4IOAJ

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
136
structure length
136
Chain Sequence
b'KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVMSRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 20
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 4ioaJ01
1VQ6H 3CPWH 1Q82J 2OTJH 1YJWH 3CC2H 1KD1J 1VQMH 1VQLH 3CD6H 1Q7YJ 3CXCH 3CCQH 3CC4H 1YJNH 5H1SO 3CF5J 4U67J 1N8RJ 3J7ZM 1YITH 5GAEN 3G4SH 1WKIA 1VQOH 3DLLJ 1JJ2H 1KQSH 3CCSH 4WFAJ 2QEXH 3PIOJ 3I55H 4WCEJ 3CCEH 5JVHJ 1VQ9H 1QVGH 1QVFH 3CCMH 1YIJH 1Y69K 1S72H 1Q86J 2ZJQJ 1Q81J 2ZJRJ 5MLCO 3CMEH 2OTLH 4WFBJ 3CCUH 3I56H 1VQ5H 5DM7J 1VQ8H 3CMAH 1W2BH 1YJ9H 3CCVH 1M1KJ 1YHQH 3G71H 1VQPH 4IOAJ 5GADN 1K8AJ 4WF9J 4WFNJ 5DM6J 1VQNH 1VQKH 3CCJH 1NJIJ 4IOCJ 1YI2H 3OW2H 5HL7J 2PA2A 1VQ4H 3CC7H 1M90J 5GAHN 3PIPJ 3CCLH 1VQ7H 2QA4H 1K73J 4IO9J 4UY8M 1KC8J 5JVGJ 3G6EH 5GAGN 1K9MJ 5AN9F 3CCRH 2ZJPJ
chains in the Genus database with same CATH superfamily
1VQ6H 3CPWH 1Q82J 2B7PA 2Q5WE 1OTPA 1AZYA 1FMAE 1WYGA 3ETRC 4C7YA 1BRWA 2OTJH 1YJWH 3CC2H 1KD1J 1UOUA 1VQMH 5AYYA 1VQLH 3CD6H 1N61B 3RPFA 3NVZC 2OMDA 1Q7YJ 4I9AA 3CXCH 3CCQH 3CC4H 3WO1A 1YJNH 1N62B 4X46A 1O4UA 5H1SO 3CF5J 4U67J 1N8RJ 3J7ZM 1V97A 1YITH 2W55B 5GAEN 3G4SH 2WP4A 1N5XA 3WNZA 1VLBA 2W3SB 1QPNA 1WKIA 5EP8A 3NVYC 1VQOH 3PAJA 3DLLJ 1YTKA 1JJ2H 1KQSH 2WK6A 4XR5A 4C80A 3CCSH 1N60B 5HUOA 4WFAJ 2QEXH 3PIOJ 3SR6C 2I1OA 3I55H 4WCEJ 4GA4A 2TPTA 2QIEA 2J0FA 3CCEH 5JVHJ 1VQ9H 1QVGH 1NVJA 1QVFH 3CCMH 1QPRA 1YTDA 1FIQC 1QPQA 1YIJH 1Y69K 1S72H 2W3RB 1Q86J 2ZJQJ 3L0GA 4US9A 1X1OA 1Q81J 3EUB4 2ZJRJ 3NVWC 3BIIE 3C2RA 3VMMA 5MLCO 3CMEH 3C2VA 4YEKA 3AMZA 3L4PA 4GA5A 5AYZA 2OTLH 4GA6A 4WFBJ 3CCUH 3I56H 1VDVA 1VQ5H 1FFVB 2B7QA 5DM7J 1RM6A 1VQ8H 3C2OA 1FM0E 3C2EA 3CMAH 1W2BH 1YJ9H 2B7NA 5EY3A 2DSJA 1YTEA 3CCVH 1QAPA 1YHQH 1M1KJ 3G71H 1VQPH 1DGJA 4EADA 1ZXIB 4IOAJ 5GADN 5MPOC 2W54B 1K8AJ 5HUPA 4WF9J 4WFNJ 2I14A 1JROB 4C7ZA 3WO0A 2WK5A 3GNNA 3H5QA 4KWWA 5DM6J 1VQNH 1FFUB 1SB3A 1SIJA 4AP8A 1VQKH 3NVVC 3CCJH 1NJIJ 4IOCJ 1NVIE 1YI2H 5HULA 3OW2H 3TQVA 1N5WB 4YYYA 5HL7J 2PA2A 1VQ4H 3CC7H 3FC4A 1M90J 3NS1C 5GAHN 3AM9A 3PIPJ 3CCLH 4US8A 3B9JC 4KWVA 1VQ7H 2QA4H 4EAFA 1JRPB 1K73J 4IO9J 4UY8M 2JBMA 4ZOHA 1KC8J 3AN1A 4LHMA 4USAA 1QPOA 3C2FA 3FAHA 5JVGJ 3G6EH 5GAGN 1K9MJ 5AYXA 3NRZC 5AN9F 1FO4A 3CCRH 1N63B 2ZJPJ 2E3TA
chains in the Genus database with same CATH topology
