4IOAL

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ioaL01
1VQ7N 1JJ2M 1M90O 1QVGM 4WF9L 3CCJN 5GAHP 3I56N 3CCSN 5DM7L 1KD1O 4UY8O 1K9MO 4WFAL 3CCRN 1YJWN 4U67L 1VQPN 1KQSM 3G71N 3CCUN 1VQ8N 3CC7N 1N8RO 3CD6N 3G6EN 1K73O 3CCMN 3CCLN 3G4SN 1OVYA 1Q7YO 2QA4N 1YI2N 1VQ4N 5MLCQ 3CCQN 3CF5L 1VQON 1VQMN 1ILYA 2QEXN 3CXCM 5DM6L 3CC4N 1KC8O 4WFBL 3CPWM 5GAGP 2OTJN 1QVFM 5JVHL 1YJNN 5GADP 1VQKN 4IOCL 1NJIO 2ZJPL 4IO9L 1YJ9N 3OW2M 3CC2N 3CMAN 1VQ6N 3CMEN 1K8AO 3CCVN 1S72N 3DLLL 1W2BM 2ZJRL 1YITN 3CCEN 3I55N 2ZJQL 1VQNN 5JVGL 1YIJN 1Q81O 1Q82O 1VQ9N 2OTLN 1M1KO 3PIOL 5GAEP 4WCEL 1YHQN 1Q86O 3J7ZO 5H1SQ 3PIPL 5HL7L 1VQLN 4IOAL 1VQ5N 4WFNL
chains in the Genus database with same CATH superfamily
4IOXA 2I7PA 1QS4A 3BUZB 4JYAK 4GKKK 3WEEB 2XHBA 4GW6A 3F5TA 3V6DA 4JKBA 4BROA 4O8UA 3E9OA 3JSMA 2IC3A 2CGJA 4FWKA 2O8CA 2Q0UA 3O3HA 1KFSA 5M1KA 4B9VA 3UKRA 4UY8O 1QHTA 1BWFO 1HPZA 1MA9B 3QNOA 2E1ZA 4JHDB 2BH1A 2D1KA 1VSMA 4KBOA 3U8XA 1FW6A 3OYGA 1XUPO 4BGBA 1RT3A 3S9HA 1SL1A 1EKEA 4JV5K 2YV0X 5LY3A 1BI4A 4FM1A 2IOCA 5I9EB 3VEZA 3PX0A 2FBVA 4GMJB 2D5RA 4CHQA 3MN9A 4CF1A 2HVIA 1TL3A 3GL1A 5CYMA 3RRHA 4DR3K 4FJ5A 2Q97A 4IBNA 3TTDA 1X9WA 5GAGP 2NRWA 3DI6A 3ITHA 5KPTA 4IEEA 2Z1GA 3HP6A 2ZE2A 3HXMA 4B08A 4MDAA 3B8AX 2D0BA 3CERA 1NK7A 2HBJA 2HHHK 1NJXA 3CYMA 1B9DA 2VWBA 4FLXA 4ISFA 4DCHA 3H6EA 3AA3A 5KI6A 4CEZA 2PAVA 2EWSA 1K8KA 1TKTA 5AQOA 1WLJA 3U4LA 3OYFA 1NMNA 5C15A 2YKMA 1QQMA 2ZJQL 3WNGA 5JVGL 1L3SA 4FOEA 2X78A 5FPMA 4NO7A 1HQUA 1S9GA 1XC3A 3KWIA 3R6MA 1DKGD 3AVJA 4FWPA 1J53A 3QFPA 4DKWA 3PIOL 1YHQN 1S1VA 2O8EA 4LD0A 3BGRA 2B6AA 3MK6A 5AQRA 2PYLA 3H3OB 4ELTA 2YHYA 4DTSA 1LWCA 3CJ9A 3L2RA 3OYCA 4ZHRA 4YOYA 4ZTJA 4EZ6A 3NF7A 3AO2A 4I2QA 2FC0A 4X62K 4BVPA 4CZFA 4KFBA 1V4TA 3O80A 4B9SA 4RW8A 4CZJA 5HLFA 4DWIA 1UA1A 5KGXA 4G9ZA 4DTMA 3IUCA 1EWRA 1T6CA 4KH4A 3OJUA 2DTUA 2WBNA 4DTPA 4U67L 1IKYA 3SQ2A 2KHOA 3MN5A 3VMFB 4CF0A 3ZSOA 1IKVA 5HP1A 2OANA 2YHXA 1BQMA 4E7JA 1TKDA 3CPEA 1B9FA 4H0PA 3EL2A 3BP8A 5AQKA 1JL2A 4FJGA 2E5LK 4X66K 3WNEA 3KHYA 2H3GX 1BQNA 3A8YA 2D0CA 3KVGA 2VQFK 5BN8A 1DEJA 4E7LA 1SKRA 1BIZA 3THXA 4E1MA 2NRVA 4PY5A 3NE6A 4MLHA 3O1WA 3BF3A 3O6WA 3ATUA 3AVLA 1KLNA 1ESVA 1NJIO 3LPTA 1LV5A 5TKYA 2PYJA 4KI6A 4CECA 5BR8K 1EXQA 3LDOA 4DS5A 3A5LC 1RFQA 3OA9A 5HOOA 5DK5A 3LPUA 4EZ9A 5EOYA 4CFBA 1IJJA 3DWLA 4QAGA 3SJHA 1CXQA 4BR2A 3QEIA 1C0MA 1D4XA 1JCFA 2HOEA 1HR0K 1YT3A 2ATQA 4FVUA 1HNIA 1VQ9N 3THYA 1ZBFA 3NH1A 3LDQA 2DFEA 4FSVA 3UKUB 1Q86O 3K5OA 4B1WB 4W5RA 2OYQA 3QBXA 5H1SQ 2OA8A 4FZZA 3CJ7A 3QBWA 1SKSA 3ZETA 1VSHA 3TSQA 3HPOA 1VQ5N 1VSDA 1XHZA 4CJTA 4DSKA 3K9KA 4BC2A 3SJJA 4B1YB 3NF8A 2P9PB 4KAZA 5AZIA 3TPQA 4ILHA 1KVBA 5C24A 2QWOA 4C1NI 3HOTA 4CHNA 1BDGA 1SAZA 1YVNA 3M6GA 5ADXA 3ENHA 4DUYK 3VQ7A 1JLAA 5M1QA 2FSKA 3O08A 3CFPA 1JLCA 1KAYA 5AQTA 3P31A 3VA3A 1S22A 5BPLA 4AHCA 2KLAA 2RN2A 1REVA 4DV2K 1W9HA 2KZMA 4PHTX 3O4WA 2HSTA 1TL1A 1YAGA 3QLHA 1QQNA 5J2MA 4W5NA 3MXJA 2OPSA 3NF6A 