4IOAF

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
71
structure length
71
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 8
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4ioaF00
3PIOF 3I55I 1VQ9I 1YJ9I 2ZJQF 3CCSI 1FOXA 3J7ZI 2OTLI 5JVGF 5DM7F 3CD6I 1YITI 1HC8A 5GADJ 2E34A 1FOWA 1YJNI 2NXNB 1VQPI 1VQ7I 1QA6A 3CCJI 2K3FA 2ZJPF 4V19K 1VQ4I 3PIPF 3DLLF 3CCLI 1YJWI 3G71I 2H8WA 5DM6F 3G6EI 3CCVI 4IOCF 1S72I 3CCMI 3CC2I 1VQNI 3CC7I 5GAHJ 3J7YJ 1FOYA 5GAEJ 3I56I 2FOWA 2E36A 3CCUI 1YIJI 2ZJRF 3CF5F 3CC4I 1VQ6I 4IO9F 4UY8I 3CMAI 1VQ8I 1YHQI 2JQ7A 1YI2I 1MMSA 2E35A 3CCRI 3CCEI 2OTJI 3G4SI 5GAGJ 2QA4I 3CJTB 2QEXI 1VQLI 1VQMI 1VQOI 1VQ5I 3CMEI 4IOAF 3CCQI 1Y39A 1VQKI 1ACIA
chains in the Genus database with same CATH superfamily
2EV0A 3IV5A 2P6SA 3HC7A 1H0MA 3LWFA 3BTJA 4II2A 1O3QA 1S3JA 2A3SA 4CO8A 4PSWA 1AKHA 3ONQA 4F93B 3CJQB 3B73A 3C3WA 2CQNA 1IC8A 3OS2A 3DTKA 2QBYA 2K40A 2K85A 3VSLA 1LEBA 2RC4A 2OTLI 2ZMEC 2L2OA 3H0DA 1X4PA 2P7VB 2X4HA 3RYPA 3TKYA 4LFUA 3FXOA 1MBJA 3CDHA 1V4RA 2XGEA 2QKMB 3I59B 4UUSB 1MH3A 2Z99A 4XNFA 2HPIA 2Z16A 1FBQA 4MHGA 5HVQC 3GXOA 1QHGA 1MMAA 3ABUA 3GZ5A 4A0ZA 3ESWB 5GP9A 3E5UA 1HBXG 1P4AA 2EH3A 2R5YB 2CUFA 4KITB 3JCUC 1KU9A 1MNDA 2VLAA 2MH2A 3AAFA 2YUSA 2XGDA 1MNEA 1RPWA 2GZWA 3JRIA 4EJTA 1TBXA 2D1HA 4HF1A 1FMVA 3C2GA 5E3NA 4U0VA 1S29A 1YS6A 3TMOA 1D0XA 2KIUA 5GTHC 3VOEA 3K69A 2Q2EB 3ZMUA 4F3QA 1RI7A 1OFCX 4MO7A 3K6GA 1LEAA 5GAHJ 1V5FA 2EFOA 2JJ7A 2KISA 4LD5A 4BXUA 3QYFA 4DBRA 2CV2A 3I56I 3VPRA 3OYNA 3EETA 4B48A 5KAIC 2RAEA 2X85A 5M5YJ 5EGOA 2PLYA 1XB4A 2BOLA 1FPQA 2R7TA 2A6TA 3QOEA 3KP6A 3JRBA 1NH3A 2JK3A 1SVLA 3HDDA 4AUXA 1MBFA 4YFKF 1WJFA 1UJ8A 4D1QA 2I5UA 2LKPA 4UUTA 1U0JA 3IP4B 1PUEE 1X1PA 2KIQA 1OR7C 4XBFA 3KCCA 2DT7B 2E35A 2KHMA 4YIFA 3IC7A 4UB8C 1FX7A 3BY6A 2DJIA 5F64A 2DQLA 3A01A 4HEA2 2QSGX 1YYVA 3OYDA 1FEXA 1B6AA 2QQBA 5HNFA 5A2QZ 3L1PA 2V1UA 3IUOA 4L9NA 4ZDOA 3IRQA 1S7OA 2F5FA 3DFGA 2MSYA 1YRNA 3KEYA 4JX5A 2TCTA 4QLCU 1YJ9I 1RUNA 4B09A 3ZP5A 1AWCA 5GTIC 4KDPA 2BGCA 3A0BC 3TO6A 2BEOA 2GM4A 2L7MP 1BL0A 2COBA 4JP0A 2R7OA 1IV6A 3HRUA 1R7JA 4Q5SF 3E0JB 5FKKA 2OC6A 2EK5A 3BTLA 3H9QA 4N9HA 1N25A 1MSFC 2ZFUA 3D5SC 2BZTA 1BI3A 3OSGA 2BYVE 1MMDA 5LD2C 1ZK8A 2E1NA 2VKVA 2FBIA 2NNNA 3DLLF 3O2PE 2GIZA 1HKTA 3E6MA 3NEUA 3F8CA 2L9SA 2QKLB 1G6NA 2CFXA 3ULQB 4LLNA 2ACJA 2DYSH 3VEPA 5D8LB 1EKEA 1R5ID 5IOZA 1JKQC 1MDMA 4KT6A 3WE2A 5IYCJ 2JN6A 1DGRM 3JREA 1U6GA 3RCOA 4HX7A 4CYCB 1YE9A 3CP2A 2HYJA 4AVZA 2HYFA 2DDBA 2KDZA 3QAHA 3K7AJ 2O61A 5EYRA 4RLFA 4YFNF 4AYBA 4CHUA 2WTEA 2FRHA 3FMSA 3WHBA 4L0YB 1K4SA 5JI6A 3JTHA 4KN7X 4QPOA 3JAMZ 1G4DA 2EA4A 1R23A 2Y30A 5CYVA 4ZDLA 5HOOA 2K3PA 1TT0A 4GO1A 4BYYA 2IAIA 1ZREA 1J09A 1HW2A 3Q9SA 2OCCH 1XCBA 1KU7A 1VQ6I 2CH0A 4BHPA 3GLXA 1E2XA 4LG0B 2E1MB 2X6YA 3S1QJ 4WF2A 2FX0A 4ETSA 3QQAA 3RKYA 3E6CC 2JUGA 2JQ7A 1MMSA 2AQFA 1L3LA 3N05A 2UWMA 3HB9A 4C9YA 1TTYA 4R8HA 3K0LA 4IRHA 1UHWA 3N97A 2K02A 3S3OA 2L9NA 5FB2A 4MQ9F 3CUOA 2DK8A 4M73A 3DLAA 2QQ8A 5BS6A 2M2EA 1VQ5I 2FU4A 4FE7A 2LOOA 4FQGA 2P0WA 3L2WA 2HQAA 3F8BA 4IHYA 4EJWA 2D1VA 1XSVA 1RESA 2R7XA 3H36A 1QZZA 1XTAA 5EF6A 5EEGA 1VQ9I 1I50J 1WVRA 3MZ8A 3ECHA 4PK4A 1Z1DA 2ZJQF 4LIVA 4Q4ZF 2KFDA 1LFUP 5J40A 1WJEA 3IAM2 2XF6A 4RB1A 4GCVA 3OL3A 2QLZA 3BC8A 4DNCA 1HC8A 4HSRA 2KP6A 2GXGA 1OYIA 5D4SA 5ICFA 4A3EJ 4B3XA 4RA2A 5AIPA 4J19A 1FNNA 1A36A 3OYLA 4XLAA 4MIMA 2FF4A 4JX6A 3RPUA 1XN7A 4CZCA 1YFHA 3HSEA 3LFKA 2JRMA 5FGMA 3Q5FA 2E7XA 2VKHA 4P5OA 3CCJI 2HOTA 3GF2A 4RB3C 2DFFA 3W6VA 1X19A 1Z7UA 1OQYA 5JHFA 2O9LA 4BBSJ 2V4JC 4LLGF 2KMUA 4BQAA 3G6EI 3CQZJ 1Z6RA 2V26A 1U2WA 1MIJA 1APLC 2F4IA 4FISA 3BR0A 4NQWB 1FWZA 3BLYA 1EH8A 4BJTA 1X4OA 1WKMA 4L9VA 2M30A 2FNPA 2PMUA 2W57A 1R00A 4ZYGA 4IX7A 1IW7F 4A3BJ 2WAFA 2D2WA 1KU2A 4XM3A 3TL4X 1BI1A 4UVAA 3GBGA 2A6HF 2H94A 5F0CA 3C1DA 2VXZA 2L9RA 1YIJI 4BJ5C 1LNWA 1NG7A 1TWGJ 2EILH 2YS9A 2GOXB 2DK5A 3MKZA 1IO2A 5FKNA 1S9HA 4G6TB 2GAUA 4O5VA 4RGUA 2GA1A 3L2CA 5FO5A 2KIFA 1DUXC 1T38A 3JRDA 3KFWX 3HZJA 3OMYA 3K4JA 2JA6J 4BXXJ 2OTJI 1IUFA 4ZYDA 1O7FA 4FASD 4F55A 2LH9A 5EZGA 3KP2A 2NVYJ 3BCBA 3MZYA 4I99C 3HPHA 4AIDA 2UXXA 2FBKA 2NS7A 3SEZA 1QU3A 1E3PA 2MG4A 4KIGA 2GLOA 3CLQA 3F23A 3K4CA 2IT0A 3D5LA 5E18F 4FE4A 3UKGA 2VONA 3QPLA 4IEJA 1LDKB 1OMIA 5B1AH 2CUJA 1FSHA 1FY7A 3DBRB 2E71A 1G3SA 1NTCA 2K9NA 4ON0A 2MGQA 5E3LA 2E1CA 1I5ZA 3GFMA 1ETWA 1EA3A 4XONA 2EFWA 4B4CA 4EJUA 3HKZA 1HQCA 4E7HA 4KNYA 1ZR2A 4MTDA 2R5ZB 1C0WA 1IN5A 2IGKA 4AIKA 5E17F 2J5OA 1YRNB 2MBFA 3SHFA 3KEQA 3DEEA 2ADUA 4PJJA 3CMYA 3W2WA 1KQ8A 3GUDA 3OYFA 4ENMA 3H9JA 3S1NJ 3GTPJ 4HF0A 1SANA 4V19K 2CQ7A 3RPUD 2H27A 4KISA 6PAXA 1IRFA 4A3FJ 5L3FA 3PL8A 1DQUA 1Z6TA 2EB7A 4I7HA 3KZZA 1Z05A 3BR1A 1MBHA 2Z2SB 1ODDA 5H6RA 4WCGA 2ZXHA 4IQ4A 3BOQA 3HRTA 2JZYA 4A12A 2DFEA 1U9OA 4E7KA 5M3FJ 3F8FA 4JOMA 2G9WA 1OISA 2PBIA 1SVMA 1I1GA 1IZ1A 2WADA 4F52A 3H35A 1R58A 1USTA 2EZHA 3BG6A 5A2QK 1D1AA 2MA3A 4ZH4F 4YELA 2HGCA 2FNAA 2JA8J 1WFXA 1PVEA 1ZHFA 1JKOC 2Q2EA 3VFZA 1MGTA 2F4MB 2WV0A 3ZQCA 1Y0UA 1G8XA 2O6GE 1HLVA 2LYCA 4HQEA 3BROA 3PFIA 4IQJA 2JPBA 4G8XA 5FD5A 5LLQA 2XRNA 3DTIA 3T8TA 3ZQFA 2RQPA 3EPZA 3ZQQA 5KHDA 2Y0MA 3WTUC 3FK6A 5IY5H 3AL0B 3M8EA 2MD5A 4WXHA 4M72A 2A5WA 3MKYB 3U9GA 1LVAA 2QENA 4A3JJ 2AS5F 1T56A 2C6YA 4Q48A 4L5IA 5IOYA 4M6XA 4E7SA 3IRRA 2F48A 5C4JJ 1ZELA 4WWCA 3CJTB 2RNGA 4XRMA 2IS2A 4JK1X 2STTA 1U8BA 3SZTA 1XG1A 3ECOA 5F0FA 4J00A 3V7SA 1R6RA 4ZTJA 1Y39A 1RR8C 5CVJA 1A35A 1TNSA 3AG4H 4XLCA 1XGMA 2DOFA 4RGSA 5IYDJ 4A3KJ 2L0KA 1WJ5A 2P8TA 3KP5A 1E0EA 3WGGA 2IGNA 2UZKA 1KQ9A 3FXUA 4II3A 2M0CA 5DYMA 1B8IB 2H6CA 2DCEA 3RKQA 1Y6IA 3V42A 2F4OB 5IT9Z 3TBIA 3J7ZI 2Q1ZB 3LFUA 4KMFA 3G73A 4BS9A 4AWXB 3CD6I 3QYBA 3S3MA 4UVBA 4V2FA 4XOTA 4BQNA 2VASA 5FROA 5KAFC 1G3TA 3M4OJ 4QTRA 3SDBA 2RQQA 4CH7A 3I64A 4A3CJ 1HSTA 1ON1A 3FWEA 3A03A 3G2BA 2FQ3A 3MFKA 4PZJA 2F6CA 5TJJA 4IL6C 3PSFA 2B0LA 1VQ4I 1BI0A 5L3GA 3HOWJ 5F08A 5LHIA 2KRHA 4RAGA 2FXAA 3OV8A 2ME0A 2DBBA 2Y75A 1PJRA 2DFHA 5H2FC 1XMAA 3K10A 1DU0A 4KA4A 1XS9A 3Q0UA 2NVXJ 2VBYA 4KT5C 4EGZA 1SFKA 4ENJA 2OZUA 3FHNA 3OL4A 4Y52J 4RB0A 1W5CC 2KIMA 1Q1VA 4XICA 1NHAA 2FBHA 4DYRA 2KLOA 1WH5A 1B59A 1TWAJ 3HHGA 4CYCA 1JE8A 3CCUI 4DIQA 3S15J 2V7FA 2NOGA 4X6AJ 3K1NA 3J80Z 4P9UA 4BE2A 3S32A 3RDIA 2XB5A 4XIDA 1B9NA 3M3YJ 2IRFG 1D3YA 1VQ8I 4LG3A 3V7CA 3OYHA 3S2HJ 2EA2A 2Z3YA 3W2AA 2PN6A 