1VQ6H 3CPWH 1Q82J 2OTJH 1YJWH 3CC2H 1KD1J 1VQMH 1VQLH 3CD6H 1Q7YJ 3CXCH 3CCQH 3CC4H 1YJNH 5H1SO 3CF5J 4U67J 1N8RJ 3J7ZM 1YITH 5GAEN 3G4SH 1WKIA 1VQOH 3DLLJ 1JJ2H 1KQSH 3CCSH 4WFAJ 2QEXH 3PIOJ 3I55H 4WCEJ 3CCEH 5JVHJ 1VQ9H 1QVGH 1QVFH 3CCMH 1YIJH 1Y69K 1S72H 1Q86J 2ZJQJ 1Q81J 2ZJRJ 5MLCO 3CMEH 2OTLH 4WFBJ 3CCUH 3I56H 1VQ5H 5DM7J 1VQ8H 3CMAH 1W2BH 1YJ9H 3CCVH 1M1KJ 1YHQH 3G71H 1VQPH 4IOAJ 5GADN 1K8AJ 4WF9J 4WFNJ 5DM6J 1VQNH 1VQKH 3CCJH 1NJIJ 4IOCJ 1YI2H 3OW2H 5HL7J 2PA2A 1VQ4H 3CC7H 1M90J 5GAHN 3PIPJ 3CCLH 1VQ7H 2QA4H 1K73J 4IO9J 4UY8M 1KC8J 5JVGJ 3G6EH 5GAGN 1K9MJ 5AN9F 3CCRH 2ZJPJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 H;  3CPW H;  1Q82 J;  2OTJ H;  1YJW H;  3CC2 H;  1KD1 J;  1VQM H;  1VQL H;  3CD6 H;  1Q7Y J;  3CXC H;  3CCQ H;  3CC4 H;  1YJN H;  5H1S O;  3CF5 J;  4U67 J;  1N8R J;  3J7Z M;  1YIT H;  5GAE N;  3G4S H;  1WKI A;  1VQO H;  3DLL J;  1JJ2 H;  1KQS H;  3CCS H;  4WFA J;  2QEX H;  3PIO J;  3I55 H;  4WCE J;  3CCE H;  5JVH J;  1VQ9 H;  1QVG H;  1QVF H;  3CCM H;  1YIJ H;  1Y69 K;  1S72 H;  1Q86 J;  2ZJQ J;  1Q81 J;  2ZJR J;  5MLC O;  3CME H;  2OTL H;  4WFB J;  3CCU H;  3I56 H;  1VQ5 H;  5DM7 J;  1VQ8 H;  3CMA H;  1W2B H;  1YJ9 H;  3CCV H;  1M1K J;  1YHQ H;  3G71 H;  1VQP H;  4IOA J;  5GAD N;  1K8A J;  4WF9 J;  4WFN J;  5DM6 J;  1VQN H;  1VQK H;  3CCJ H;  1NJI J;  4IOC J;  1YI2 H;  3OW2 H;  5HL7 J;  2PA2 A;  1VQ4 H;  3CC7 H;  1M90 J;  5GAH N;  3PIP J;  3CCL H;  1VQ7 H;  2QA4 H;  1K73 J;  4IO9 J;  4UY8 M;  1KC8 J;  5JVG J;  3G6E H;  5GAG N;  1K9M J;  5AN9 F;  3CCR H;  2ZJP J; 
#chains in the Genus database with same CATH topology
 1VQ6 H;  3CPW H;  1Q82 J;  2B7P A;  2Q5W E;  1OTP A;  1AZY A;  1FMA E;  1WYG A;  3ETR C;  4C7Y A;  1BRW A;  2OTJ H;  1YJW H;  3CC2 H;  1KD1 J;  1UOU A;  1VQM H;  5AYY A;  1VQL H;  3CD6 H;  1N61 B;  3RPF A;  3NVZ C;  2OMD A;  1Q7Y J;  4I9A A;  3CXC H;  3CCQ H;  3CC4 H;  3WO1 A;  1YJN H;  1N62 B;  4X46 A;  1O4U A;  5H1S O;  3CF5 J;  4U67 J;  1N8R J;  3J7Z M;  1V97 A;  1YIT H;  2W55 B;  5GAE N;  3G4S H;  2WP4 A;  1N5X A;  3WNZ A;  1VLB A;  2W3S B;  1QPN A;  1WKI A;  5EP8 A;  3NVY C;  1VQO H;  3PAJ A;  3DLL J;  1YTK A;  1JJ2 H;  1KQS H;  2WK6 A;  4XR5 A;  4C80 A;  3CCS H;  1N60 B;  5HUO A;  4WFA J;  2QEX H;  3PIO J;  3SR6 C;  2I1O A;  3I55 H;  4WCE J;  4GA4 A;  2TPT A;  2QIE A;  