4O0IA 1W97L 3KLHA 4IFVA 2GEMA 1ZBSA 3U9DA 2F8SA 4RW7A 3RSEA 3O9SA 4B9QA 4QCLA 4BE1A 3L2WA 2RKIA 4WQ4A 1VQON 1GLLO 2QEXN 3C0BA 4NLCA 4CJLA 4M42A 3GOIA 3CFRA 4CCHA 3LAMA 4WFBL 1XMQK 3TANA 1IKXA 1QVFM 4EAHD 3ZCMA 1NG9A 4DFMA 4CJWA 4CJ4A 4BR9A 4DSFA 3K5LA 1RDDA 2W41A 4AF1A 1NGGA 4KTZA 4Y0WA 4AHRA 3CMAN 4HVJA 1RT6A 4DFKA 2E6LA 3FZKA 3H08A 4CK2A 3V81A 1W2BM 2ZJRL 4BRMA 1NGDA 3JAMO 4PL7A 4DSLA 2UXBK 5LMUK 4FVMA 1HRHA 2F8TA 4F3OA 3OYDA 3RMCA 4AILC 1T03A 2P9IB 4RW9A 1JL1A 3VGMA 3ZYYX 1FK9A 3KKRA 4BRFA 2OTLN 4FJMA 3QIOA 3TU5A 1V4SA 1D8YA 2Q31A 4NXNK 4BRQA 3IMXA 5EX5A 4RW6A 1VRTA 3H45C 1YVUA 3CM5A 3ZT4A 2HHSA 5J1EA 1D5AA 1W7AA 2YX6A 3O5BA 4HCBA 4BDYA 4M3UA 5AFUH 5AQHA 4OLAA 2P9SB 2DFHA 4E1NA 4H0YB 4CF8A 3L0QA 3RMDA 1NGAA 2HBMA 1WSHA 4JK9A 4DV7K 2OCEA 4CZKA 1L3VA 3VQPA 3P38A 3DXKB 4PKGA 4DV1K 2I7NA 5TKWA 3C65A 3VQ6A 2VYPA 4AM6A 3SQ0A 3GDQA 4OGEA 3CD6N 4GV3A 2W6LA 3AARA 4CGGA 1BUPA 1SZ2A 1HUXA 4H0VB 4Y1DA 1W0HA 2X74A 5KTQA 3AVNA 3D45A 1LW2A 3VF6A 1BU6O 1NM1A 3D2FA 3VQAA 5AZJA 1R0AA 1CZ9A 4DFJA 1EETA 4FK4A 3PY8A 1EO1A 3CC4N 1HKBA 2E2OA 1H1VA 3J81O 1S6QA 1ATRA 3V9ZA 3O3GA 4I6MA 3DRSA 3OW2M 4CFCA 3K5NA 3LANA 4NYNA 4H03B 2AP1A 3HI0A 2UUCK 3MEGA 3NBPA 2YHBA 3TR8A 3BZKA 1GOAA 4JKHA 4DV3K 2P9LB 3NVMA 2GWKA 1SL0A 3GG4A 4AH9A 4DB3A 3ZSZA 5HRSA 5K14A 4LC9B 5GAEP 1RDBA 1LOTB 4M41A 1RBSA 1Q8IA 4LF8K 4FOIA 3I33A 1TVRA 3AVGA 3AY9A 3M8RA 4YFUA 4BQLA 5CHIA 4LF4K 5BRFA 3SV3A 5HL7L 3HTVA 3CJ1A 3VF4A 4CEFA 3TAFA 3CQXA 1IG9A 4A57A 4BVOA 4DU1A 3MEEA 4IZ9A 2IVNA 3KLFA 4YHHK 1CZAN 1Y64A 3OBYA 3EY1A 4F9OA 4DSJA 1N34K 3FFKB 3PUFA 3S41A 4HUGA 3PLAA 3AO3A 1Z25A 1WAFA 3AO5A 4CK3A 4B3SK 1TUYA 1VSJA 5AQLA 5AQNA 4LSNA 4CIFA 3K59A 1QZ5A 4FW1A 1VK0A 3U3GA 1KQSM 4BRGA 2G8KA 4C23A 3CJAA 2I5JA 3BDPA 1ZYQA 1K73O 4CGIA 3RTVA 3K2PA 1YI2N 1X3MA 3HOSA 3C6TA 1C0TA 3CM6A 1JLFA 5LL6Z 1NK6A 1NGJA 1HQEA 5C10A 3SMPA 3ID6A 5CZ2A 3CQYA 1S1XA 2XRIA 3O9UA 4DSEA 4L8RB 4JK8A 3QEPA 3VQ8A 4YOXA 2VCPA 4DLEA 2WC9A 4KB1A 2QI2A 1KTQA 5FPEA 2E4LA 1WSIA 3D2EB 1OH6A 4M3ZA 4HHTA 3P5JA 1YUWA 3TAGA 1RTHA 3NVKA 1FXXA 4O44A 3U9ZA 1UAXA 4K41A 1L3TA 1QSLA 2LSNA 3ID8A 2HMPA 4IEIA 5EU7A 4YY3K 3ZX0A 3LDPA 5KQ8A 5JLFA 4FJ8A 4FWSA 3WQTA 3ENOA 3SUPA 4CZEA 4BR5A 3THWA 1JXBA 2OZSA 3K9JA 4B3OA 3JXUA 3R8EA 5AQJA 4B3TK 4JS4A 2IDOA 5AQYA 2GX9A 2QKBA 2KFNA 2BDPA 3N4PA 2VG5A 5AQZA 3OYHA 1C1CA 4QOZB 3ULDA 4Z0UA 3AVFA 2QK9A 3KWGA 3AVKA 4FLYA 3DLRA 1TKZA 2G8VA 2XO7A 4CE9A 2YJEA 3C7NA 1WSGA 3L2QA 3SAFA 3WEEA 4CZGA 5J2NA 5BN9A 3OYLA 3CCRN 3VF2A 5ADXH 4K43A 1Q18A 3AGKA 3PO4A 3OYMA 3ULEB 4CHOA 4B1VA 1T6DA 4CJVA 4XEIA 1VQ8N 2B4JA 2GTDA 4JKDA 3SBTA 1HNVA 1GOBA 3OBWA 4DTUA 3NAEA 4FWRA 4ID5A 1VSKA 4BC5A 1N32K 3T3FA 3VQ4A 2P9UB 4FJXA 3H46O 1BGXT 1KXPA 3ZX3A 3CPWM 2HBKA 1JXEA 1J5EK 3AA2A 1C0FA 2V7ZA 1LAWA 3ZX2A 4B3RK 4IOCL 1TK5A 5AQIA 1RTIA 4FLVA 1FKOA 5E41A 4FXDA 5D3GA 4ILGB 4ELUA 4NCGA 3OY9A 1K8AO 4DUZK 2WUSA 4A59A 4CEDA 5HBMA 4B1XB 3KKSA 3LWMA 3S3MA 3UKRB 3FZMA 2NRTA 