A;  2FX0 A;  2EA2 A;  3PNV A;  1FP2 A;  1TNS A;  5E8I A;  9ANT A;  1P6R A;  1JI8 A;  4XM3 A;  2HEO A;  1G8X A;  4D7N A;  2DOE A;  1P7I A;  4HNU A;  3U1D A;  1P7J A;  4OIO F;  1HDP A;  4G12 A;  4XIC A;  1GV2 A;  1VQP I;  3C18 A;  1D0Y A;  1LFP A;  5IPA A;  2FUG 2;  1UCR A;  1YTY A;  2DPD A;  1ZG5 A;  5JLW A;  3BZK A;  3O8H A;  4BGD A;  2KP6 A;  3P7N A;  3QWL A;  3GZN B;  2LFB A;  4BJ6 C;  2RAE A;  1IG7 A;  1E3P A;  2WY7 Q;  4DOZ A;  1APL C;  2MH2 A;  4HF0 A;  2KJC A;  1QBJ A;  3VOD A;  2JPB A;  3GO5 A;  1B1B A;  5D6F A;  1SVM A;  3RQI A;  1ZQ3 P;  5D5U B;  3Q5F A;  2HOE A;  5CYV A;  4ZYA A;  3HB9 A;  1PYV A;  2H6B A;  1KGS A;  4N0B A;  4XSZ F;  1ZRD A;  2IS1 A;  4KMU X;  1S6L A;  2EIN H;  3V7S A;  2YS9 A;  1G2H A;  4D9J A;  4LG3 A;  1IRG A;  2CUJ A;  2WAQ N;  4IZZ A;  4CYC B;  3PNY A;  4Q47 A;  2A5Y B;  4D0P A;  2LK2 A;  4MNU A;  4N4O B;  4CDG A;  2LBF B;  3HHH A;  1IV8 A;  2OUM A;  3MD2 A;  2LKP A;  2QF7 A;  3I59 B;  1FY7 A;  1UB9 A;  3DPL C;  1MND A;  1YQA A;  3IH4 A;  2FD5 A;  3WTU C;  5DDG A;  1R4N B;  2FF4 A;  1W36 C;  5TRD A;  2HXO A;  3CC2 I;  1IC8 A;  1G3T A;  2R7Q A;  2HOT A;  4C2U A;  2R7T A;  1S5L C;  4YFN F;  4BDZ A;  2L7M P;  2DT5 A;  1G3Y A;  1MKM A;  1OMI A;  1JHH A;  4P1W A;  1VZ0 A;  2ISZ A;  1OCO H;  3F8N A;  3LSK A;  4NC6 A;  3S8P A;  4DYQ A;  2CRG A;  2DMQ A;  4HW0 A;  4B1R A;  4AM3 A;  4I76 A;  3Q9S A;  2CGP A;  1G3S A;  2K27 A;  2X85 A;  3WTV C;  5LHH A;  5BNG A;  2X1C A;  2QBY B;  3HHG A;  3HOY J;  3CME I;  3AG1 H;  3SHF A;  4ETS A;  1AU7 A;  3WGH A;  4UV8 A;  1WI9 A;  2X51 A;  3D5L A;  1W4M A;  3A2K A;  1GLN A;  2KIM A;  2ZKZ A;  4R1H A;  1OPC A;  3E5Q A;  3NWS A;  5E3N A;  4XRF A;  3C2B A;  2XPU A;  4EVI A;  4ZTF A;  1LKX A;  3OYG A;  2DA7 A;  2KMU A;  1FJL A;  3MZ8 A;  5JHU A;  1X58 A;  2IA2 A;  1UFM A;  1YIT I;  1LE8 A;  3BJO A;  3OYL A;  2J5O A;  3OYH A;  3ML6 A;  4BBS J;  4RB2 C;  3Q3S A;  5E20 A;  2PN6 A;  2ZXW H;  3DLL F;  4A93 J;  2FOK A;  1BBY A;  1ZGJ A;  4G7H F;  3G3Z A;  2OF7 A;  5F1R A;  1LDJ A;  3GTG J;  1IN6 A;  1ON2 A;  2FOW A;  4ENM A;  3W6V A;  3PSF A;  2NOJ B;  2L7Z A;  3BR5 A;  2LH9 A;  5LGN A;  1QNT A;  4FHT A;  2VQG A;  4UNO A;  3SXY A;  4A0X A;  4IOA F;  1D1C A;  2JRM A;  1RRJ A;  1FLI A;  5IP6 A;  2QM3 A;  1ETX A;  1ETV A;  3ZCO A;  3OYJ A;  5KVR A;  4HNV A;  2Q8K A;  1ZRC A;  3ASO H;  3K4K A;  5LFA A;  2H8W A;  4HST A;  3L2C A;  2IT0 A;  1W1W