5ILSA 3EQLF 2CJJA 2HWVA 2L02A 3HSRA 1BJZA 1TW3A 3WODF 3JR9A 3CCEI 4LG0A 4M3FA 4YIIA 2LBFB 3RSNA 2IPQX 3H9GA 1OCRH 4BQOA 1UELB 1WI9A 4D0PA 4KN4X 2X6WA 1GVJA 4ABZA 2CMPA 2L5QA 2LSOA 3TW7A 4ZC3A 3VYSB 3TQNA 1O3RA 3OOUA 2ISZA 1BJAA 3FISA 4BGDA 4Q47A 3S8PA 4DBQA 1W36D 1E17A 3E97A 3ZMVA 3M1CA 2YPRA 1GXQA 3WTVC 4LMYA 2XKPA 1HW1A 4E6KG 3I55I 3JRGA 3OIOA 1V5EA 3LQQA 1KU3A 1TT5B 4I0AA 5J4VA 2DO7A 2HR3A 3AG1H 3AKZA 5F6FA 2WAQN 4DGWB 2WAQA 1WRJA 4R1HA 5B3SH 2M34A 1YG2A 2WAEA 1XDUA 2UUZA 1JGGA 1LKXA 3NQOA 3H5AA 3GX4X 3PSIA 2ME6A 1PP7U 3GMEA 3QU3A 1VQPI 2D45A 5FKMA 2G0EA 2F5EA 1Z91A 2HTJA 2CFOA 1W7PB 5HS8A 2P7CB 4NUBA 2QSFX 2QVOA 1F5TA 1ETOA 1DDNA 5K7HA 3CCVI 2R93J 5CQGA 3U21A 4A6DA 2RKHA 3WU1B 4HDVA 4S04A 2ESNA 2CQXA 3H5NA 1K79A 4DQ2A 3K2ZA 5GPAA 1IXCA 2CU7A 3JSOA 2XF5A 2IGMA 3ZRGA 4NQWA 3DPUA 3OYGA 3RYRA 5DDGA 1DGWY 4W1UA 3KP7A 4BXFA 4AIJA 4BNCA 5L3CA 2NS0A 1GHCA 4A3LJ 3CZ6A 1X1BA 4ZZLA 2VKDA 3CF5F 3CDLA 4OIQF 4AIHA 2ESHA 4RBOA 4PCQA 3J7AY 3DKXA 4H0EA 4IJAA 4RAZA 4IHSA 3S2WA 5FD6A 1SD6A 4I98B 1JKPC 1A31A 3RIRA 3P5JA 4G9YA 2PMHA 1ZH5A 4I0BA 4Y13A 1DU6A 5HS9A 3V4GA 4N4OB 3C7JA 3U2RA 3G4SI 1D0ZA 1JTXA 5LRRA 5E3MA 4IKFA 3H3UA 3IWFA 4L18B 3ABLH 3KETA 3H92A 2ZXJA 2BW3A 2E5NA 3UNGC 1T39A 3E5QA 1KYZA 3RJPA 2XSDC 3CUQB 4XN0A 4Z2YA 2CO5A 2VI6A 3HBLA 1JT6A 5BPIA 2FMYA 2LF7A 4PFPA 3OYEA 4IPAA 3WG7H 4OMZA 4U87A 1A04A 2DJNA 2QM3A 1I39A 4PGGA 4L0ZB 3HUGB 1HF0A 1QHHD 1XGOA 4YEJA 1JUSA 2PEXA 4BU2A 2CV0A 2MW8A 2RDPA 3JRHA 4LB5A 2DW4A 3OS1A 1JJ8C 2VQHA 4RM3A 3K70C 1FOWA 2DQRA 1HKQA 1R9TJ 2BY2A 2MC4A 2IJLA 2CWEA 2UXNA 3DQVC 3H5RA 1IG7A 2HDCA 2IA2A 3M9AA 4I01A 2R5ZA 1MZBA 3T1BA 4M9ZA 2ZJPF 1I3AA 2W82A 4OOIA 1UG2A 2ZKZA 3PJRA 1QPIA 2JT1A 2VQGA 2ETHA 3PFYA 4IZZA 1W36C 2N8GA 2XGCA 5D6EA 4A6EA 4AU7A 4A0YA 3ABMH 3ZXSA 3T5XA 3QOPA 4MFDA 1DPRA 1ZYRF 3DEUA 3I0TA 4M3DA 4XLFA 4XMYA 5ERIA 5KNLA 2OV7A 1LE8B 4Z6YA 3FBIB 2K5CA 1W5TA 2XB0X 4RGXA 5F0HA 5CVIA 3FXKA 3LA7A 3K2AA 3R60A 2D5VA 5K5OA 4JBAA 3K4BA 1N75A 2COMA 2IA1A 4E7IA 4GXOA 3WU2C 2JWTA 1RKWA 3OR1C 2WY8Q 3TOBA 1FMWA 1FIPA 3FBNB 3HGYA 3D1NI 4NHJA 1FBUA 2E36A 3E6BA 3SFIA 1K4TA 2YU3A 4OWRB 2DOEA 1FYMA 3P9IA 1QO0D 5IT9K 2M0MA 1GDTA 5JLXA 1AOYA 1M1EB 1D8KA 3C2HA 3ZMTA 2DLLA 1TQIA 2E2JJ 3EDPA 1O7LA 2NS8A 2XPWA 1CQTA 1LUJB 2FMLA 4AYBN 4PGHA 2EQRA 5AIQA 1YO5C 1TC3C 2CS3A 3ELKA 5E1ZB 2XRLA 4JYKA 3CCRI 2XAQA 4H4KC 2X1CA 1U9NA 2NVQJ 2ELKA 1BR1A 1U3EM 1D5VA 3CMEI 4NNJA 1XX5A 5D6FA 2A61A 3Q0WA 4KIFA 3ZQ7A 5HDGA 5DUIA 3E3VA 4CSWA 3CF2A 2NVTJ 2DMTA 2HDWA 3GTGJ 1ZAOA 1WI3A 1RZ4A 2ZXWH 4G94A 3PIOF 3VB2A 1RUOA 1MMNA 3RZDJ 1FC3A 1JI8A 2KT0A 2BBYA 1V55H 4P96A 4EJVA 1Z77A 2LLKA 1Y56A 3RQ4A 5K5QA 2V1XA 2WA0A 2EV6A 2X6XA 3K4NA 1QZEA 5IPAA 3A0HC 2LNBA 1U5TB 2XAUA 3L9FA 4X0GA 2IS6A 3O8HA 3OR2C 3EUHA 4EATA 1XSDA 1FOKA 2HI3A 2XASA 4Y33A 2NYXA 3ZGKA 1P4XA 1T95A 3LSPA 5J8CA 5K1YA 1R4NB 2IW5A 4L5JA 5JFRA 1W0UA 2JMWA 4HLXA 5ILUA 1WHUA 1B8IA 1QVTA 4CCMA 4DZJA 3DCFA 3H0GJ 2KRFA 4RGRA 4QIWN 2E1MC 2LK2A 5LGUA 1K83J 1ETQA 1OPCA 1ZGWA 2OA4A 2YX4A 4XLEA 3OYMA 4KFCA 4U0YA 3G71I 4LOCA 2MH9A 5J1YA 2BXZA 4G6QA 2HNHA 1V3FA 3SZGA 3MKLA 3HOYJ 1BN5A 3P9KA 4CCJA 2QWWA 3KYLA 3DV8A 2M7AA 4CGZA 2V9KA 3MVPA 4BE1A 2QGUA 1ZRCA 5F1JA 3I54A 3ASOH 3ISPA 5ICCA 2R7DA 1HKSA 2QYOA 1WSUA 1IGNA 3G1OA 2HXOA 5LFAA 3BJ6A 1LB2A 5FLMJ 5HNHA 2HXIA 1HDPA 4BBRJ 4HNTA 2K9SA 3BTIA 2VN2A 5H6QA 1R1UA 5FRNA 2K27A 2IEKA 3LMMA 2P5LC 4PUSA 4OU0A 3GCMA 3JTGA 3A2KA 1LVKA 4C2TA 2K4BA 1BA5A 2CRGA 2E5ZA 3HM5A 1RNLA 2HOAA 4BQQA 3HXLA 2PFBA 5IP9J 3PUFA 1F43A 2DTZA 3E1SA 2OD5A 2ICWG 1FIAA 4D9JA 1T0FA 3SQNA 2AHQA 3FXQA 1SD7A 2EPFA 4XORA 1J0RA 2K9LA 2MYSA 2VQLA 2MLGA 3QPTA 5HS7A 1Z7LA 2IXSA 1IXSB 3REOA 2E2HJ 1VQMI 5J1UA 4QSHA 1BR2A 2QQAA 3BR6A 4N4NB 4UNOA 4OAZA 1ACIA 4GRIA 3G1MA 2LBFA 4FCYA 3MWMA 2DDAA 2CG4A 4PJLA 4CZZA 3IH2A 1P7JA 2F5DA 3GTLJ 1JGSA 2LMDA 3MQ0A 4BACA 1OCZH 3I3LA 1DP7P 1UHMA 2BHZA 3LOCA 3S2DJ 2O03A 2BW3B 2AXLA 2BV6A 3ZPLA 1I3QJ 4B43A 3GVAA 1K6OA 2STWA 4FTHA 4EM0B 4N9IA 1EF4A 2O5RA 4LGWA 3GTMJ 5DM7F 1J7KA 3HHHA 2B7EA 1BC7C 3Q3SA 1IJWC 3K1MA 1ZLKA 4C2UA 4HRIA 3KX2A 2VKEA 2L01A 2P5KA 1WGXA 2HPMA 2R7FA 3M07A 4ZYEA 2YX7A 2HZTA 3FKJA 4ESFA 5E3OA 1BIBA 4KUMA 1RC9A 3I4PA 3CTAA 5HLTA 1XSXA 3ZN0A 1K6YA 4U7BA 1J75A 2JA2A 2EFPA 3BP8A 2G7HA 4M6YA 3HKZN 3W3CA 4XL9A 1XCVA 3WTWC 1J9IA 3E6DA 3WG9A 1OCTC 2JTVA 5D5UB 2DTRA 2WV1A 4Y4RA 2ZMEA 2ZJ2A 1AHDP 3PO2J 3H3VK 2K7LA 1W7PA 3PO3J 3F6VA 1HA8A 2LY2A 3OOPA 1QNTA 5IT3A 2L7ZA 2V9PA 4UV9A 4ZYAA 4XQFA 2VJ5A 4NB5A 1R36A 4Y17A 3WTZA 1NK2P 3JW4A 2JSPA 1SFOJ 3DKYA 5BQTA 3OYKA 1LPQA 2M45A 2XIGA 3FMRA 2DT5A 4C3IJ 5CKTA 2FE3A 3T0YA 5CVRA 2HVSA 1BI2A 2PJPA 3MMYB 1ZG5A 2V79A 2VB6A 2DPUA 2MFZA 2ZB9A 3OYBA 3EUAA 1WJBA 1HDDC 3V8JA 3GO5A 1X3UA 1MKMA 4A93J 5DTDA 2I10A 2GA2A 3FK7A 4EVIA 3CMAI 2JA7J 2RNJA 4HQMA 1TWFJ 3DTEA 3F0CA 5ILVA 2AXTC 1FTTA 3GEZA 2IGOA 1ZQ3P 3PNYA 3LSRA 3JRFA 2ID6A 3CDIA 5E1WA 2CUZA 2OBPA 2L7FP 5F27A 4A5NA 1MW7A 5GAGJ 1TNTA 1ZG3A 4V2GA 3TDZC 3ZQIA 4HNVA 3HOSA 2EFNA 1J2XA 1R1VA 1GT0C 3PNTA 2ZC2A 1JJ6C 2HDDA 1F4KA 1FYLA 4CCNA 2EWNA 2HQ5A 3WE3A 5J8FA 5FLXZ 1BC8C 4BJ6C 5LBQA 2VQCA 1D1CA 3TW6A 3QP5A 2FOKA 4DZPA 3KE2A 3GTQJ 3KPHA 2L54A 4X1EA 4CXFA 2A6EF 2M1BA 2O0YA 3AFHA 1LFBA 5HLIA 5CLSA 2HKXA 1K78B 1UHSA 3CUQA 3CP8A 5K7FA 3OWTA 1MD0A 2FQ4A 3GTJJ 3ZN1A 1H88C 3J7AO 3L2UA 2BHYA 3K4LA 4I02A 1ZARA 1XGNA 2EZIA 1CF7B 3FDYA 1MBEA 5FLVA 1GXPA 1ZTRA 1B72B 3FXRA 3IWZA 3FX3A 3HUGA 1HOMA 1W1WE 1S6LA 2VC0A 2EBIA 3VYUB 3K1PA 2WY7Q 1V54H 1QBJA 5CVUA 2A5YB 2M4KA 4Y15A 1X1CA 2ZNYA 2HOEA 1KZHA 3AL0C 1B1BA 3LSIA 1GLNA 1KA8A 4FX0A 2VOOA 2IBDA 1XDSA 4IOCF 3O3KA 3WTSC 3S1MJ 3PQJA 3JAMK 1Y1WJ 4OINF 5CPRB 1P6RA 2FSWA 2KL4A 2JRTA 1ERDA 3I71A 1ZR4A 3WU0A 4ANJA 1T6SA 3CLOA 2P6TA 5ED4A 2R7SA 1LE8A 4I2OA 5C4XJ 1OYWA 1GUUA 4HPQA 1R1TA 4MNUA 3MKWB 4XK4A 1W7PD 1SAXA 3WTTC 3BPVA 2NNYA 1FOYA 1HXDA 1QRYA 2HQNA 4GDFA 3COAC 1VTNC 1MBKA 2AQEA 2DA6A 3F72A 4Y3OA 2DMQA 1T33A 2GOMA 1KQ0A 1WWXA 4IRGA 1G59A 5E20A 2KJCA 1K7AA 3KLOA 3LSJA 3DWLE 4HV6A 5LGNA 2EIMH 5JVTA 3ZQLA 2V9VA 1YW9A 1IDYA 5FJ8J 1T2KA 2HVQA 1QPMA 3RKXA 2LR8A 3DKWA 4AVPA 1GV5A 1H9TA 4MGRA 2CUEA 3AG3H 1ZRFA 1D8JA 4RAFA 1KYWA 2CW7A 4RS8A 2ELJA 2DA2A 2JPCA 2LTPA 1IRGA 5DD4A 2M87A 2E7WA 2VIXA 5C44J 4A3MJ 1RR7A 5M5WJ 4D7MA 1SMYF 3GTOJ 3TO9A 3BZCA 2BY1A 2ZSHB 4ZZDA 2DAOA 3SJMA 3IKTA 3C2BA 3F3XA 2E19A 2EJRA 3BG3A 