2J0F A;  3CCE H;  5JVH J;  1VQ9 H;  1QVG H;  1NVJ A;  1QVF H;  3CCM H;  1QPR A;  1YTD A;  1FIQ C;  1QPQ A;  1YIJ H;  1Y69 K;  1S72 H;  2W3R B;  1Q86 J;  2ZJQ J;  3L0G A;  4US9 A;  1X1O A;  1Q81 J;  3EUB 4;  2ZJR J;  3NVW C;  3BII E;  3C2R A;  3VMM A;  5MLC O;  3CME H;  3C2V A;  4YEK A;  3AMZ A;  3L4P A;  4GA5 A;  5AYZ A;  2OTL H;  4GA6 A;  4WFB J;  3CCU H;  3I56 H;  1VDV A;  1VQ5 H;  1FFV B;  2B7Q A;  5DM7 J;  1RM6 A;  1VQ8 H;  3C2O A;  1FM0 E;  3C2E A;  3CMA H;  1W2B H;  1YJ9 H;  2B7N A;  5EY3 A;  2DSJ A;  1YTE A;  3CCV H;  1QAP A;  1YHQ H;  1M1K J;  3G71 H;  1VQP H;  1DGJ A;  4EAD A;  1ZXI B;  4IOA J;  5GAD N;  5MPO C;  2W54 B;  1K8A J;  5HUP A;  4WF9 J;  4WFN J;  2I14 A;  1JRO B;  4C7Z A;  3WO0 A;  2WK5 A;  3GNN A;  3H5Q A;  4KWW A;  5DM6 J;  1VQN H;  1FFU B;  1SB3 A;  1SIJ A;  4AP8 A;  1VQK H;  3NVV C;  3CCJ H;  1NJI J;  4IOC J;  1NVI E;  1YI2 H;  5HUL A;  3OW2 H;  3TQV A;  1N5W B;  4YYY A;  5HL7 J;  2PA2 A;  1VQ4 H;  3CC7 H;  3FC4 A;  1M90 J;  3NS1 C;  5GAH N;  3AM9 A;  3PIP J;  3CCL H;  4US8 A;  3B9J C;  4KWV A;  1VQ7 H;  2QA4 H;  4EAF A;  1JRP B;  1K73 J;  4IO9 J;  4UY8 M;  2JBM A;  4ZOH A;  1KC8 J;  3AN1 A;  4LHM A;  4USA A;  1QPO A;  3C2F A;  3FAH A;  5JVG J;  3G6E H;  5GAG N;  1K9M J;  5AYX A;  3NRZ C;  5AN9 F;  1FO4 A;  3CCR H;  1N63 B;  2ZJP J;  2E3T A; 
#chains in the Genus database with same CATH homology
 1VQ6 H;  3CPW H;  1Q82 J;  2OTJ H;  1YJW H;  3CC2 H;  1KD1 J;  1VQM H;  1VQL H;  3CD6 H;  1Q7Y J;  3CXC H;  3CCQ H;  3CC4 H;  1YJN H;  5H1S O;  3CF5 J;  4U67 J;  1N8R J;  3J7Z M;  1YIT H;  5GAE N;  3G4S H;  1WKI A;  1VQO H;  3DLL J;  1JJ2 H;  1KQS H;  3CCS H;  4WFA J;  2QEX H;  3PIO J;  3I55 H;  4WCE J;  3CCE H;  5JVH J;  1VQ9 H;  1QVG H;  1QVF H;  3CCM H;  1YIJ H;  1Y69 K;  1S72 H;  1Q86 J;  2ZJQ J;  1Q81 J;  2ZJR J;  5MLC O;  3CME H;  2OTL H;  4WFB J;  3CCU H;  3I56 H;  1VQ5 H;  5DM7 J;  1VQ8 H;  3CMA H;  1W2B H;  1YJ9 H;  3CCV H;  1M1K J;  1YHQ H;  3G71 H;  1VQP H;  4IOA J;  5GAD N;  1K8A J;  4WF9 J;  4WFN J;  5DM6 J;  1VQN H;  1VQK H;  3CCJ H;  1NJI J;  4IOC J;  1YI2 H;  3OW2 H;  5HL7 J;  2PA2 A;  1VQ4 H;  3CC7 H;  1M90 J;  5GAH N;  3PIP J;  3CCL H;  1VQ7 H;  2QA4 H;  1K73 J;  4IO9 J;  4UY8 M;  1KC8 J;  5JVG J;  3G6E H;  5GAG N;  1K9M J;  5AN9 F;  3CCR H;  2ZJP J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...