E;  2I10 A;  2ZME C;  4PJJ A;  2K85 A;  2V6C A;  4E4H A;  2OBP A;  4J01 A;  1NTC A;  5HS9 A;  1BI1 A;  4XKW A;  4L9J A;  4A2U A;  2HKX A;  2LLK A;  4KFC A;  1ZKG A;  2DTR A;  4GXO A;  2GA2 A;  5EYR A;  3D1N I;  4ENN A;  2Z1D A;  3RYR A;  3S1Q J;  1TQM A;  3KPH A;  2EZK A;  2R7F A;  2O8K A;  3FK7 A;  2DYS H;  4HZF A;  2M34 A;  1U9N A;  3F22 A;  5B1B H;  3KE2 A;  2DDB A;  2X6W A;  5TJJ A;  3OIP A;  2R7D A;  1YS6 A;  2IVM A;  3K2Z A;  1O3R A;  2E1C A;  2EV6 A;  1A5J A;  3CES A;  2WY8 Q;  1J09 A;  2STW A;  1WPK A;  2ZSI B;  1FZP B;  2P7V B;  2GOX B;  4IRI A;  4ESJ A;  2HDD A;  1FMW A;  1KQ9 A;  4Z6Y A;  4EMS A;  1DGR M;  4DIQ A;  2CW0 F;  2X6Y A;  1IAW A;  3OMY A;  2DMN A;  1T95 A;  1V55 H;  3ISP A;  2LC2 A;  1YFH A;  4KIF A;  2M0M A;  2A5W A;  4EV0 A;  1NG7 A;  2DA5 A;  1TC3 C;  2A05 A;  1MBG A;  2EV5 A;  2R4G A;  3L09 A;  4UUV A;  1U5T C;  3CLQ A;  2M7B A;  1Z77 A;  4BHP A;  2XAH A;  4MGR A;  1WSU A;  1IV6 A;  2IA1 A;  1W0T A;  2CQX A;  3T1B A;  5IYD J;  2QQ9 A;  3L2U A;  1OCT C;  2UUZ A;  2VOO A;  2MLG A;  4PJL A;  2KIU A;  2VQH A;  1U78 A;  2Q1Z B;  2HZT A;  3PO2 J;  2JQ7 A;  3AG3 H;  1YHQ I;  2HS5 A;  3LA7 A;  2R92 J;  3F21 A;  2P8T A;  2P5L C;  1YO5 C;  1IRX A;  4C2M J;  3OV8 A;  3JRC A;  2MD0 A;  2K9S A;  2Q0O A;  3FXQ A;  1R71 A;  3SFZ A;  2BV6 A;  2G9W A;  5EGO A;  1V4R A;  4XRS A;  2VIX A;  5L3D A;  3AAF A;  3TKY A;  4CCO A;  1EH8 A;  5L3C A;  1X2N A;  2XKP A;  2GLO A;  1WZ2 A;  1FOK A;  4IL6 C;  3HL2 A;  1O3S A;  5KNL A;  4ZH4 F;  4M3G A;  3M9A A;  3V8L A;  2V9K A;  2F2E A;  5DV5 A;  3L2Q A;  4HRI A;  1FP1 D;  2K3P A;  2VUM J;  1XC5 A;  4M72 A;  3RKX A;  2CYY A;  4BUP A;  3J81 K;  3G1O A;  2P0W A;  1G3W A;  3FXK A;  2YPR A;  2MSY A;  2VOP A;  4Y4R A;  5FO5 A;  3JRD A;  4B4C A;  3RZO J;  2LY9 A;  2BXY A;  2LF7 A;  1RIO H;  1SFK A;  1HA8 A;  1STZ A;  4EJW A;  4PDK A;  1MH4 A;  4E7Z A;  2Y0S N;  4ENJ A;  5FB2 A;  2KL4 A;  3G6E I;  1HW1 A;  3E1S A;  1WCM J;  2B7E A;  3LFU A;  1LPQ A;  3ABU A;  3H92 A;  2XAS A;  1K4T A;  1FNN A;  2A6E F;  4M71 A;  3T0Y A;  3WU1 B;  1N25 A;  3LSM A;  3I4N J;  3IC7 A;  5FLM J;  2DU9 A;  1JGS A;  2QGU A;  1QU3 A;  3GME A;  3K4J A;  2H8R A;  3ONQ A;  4L5J A;  3K4M A;  1I6X A;  1H0M A;  3HGG A;  3VYR B;  2QLZ A;  4OAY A;  4DBQ A;  4HOB A;  2QQ8 A;  3D5R C;  2IP2 A;  3CCL I;  2CFX A;  4BY7 J;  1HF0 A;  3ZQH A;  3N97 A;  2HTS A;  3PFY A;  2L9S A;  4N9I A;  4S04 