2GQQA 2I8DA 5LGTA 5E8GA 4EMSA 5D5VB 2ELHA 1SC7A 3FXMA 4PJNA 2BVMA 1BOBA 2M8GX 4NC6A 1VI0A 2X9DA 2E34A 2PJRA 3EYIA 2XSJC 3VSKA 4BY1J 1X1DA 4CA0A 2ECBA 2W48A 1U5TA 1IV8A 4EGYA 2NXNB 3HRMA 2ISYA 4XOPA 2CQQA 2HQRA 5D5XB 3HTUA 1QA6A 2E1OA 1F36A 2AO9A 2K86A 2XKOA 5ICEA 2FUG2 3DU6A 3CJRB 1Z3YA 2IS1A 3V8LA 2JVGA 2M8EA 3H1CA 4B44A 2EFQA 2ZXIA 3U1DA 3KYCB 2A68F 1ITYA 2XC7A 2R7RA 3BQZA 3WHCA 1S72I 1YIOA 3UR3C 5KCMA 1QQIA 3A4CA 4FX4A 4ASNA 4LLLA 4F91B 3I53A 2M9HA 3ERMA 3CC7I 2LC2A 3P9CA 1UG0A 2HU9A 1BR4A 1Y8RB 1S7AA 1UZCA 2FJ1A 1VF9A 3ZR8X 3TO7A 4HYEA 1E3OC 1R22A 2ZMEB 4FETA 3RTRA 1X2MA 1D1BA 2LVSA 3F6OA 4HF2A 3DU5A 2DA4A 4HX4A 5C3EJ 2Q0OA 2Y2ZA 5J47A 2R7QA 4FHTA 2PX9A 3KIOA 2VBWA 4AD9A 4BE0A 5TRDA 2A05A 1XPXA 3RZOJ 1T98A 2L9VA 1WCMJ 4MTEA 1MMGA 3OYAA 4IO9F 4E4HA 4DYCA 3K4KA 1TWHJ 4B1RA 3NWSA 1WPKA 2LP0A 4MFEA 3NARA 3BR3A 3L09A 4E70A 1MJBA 2Y31A 5LRSA 2UV1A 2Y0SN 4L5EA 4XSZF 4ITVA 3B6AA 4M3GA 3FXJA 1IN4A 2Y0SA 3DXJF 3ZCOA 2V6CA 3BPXA 1I6HJ 4HV5A 1EH6A 3HOUJ 2KDOA 3DF8A 4C2MJ 2R7VA 4XLHA 1J5YA 3ZMDA 1KGSA 1ZKGA 4IF4A 3Q0VA 1XGSA 3FMQA 4KIBA 1Z3XA 2DOAA 2PG4A 2CQKA 4KMUX 3WGIA 3S17J 3B02A 4ENKA 3Q9VA 4MLOA 3KZYA 2PJRB 1USSA 1MJAA 2LY1A 4A3DJ 1MJ9A 1WH7A 3TP3A 5K7ZA 5KVRA 2IS4A 4BDYA 2MABA 4HBLA 1EJ9A 2KPMA 2HS5A 3M8JA 2Z5UA 3QWLA 1XMXA 4XLPF 1YTYA 2R7ZJ 3JRCA 3MCZA 3QODA 5L3EA 4GFBA 1D5YA 3GZNB 5GADJ 1ZGAA 1E3HA 4B47A 2DT6A 4NC8A 4S05A 5EEAA 1UCRA 3O6BB 1QVUA 4C3HJ 2W84A 1IN6A 1Q1HA 3VODA 4L9JA 2XUBA 5HDKA 3AG2H 3PIPF 1HSJA 3D5RC 2RREA 2JVHA 3CCLI 1F9NA 1MSEC 2E60A 2Y9ZA 3KLNA 2HKOA 3M1EA 2Z33A 2VJIA 4RMNA 4J01A 2DN0A 2KKOA 1ULYA 3R4KA 3FZVA 5HDNA 1U78A 1LDDA 3ZOBA 1RETA 3HSFA 3J81Z 5IP6A 2DYRH 1I1SA 2YR2A 1BM9A 4C30A 3RPQA 2CW8A 3CUQC 1B4AA 5FLXK 1PUFB 4WXDA 1XD7A 3FIWA 4HW0A 3CO7C 4IHVA 3LNQA 3L2QA 3BTCA 1YW7A 1RKTA 3FKIJ 3CO6C 2DPDA 5JHUA 5LEKA 2WC2A 1ENHA 2XPVA 2H1LA 1JHHA 5DCMB 3WTYC 2Z9OA 4MQVA 4ZJZA 2B63J 1HW5A 2M3AA 2QCOA 2GXBA 2M7BA 3KP3A 5DV5A 4A2UA 3W2VA 4E7LA 1TL8A 2DFIA 4GYGA 4QPQA 3GYHX 2XAHA 4ENNA 4C3JJ 5J4YA 5EDNA 3BT9A 1LQ1A 3OS0A 1W4MA 4BHCA 1ON2A 4M6VA 4CCLA 1VZ0A 1IAWA 3HYIA 3DBHB 4DOZA 1Y8QB 2DA7A 4IOAF 4BY7J 3F22A 1FJLA 4XSXF 2HFHA 4PSXA 4WXCA 4A5MA 3GFIA 2H1KA 2DXIA 2ZSIB 4G6DA 2ID3A 1BBYA 1OYYA 4RLQA 4XKWA 3LSKA 1FT9A 1UMQA 2L7KA 1UB9A 2P5VA 3CCSI 1IF1A 3B6CA 3MD2A 3GZ6A 1I27A 4HOBA 2QF7A 3E7LA 5JVGF 2J5PA 1YITI 5CQEA 3RI4A 3PUBA 1R5HA 3HEFA 3ABKH 4CDGA 1K78A 1Y0NA 4BH9A 2XF7A 3QP6A 5LHGA 1JKRC 1R4MB 1Z67A 2HOSA 3BR2A 3FM3A 4NC7A 1X3ZB 2DA5A 1N78A 3F21A 1BOAA 5B5EC 3QPSA 1CF7A 2KRCA 3QU6A 5K5RA 2O7OA 1B72A 3HJEA 1SFEA 2H09A 4B8XA 1YJWI 2H8WA 3VDXA 3HOXJ 4G7OF 3MAJA 2VUMJ 3RKWA 5EG0B 3HL2A 2X1DA 2E2IJ 2VT2A 1U8RA 3KYDB 1T8IA 2L4MA 1R49A 4RM2A 2VBZA 4HZFA 1YOVB 3TDUC 4DJAA 1RIOH 4BHBA 2QQ9A 1QGPA 2Y69H 3QPHA 3HIFA 2FD5A 2LREA 3CCYA 3OYCA 4UUVA 3J80K 1ONVA 5L3DA 2Q8KA 1A5JA 5JLWA 3IH3A 1X2NA 4W97A 2EINH 3BWGA 4BKXA 3R6SA 2OPTA 2WWYA 1MH4A 5E1XA 4KYWA 1U5TC 4XLNF 3X2QH 4IHWA 3F9KA 5D8KB 5J6XA 5H20A 1NK3P 2G7UA 3DBLB 4M9SA 3L7WA 4PJ0C 1Z0XA 2K9QA 5E8IA 4P9FA 3G3ZA 1OCCH 4UY8I 3G1LA 2V1NA 2LD5A 2ZO4A 1RRJA 5DS9A 1ETVA 3QRFF 2VL8A 1TQMA 1F1ZA 3NAUA 3I9V2 3I5UA 2IP2A 5EEHA 4BEHB 3BG7A 1YHQI 1YI2I 1D0YA 1L0OC 3N4MA 1ETKA 1WJDA 2OAZA 1FLIA 3CJNA 2F2EA 4CICA 2W7NA 1G2HA 2W00A 3HGGA 3L00A 4XN3A 4P55A 2QA4I 1I6XA 5LEJA 2QEXI 4XR6A 5AONA 3ROUA 3P7NA 3TP0A 4WK8F 1VQLI 1AKHB 1X1AA 2DA1A 3ZMZA 4HNUA 4D5CA 4L9TA 2A07F 4M71A 1Z21A 5E79C 4HSTA 5BMZA 1H8AC 4A3IJ 4LB6B 2H8RA 2QBYB 3WTXC 2EV5A 2ECCA 2VJ4A 3LSTA 3L2VA 1NG6A 1SAUA 2F5CA 1GVDA 2KQRA 3MN2A 2W85A 2YU9J 1SVOA 3GFLA 3PM1A 3HOTA 3SDGA 3BQYA 9ANTA 1FP2A 1SD4A 4UXNA 1FOXA 1XMKA 4BL0B 1YX3A 1DP3A 2XAGA 3IL2A 1S7EA 1ZRDA 1Y1VJ 3ZQGA 2HZDA 4XRSA 1S8NA 3F8MA 2VBXA 3TGNA 1REPC 3K4MA 1ETXA 3SZPA 4IXAA 3QYEA 3LA3A 5DUKA 2W1OA 3O8GA 2XROA 1X3WB 2ZFWA 3LSGA 4JQFA 4I6ZA 1SMTA 5EJCA 1N77A 3W6KB 3ERED 5J3LA 2VE9A 3S16J 4IHTA 2JA5J 3FHZA 1JXSA 1EH7A 4XKVA 2JUCA 4LITA 4PJMA 2R7UA 1FTZA 2ZNZA 3OYIA 4UV8A 2EZLA 1JUMA 2LY9A 5D4RA 4XRSG 2BY0A 4OIRF 3LSMA 2KJBA 4D5FA 3BR5A 5DEQA 1FBSA 3NRVA 1IRXA 1EV7A 2KZGA 2R3SA 2X48A 1X58A 2GBYA 3TOAA 5TISC 4IRIA 1H9GA 5FFZA 1T08B 2K9MA 2NOJB 4E7ZA 1VQNI 5BOXA 3HOVJ 2OU2A 5EGOB 1VFCA 2VODA 4I76A 2VPRA 1P92A 2L3DA 5GPCA 2DU9A 2XAJA 3GFJA 1Z9CA 4PFOA 4G7HF 5BPDA 2YSRA 4HG2A 1R71A 1TQPA 2DI3A 2V1DA 3U1KA 2R4GA 3HPGA 5L3BA 2F5VA 3K9TA 3L2RA 4M9XA 1WJAA 1ETYA 1YQAA 1P7IA 5CJ9A 1SFUA 2P81A 1O3TA 4NBQA 4A3GJ 5KK1A 2VXDA 3OY9A 2R0QC 4RB2C 2RN7A 2LDUA 2XVCA 3EUKL 2EIKH 3ZMSA 3A01B 2IVMA 2BE5F 3KP4A 1R5GA 2X1EA 3BZKA 2OQGA 4NDLA 2LG4A 3R0AA 3ZQHA 2V6EA 4ESJA 5J1RA 1TW2A 3IKVA 2MD0A 3SXYA 4YRVA 4LJZF 2MC3A 3CCQI 4ESBA 4PDKA 3LAJA 4EEFG 1V5GA 3LA2A 4A69C 2VT3A 4KICA 2DMUA 4BAYA 2RVCA 5LHHA 1STZA 2FA5A 2VC1A 5FKLA 1TLHB 4RDUA 3S93A 1MBGA 2RGVA 3I58A 4GYIA 3J81K 3GW2A 2EIJH 3I59A 4UUSA 4U0WA 2PQ8A 2O8KA 3HG9A 2K4JA 1K61A 4AM3A 1J59A 4A0XA 4TV7A 4LK1F 5DD8A 2R92J 2XPUA 4UHTA 3MZHA 2PI0A 2R5YA 2BY3A 5JR3A 2TRTA 3WGHA 4CCOA 2BXYA 1YJNI 3OYJA 3DEWA 1SEUA 3I4NJ 3DPLC 2W24A 4I09A 2LKSA 1W0TA 1WZ2A 1ZGJA 1OCPA 1IXRC 2P4WA 1P2FA 1VQ7I 4YIRX 3A02A 1JTYA 3BJOA 3LQRA 4P1WA 1OKRA 3TEDA 2QZ8A 1UAAA 3F8NA 3IH4A 3LL7A 4CUGA 3GWZA 4IVNA 1MDMB 4QWQA 2RV8A 3DPTA 2JSCA 4KJZA 1AA7A 4OMYA 1VNDA 5DM6F 2BVLA 4BUPA 1OR7A 2GXAA 4EJOA 4LK0F 2Y9YA 3BG5A 4JX4A 2LFBA 1AU7A 4OIOF 3VWBA 5IP7J 2XV4S 2ZCWA 3GLLA 4CCKA 4R79A 3BCAA 3S3NA 1ZLJA 2GIVA 1OCOH 4HDUA 2DMPA 2B9SA 2CW0F 2M4GA 1IUYA 5M3MJ 1TWCJ 2CYYA 2VOPA 3LAPA 2DODA 4XKBA 5HLGA 2R7WA 2DA3A 3BZ6A 2X6OA 3FF5A 3VYTB 3HRSA 3LSHA 1PUFA 3MEXA 1PDNC 1JT0A 1POGA 5CVVA 2CGPA 3T8RA 2O3FA 1TP4A 3V7RA 3PNVA 1BW5A 3OIPA 3KZIC 1WJCA 2L4AA 2HEOA 1BW6A 3C18A 4G7ZF 5DCMA 4AC0A 2XAFA 2KZVA 3EUHC 4F92B 1SD5A 3FM5A 4K2EA 2OF7A 3BDDA 3E5XA 1QZYA 4XRFA 2NRAC 1H89C 4Y7NJ 1TZLA 2PMZN 5FKOA 4HAMA 4U7DA 2PMZA 5F04A 1VQKI 1IN7A 3DP7A 3IHUA 2HVRA 3H3ZA 3JRAA 2HYGD 2OJED 2CSOA 2QUFA 2DMNA 4EV0A 1JHFA 4DW6A 3I4MJ 2NVUB 4GGGA 2VJJA 1IDZA 2LF8A 2A69F 1SFXA 1LDJA 3CESA 1A6QA 1LFPA 3R0JA 1GV2A 4U88A 5M5XJ 4YFXF 1OLTA 1P4WA 1FYKA 2XGXA 1YS7A 3SEQA 5HODA 5F1RA 4UB6C 5DCFA 1PP8F 2O8XA 3CMMA 2K3FA 3D0SA 4B3AA 4F7ZA 1A6IA 2FEZA 5FFXA 2IA0A 5IYBJ 4G12A 3ASNH 2HTSA 2LRDA 2W4SA 1FP1D 1YW8A 3SYTA 1BIAA 3IAS2 2NAZA 4EM1A 3BG9A 3JSPA 5B1BH 1OJLA 2W25A 4N0BA 1O57A 3RQIA 1ZG1A 5HLHA 3W6JB 1WQ2A 3CCMI 2WB1N 4RAYA 1MNMC 3CC2I 3OIQA 3M8FA 1T0FC 4HX8A 4S0HB 2WB1A 5EG0A 4E7JA 3SFZA 2XHKA 1UFMA 2OZ6A 4FT8A 4CYDA 1JUPA 1CGPA 1ZN2A 1DPUA 3J7YJ 1IRZA 3K70D 1G3WA 5EZHA 1S5LC 2WBMA 1G3YA 5GAEJ 3OSFA 4BDZA 4OIPF 3PQKA 1LJ9A 4ZYHA 2FOWA 5D5WB 4M3BA 2Z1DA 4HA8A 2LKXA 4DYQA 4ZTFA 3HOZJ 2ZJRF 4UVCA 3EYYA 3CC4I 4O3MA 5B66C 4HLYA 4ZDPA 1B9MA 2Y48A 1FSEA 4OAYA 5FRMA 4LIUA 2VE8A 3HTSB 3VYRB 1PYVA 1YX5A 3S1RJ 2CV1A 2OQRA 1KONA 2QSHX 1XC5A 4MEXF 1W5SA 3M7GA 4EM2A 2GWRA 2MLKA 4M3EA 5BNGA 3V8KA 2X0LA 1IN8A 3FXLA 2OUMA 4O6JA 4D7NA 5TGTA 1O3SA 4MEYF 4IHXA 2OCEA 2M5WA 1FZPB 4M74A 1ORKA 5ICGA 1YLFA 3NWTA 3ABTA 3A1YA 2EZKA 3BJAA 1O4XA 4BEHA 2ZBKA 2TDXA 3R61A 1VQOI 3S14J 4XKCA 2X51A 3GTKJ 2VPLA 4EQQA 1HCRA 4WX9A 4YG2F 2XDVA 1P9QC 2H6BA 3KEOA 3ML6A