1NGCA 4YORA 3G25A 4NCAA 4IDKA 4BDZA 4JKEA 4KH5A 3HO1A 1BI4B 3DMJA 3TSPA 3I8BA 5KQDA 4FPBA 4FJHA 4O55A 4WFNL 1BCOA 1Y97A 4BRPA 4V19S 1Z05A 1U4BA 1X3NA 1S1TA 4WF9L 3C6HA 4KKOA 2HBLA 1L3UA 3O9RA 3DLKA 3MX5A 1KSPA 4U7BA 4B9UA 3AGRA 1BA0A 3DLBA 3SUQA 2E2NA 1YJWN 3DXMA 4CBUA 3EE9A 3VEXA 2XY6A 3CC7N 1N8RO 2Q1NA 4YOTA 3QEXA 3OS1A 5AQQA 1K8KB 5I3UA 1QZ6A 4AHUA 4AHTA 3VQDA 2B5JA 3T69A 1HJOA 1XI1A 3QINA 1HNXK 3OVNA 4OVLA 1KRPA 4BRKA 2YKNA 2UXDK 4OLBA 3A5NC 3D0PA 4BDPA 5EY4A 2YI1A 2HHVA 2JWKA 2O8EB 2VGNA 1BISA 3O1BA 4X65K 1KC8O 2NNWA 4W5TA 3P4IA 1X9JA 1QHAA 2W42A 4JK7A 1B92A 3AO1A 3C6AA 4LH4A 1GLBG 3RVCA 3QIPA 3V9XA 3GE1A 4L3QA 2VQEK 5AQVA 3KJVA 3VN5A 3L8BA 4DR5K 3UE5A 3M5RA 5SZTA 4OJRA 1QQCA 3MMVA 1KVCA 3MWTA 3KD1E 3CCEN 2ASOA 4DG1A 4KHYA 1HLUA 2E20A 2GBZA 3ZEUA 3UB5A 3VETA 2A1RA 3DLHA 4DSIA 1GOCA 4OKEA 4DV5K 2G8FA 1YIJN 3E01A 1NLVA 5BREA 3M3ZA 1JLQA 2FSNA 3NGZA 2DY4A 2YNFA 4OPAA 3EZ5A 4C8MA 4DHYA 3HT3A 1XQSC 4LF5K 4EIAA 3E9PA 3BY5A 4IOAL 4B3MK 1JJ2M 2GUIA 3SV4A 4KREA 4C8LA 1M90O 3P39A 2ZM6K 4ISGA 4DLGA 5J2QA 4N41A 1OH5A 2PY5A 1KD1O 3H1QA 3THXB 3BF1A 1NK8A 3ATVA 3V9UA 3B6OA 1DT9A 3VEYA 3I0RA 4FWLA 3F2KA 1NK4A 3H1VX 3G10A 4CJ3A 1T7PA 1ASUA 3QNNA 4BR4A 3DLGA 4BG8A 3AVIA 4GY2B 1OVQA 4OKKA 3KLGA 3G4SN 2BGGA 4H5NA 1QSYA 4YNQA 1DTQA 4PWDA 3AVAA 1DTTA 3VA0A 1VQ4N 4JD2A 3WNHA 4CZLA 4FJIA 5BPNA 4CD3A 5C2FA 3HP9A 1EP4A 4NCBA 1HNWK 2O8FA 3THYB 4YOVA 2UUAK 3TAMA 5KRSA 4JLHA 3EE8A 2KW4A 4KHPK 3T1HK 1NNEA 4DQ8A 2HHTA 4H5VA 3TAEA 4RW4A 1NU0A 3SI6A 4Z94A 3LWLA 1ITGA 3ZETB 5JS2A 2A3ZA 4F3TA 2V7YA 5E26A 4JKAA 1NGHA 1RDAA 3AAQA 4CGDA 1KCFA 4Z4FA 1TYQA 4CJPA 3TARA 2QTDA 3DYAA 2OPPA 5AZIB 4JI6K 1DGKN 1S72N 3CIPA 2HVHA 4BR7A 1YF5L 1J54A 1YITN 1ASVA 3C94A 1I39A 2E88A 3AAPA 3QETA 2QW9A 1E4GT 2CGLA 3MX2A 2ZD1A 4CJRA 4MLEA 3ZSVA 1VQNN 4CD1A 4DR6K 3AA4A 5FDLA 4ELVA 4HTLA 3OHRA 2NRHA 4BRHA 2V51B 4FJ9A 5LJVA 3PV8A 5FRNA 4E7IA 1CXUA 3CJBA 4A62A 3PIPL 3DM2A 1RT2A 4FWNA 3TABA 4XH5A 4DR2K 1RT5A 3RSEB 5C25A 4K25A 1RTDA 4C1NK 3WUHA 1QVGM 3EN9A 1WBDA 3CCSN 5DM7L 1ZC6A 1T3VA 3KIOA 2HNDA 4LFAK 1ATNA 2JLEA 3EKSA 1NKCA 4WFAL 4JKGA 1VHXA 1A5WA 5F2RA 4EHTA 1CLQA 4EHUA 4CFDA 4LF7K 1IKWA 3SMSA 3M8PA 4OX9K 2QXFA 3KD5E 4CJQA 5IWAK 4ILJA 1RT4A 4LSLA 4FJLA 2BANA 1Q7YO 2HNZA 4GNIA 2P51A 3L6QA 4O4GA 2QA4N 4CGJA 4DF4A 3LDSA 1YTAA 5MLCQ 1VQMN 1ILYA 4HWIA 2AA4A 1NJYA 3HYFA 3DOLA 4BRIA 3HBTA 4BACA 3QERA 2O8BB 4LFCK 1EWQA 1SUQA 3JS6A 4CESA 1RCHA 4KV8A 3RR7A 3VGKA 3IDHA 2FBTA 1HX1A 3J7YP 1RBUA 1VQKN 4O5BA 3K57A 4JRPA 4KTQA 4FJKA 4J2DA 2WOMA 4IJAA 4DU4A 5C2DA 4DV6K 1KLMA 4MDBA 3VEOA 4W5QA 3RMBA 4CJEA 3ZSYA 3WXJA 4E89A 1WBBA 3WXMB 2IIRA 4IG0A 4CF2A 1ASWA 1RDWX 3L3VA 2ASMA 3FZLA 2RHKA 2IS3A 3L2UA 3VOVA 2Q2RA 2NLXA 3I55N 2IVPA 1SL2A 1N33K 5AQPA 4GVEA 2DFFA 4RWTA 4DTNA 2JWLA 4DMNA 5JS1A 4C8OA 4KHWA 3RR8A 1HPMA 1S1UA 3QFUA 4CGFA 4CHYA 1NWKA 2W40A 3EKUA 4EP4A 3HVTA 2G8WA 1I3AA 1WOQA 2A6AA 1EQYA 3RMAA 1U2VA 3TSUA 1BIUA 1VSIA 4OGCA 4GV6A 