A;  3I55 I;  2XRO A;  3CCJ I;  1N77 A;  4EJT A;  4RS8 A;  1VQ4 I;  5L3B A;  1ETQ A;  4HG2 A;  2KIQ A;  3F9K A;  2GM4 A;  2R7U A;  1RR8 C;  2M3A A;  2O7O A;  2MH9 A;  1IN8 A;  1Z91 A;  3OL3 A;  1A35 A;  3TBI A;  1MMG A;  2MBF A;  2K9L A;  5DCF A;  3VDX A;  3CP8 A;  4EJO A;  4K2E A;  1LDK B;  4FE4 A;  5FD5 A;  2ZFW A;  1JJ6 C;  4CCM A;  3ZGK A;  2FSW A;  5DD4 A;  1E17 A;  3S16 J;  1F36 A;  4XK4 A;  1K83 J;  2R93 J;  1LNW A;  2LY1 A;  2HPI A;  1R6R A;  1B9N A;  2VE8 A;  3FXU A;  4CCL A;  4KIT B;  2WAQ A;  5LGU A;  4R8H A;  2E34 A;  4I09 A;  2Y75 A;  4A3M J;  1VQ6 I;  4IEJ A;  1XB4 A;  2XSD C;  5DD8 A;  3JR9 A;  3GLX A;  5FKL A;  2GZW A;  1S3J A;  2FQ3 A;  1I39 A;  1XGM A;  2P6S A;  3PJR A;  4IHW A;  1D3Y A;  1RPW A;  5C3E J;  1XX5 A;  2K9Q A;  2K9M A;  3BP8 A;  3ULQ B;  2RDP A;  4BXF A;  5DS9 A;  3VYU B;  4OMY A;  4IX7 A;  1KZH A;  5IOY A;  1WH7 A;  3WE3 A;  1AA7 A;  1QA6 A;  1TT0 A;  2VKD A;  4LGW A;  1SAX A;  1SFO J;  2LP0 A;  2JJ7 A;  2Y30 A;  1AKH A;  4A3E J;  5J1Y A;  1USS A;  2NXN B;  4XON A;  1LFU P;  3CD6 I;  2EB7 A;  2K5C A;  2XSJ C;  2JPC A;  4KN7 X;  2LMD A;  3LMM A;  3OWT A;  2O03 A;  2AHQ A;  3CMY A;  4WF2 A;  3CUQ A;  4KIS A;  3ABT A;  5EGO B;  1Y8R B;  3G1M A;  2IW5 A;  4B3X A;  3G2B A;  1NK3 P;  3G71 I;  1T98 A;  3D0S A;  3TQN A;  5J4V A;  2E1O A;  3TOA A;  4M3E A;  3HOW J;  2ZJR F;  4C3J J;  4PGH A;  4RMN A;  2XKO A;  4L0Z B;  5TGT A;  3DLA A;  2LG4 A;  1D1B A;  1ETW A;  5L3F A;  3BTC A;  4E7L A;  4P5O A;  1MW7 A;  3HRS A;  2VQL A;  3M1C A;  4XRM A; 
#chains in the Genus database with same CATH homology
 3J7Z I;  1VQL I;  2ZJP F;  2K3F A;  1VQM I;  1YI2 I;  3CCL I;  3CC2 I;  3CJT B;  3I55 I;  3I56 I;  3CC7 I;  3CCJ I;  1FOX A;  1VQ4 I;  1YJ9 I;  1VQ7 I;  3CCQ I;  3CF5 F;  3CCE I;  1VQK I;  1YJW I;  1FOW A;  2OTL I;  3CME I;  5DM7 F;  4IOC F;  1HC8 A;  2E34 A;  3PIP F;  1Y39 A;  3CCU I;  1VQ6 I;  5GAG J;  5GAH J;  1YIT I;  2JQ7 A;  1YHQ I;  1VQP I;  1S72 I;  3DLL F;  1YIJ I;  5GAE J;  2FOW A;  3CCM I;  1QA6 A;  1FOY A;  1MMS A;  2QEX I;  1VQN I;  4IOA F;  4IO9 F;  4V19 K;  2NXN B;  4UY8 I;  2OTJ I;  3CD6 I;  1VQ9 I;  2H8W A;  1YJN I;  3CCS I;  2QA4 I;  3CCV I;  1VQ8 I;  3G71 I;  1VQ5 I;  2ZJR F;  1VQO I;  3G4S I;  3CMA I;  3CCR I;  5DM6 F;  5GAD J;  3G6E I;  3J7Y J;  2E35 A;  2E36 A;  3CC4 I;  3PIO F;  1ACI A;  5JVG F;  2ZJQ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...