chains in the Genus database with same CATH topology
3PIOF 3I55I 1VQ9I 1YJ9I 2ZJQF 3CCSI 1FOXA 3J7ZI 2OTLI 5JVGF 5DM7F 3CD6I 1YITI 1HC8A 5GADJ 2E34A 1FOWA 1YJNI 2NXNB 1VQPI 1VQ7I 1QA6A 3CCJI 2K3FA 2ZJPF 4V19K 1VQ4I 3PIPF 3DLLF 3CCLI 1YJWI 3G71I 2H8WA 5DM6F 3G6EI 3CCVI 4IOCF 1S72I 3CCMI 3CC2I 1VQNI 3CC7I 5GAHJ 3J7YJ 1FOYA 5GAEJ 3I56I 2FOWA 2E36A 3CCUI 1YIJI 2ZJRF 3CF5F 3CC4I 1VQ6I 4IO9F 4UY8I 3CMAI 1VQ8I 1YHQI 2JQ7A 1YI2I 1MMSA 2E35A 3CCRI 3CCEI 2OTJI 3G4SI 5GAGJ 2QA4I 3CJTB 2QEXI 1VQLI 1VQMI 1VQOI 1VQ5I 3CMEI 4IOAF 3CCQI 1Y39A 1VQKI 1ACIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIO F;  3I55 I;  1VQ9 I;  1YJ9 I;  2ZJQ F;  3CCS I;  1FOX A;  3J7Z I;  2OTL I;  5JVG F;  5DM7 F;  3CD6 I;  1YIT I;  1HC8 A;  5GAD J;  2E34 A;  1FOW A;  1YJN I;  2NXN B;  1VQP I;  1VQ7 I;  1QA6 A;  3CCJ I;  2K3F A;  2ZJP F;  4V19 K;  1VQ4 I;  3PIP F;  3DLL F;  3CCL I;  1YJW I;  3G71 I;  2H8W A;  5DM6 F;  3G6E I;  3CCV I;  4IOC F;  1S72 I;  3CCM I;  3CC2 I;  1VQN I;  3CC7 I;  5GAH J;  3J7Y J;  1FOY A;  5GAE J;  3I56 I;  2FOW A;  2E36 A;  3CCU I;  1YIJ I;  2ZJR F;  3CF5 F;  3CC4 I;  1VQ6 I;  4IO9 F;  4UY8 I;  3CMA I;  1VQ8 I;  1YHQ I;  2JQ7 A;  1YI2 I;  1MMS A;  2E35 A;  3CCR I;  3CCE I;  2OTJ I;  3G4S I;  5GAG J;  2QA4 I;  3CJT B;  2QEX I;  1VQL I;  1VQM I;  1VQO I;  1VQ5 I;  3CME I;  4IOA F;  3CCQ I;  1Y39 A;  1VQK I;  1ACI A; 
#chains in the Genus database with same CATH topology
 2EV0 A;  3IV5 A;  2P6S A;  3HC7 A;  1H0M A;  3LWF A;  3BTJ A;  4II2 A;  1O3Q A;  1S3J A;  2A3S A;  4CO8 A;  4PSW A;  1AKH A;  3ONQ A;  4F93 B;  3CJQ B;  3B73 A;  3C3W A;  2CQN A;  1IC8 A;  3OS2 A;  3DTK A;  2QBY A;  2K40 A;  2K85 A;  3VSL A;  1LEB A;  2RC4 A;  2OTL I;  2ZME C;  2L2O A;  3H0D A;  1X4P A;  2P7V B;  2X4H A;  3RYP A;  3TKY A;  4LFU A;  3FXO A;  1MBJ A;  3CDH A;  1V4R A;  2XGE A;  2QKM B;  3I59 B;  4UUS B;  1MH3 A;  2Z99 A;  4XNF A;  2HPI A;  2Z16 A;  1FBQ A;  4MHG A;  5HVQ C;  3GXO A;  1QHG A;  1MMA A;  3ABU A;  3GZ5 A;  4A0Z A;  3ESW B;  5GP9 A;  3E5U A;  1HBX G;  1P4A A;  2EH3 A;  2R5Y B;  2CUF A;  4KIT B;  3JCU C;  1KU9 A;  1MND A;  2VLA A;  2MH2 A;  3AAF A;  2YUS A;  2XGD A;  1MNE A;  1RPW A;  2GZW A;  3JRI A;  4EJT A;  1TBX A;  2D1H A;  4HF1 A;  1FMV A;  3C2G A;  5E3N A;  4U0V A;  1S29 A;  1YS6 A;  3TMO A;  1D0X A;  2KIU A;  5GTH C;  3VOE A;  3K69 A;  2Q2E B;  3ZMU A;  4F3Q A;  1RI7 A;  1OFC X;  4MO7 A;  3K6G A;  1LEA A;  5GAH J;  1V5F A;  2EFO A;  2JJ7 A;  2KIS A;  4LD5 A;  4BXU A;  3QYF A;  4DBR A;  2CV2 A;  3I56 I;  3VPR A;  3OYN A;  3EET A;  4B48 A;  5KAI C;  2RAE A;  2X85 A;  5M5Y J;  5EGO A;  2PLY A;  1XB4 A;  2BOL A;  1FPQ A;  2R7T A;  2A6T A;  3QOE A;  3KP6 A;  3JRB A;  1NH3 A;  2JK3 A;  1SVL A;  3HDD A;  4AUX A;  1MBF A;  4YFK F;  1WJF A;  1UJ8 A;  4D1Q A;  2I5U A;  2LKP A;  4UUT A;  1U0J A;  3IP4 B;  1PUE E;  1X1P A;  2KIQ A;  1OR7 C;  4XBF A;  3KCC A;  2DT7 B;  2E35 A;  2KHM A;  4YIF A;  3IC7 A;  4UB8 C;  1FX7 A;  3BY6 A;  2DJI A;  5F64 A;  2DQL A;  3A01 A;  4HEA 2;  2QSG X;  1YYV A;  3OYD A;  1FEX A;  1B6A A;  2QQB A;  5HNF A;  5A2Q Z;  3L1P A;  2V1U A;  3IUO A;  4L9N A;  4ZDO A;  3IRQ A;  1S7O A;  2F5F A;  3DFG A;  2MSY A;  1YRN A;  3KEY A;  4JX5 A;  2TCT A;  4QLC U;  1YJ9 I;  1RUN A;  4B09 A;  3ZP5 A;  1AWC A;  5GTI C;  4KDP A;  2BGC A;  3A0B C;  3TO6 A;  2BEO A;  2GM4 A;  2L7M P;  1BL0 A;  2COB A;  4JP0 A;  2R7O A;  1IV6 A;  3HRU A;  1R7J A;  4Q5S F;  3E0J B;  5FKK A;  2OC6 A;  2EK5 A;  3BTL A;  3H9Q A;  4N9H A;  1N25 A;  1MSF C;  2ZFU A;  3D5S C;  2BZT A;  1BI3 A;  3OSG A;  2BYV E;  1MMD A;  5LD2 C;  1ZK8 A;  2E1N A;  2VKV A;  2FBI A;  2NNN A;  3DLL F;  3O2P E;  2GIZ A;  1HKT A;  3E6M A;  3NEU A;  3F8C A;  2L9S A;  2QKL B;  1G6N A;  2CFX A;  3ULQ B;  4LLN A;  2ACJ A;  2DYS H;  3VEP A;  5D8L B;  1EKE A;  1R5I D;  5IOZ A;  1JKQ C;  1MDM A;  4KT6 A;  3WE2 A;  5IYC J;  2JN6 A;  1DGR M;  3JRE A;  1U6G A;  3RCO A;  4HX7 A;  4CYC B;  1YE9 A;  3CP2 A;  2HYJ A;  4AVZ A;  2HYF A;  2DDB A;  2KDZ A;  3QAH A;  3K7A J;  2O61 A;  5EYR A;  4RLF A;  4YFN F;  4AYB A;  4CHU A;  2WTE A;  2FRH A;  3FMS A;  3WHB A;  4L0Y B;  1K4S A;  5JI6 A;  3JTH A;  4KN7 X;  4QPO A;  3JAM Z;  1G4D A;  2EA4 A;  1R23 A;  2Y30 A;  5CYV A;  4ZDL A;  5HOO A;  2K3P A;  1TT0 A;  4GO1 A;  4BYY A;  2IAI A;  1ZRE A;  1J09 A;  1HW2 A;  3Q9S A;  2OCC H;  1XCB A;  1KU7 A;  1VQ6 I;  2CH0 A;  4BHP A;  3GLX A;  1E2X A;  4LG0 B;  2E1M B;  2X6Y A;  3S1Q J;  4WF2 A;  2FX0 A;  4ETS A;  3QQA A;  3RKY A;  3E6C C;  2JUG A;  2JQ7 A;  1MMS A;  2AQF A;  1L3L A;  3N05 A;  2UWM A;  3HB9 A;  4C9Y A;  1TTY A;  4R8H A;  3K0L A;  4IRH A;  1UHW A;  3N97 A;  2K02 A;  3S3O A;  2L9N A;  5FB2 A;  4MQ9 F;  3CUO A;  2DK8 A;  4M73 A;  3DLA A;  2QQ8 A;  5BS6 A;  2M2E A;  1VQ5 I;  2FU4 A;  4FE7 A;  2LOO A;  4FQG A;  2P0W A;  3L2W A;  2HQA A;  3F8B A;  4IHY A;  4EJW A;  2D1V A;  1XSV A;  1RES A;  2R7X A;  3H36 A;  1QZZ A;  1XTA A;  5EF6 A;  5EEG A;  1VQ9 I;  1I50 J;  1WVR A;  3MZ8 A;  3ECH A;  4PK4 A;  1Z1D A;  2ZJQ F;  4LIV A;  4Q4Z F;  2KFD A;  1LFU P;  5J40 A;  1WJE A;  3IAM 2;  2XF6 A;  4RB1 A;  4GCV A;  3OL3 A;  2QLZ A;  3BC8 A;  4DNC A;  1HC8 A;  4HSR A;  2KP6 A;  2GXG A;  1OYI A;  5D4S A;  5ICF A;  4A3E J;  4B3X A;  4RA2 A;  5AIP A;  4J19 A;  1FNN A;  1A36 A;  3OYL A;  4XLA A;  4MIM A;  2FF4 A;  4JX6 A;  3RPU A;  1XN7 A;  4CZC A;  1YFH A;  3HSE A;  3LFK A;  2JRM A;  5FGM A;  3Q5F A;  2E7X A;  2VKH A;  4P5O A;  3CCJ I;  2HOT A;  3GF2 