4J8FA 3VPZA 4YDUC 3D2FB 1LWFA 3PSIA 2ZF5O 3VERA 5AZJB 4KRFA 3CCJN 5GAHP 5CE3A 4E3SA 4H8KA 5EVZA 4JI3K 1WN7A 1ZXOA 4I2PA 3V9SA 4YDUA 1NGIA 3PX4A 4Z4GA 4IKFA 3NH2A 3MXIA 5DMRA 4I6MB 1K9MO 1GLEG 3E66A 3H3NO 4DTJA 2NRRA 3G71N 3BEXA 3TTCA 1VSFA 3O4NA 3I0SA 4G1QA 4N56A 1OVYA 4EFHA 3WT0A 4DU3A 4JI4K 3FGUA 3CQ8A 5LMNK 2IVOA 2XY8A 3FFIA 1WSEA 1K6YA 4CW7B 3AVHA 2O8DA 1NK0A 4DTRA 3CI5A 4FJNA 2KFZA 3ZSXA 3MAQA 2PZSA 5LJWA 4NYFA 3B6PA 4B9NA 4FK2A 4BG9A 4DR4K 3LAKA 2HF4A 4H0XB 1JLEA 3A0IX 2KZZA 3L2VA 2Z1HA 2P9KA 4JNEA 4MO4A 3ZLJA 2E8AA 3V1QA 2ITGA 1O13A 3VESA 3V9WA 3EEQA 1BG3A 3FZFA 2RE2A 3MECA 2CH6A 2NZTA 3EYZA 3QDKA 3A2FA 3WXLA 1I94K 3AVBA 3A5MC 3AO4A 1HKGA 3HPHA 1S1WA 2UU9K 2Z1JA 4JI8K 1XMOK 1TGOA 1S6PA 1IO2A 1O1WA 4CK1A 4CF9A 4IDHA 4Q0BA 4BY9C 3NF9A 3TAPA 2F4VK 2X6NA 3F9MA 2ITMA 3VQBA 2HMIA 4CEBA 1FJGK 2NRZA 3C95A 3QESA 4I9LA 3L4IA 3V1RA 2PFUA 3T19A 3HM8A 2QWNA 4FLWA 3SYZA 3NGYA 3LDLA 3ZT2A 1NGFA 1RDUA 3F9KA 1XNRK 2GV9A 1FKPA 3SQ1A 4M3RA 1IG8A 5AQWA 5BR9A 1MWKA 3ZT1A 4B9LA 2JGUA 4PUOA 3HSCA 3LDNA 1RBRA 1P90A 2YHWA 2A1SA 5FPNA 2Y1IA 4WQ5C 1NBWA 3OYNA 1ATSA 4JRQA 1XHXA 2P9NA 3M8SA 3VQEA 4IG3A 5AQXA 4JI0K 4IJNA 2KKZA 2KTQA 3ALYA 4LH5A 3R1XA 2NUBA 1S9EA 4Y1CA 3G0ZA 4LY7A 3THWB 2Y1JA 5SWMA 2IAJA 4RTFD 4B9MA 4BC4A 2YNIA 4JI1K 4CVNE 3WNFA 3SQ4A 4C8NA 3ASMA 3MCPA 3OYIA 2GUPA 1VSEA 3SK3A 4JHDA 3NDKA 5B8HA 1VQ6N 5C12A 1U04A 1XWLA 3DLLL 5JLHA 3M8QA 1LAVA 3AVCA 5AFUA 3SZ2A 2CGKA 3C7NB 4BQZA 1D9FA 2ZGZA 5BRDA 1GLDG 2ZGYA 4CEOA 4F2RA 1Q82O 1E3MA 1BHLA 2Z1IA 5JICA 2OPQA 3QMLA 3VTHA 4BC3A 4DQPA 4FZXC 1G15A 3IKMA 4I7FA 2F96A 2IGIA 4M7YA 2E6MA 1NMDA 4CJ5A 3HK2A 1XC9A 3SUNA 1TKXA 1RT7A 4Z4IA 1VQLN 3VQCA 4H0TB 2O8CB 2WONA 1CZBA 5HRRA 3MDQA 4R79A 2D0PA 5I42A 3VQ9A 3PX6A 3WQUA 2HHWA 2E1YA 2YJFA 4F4KA 2PBDA 3I56N 4N76A 5AQUA 2HHUA 1ZBLA 2QWPA 3HVRA 3LM2A 3SPYA 5AQFA 5A2QO 1TAUA 1BL3A 2FF3B 3W3DA 2RPIA 1T44A 1NKEA 2YHAA 1WB9A 3CCUN 3LP1A 3G6EN 2F9WA 3GBTA 4MQ3A 3NH0A 4FLUA 3O9QA 3CCMN 4BE0A 3DRPA 1LWEA 5HRPA 1QTMA 4HTUA 5HROA 4HUEA 2HW3A 5IT9O 4JAXA 5GIOA 1X9SA 4KPYA 4CZHA 1RILA 4NB4A 4BRLA 3IS9A 3CF5L 5F1XA 4FLZA 4FW2A 5C42A 4E1JA 4B1UB 4ID1A 3OYKA 3O4QA 4OO1J 4LFBK 4N5SA 2HB5A 3CETA 5C0YA 2J4RA 3PSFA 3OS0A 3DRRA 2VWJA 2QM1A 3DJCA 5JVHL 5GADP 4IO9L 5FRMA 1TUUA 2D0AA 4M3TA 4DR7K 3LL3A 3CCVN 3Q7BA 4BWJA 5E84A 3LZJA 1X9MA 3OYBA 3N4QA 3HPGA 4CIGA 4PKIA 1J6ZA 2FBYA 4PKHA 4ICLA 4O5FA 3DXMB 2A41A 4CGHA 1EX4A 3MN6A 1NKBA 3IG1A 5CR4A 4ZTFA 1IH7A 4OKJA 4H0OA 3F73A 2YNGA 1SQKA 1BOTO 1U48A 1Z6RA 2BTFA 2FSJA 4WE1A 1NK9A 3S3OA 1VQ7N 5AQSA 3UIQA 3QICA 3R3LA 4F2SA 2DPNA 1S3XA 2NRXA 4CJ7A 1P8ZA 2FBXA 3WXKA 2QWRA 3OS2A 2HHQA 1NGBA 1C6VA 3LP3A 3ZT0A 1TK8A 2D4WA 4E0DA 2F7TA 4MFBA 4LF9K 2ASPA 3QEWA 3UKUA 4N47A 3LALA 3QEVA 2ZQBA 4KHUA 3ZEUB 2W6KA 1E4FT 1J9AA 1GLJO 2E2QA 1VRUA 5M1OA 3J80O 3D6RA 3HZ6A 4DTXA 1RBTA 3SAGA 4FWOA 2P9PA 4KB0A 4FJ7A 1HNZK 1JLBA 1DLOA 3O9TA 2XY7A 1KAXA 4FYDA 2HHXA 1RT1A 2QWMA 2R7YA 3NMUA 1X1PA 2BUPA 