A;  4RB3 C;  2DFF A;  3W6V A;  1X19 A;  1Z7U A;  1OQY A;  5JHF A;  2O9L A;  4BBS J;  2V4J C;  4LLG F;  2KMU A;  4BQA A;  3G6E I;  3CQZ J;  1Z6R A;  2V26 A;  1U2W A;  1MIJ A;  1APL C;  2F4I A;  4FIS A;  3BR0 A;  4NQW B;  1FWZ A;  3BLY A;  1EH8 A;  4BJT A;  1X4O A;  1WKM A;  4L9V A;  2M30 A;  2FNP A;  2PMU A;  2W57 A;  1R00 A;  4ZYG A;  4IX7 A;  1IW7 F;  4A3B J;  2WAF A;  2D2W A;  1KU2 A;  4XM3 A;  3TL4 X;  1BI1 A;  4UVA A;  3GBG A;  2A6H F;  2H94 A;  5F0C A;  3C1D A;  2VXZ A;  2L9R A;  1YIJ I;  4BJ5 C;  1LNW A;  1NG7 A;  1TWG J;  2EIL H;  2YS9 A;  2GOX B;  2DK5 A;  3MKZ A;  1IO2 A;  5FKN A;  1S9H A;  4G6T B;  2GAU A;  4O5V A;  4RGU A;  2GA1 A;  3L2C A;  5FO5 A;  2KIF A;  1DUX C;  1T38 A;  3JRD A;  3KFW X;  3HZJ A;  3OMY A;  3K4J A;  2JA6 J;  4BXX J;  2OTJ I;  1IUF A;  4ZYD A;  1O7F A;  4FAS D;  4F55 A;  2LH9 A;  5EZG A;  3KP2 A;  2NVY J;  3BCB A;  3MZY A;  4I99 C;  3HPH A;  4AID A;  2UXX A;  2FBK A;  2NS7 A;  3SEZ A;  1QU3 A;  1E3P A;  2MG4 A;  4KIG A;  2GLO A;  3CLQ A;  3F23 A;  3K4C A;  2IT0 A;  3D5L A;  5E18 F;  4FE4 A;  3UKG A;  2VON A;  3QPL A;  4IEJ A;  1LDK B;  1OMI A;  5B1A H;  2CUJ A;  1FSH A;  1FY7 A;  3DBR B;  2E71 A;  1G3S A;  1NTC A;  2K9N A;  4ON0 A;  2MGQ A;  5E3L A;  2E1C A;  1I5Z A;  3GFM A;  1ETW A;  1EA3 A;  4XON A;  2EFW A;  4B4C A;  4EJU A;  3HKZ A;  1HQC A;  4E7H A;  4KNY A;  1ZR2 A;  4MTD A;  2R5Z B;  1C0W A;  1IN5 A;  2IGK A;  4AIK A;  5E17 F;  2J5O A;  1YRN B;  2MBF A;  3SHF A;  3KEQ A;  3DEE A;  2ADU A;  4PJJ A;  3CMY A;  3W2W A;  1KQ8 A;  3GUD A;  3OYF A;  4ENM A;  3H9J A;  3S1N J;  3GTP J;  4HF0 A;  1SAN A;  4V19 K;  2CQ7 A;  3RPU D;  2H27 A;  4KIS A;  6PAX A;  1IRF A;  4A3F J;  5L3F A;  3PL8 A;  1DQU A;  1Z6T A;  2EB7 A;  4I7H A;  3KZZ A;  1Z05 A;  3BR1 A;  1MBH A;  2Z2S B;  1ODD A;  5H6R A;  4WCG A;  2ZXH A;  4IQ4 A;  3BOQ A;  3HRT A;  2JZY A;  4A12 A;  2DFE A;  1U9O A;  4E7K A;  5M3F J;  3F8F A;  4JOM A;  2G9W A;  1OIS A;  2PBI A;  1SVM A;  1I1G A;  1IZ1 A;  2WAD A;  4F52 A;  3H35 A;  1R58 A;  1UST A;  2EZH A;  3BG6 A;  5A2Q K;  1D1A A;  2MA3 A;  4ZH4 F;  4YEL A;  2HGC A;  2FNA A;  2JA8 J;  1WFX A;  1PVE A;  1ZHF A;  1JKO C;  2Q2E A;  3VFZ A;  1MGT A;  2F4M B;  2WV0 A;  3ZQC A;  1Y0U A;  1G8X A;  2O6G E;  1HLV A;  2LYC A;  4HQE A;  3BRO A;  3PFI A;  4IQJ A;  2JPB A;  4G8X A;  5FD5 A;  5LLQ A;  2XRN A;  3DTI A;  3T8T A;  3ZQF A;  2RQP A;  3EPZ A;  3ZQQ A;  5KHD A;  2Y0M A;  3WTU C;  3FK6 A;  5IY5 H;  3AL0 B;  3M8E A;  2MD5 A;  4WXH A;  4M72 A;  2A5W A;  3MKY B;  3U9G A;  1LVA A;  2QEN A;  4A3J J;  2AS5 F;  1T56 A;  2C6Y A;  4Q48 A;  4L5I A;  5IOY A;  4M6X A;  4E7S A;  3IRR A;  2F48 A;  5C4J J;  1ZEL A;  4WWC A;  3CJT B;  2RNG A;  4XRM A;  2IS2 A;  4JK1 X;  2STT A;  1U8B A;  3SZT A;  1XG1 A;  3ECO A;  5F0F A;  4J00 A;  3V7S A;  1R6R A;  4ZTJ A;  1Y39 A;  1RR8 C;  5CVJ A;  1A35 A;  1TNS A;  3AG4 H;  4XLC A;  1XGM A;  2DOF A;  4RGS A;  5IYD J;  4A3K J;  2L0K A;  1WJ5 A;  2P8T A;  3KP5 A;  1E0E A;  3WGG A;  2IGN A;  2UZK A;  1KQ9 A;  3FXU A;  4II3 A;  2M0C A;  5DYM A;  1B8I B;  2H6C A;  2DCE A;  3RKQ A;  1Y6I A;  3V42 A;  2F4O B;  5IT9 Z;  3TBI A;  3J7Z I;  2Q1Z B;  3LFU A;  4KMF A;  3G73 A;  4BS9 A;  4AWX B;  3CD6 I;  3QYB A;  3S3M A;  4UVB A;  4V2F A;  4XOT A;  4BQN A;  2VAS A;  5FRO A;  5KAF C;  1G3T A;  3M4O J;  4QTR A;  3SDB A;  2RQQ A;  4CH7 A;  3I64 A;  4A3C J;  1HST A;  1ON1 A;  3FWE A;  3A03 A;  3G2B A;  2FQ3 A;  3MFK A;  4PZJ A;  2F6C A;  5TJJ A;  4IL6 C;  3PSF A;  2B0L A;  1VQ4 I;  1BI0 A;  5L3G A;  3HOW J;  5F08 A;  5LHI A;  2KRH A;  4RAG A;  2FXA A;  3OV8 A;  2ME0 A;  2DBB A;  2Y75 A;  1PJR A;  2DFH A;  5H2F C;  1XMA A;  3K10 A;  1DU0 A;  4KA4 A;  1XS9 A;  3Q0U A;  2NVX J;  2VBY A;  4KT5 C;  4EGZ A;  1SFK A;  4ENJ A;  2OZU A;  3FHN A;  3OL4 A;  4Y52 J;  4RB0 A;  1W5C C;  2KIM A;  1Q1V A;  4XIC A;  1NHA A;  2FBH A;  4DYR A;  2KLO A;  1WH5 A;  1B59 A;  1TWA J;  3HHG A;  4CYC A;  1JE8 A;  3CCU I;  4DIQ A;  3S15 J;  2V7F A;  2NOG A;  4X6A J;  3K1N A;  3J80 Z;  4P9U A;  4BE2 A;  3S32 A;  3RDI A;  2XB5 A;  4XID A;  1B9N A;  3M3Y J;  2IRF G;  1D3Y A;  1VQ8 I;  4LG3 A;  3V7C A;  3OYH A;  3S2H J;  2EA2 A;  2Z3Y A;  3W2A A;  2PN6 A;  5ILS A;  3EQL F;  2CJJ A;  2HWV A;  2L02 A;  3HSR A;  1BJZ A;  1TW3 A;  3WOD F;  3JR9 A;  3CCE I;  4LG0 A;  4M3F A;  4YII A;  2LBF B;  3RSN A;  2IPQ X;  3H9G A;  1OCR H;  4BQO A;  1UEL B;  1WI9 A;  4D0P A;  4KN4 X;  2X6W A;  1GVJ A;  4ABZ A;  2CMP A;  2L5Q A;  2LSO A;  3TW7 A;  4ZC3 A;  3VYS B;  3TQN A;  1O3R A;  3OOU A;  2ISZ A;  1BJA A;  3FIS A;  4BGD A;  4Q47 A;  3S8P A;  4DBQ A;  1W36 D;  1E17 A;  3E97 A;  3ZMV A;  3M1C A;  2YPR A;  1GXQ A;  3WTV C;  4LMY A;  2XKP A;  1HW1 A;  4E6K G;  3I55 I;  3JRG A;  3OIO A;  1V5E A;  3LQQ A;  1KU3 A;  1TT5 B;  4I0A A;  5J4V A;  2DO7 A;  2HR3 A;  3AG1 H;  3AKZ A;  5F6F A;  2WAQ N;  4DGW B;  2WAQ A;  1WRJ A;  4R1H A;  5B3S H;  2M34 A;  1YG2 A;  2WAE A;  1XDU A;  2UUZ A;  1JGG A;  1LKX A;  3NQO A;  3H5A A;  3GX4 X;  3PSI A;  2ME6 A;  1PP7 U;  3GME A;  3QU3 A;  1VQP I;  2D45 A;  5FKM A;  2G0E A;  2F5E A;  1Z91 A;  2HTJ A;  2CFO A;  1W7P B;  5HS8 A;  2P7C B;  4NUB A;  2QSF X;  2QVO A;  1F5T A;  1ETO A;  1DDN A;  5K7H A;  3CCV I;  2R93 J;  5CQG A;  3U21 A;  4A6D A;  2RKH A;  3WU1 B;  4HDV A;  4S04 A;  2ESN A;  2CQX A;  3H5N A;  1K79 A;  4DQ2 A;  3K2Z A;  5GPA A;  1IXC A;  2CU7 A;  3JSO A;  2XF5 A;  2IGM A;  3ZRG A;  4NQW A;  3DPU A;  3OYG A;  3RYR A;  5DDG A;  1DGW Y;  4W1U A;  3KP7 A;  4BXF A;  4AIJ A;  4BNC A;  5L3C A;  2NS0 A;  1GHC A;  4A3L J;  3CZ6 A;  1X1B A;  4ZZL A;  2VKD A;  3CF5 F;  3CDL A;  4OIQ F;  4AIH A;  2ESH A;  4RBO A;  4PCQ A;  3J7A Y;  3DKX A;  4H0E A;  4IJA A;  4RAZ A;  4IHS A;  3S2W A;  5FD6 A;  1SD6 A;  4I98 B;  1JKP C;  1A31 A;  3RIR A;  3P5J A;  4G9Y A;  2PMH A;  1ZH5 A;  4I0B A;  4Y13 A;  1DU6 A;  5HS9 A;  3V4G A;  4N4O B;  3C7J A;  3U2R A;  3G4S I;  1D0Z A;  1JTX A;  5LRR A;  5E3M A;  4IKF A;  3H3U A;  3IWF A;  4L18 B;  3ABL H;  3KET A;  3H92 A;  2ZXJ A;  2BW3 A;  2E5N A;  3UNG C;  1T39 A;  3E5Q A;  1KYZ A;  3RJP A;  2XSD C;  3CUQ B;  4XN0 A;  4Z2Y A;  2CO5 A;  2VI6 A;  3HBL A;  1JT6 A;  5BPI A;  2FMY A;  2LF7 A;  4PFP A;  3OYE A;  4IPA A;  3WG7 H;  4OMZ A;  4U87 A;  1A04 A;  2DJN A;  2QM3 A;  1I39 A;  4PGG A;  4L0Z B;  3HUG B;  1HF0 A;  1QHH D;  1XGO A;  4YEJ A;  1JUS A;  2PEX A;  4BU2 A;  2CV0 A;  2MW8 A;  2RDP A;  3JRH A;  4LB5 A;  2DW4 A;  3OS1 A;  1JJ8 C;  2VQH A;  4RM3 A;  3K70 C;  1FOW A;  2DQR A;  1HKQ A;  1R9T J;  2BY2 A;  2MC4 A;  2IJL A;  2CWE A;  2UXN A;  3DQV C;  3H5R A;  1IG7 A;  2HDC A;  2IA2 A;  3M9A A;  4I01 A;  2R5Z A;  1MZB A;  3T1B A;  4M9Z A;  2ZJP F;  1I3A A;  2W82 A;  4OOI A;  1UG2 A;  2ZKZ A;  3PJR A;  1QPI A;  2JT1 A;  2VQG A;  2ETH A;  3PFY A;  4IZZ A;  1W36 C;  2N8G A;  2XGC A;  5D6E A;  4A6E A;  4AU7 A;  4A0Y A;  3ABM H;  3ZXS A;  3T5X A;  3QOP A;  4MFD A;  1DPR A;  1ZYR F;  3DEU A;  3I0T A;  4M3D A;  4XLF A;  4XMY A;  5ERI A;  5KNL A;  2OV7 A;  1LE8 B;  4Z6Y A;  3FBI B;  2K5C A;  1W5T A;  2XB0 X;  4RGX A;  5F0H A;  5CVI A;  3FXK A;  3LA7 A;  3K2A A;  3R60 A;  2D5V A;  5K5O A;  4JBA A;  3K4B A;  1N75 A;  2COM A;  2IA1 A;  4E7I A;  4GXO A;  3WU2 C;  2JWT A;  1RKW A;  3OR1 C;  2WY8 Q;  3TOB A;  1FMW A;  1FIP A;  3FBN B;  3HGY A;  3D1N I;  4NHJ A;  1FBU A;  2E36 A;  3E6B A;  3SFI A;  1K4T A;  2YU3 A;  4OWR B;  2DOE A;  1FYM A;  3P9I A;  1QO0 D;  5IT9 K;  2M0M A;  1GDT A;  5JLX A;  1AOY A;  1M1E B;  1D8K A;  3C2H A;  3ZMT A;  2DLL A;  1TQI A;  2E2J J;  3EDP A;  1O7L A;  2NS8 A;  2XPW A;  1CQT A;  1LUJ B;  2FML A;  4AYB N;  4PGH A;  2EQR A;  5AIQ A;  1YO5 C;  1TC3 C;  2CS3 A;  3ELK A;  5E1Z B;  2XRL A;  4JYK A;  3CCR I;  2XAQ A;  4H4K C;  2X1C A;  1U9N A;  2NVQ J;  2ELK A;  1BR1 A;  1U3E M;  1D5V A;  3CME I;  4NNJ A;  1XX5 A;  5D6F A;  2A61 A;  3Q0W A;  4KIF A;  3ZQ7 A;  5HDG A;  5DUI A;  3E3V A;  4CSW A;  3CF2 A;  2NVT J;  2DMT A;  2HDW A;  3GTG J;  1ZAO A;  1WI3 A;  1RZ4 A;  2ZXW H;  4G94 A;  3PIO F;  3VB2 A;  1RUO A;  1MMN A;  3RZD J;  1FC3 A;  1JI8 A;  2KT0 A;  2BBY A;  1V55 H;  4P96 A;  4EJV A;  1Z77 A;  2LLK A;  1Y56 A;  3RQ4 A;  5K5Q A;  2V1X A;  2WA0 A;  2EV6 A;  2X6X A;  3K4N A;  1QZE A;  5IPA A;  3A0H C;  2LNB A;  1U5T B;  2XAU A;  3L9F A;  4X0G A;  2IS6 A;  3O8H A;  3OR2 C;  3EUH A;  4EAT A;  1XSD A;  1FOK A;  2HI3 A;  2XAS A;  4Y33 A;  2NYX A;  3ZGK A;  1P4X A;  1T95 A;  3LSP A;  5J8C A;  5K1Y A;  1R4N B;  2IW5 A;  4L5J A;  5JFR A;  1W0U A;  2JMW A;  4HLX A;  5ILU A;  1WHU A;  1B8I A;  1QVT A;  4CCM A;  4DZJ A;  3DCF A;  3H0G J;  2KRF A;  4RGR A;  4QIW N;  2E1M C;  2LK2 A;  5LGU A;  1K83 J;  1ETQ A;  1OPC A;  1ZGW A;  2OA4 A;  2YX4 A;  4XLE A;  3OYM A;  4KFC A;  4U0Y A;  3G71 I;  4LOC A;  2MH9 A;  5J1Y A;  2BXZ A;  4G6Q A;  2HNH A;  1V3F A;  3SZG A;  3MKL A;  3HOY J;  1BN5 A;  3P9K A;  4CCJ A;  2QWW A;  3KYL A;  3DV8 A;  2M7A A;  4CGZ A;  2V9K A;  3MVP A;  4BE1 A;  2QGU A;  1ZRC A;  5F1J A;  3I54 A;  3ASO H;  3ISP A;  5ICC A;  2R7D A;  1HKS A;  2QYO A;  1WSU A;  1IGN A;  3G1O A;  2HXO A;  5LFA A;  3BJ6 A;  1LB2 A;  5FLM J;  5HNH A;  2HXI A;  1HDP A;  4BBR J;  4HNT A;  2K9S A;  3BTI A;  2VN2 A;  5H6Q A;  1R1U A;  5FRN A;  2K27 A;  2IEK A;  3LMM A;  2P5L C;  4PUS A;  4OU0 A;  3GCM A;  3JTG A;  3A2K A;  1LVK A;  4C2T A;  2K4B A;  1BA5 A;  2CRG A;  2E5Z A;  3HM5 A;  1RNL A;  2HOA A;  4BQQ A;  3HXL A;  2PFB A;  5IP9 J;  3PUF A;  1F43 A;  2DTZ A;  3E1S A;  2OD5 A;  2ICW G;  1FIA A;  4D9J A;  1T0F A;  3SQN A;  2AHQ A;  3FXQ A;  1SD7 A;  2EPF A;  4XOR A;  1J0R A;  2K9L A;  2MYS A;  2VQL A;  2MLG A;  3QPT A;  5HS7 A;  1Z7L A;  2IXS A;  1IXS B;  3REO A;  2E2H J;  1VQM I;  5J1U A;  4QSH A;  1BR2 A;  2QQA A;  3BR6 A;  4N4N B;  4UNO A;  4OAZ A;  1ACI A;  4GRI A;  3G1M A;  2LBF A;  4FCY A;  3MWM A;  2DDA A;  2CG4 A;  4PJL A;  4CZZ A;  3IH2 A;  1P7J A;  2F5D A;  3GTL J;  1JGS A;  2LMD A;  3MQ0 A;  4BAC A;  1OCZ H;  3I3L A;  1DP7 P;  1UHM A;  2BHZ A;  3LOC A;  3S2D J;  2O03 A;  2BW3 B;  2AXL A;  2BV6 A;  3ZPL A;  1I3Q J;  4B43 A;  3GVA A;  1K6O A;  2STW A;  4FTH A;  4EM0 B;  4N9I A;  1EF4 A;  2O5R A;  4LGW A;  3GTM J;  5DM7 F;  1J7K A;  3HHH A;  2B7E A;  1BC7 C;  3Q3S A;  1IJW C;  3K1M A;  1ZLK A;  4C2U A;  4HRI A;  3KX2 A;  2VKE A;  2L01 A;  2P5K A;  1WGX A;  2HPM A;  2R7F A;  3M07 A;  4ZYE A;  2YX7 A;  2HZT A;  3FKJ A;  4ESF A;  5E3O A;  1BIB A;  4KUM A;  1RC9 A;  3I4P A;  3CTA A;  5HLT A;  1XSX A;  3ZN0 A;  1K6Y A;  4U7B A;  1J75 A;  2JA2 A;  2EFP A;  3BP8 A;  2G7H A;  4M6Y A;  3HKZ N;  3W3C A;  4XL9 A;  1XCV A;  3WTW C;  1J9I A;  3E6D A;  3WG9 A;  1OCT C;  2JTV A;  5D5U B;  2DTR A;  2WV1 A;  4Y4R A;  2ZME A;  2ZJ2 A;  1AHD P;  3PO2 J;  3H3V K;  2K7L A;  1W7P A;  3PO3 J;  3F6V A;  1HA8 A;  2LY2 A;  3OOP A;  1QNT A;  5IT3 A;  2L7Z A;  2V9P A;  4UV9 A;  4ZYA A;  4XQF A;  2VJ5 A;  4NB5 A;  1R36 A;  4Y17 A;  3WTZ A;  1NK2 P;  3JW4 A;  2JSP A;  1SFO J;  3DKY A;  5BQT A;  3OYK A;  1LPQ A;  2M45 A;  2XIG A;  3FMR A;  2DT5 A;  4C3I J;  5CKT A;  2FE3 A;  3T0Y A;  5CVR A;  2HVS A;  1BI2 A;  2PJP A;  3MMY B;  1ZG5 A;  2V79 A;  2VB6 A;  2DPU A;  2MFZ A;  2ZB9 A;  3OYB A;  3EUA A;  1WJB A;  1HDD C;  3V8J A;  3GO5 A;  1X3U A;  1MKM A;  4A93 J;  5DTD A;  2I10 A;  2GA2 A;  3FK7 A;  4EVI A;  3CMA I;  2JA7 J;  2RNJ A;  4HQM A;  1TWF J;  3DTE A;  3F0C A;  5ILV A;  2AXT C;  1FTT A;  3GEZ A;  2IGO A;  1ZQ3 P;  3PNY A;  3LSR A;  3JRF A;  2ID6 A;  3CDI A;  5E1W A;  2CUZ A;  2OBP A;  2L7F P;  5F27 A;  4A5N A;  1MW7 A;  5GAG J;  1TNT A;  1ZG3 A;  4V2G A;  3TDZ C;  3ZQI A;  4HNV A;  3HOS A;  2EFN A;  1J2X A;  1R1V A;  1GT0 C;  3PNT A;  2ZC2 A;  1JJ6 C;  2HDD A;  1F4K A;  1FYL A;  4CCN A;  2EWN A;  2HQ5 A;  3WE3 A;  5J8F A;  5FLX Z;  1BC8 C;  4BJ6 C;  5LBQ A;  2VQC A;  1D1C A;  3TW6 A;  3QP5 A;  2FOK A;  4DZP A;  3KE2 A;  3GTQ J;  3KPH A;  2L54 A;  4X1E A;  4CXF A;  2A6E F;  2M1B A;  2O0Y A;  3AFH A;  1LFB A;  5HLI A;  5CLS A;  2HKX A;  1K78 B;  1UHS A;  3CUQ A;  3CP8 A;  5K7F A;  3OWT A;  1MD0 A;  2FQ4 A;  3GTJ J;  3ZN1 A;  1H88 C;  3J7A O;  3L2U A;  2BHY A;  3K4L A;  4I02 A;  1ZAR A;  1XGN A;  2EZI A;  1CF7 B;  3FDY A;  1MBE A;  5FLV A;  1GXP A;  1ZTR A;  1B72 B;  3FXR A;  3IWZ A;  3FX3 A;  3HUG A;  1HOM A;  1W1W E;  1S6L A;  2VC0 A;  2EBI A;  3VYU B;  3K1P A;  2WY7 Q;  1V54 H;  1QBJ A;  5CVU A;  2A5Y B;  2M4K A;  4Y15 A;  1X1C A;  2ZNY A;  2HOE A;  1KZH A;  3AL0 C;  1B1B A;  3LSI A;  1GLN A;  1KA8 A;  4FX0 A;  2VOO A;  2IBD A;  1XDS A;  4IOC F;  3O3K A;  3WTS C;  3S1M J;  3PQJ A;  