2VWKA 2YCHA 3AA5X 1ZBUA 2YNHA 2QXLA 4KO0A 2P5OA 1TK0A 2FXUA 3J8AA 3L3UA 3ZSQA 1T05A 4CIEA 1N6QA 4A5BA 3K0SA 5BRHA 4M63C 4FK0A 4BREA 2Q3SA 3K58A 4A61A 3ZSRA 3ZSWA 4H4MA 3HRGA 2HF3A 3IRXA 1C0GA 4K42A 1Q9XA 2D0OA 4DQQA 1RGIA 4RG8A 3VQQA 4BRAA 3QB0A 1ZBHA 2ETJA 1HYZA 3RWUA 5KRTA 4XH4A 3OYJA 4WYBA 4KTWA 1Q9YA 4O8KA 4JD2B 2GWJA 3U6FA 2A40A 1U47A 4FPAA 3SPZA 3DAWA 2O8FB 3NCIA 3VENA 5M1FA 1QQOA 1UOCA 5KPRA 5CZ1A 3KK1A 4KH6A 3DLEA 4JI2K 4FM0A 1U6ZA 4WQ4C 5KGWA 4IFEA 1JKHA 3LM9A 2VGMA 4YOUA 5AQMA 1XNQK 4H4OA 5JMVA 5T7BA 4KI4A 1IBMK 4JEPA 1HKCA 2P9IA 4K0KK 1TYQB 3VEVA 3MEDA 3D7EO 1NJWA 4GVMA 1UA0A 4NXMK 4EP5A 1TV6A 4BRNA 1IV0A 4TSXA 1IBKK 4Z4EA 3OYAA 1U49A 5GINA 1HJRA 3HL8A 3U3YA 4H5WA 2Q0RA 4AQYK 4LF6K 4CHPA 3R9PA 2P5GA 5FROA 3CXCM 4Z4CA 2P9SA 1WSJA 3QO9A 1WSFA 2RF2A 5M1PA 2WFBA 5CY4A 4MO5A 3HSTB 2G8HA 4JS5A 3O8MA 3WXIA 3T7ZA 3DXKA 4DQSA 1YJNN 1KFDA 4B8CA 1SS6A 4OPHA 1QE1A 4PL8A 2O8BA 4DR1K 2BE2A 3OTOK 4HUFA 4HCCA 3FR0A 1S5JA 4RCHA 4FWMA 3KK3A 3HM9A 4BR0A 2FF6A 2E2PA 4JKGB 4QS9A 4DQRA 3THVA 1C1AA 4IO8A 1OH7A 4WCEL 3LZIA 1NOZA 4E7HA 4CBWA 1A5XA 1YTUA 4ISEA 5CYQA 4CBXA 1Z26A 4CHZA 3RRGA 3EZWA 3W0LA 1NOYA 4FCYA 3SAHA 3V4IA 2ZWHA 3ISNC 4R5PA 4FM2A 4XH1A 2CH5A 3L4QA 4AHSA 4M3WA 3DOKA 4Q5VA 1VSLA 3T1AA 3OJSA 2P9LA 4H5TA 1GLFO 3M1FA 3MCAB 4KHQA 4M45A 3P1GA 5J2PA 3NHGA 4IXCA 3TAQA 1VQPN 4CJSA 4FLTA 4KHSA 4K8XA 4M7XA 3FE1A 4CEAA 3PO5A 4BE2A 4CJUA 3AVMA 4B9TA 3T1YK 2O4GA 3E1YA 4BRCA 2FLOA 1JCEA 5AR0A 4DS4A 4BWMA 2EX3A 3SNNA 5BPMA 3CCQN 5FPDA 1N36K 1J5OA 5DM6L 4JI7K 1ZBIA 4OPJA 5AQGA 2Q36A 1BO5O 3KZBA 1N5YA 1U2VB 1JCGA 3MN7A 4DF8A 4W5OA 1C1BA 3LP0A 3SBGA 2O4IA 2ZJPL 3KK7A 1YJ9N 4CJKA 4JKFA 4QS7A 1OH8A 3EO3A 3IFRA 3CMEN 3VQ5A 4CERA 3E9LA 3IAYA 3ZT3A 5GIPA 1SV5A 3HJFA 3S3NA 3P83D 2GELA 5KPZA 3CHWA 1UWBA 4B1ZA 2QKKA 5AJ3K 2AJQA 4A2AA 4X64K 3K5MA 3C6UA 2KQ2A 4IWVA 3TTFA 1WNSA 1JLGA 4OPKA 3NGIA 2UUBK 1R59O 4H5RA 1F21A 1HYSA 2OZMA 3D2EA 2P1JA 1L5UA 4M3YA 4BGAA 3VEWA 4DTOA 2EHGA 1T8EA 2F9TA 4I9QA 2O8DB 4CFAA 4FZYA 5EXWA 4E7KA 1WUAA 2V52B 4PQUA 4DFPA 4FJJA 3OYEA 3LP2A 3KK2A 4CEEA 4B8AB 3JYTA 2X6SA 2UXCK 1C0UA 2G8UA 3NFAA 1NK5A 3O3FA 4PA1A 4BRDA 1VAZA 4AM7A 1D9DA 4K8ZA 2WTUA 1NJZA 2VG6A 4KHNA 1MU2A 2P9KB 3A5OC 1IBLK 4FWQA 4DQIA 1RTJA 1KVAA 1OKJA 3J7AP 3CCLN 1RBVA 2A5XA 4GV9A 4C8KA 2OPRA 1RDCA 3ENBA 5M1NA 3I8DA 1RNHA 4NLBA 4YOWA 3KTQA 4CI6A 4JI5K 1LCUA 2HNYA 1KAZA 4CZIA 3TWHA 3KLEA 4F8RA 2QWLA 1BCMA 2VG7A 1YXQA 3TI0A 1MWMA 3MWPA 1G99A 4CZMA 5HRNA 4E19A 4M3XA 2OTJN 1HMVA 1GLCG 4J2EA 2UYTA 3SUOA 1GLAG 1HYVA 1LW0A 3KLIA 4FO0A 1TAQA 3SLCA 4WQ5A 3ULEA 3VGLA 3MXMA 1QSSA 4A2BA 1BA1A 3BZCA 5ELZA 3CC2N 3CFOA 3Q7CA 3FLCO 4CJFA 4XIUA 4J2AA 1WAJA 4IFYA 3CJCA 4GKJK 4DV0K 4DV4K 2QWQA 1MDUB 1U45A 3FZHA 4QS8A 4UQGA 5F0XA 1A5VA 4O0JA 4J2BA 2XY5A 1Q81O 3V1OA 4AHVA 4CEQA 3AV9A 3VTIA 5FLXO 1M1KO 4FL9A 4JN4A 3CG7A 2P9UA 3J7ZO 3SCXA 2G8IA 2A42A 1NGEA 2P9NB 1SKWA 4JKCA 4A5AA 4Z4HA
chains in the Genus database with same CATH topology