3JAM K;  1Y1W J;  4OIN F;  5CPR B;  1P6R A;  2FSW A;  2KL4 A;  2JRT A;  1ERD A;  3I71 A;  1ZR4 A;  3WU0 A;  4ANJ A;  1T6S A;  3CLO A;  2P6T A;  5ED4 A;  2R7S A;  1LE8 A;  4I2O A;  5C4X J;  1OYW A;  1GUU A;  4HPQ A;  1R1T A;  4MNU A;  3MKW B;  4XK4 A;  1W7P D;  1SAX A;  3WTT C;  3BPV A;  2NNY A;  1FOY A;  1HXD A;  1QRY A;  2HQN A;  4GDF A;  3COA C;  1VTN C;  1MBK A;  2AQE A;  2DA6 A;  3F72 A;  4Y3O A;  2DMQ A;  1T33 A;  2GOM A;  1KQ0 A;  1WWX A;  4IRG A;  1G59 A;  5E20 A;  2KJC A;  1K7A A;  3KLO A;  3LSJ A;  3DWL E;  4HV6 A;  5LGN A;  2EIM H;  5JVT A;  3ZQL A;  2V9V A;  1YW9 A;  1IDY A;  5FJ8 J;  1T2K A;  2HVQ A;  1QPM A;  3RKX A;  2LR8 A;  3DKW A;  4AVP A;  1GV5 A;  1H9T A;  4MGR A;  2CUE A;  3AG3 H;  1ZRF A;  1D8J A;  4RAF A;  1KYW A;  2CW7 A;  4RS8 A;  2ELJ A;  2DA2 A;  2JPC A;  2LTP A;  1IRG A;  5DD4 A;  2M87 A;  2E7W A;  2VIX A;  5C44 J;  4A3M J;  1RR7 A;  5M5W J;  4D7M A;  1SMY F;  3GTO J;  3TO9 A;  3BZC A;  2BY1 A;  2ZSH B;  4ZZD A;  2DAO A;  3SJM A;  3IKT A;  3C2B A;  3F3X A;  2E19 A;  2EJR A;  3BG3 A;  2GQQ A;  2I8D A;  5LGT A;  5E8G A;  4EMS A;  5D5V B;  2ELH A;  1SC7 A;  3FXM A;  4PJN A;  2BVM A;  1BOB A;  2M8G X;  4NC6 A;  1VI0 A;  2X9D A;  2E34 A;  2PJR A;  3EYI A;  2XSJ C;  3VSK A;  4BY1 J;  1X1D A;  4CA0 A;  2ECB A;  2W48 A;  1U5T A;  1IV8 A;  4EGY A;  2NXN B;  3HRM A;  2ISY A;  4XOP A;  2CQQ A;  2HQR A;  5D5X B;  3HTU A;  1QA6 A;  2E1O A;  1F36 A;  2AO9 A;  2K86 A;  2XKO A;  5ICE A;  2FUG 2;  3DU6 A;  3CJR B;  1Z3Y A;  2IS1 A;  3V8L A;  2JVG A;  2M8E A;  3H1C A;  4B44 A;  2EFQ A;  2ZXI A;  3U1D A;  3KYC B;  2A68 F;  1ITY A;  2XC7 A;  2R7R A;  3BQZ A;  3WHC A;  1S72 I;  1YIO A;  3UR3 C;  5KCM A;  1QQI A;  3A4C A;  4FX4 A;  4ASN A;  4LLL A;  4F91 B;  3I53 A;  2M9H A;  3ERM A;  3CC7 I;  2LC2 A;  3P9C A;  1UG0 A;  2HU9 A;  1BR4 A;  1Y8R B;  1S7A A;  1UZC A;  2FJ1 A;  1VF9 A;  3ZR8 X;  3TO7 A;  4HYE A;  1E3O C;  1R22 A;  2ZME B;  4FET A;  3RTR A;  1X2M A;  1D1B A;  2LVS A;  3F6O A;  4HF2 A;  3DU5 A;  2DA4 A;  4HX4 A;  5C3E J;  2Q0O A;  2Y2Z A;  5J47 A;  2R7Q A;  4FHT A;  2PX9 A;  3KIO A;  2VBW A;  4AD9 A;  4BE0 A;  5TRD A;  2A05 A;  1XPX A;  3RZO J;  1T98 A;  2L9V A;  1WCM J;  4MTE A;  1MMG A;  3OYA A;  4IO9 F;  4E4H A;  4DYC A;  3K4K A;  1TWH J;  4B1R A;  3NWS A;  1WPK A;  2LP0 A;  4MFE A;  3NAR A;  3BR3 A;  3L09 A;  4E70 A;  1MJB A;  2Y31 A;  5LRS A;  2UV1 A;  2Y0S N;  4L5E A;  4XSZ F;  4ITV A;  3B6A A;  4M3G A;  3FXJ A;  1IN4 A;  2Y0S A;  3DXJ F;  3ZCO A;  2V6C A;  3BPX A;  1I6H J;  4HV5 A;  1EH6 A;  3HOU J;  2KDO A;  3DF8 A;  4C2M J;  2R7V A;  4XLH A;  1J5Y A;  3ZMD A;  1KGS A;  1ZKG A;  4IF4 A;  3Q0V A;  1XGS A;  3FMQ A;  4KIB A;  1Z3X A;  2DOA A;  2PG4 A;  2CQK A;  4KMU X;  3WGI A;  3S17 J;  3B02 A;  4ENK A;  3Q9V A;  4MLO A;  3KZY A;  2PJR B;  1USS A;  1MJA A;  2LY1 A;  4A3D J;  1MJ9 A;  1WH7 A;  3TP3 A;  5K7Z A;  5KVR A;  2IS4 A;  4BDY A;  2MAB A;  4HBL A;  1EJ9 A;  2KPM A;  2HS5 A;  3M8J A;  2Z5U A;  3QWL A;  1XMX A;  4XLP F;  1YTY A;  2R7Z J;  3JRC A;  3MCZ A;  3QOD A;  5L3E A;  4GFB A;  1D5Y A;  3GZN B;  5GAD J;  1ZGA A;  1E3H A;  4B47 A;  2DT6 A;  4NC8 A;  4S05 A;  5EEA A;  1UCR A;  3O6B B;  1QVU A;  4C3H J;  2W84 A;  1IN6 A;  1Q1H A;  3VOD A;  4L9J A;  2XUB A;  5HDK A;  3AG2 H;  3PIP F;  1HSJ A;  3D5R C;  2RRE A;  2JVH A;  3CCL I;  1F9N A;  1MSE C;  2E60 A;  2Y9Z A;  3KLN A;  2HKO A;  3M1E A;  2Z33 A;  2VJI A;  4RMN A;  4J01 A;  2DN0 A;  2KKO A;  1ULY A;  3R4K A;  3FZV A;  5HDN A;  1U78 A;  1LDD A;  3ZOB A;  1RET A;  3HSF A;  3J81 Z;  5IP6 A;  2DYR H;  1I1S A;  2YR2 A;  1BM9 A;  4C30 A;  3RPQ A;  2CW8 A;  3CUQ C;  1B4A A;  5FLX K;  1PUF B;  4WXD A;  1XD7 A;  3FIW A;  4HW0 A;  3CO7 C;  4IHV A;  3LNQ A;  3L2Q A;  3BTC A;  1YW7 A;  1RKT A;  3FKI J;  3CO6 C;  2DPD A;  5JHU A;  5LEK A;  2WC2 A;  1ENH A;  2XPV A;  2H1L A;  1JHH A;  5DCM B;  3WTY C;  2Z9O A;  4MQV A;  4ZJZ A;  2B63 J;  1HW5 A;  2M3A A;  2QCO A;  2GXB A;  2M7B A;  3KP3 A;  5DV5 A;  4A2U A;  3W2V A;  4E7L A;  1TL8 A;  2DFI A;  4GYG A;  4QPQ A;  3GYH X;  2XAH A;  4ENN A;  4C3J J;  5J4Y A;  5EDN A;  3BT9 A;  1LQ1 A;  3OS0 A;  1W4M A;  4BHC A;  1ON2 A;  4M6V A;  4CCL A;  1VZ0 A;  1IAW A;  3HYI A;  3DBH B;  4DOZ A;  1Y8Q B;  2DA7 A;  4IOA F;  4BY7 J;  3F22 A;  1FJL A;  4XSX F;  2HFH A;  4PSX A;  4WXC A;  4A5M A;  3GFI A;  2H1K A;  2DXI A;  2ZSI B;  4G6D A;  2ID3 A;  1BBY A;  1OYY A;  4RLQ A;  4XKW A;  3LSK A;  1FT9 A;  1UMQ A;  2L7K A;  1UB9 A;  2P5V A;  3CCS I;  1IF1 A;  3B6C A;  3MD2 A;  3GZ6 A;  1I27 A;  4HOB A;  2QF7 A;  3E7L A;  5JVG F;  2J5P A;  1YIT I;  5CQE A;  3RI4 A;  3PUB A;  1R5H A;  3HEF A;  3ABK H;  4CDG A;  1K78 A;  1Y0N A;  4BH9 A;  2XF7 A;  3QP6 A;  5LHG A;  1JKR C;  1R4M B;  1Z67 A;  2HOS A;  3BR2 A;  3FM3 A;  4NC7 A;  1X3Z B;  2DA5 A;  1N78 A;  3F21 A;  1BOA A;  5B5E C;  3QPS A;  1CF7 A;  2KRC A;  3QU6 A;  5K5R A;  2O7O A;  1B72 A;  3HJE A;  1SFE A;  2H09 A;  4B8X A;  1YJW I;  2H8W A;  3VDX A;  3HOX J;  4G7O F;  3MAJ A;  2VUM J;  3RKW A;  5EG0 B;  3HL2 A;  2X1D A;  2E2I J;  2VT2 A;  1U8R A;  3KYD B;  1T8I A;  2L4M A;  1R49 A;  4RM2 A;  2VBZ A;  4HZF A;  1YOV B;  3TDU C;  4DJA A;  1RIO H;  4BHB A;  2QQ9 A;  1QGP A;  2Y69 H;  3QPH A;  3HIF A;  2FD5 A;  2LRE A;  3CCY A;  3OYC A;  4UUV A;  3J80 K;  1ONV A;  5L3D A;  2Q8K A;  1A5J A;  5JLW A;  3IH3 A;  1X2N A;  4W97 A;  2EIN H;  3BWG A;  4BKX A;  3R6S A;  2OPT A;  2WWY A;  1MH4 A;  5E1X A;  4KYW A;  1U5T C;  4XLN F;  3X2Q H;  4IHW A;  3F9K A;  5D8K B;  5J6X A;  5H20 A;  1NK3 P;  2G7U A;  3DBL B;  4M9S A;  3L7W A;  4PJ0 C;  1Z0X A;  2K9Q A;  5E8I A;  4P9F A;  3G3Z A;  1OCC H;  4UY8 I;  3G1L A;  2V1N A;  2LD5 A;  2ZO4 A;  1RRJ A;  5DS9 A;  1ETV A;  3QRF F;  2VL8 A;  1TQM A;  1F1Z A;  3NAU A;  3I9V 2;  3I5U A;  2IP2 A;  5EEH A;  4BEH B;  3BG7 A;  1YHQ I;  1YI2 I;  1D0Y A;  1L0O C;  3N4M A;  1ETK A;  1WJD A;  2OAZ A;  1FLI A;  3CJN A;  2F2E A;  4CIC A;  2W7N A;  1G2H A;  2W00 A;  3HGG A;  3L00 A;  4XN3 A;  4P55 A;  2QA4 I;  1I6X A;  5LEJ A;  2QEX I;  4XR6 A;  5AON A;  3ROU A;  3P7N A;  3TP0 A;  4WK8 F;  1VQL I;  1AKH B;  1X1A A;  2DA1 A;  3ZMZ A;  4HNU A;  4D5C A;  4L9T A;  2A07 F;  4M71 A;  1Z21 A;  5E79 C;  4HST A;  5BMZ A;  1H8A C;  4A3I J;  4LB6 B;  2H8R A;  2QBY