1VQ7N 4IOXA 2I7PA 5AQSA 3BUZB 4C1NK 4IZ9A 2IVNA 3QICA 3R3LA 3WEEB 3WUHA 1QVGM 1CZAN 1Y64A 3EN9A 3F5TA 3OBYA 2DPNA 4JKBA 4BROA 3CCSN 4F9OA 4O8UA 5DM7L 3FFKB 1ZC6A 3E9OA 1S3XA 1T3VA 2CGJA 4FWKA 2NRXA 3S41A 4CJ7A 1P8ZA 2Q0UA 3PLAA 3WXKA 5M1KA 3UKRA 2QWRA 1ATNA 4UY8O 3EKSA 1BWFO 1NGBA 4WFAL 1MA9B 4JKGA 1TUYA 5F2RA 5AQLA 5AQNA 4EHTA 2E1ZA 4EHUA 2D4WA 1QZ5A 1KQSM 4JHDB 2BH1A 2F7TA 3SMSA 2D1KA 4KBOA 3U8XA 4BRGA 1XUPO 2ASPA 3UKUA 3CJAA 4BGBA 4C23A 4ILJA 1K73O 5LY3A 3ZEUB 1Q7YO 4GNIA 5I9EB 1E4FT 3L6QA 2QA4N 1YI2N 1X3MA 3HOSA 3VEZA 1GLJO 2E2QA 5M1OA 1NGJA 3D6RA 3HZ6A 5MLCQ 3MN9A 3SAGA 5C10A 3SMPA 4FWOA 3ID6A 2P9PA 1VQMN 3CQYA 1ILYA 4HWIA 3GL1A 3O9UA 3O9TA 2AA4A 1KAXA 4JK8A 4BRIA 2Q97A 3HBTA 3TTDA 2QWMA 4YOXA 5GAGP 2VCPA 3NMUA 2BUPA 2NRWA 2WC9A 2QI2A 5KPTA 2YCHA 5FPEA 3JS6A 4IEEA 2QXLA 3VGKA 4MDAA 3B8AX 3CERA 3IDHA 2HBJA 3D2EB 1HX1A 1VQKN 2FXUA 3J8AA 4IJAA 5C2DA 4A5BA 2VWBA 3VEOA 4MDBA 4ISFA 1YUWA 3H6EA 4DCHA 5BRHA 4M63C 3NVKA 3WXJA 4BREA 2PAVA 2EWSA 1K8KA 2IIRA 3U9ZA 3WXMB 4A61A 4K41A 5AQOA 1RDWX 2ASMA 3U4LA 3FZLA 2RHKA 3ID8A 5C15A 3VOVA 2Q2RA 3HRGA 2NLXA 2HMPA 4IEIA 1QQMA 3I55N 2HF3A 2ZJQL 2IVPA 3ZX0A 1C0GA 3LDPA 5KQ8A 5JLFA 4K42A 4GVEA 5AQPA 5JVGL 4FWSA 3WQTA 3ENOA 4FOEA 4CZEA 2D0OA 4RWTA 1RGIA 2JWLA 4NO7A 5FPMA 4BR5A 1XC3A 3R6MA 3KWIA 1DKGD 4FWPA 3QFPA 3K9JA 4BRAA 3QB0A 4DKWA 3PIOL 1YHQN 1HPMA 3JXUA 3QFUA 3R8EA 5AQJA 1NWKA 2W40A 3MK6A 5AQYA 2GX9A 3EKUA 3H3OB 5AQRA 4XH4A 1WOQA 2A6AA 2YHYA 3N4PA 1EQYA 5AQZA 4WYBA 1U2VA 3TSUA 4O8KA 3CJ9A 4JD2B 2GWJA 4GV6A 2A40A 4J8FA 3VPZA 4YOYA 4FPAA 3DAWA 4YDUC 3KWGA 3D2FB 3VERA 3VENA 2ZF5O 5AZJB 5M1FA 1QQOA 4BVPA 4CZFA 5KPRA 5GAHP 5CE3A 1V4TA 3CCJN 3O80A 5EVZA 4KH6A 1ZXOA 1U6ZA 4WQ4C 4YDUA 1NGIA 4IFEA 3LM9A 2VGMA 4CZJA 2YJEA 4YOUA 5AQMA 3C7NA 5JMVA 4G9ZA 3IUCA 1T6CA 4JEPA 4I6MB 4KH4A 1HKCA 3WEEA 2WBNA 2P9IA 4CZGA 1K9MO 5BN9A 3CCRN 3VF2A 5ADXH 4K43A 1GLEG 1Q18A 3AGKA 3E66A 4U67L 3H3NO 1TYQB 3ULEB 3VEVA 4B1VA 3D7EO 1T6DA 2KHOA 2NRRA 3G71N 3MN5A 3BEXA 3VMFB 4XEIA 1VQ8N 3TTCA 2OANA 2GTDA 4JKDA 4BRNA 2YHXA 3CPEA 4H0PA 3SBTA 1OVYA 3EL2A 3BP8A 3OBWA 5AQKA 3WT0A 4EFHA 5GINA 4H5WA 4FWRA 3FGUA 2Q0RA 2IVOA 3KHYA 4BC5A 2H3GX 3A8YA 3KVGA 3R9PA 3SAFA 3CXCM 5BN8A 2P9SA 1DEJA 3CI5A 2P9UB 3H46O 1KXPA 3ZX3A 3CPWM 5M1PA 2HBKA 2NRVA 2WFBA 4MO5A 5LJWA 4BG9A 4MLHA 3O1WA 3BF3A 3O6WA 3O8MA 3ATUA 1C0FA 2V7ZA 3WXIA 2HF4A 3T7ZA 3DXKA 4H0XB 1YJNN 3ZX2A 1ESVA 4IOCL 5AQIA 1NJIO 1SS6A 4OPHA 3A0IX 5TKYA 3LDOA 4ILGB 3A5LC 4PL8A 2P9KA 4JNEA 1RFQA 4MO4A 3OA9A 2E8AA 5HOOA 1K8AO 1O13A 2WUSA 5EOYA 4A59A 3VESA 1IJJA 1BG3A 3DWLA 3SJHA 4BR2A 3FR0A 1D4XA 3FZFA 4B1XB 2RE2A 1JCFA 2HOEA 2CH6A 2NZTA 4RCHA 3QDKA 3UKRB 3FZMA 4FWMA 4BR0A 2FF6A 2E2PA 3WXLA 4JKGB 4QS9A 3A5MC 2NRTA 1HKGA 4FVUA 1NGCA 1VQ9N 4YORA 3G25A 3LDQA 4IO8A 4WCEL 4FSVA 3UKUB 1Q86O 4CBWA 4B1WB 4JKEA 3QBXA 5H1SQ 4ISEA 4KH5A 3CJ7A 4CBXA 3TSPA 3I8BA 4IDHA 3QBWA 5KQDA 4BY9C 3EZWA 3ZETA 3F9MA 3W0LA 2ITMA 4FPBA 3TSQA 1VQ5N 3SAHA 4WFNL 2ZWHA 4BRPA 2NRZA 1Z05A 3K9KA 1X3NA 4BC2A 4B1YB 3L4IA 4XH1A 2P9PB 2CH5A 2PFUA 4WF9L 3C6HA 3HM8A 2QWNA 2HBLA 5AZIA 3TPQA 4ILHA 3L4QA 3LDLA 2QWOA 3O9RA 1NGFA 4C1NI 1RDUA 3HOTA 3MX5A 1BDGA 4U7BA 2P9LA 1SAZA 1YVNA 3M6GA 4H5TA 1IG8A 1GLFO 3AGRA 5ADXA 1BA0A 3ENHA 3M1FA 3MCAB 5AQWA 5M1QA 5BR9A 2FSKA 1MWKA 3O08A 2E2NA 1KAYA 3HSCA 3LDNA 4IXCA 3DXMA 5AQTA 1YJWN 4CBUA 3P31A 1VQPN 1S22A 3EE9A 1P90A 5BPLA 3VEXA 2KLAA 2YHWA 5FPNA 4PHTX 3CC7N 1N8RO 3O4WA 4M7XA 2HSTA 3FE1A 4WQ5C 2Q1NA 4YOTA 1NBWA 5AQQA 1K8KB 1ATSA 1QQNA 1YAGA 1QZ6A 2P9NA 3E1YA 3T69A 1HJOA 1W97L 4BRCA 2FLOA 5AQXA 2GEMA 4IJNA 1ZBSA 1JCEA 5AR0A 2KKZA 3U9DA 4BRKA 3RSEA 3O9SA 3R1XA 4B9QA 5BPMA 3A5NC 3CCQN 5FPDA 4WQ4A 1VQON 1GLLO 5EY4A 2YI1A 2QEXN 3C0BA 4NLCA 5DM6L 2JWKA 3GOIA 2VGNA 3O1BA 1KC8O 5AQGA 2NNWA 4RTFD 4BC4A 4WFBL 2Q36A 1QVFM 3P4IA 4EAHD 1BO5O 1X9JA 1QHAA 3KZBA 4JK7A 1U2VB 3C6AA 1JCGA 1GLBG 3RVCA 3MN7A 3GE1A 3MCPA 4BR9A 4L3QA 5AQVA 3SBGA 2GUPA 2W41A 4AF1A 3UE5A 3KK7A 2ZJPL 3SK3A 1NGGA 3M5RA 1YJ9N 4JKFA 4JHDA 4QS7A 4Y0WA 3CMAN 3MMVA 3EO3A 3IFRA 5B8HA 3CMEN 5C12A 1VQ6N 3MWTA 3FZKA 3DLLL 1W2BM 2ZJRL 3CCEN 2ASOA 5JLHA 4BRMA 1HLUA 2E20A 1NGDA 3ZEUA 5AFUA 4PL7A 3E9LA 3UB5A 3VETA 3C7NB 2CGKA 5GIPA 4BQZA 2GELA 2P9IB 2ZGZA 3CHWA 1GLDG 2ZGYA 5BRDA 5KPZA 1YIJN 4B1ZA 3VGMA 3ZYYX 1NLVA 5BREA 1Q82O 4A2AA 3M3ZA 5JICA 4BRFA 3QMLA 3VTHA 4BC3A 2OTLN 2FSNA 3IKMA 4IWVA 3TU5A 1V4SA 3TTFA 2Q31A 4M7YA 4OPAA 4DHYA 1NMDA 4BRQA 3IMXA 5EX5A 1R59O 1XQSC 3H45C 4H5RA 4EIAA 3E9PA 1VQLN 4IOAL 4H0TB 3D2EA 3MDQA 4R79A 2D0PA 4BGAA 3VEWA 2YX6A 3O5BA 3WQUA 1JJ2M 2E1YA 2YJFA 2F9TA 1M90O 3P39A 5AFUH 4ISGA 2PBDA 5AQHA 2P9SB 3I56N 5EXWA 1WUAA 2V52B 5AQUA 1KD1O 3H1QA 4H0YB 3BF1A 3L0QA 3ATVA 1NGAA 2HBMA 4JK9A 2QWPA 4CZKA 1DT9A 3VEYA 3LM2A 4FWLA 3P38A 3DXKB 4PKGA 5AQFA 2I7NA 4BRDA 1VAZA 3F2KA 5TKWA 2FF3B 3W3DA 4AM7A 3C65A 1T44A 3H1VX 2VYPA 4AM6A 2P9KB 3GDQA 3A5OC 3CCUN 4FWQA 3CD6N 3G6EN 2F9WA 3GBTA 4BR4A 4GV3A 3O9QA 1OKJA 3AARA 4BG8A 3CCMN 3CCLN 4GY2B 3G4SN 4H5NA 1BUPA 1SZ2A 2A5XA 4GV9A 1HUXA 3ENBA 4JAXA 5M1NA 4H0VB 5GIOA 1VQ4N 4JD2A 4CZHA 4NLBA 4YOWA 4CZLA 4CI6A 5BPNA 1LCUA 4CD3A 4NB4A 1KAZA 4CZIA 4BRLA 5C2FA 3VF6A 1BU6O 3CF5L 1NM1A 5F1XA 3D2FA 2QWLA 4YOVA 5AZJA 1YXQA 1MWMA 3MWPA 1G99A 4CZMA 1EO1A 3EE8A 4E1JA 3CC4N 4B1UB 1HKBA 4OO1J 2OTJN 2E2OA 1H1VA 4DQ8A 4H5VA 1GLCG 1ATRA 3CETA 5C0YA 2J4RA 2UYTA 4Z94A 1GLAG 3ZETB 2QM1A 4I6MA 2A3ZA 2V7YA 5E26A 3DJCA 1NGHA 4JKAA 5GADP 5JVHL 3AAQA 4FO0A 3SLCA 4WQ5A 4IO9L 1TYQA 3ULEA 3VGLA 1TUUA 3OW2M 4A2BA 1BA1A 5ELZA 2QTDA 3CC2N 4H03B 2AP1A 3FLCO 3HI0A 3LL3A 3Q7CA 5AZIB 1DGKN 3CCVN 3CIPA 3Q7BA 1S72N 5E84A 1YF5L 3CJCA 4BR7A 1YITN 4JKHA 2E88A 1MDUB 2QWQA 2P9LB 3AAPA 3N4QA 3NVMA 2QW9A 4PKIA 1J6ZA 1E4GT 2GWKA 2CGLA 3MX2A 3FZHA 4QS8A 4MLEA 1VQNN 4PKHA 4CD1A 5F0XA 4O5FA 3GG4A 4HTLA 3DXMB 2A41A 1Q81O 3OHRA 3MN6A 3VTIA 4DB3A 2NRHA 4LC9B 1M1KO 4FL9A 5CR4A 4BRHA 2V51B 5GAEP 1LOTB 4JN4A 5LJVA 2P9UA 4H0OA 