B;  3WTX C;  2EV5 A;  2ECC A;  2VJ4 A;  3LST A;  3L2V A;  1NG6 A;  1SAU A;  2F5C A;  1GVD A;  2KQR A;  3MN2 A;  2W85 A;  2YU9 J;  1SVO A;  3GFL A;  3PM1 A;  3HOT A;  3SDG A;  3BQY A;  9ANT A;  1FP2 A;  1SD4 A;  4UXN A;  1FOX A;  1XMK A;  4BL0 B;  1YX3 A;  1DP3 A;  2XAG A;  3IL2 A;  1S7E A;  1ZRD A;  1Y1V J;  3ZQG A;  2HZD A;  4XRS A;  1S8N A;  3F8M A;  2VBX A;  3TGN A;  1REP C;  3K4M A;  1ETX A;  3SZP A;  4IXA A;  3QYE A;  3LA3 A;  5DUK A;  2W1O A;  3O8G A;  2XRO A;  1X3W B;  2ZFW A;  3LSG A;  4JQF A;  4I6Z A;  1SMT A;  5EJC A;  1N77 A;  3W6K B;  3ERE D;  5J3L A;  2VE9 A;  3S16 J;  4IHT A;  2JA5 J;  3FHZ A;  1JXS A;  1EH7 A;  4XKV A;  2JUC A;  4LIT A;  4PJM A;  2R7U A;  1FTZ A;  2ZNZ A;  3OYI A;  4UV8 A;  2EZL A;  1JUM A;  2LY9 A;  5D4R A;  4XRS G;  2BY0 A;  4OIR F;  3LSM A;  2KJB A;  4D5F A;  3BR5 A;  5DEQ A;  1FBS A;  3NRV A;  1IRX A;  1EV7 A;  2KZG A;  2R3S A;  2X48 A;  1X58 A;  2GBY A;  3TOA A;  5TIS C;  4IRI A;  1H9G A;  5FFZ A;  1T08 B;  2K9M A;  2NOJ B;  4E7Z A;  1VQN I;  5BOX A;  3HOV J;  2OU2 A;  5EGO B;  1VFC A;  2VOD A;  4I76 A;  2VPR A;  1P92 A;  2L3D A;  5GPC A;  2DU9 A;  2XAJ A;  3GFJ A;  1Z9C A;  4PFO A;  4G7H F;  5BPD A;  2YSR A;  4HG2 A;  1R71 A;  1TQP A;  2DI3 A;  2V1D A;  3U1K A;  2R4G A;  3HPG A;  5L3B A;  2F5V A;  3K9T A;  3L2R A;  4M9X A;  1WJA A;  1ETY A;  1YQA A;  1P7I A;  5CJ9 A;  1SFU A;  2P81 A;  1O3T A;  4NBQ A;  4A3G J;  5KK1 A;  2VXD A;  3OY9 A;  2R0Q C;  4RB2 C;  2RN7 A;  2LDU A;  2XVC A;  3EUK L;  2EIK H;  3ZMS A;  3A01 B;  2IVM A;  2BE5 F;  3KP4 A;  1R5G A;  2X1E A;  3BZK A;  2OQG A;  4NDL A;  2LG4 A;  3R0A A;  3ZQH A;  2V6E A;  4ESJ A;  5J1R A;  1TW2 A;  3IKV A;  2MD0 A;  3SXY A;  4YRV A;  4LJZ F;  2MC3 A;  3CCQ I;  4ESB A;  4PDK A;  3LAJ A;  4EEF G;  1V5G A;  3LA2 A;  4A69 C;  2VT3 A;  4KIC A;  2DMU A;  4BAY A;  2RVC A;  5LHH A;  1STZ A;  2FA5 A;  2VC1 A;  5FKL A;  1TLH B;  4RDU A;  3S93 A;  1MBG A;  2RGV A;  3I58 A;  4GYI A;  3J81 K;  3GW2 A;  2EIJ H;  3I59 A;  4UUS A;  4U0W A;  2PQ8 A;  2O8K A;  3HG9 A;  2K4J A;  1K61 A;  4AM3 A;  1J59 A;  4A0X A;  4TV7 A;  4LK1 F;  5DD8 A;  2R92 J;  2XPU A;  4UHT A;  3MZH A;  2PI0 A;  2R5Y A;  2BY3 A;  5JR3 A;  2TRT A;  3WGH A;  4CCO A;  2BXY A;  1YJN I;  3OYJ A;  3DEW A;  1SEU A;  3I4N J;  3DPL C;  2W24 A;  4I09 A;  2LKS A;  1W0T A;  1WZ2 A;  1ZGJ A;  1OCP A;  1IXR C;  2P4W A;  1P2F A;  1VQ7 I;  4YIR X;  3A02 A;  1JTY A;  3BJO A;  3LQR A;  4P1W A;  1OKR A;  3TED A;  2QZ8 A;  1UAA A;  3F8N A;  3IH4 A;  3LL7 A;  4CUG A;  3GWZ A;  4IVN A;  1MDM B;  4QWQ A;  2RV8 A;  3DPT A;  2JSC A;  4KJZ A;  1AA7 A;  4OMY A;  1VND A;  5DM6 F;  2BVL A;  4BUP A;  1OR7 A;  2GXA A;  4EJO A;  4LK0 F;  2Y9Y A;  3BG5 A;  4JX4 A;  2LFB A;  1AU7 A;  4OIO F;  3VWB A;  5IP7 J;  2XV4 S;  2ZCW A;  3GLL A;  4CCK A;  4R79 A;  3BCA A;  3S3N A;  1ZLJ A;  2GIV A;  1OCO H;  4HDU A;  2DMP A;  2B9S A;  2CW0 F;  2M4G A;  1IUY A;  5M3M J;  1TWC J;  2CYY A;  2VOP A;  3LAP A;  2DOD A;  4XKB A;  5HLG A;  2R7W A;  2DA3 A;  3BZ6 A;  2X6O A;  3FF5 A;  3VYT B;  3HRS A;  3LSH A;  1PUF A;  3MEX A;  1PDN C;  1JT0 A;  1POG A;  5CVV A;  2CGP A;  3T8R A;  2O3F A;  1TP4 A;  3V7R A;  3PNV A;  1BW5 A;  3OIP A;  3KZI C;  1WJC A;  2L4A A;  2HEO A;  1BW6 A;  3C18 A;  4G7Z F;  5DCM A;  4AC0 A;  2XAF A;  2KZV A;  3EUH C;  4F92 B;  1SD5 A;  3FM5 A;  4K2E A;  2OF7 A;  3BDD A;  3E5X A;  1QZY A;  4XRF A;  2NRA C;  1H89 C;  4Y7N J;  1TZL A;  2PMZ N;  5FKO A;  4HAM A;  4U7D A;  2PMZ A;  5F04 A;  1VQK I;  1IN7 A;  3DP7 A;  3IHU A;  2HVR A;  3H3Z A;  3JRA A;  2HYG D;  2OJE D;  2CSO A;  2QUF A;  2DMN A;  4EV0 A;  1JHF A;  4DW6 A;  3I4M J;  2NVU B;  4GGG A;  2VJJ A;  1IDZ A;  2LF8 A;  2A69 F;  1SFX A;  1LDJ A;  3CES A;  1A6Q A;  1LFP A;  3R0J A;  1GV2 A;  4U88 A;  5M5X J;  4YFX F;  1OLT A;  1P4W A;  1FYK A;  2XGX A;  1YS7 A;  3SEQ A;  5HOD A;  5F1R A;  4UB6 C;  5DCF A;  1PP8 F;  2O8X A;  3CMM A;  2K3F A;  3D0S A;  4B3A A;  4F7Z A;  1A6I A;  2FEZ A;  5FFX A;  2IA0 A;  5IYB J;  4G12 A;  3ASN H;  2HTS A;  2LRD A;  2W4S A;  1FP1 D;  1YW8 A;  3SYT A;  1BIA A;  3IAS 2;  2NAZ A;  4EM1 A;  3BG9 A;  3JSP A;  5B1B H;  1OJL A;  2W25 A;  4N0B A;  1O57 A;  3RQI A;  1ZG1 A;  5HLH A;  3W6J B;  1WQ2 A;  3CCM I;  2WB1 N;  4RAY A;  1MNM C;  3CC2 I;  3OIQ A;  3M8F A;  1T0F C;  4HX8 A;  4S0H B;  2WB1 A;  5EG0 A;  4E7J A;  3SFZ A;  2XHK A;  1UFM A;  2OZ6 A;  4FT8 A;  4CYD A;  1JUP A;  1CGP A;  1ZN2 A;  1DPU A;  3J7Y J;  1IRZ A;  3K70 D;  1G3W A;  5EZH A;  1S5L C;  2WBM A;  1G3Y A;  5GAE J;  3OSF A;  4BDZ A;  4OIP F;  3PQK A;  1LJ9 A;  4ZYH A;  2FOW A;  5D5W B;  4M3B A;  2Z1D A;  4HA8 A;  2LKX A;  4DYQ A;  4ZTF A;  3HOZ J;  2ZJR F;  4UVC A;  3EYY A;  3CC4 I;  4O3M A;  5B66 C;  4HLY A;  4ZDP A;  1B9M A;  2Y48 A;  1FSE A;  4OAY A;  5FRM A;  4LIU A;  2VE8 A;  3HTS B;  3VYR B;  1PYV A;  1YX5 A;  3S1R J;  2CV1 A;  2OQR A;  1KON A;  2QSH X;  1XC5 A;  4MEX F;  1W5S A;  3M7G A;  4EM2 A;  2GWR A;  2MLK A;  4M3E A;  5BNG A;  3V8K A;  2X0L A;  1IN8 A;  3FXL A;  2OUM A;  4O6J A;  4D7N A;  5TGT A;  1O3S A;  4MEY F;  4IHX A;  2OCE A;  2M5W A;  1FZP B;  4M74 A;  1ORK A;  5ICG A;  1YLF A;  3NWT A;  3ABT A;  3A1Y A;  2EZK A;  3BJA A;  1O4X A;  4BEH A;  2ZBK A;  2TDX A;  3R61 A;  1VQO I;  3S14 J;  4XKC A;  2X51 A;  3GTK J;  2VPL A;  4EQQ A;  1HCR A;  4WX9 A;  4YG2 F;  2XDV A;  1P9Q C;  2H6B A;  3KEO A;  3ML6 A; 
#chains in the Genus database with same CATH homology
 3PIO F;  3I55 I;  1VQ9 I;  1YJ9 I;  2ZJQ F;  3CCS I;  1FOX A;  3J7Z I;  2OTL I;  5JVG F;  5DM7 F;  3CD6 I;  1YIT I;  1HC8 A;  5GAD J;  2E34 A;  1FOW A;  1YJN I;  2NXN B;  1VQP I;  1VQ7 I;  1QA6 A;  3CCJ I;  2K3F A;  2ZJP F;  4V19 K;  1VQ4 I;  3PIP F;  3DLL F;  3CCL I;  1YJW I;  3G71 I;  2H8W A;  5DM6 F;  3G6E I;  3CCV I;  4IOC F;  1S72 I;  3CCM I;  3CC2 I;  1VQN I;  3CC7 I;  5GAH J;  3J7Y J;  1FOY A;  5GAE J;  3I56 I;  2FOW A;  2E36 A;  3CCU I;  1YIJ I;  2ZJR F;  3CF5 F;  3CC4 I;  1VQ6 I;  4IO9 F;  4UY8 I;  3CMA I;  1VQ8 I;  1YHQ I;  2JQ7 A;  1YI2 I;  1MMS A;  2E35 A;  3CCR I;  3CCE I;  2OTJ I;  3G4S I;  5GAG J;  2QA4 I;  3CJT B;  2QEX I;  1VQL I;  1VQM I;  1VQO I;  1VQ5 I;  3CME I;  4IOA F;  3CCQ I;  1Y39 A;  1VQK I;  1ACI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...