4FOIA 3I33A 3J7ZO 3CJBA 4A62A 3AY9A 2A42A 1NGEA 3PIPL 4BQLA 1SQKA 2P9NB 5CHIA 1BOTO 5BRFA 5HL7L 3HTVA 3CJ1A 4FWNA 3VF4A 1Z6RA 4JKCA 4XH5A 3CQXA 2BTFA 2FSJA 4A57A 4A5AA 3RSEB 4BVOA 4K25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 N;  1JJ2 M;  1M90 O;  1QVG M;  4WF9 L;  3CCJ N;  5GAH P;  3I56 N;  3CCS N;  5DM7 L;  1KD1 O;  4UY8 O;  1K9M O;  4WFA L;  3CCR N;  1YJW N;  4U67 L;  1VQP N;  1KQS M;  3G71 N;  3CCU N;  1VQ8 N;  3CC7 N;  1N8R O;  3CD6 N;  3G6E N;  1K73 O;  3CCM N;  3CCL N;  3G4S N;  1OVY A;  1Q7Y O;  2QA4 N;  1YI2 N;  1VQ4 N;  5MLC Q;  3CCQ N;  3CF5 L;  1VQO N;  1VQM N;  1ILY A;  2QEX N;  3CXC M;  5DM6 L;  3CC4 N;  1KC8 O;  4WFB L;  3CPW M;  5GAG P;  2OTJ N;  1QVF M;  5JVH L;  1YJN N;  5GAD P;  1VQK N;  4IOC L;  1NJI O;  2ZJP L;  4IO9 L;  1YJ9 N;  3OW2 M;  3CC2 N;  3CMA N;  1VQ6 N;  3CME N;  1K8A O;  3CCV N;  1S72 N;  3DLL L;  1W2B M;  2ZJR L;  1YIT N;  3CCE N;  3I55 N;  2ZJQ L;  1VQN N;  5JVG L;  1YIJ N;  1Q81 O;  1Q82 O;  1VQ9 N;  2OTL N;  1M1K O;  3PIO L;  5GAE P;  4WCE L;  1YHQ N;  1Q86 O;  3J7Z O;  5H1S Q;  3PIP L;  5HL7 L;  1VQL N;  4IOA L;  1VQ5 N;  4WFN L; 
#chains in the Genus database with same CATH topology
 4IOX A;  2I7P A;  1QS4 A;  3BUZ B;  4JYA K;  4GKK K;  3WEE B;  2XHB A;  4GW6 A;  3F5T A;  3V6D A;  4JKB A;  4BRO A;  4O8U A;  3E9O A;  3JSM A;  2IC3 A;  2CGJ A;  4FWK A;  2O8C A;  2Q0U A;  3O3H A;  1KFS A;  5M1K A;  4B9V A;  3UKR A;  4UY8 O;  1QHT A;  1BWF O;  1HPZ A;  1MA9 B;  3QNO A;  2E1Z A;  4JHD B;  2BH1 A;  2D1K A;  1VSM A;  4KBO A;  3U8X A;  1FW6 A;  3OYG A;  1XUP O;  4BGB A;  1RT3 A;  3S9H A;  1SL1 A;  1EKE A;  4JV5 K;  2YV0 X;  5LY3 A;  1BI4 A;  4FM1 A;  2IOC A;  5I9E B;  3VEZ A;  3PX0 A;  2FBV A;  4GMJ B;  2D5R A;  4CHQ A;  3MN9 A;  4CF1 A;  2HVI A;  1TL3 A;  3GL1 A;  5CYM A;  3RRH A;  4DR3 K;  4FJ5 A;  2Q97 A;  4IBN A;  3TTD A;  1X9W A;  5GAG P;  2NRW A;  3DI6 A;  3ITH A;  5KPT A;  4IEE A;  2Z1G A;  3HP6 A;  2ZE2 A;  3HXM A;  4B08 A;  4MDA A;  3B8A X;  2D0B A;  3CER A;  1NK7 A;  2HBJ A;  2HHH K;  1NJX A;  3CYM A;  1B9D A;  2VWB A;  4FLX A;  4ISF A;  4DCH A;  3H6E A;  3AA3 A;  5KI6 A;  4CEZ A;  2PAV A;  2EWS A;  1K8K A;  1TKT A;  5AQO A;  1WLJ A;  3U4L A;  3OYF A;  1NMN A;  5C15 A;  2YKM A;  1QQM A;  2ZJQ L;  3WNG A;  5JVG L;  1L3S A;  4FOE A;  2X78 A;  5FPM A;  4NO7 A;  1HQU A;  1S9G A;  1XC3 A;  3KWI A;  3R6M A;  1DKG D;  3AVJ A;  4FWP A;  1J53 A;  3QFP A;  4DKW A;  3PIO L;  1YHQ N;  1S1V A;  2O8E A;  4LD0 A;  3BGR A;  2B6A A;  3MK6 A;  5AQR A;  2PYL A;  3H3O B;  4ELT A;  2YHY A;  4DTS A;  1LWC A;  3CJ9 A;  3L2R A;  3OYC A;  4ZHR A;  4YOY A;  4ZTJ A;  4EZ6 A;  3NF7 A;  3AO2 A;  4I2Q A;  2FC0 A;  4X62 K;  4BVP A;  4CZF A;  4KFB A;  1V4T A;  3O80 A;  4B9S A;  4RW8 A;  4CZJ A;  5HLF A;  4DWI A;  1UA1 A;  5KGX A;  4G9Z A;  4DTM A;  3IUC A;  1EWR A;  1T6C A;  4KH4 A;  3OJU A;  2DTU A;  2WBN A;  4DTP A;  4U67 L;  1IKY A;  3SQ2 A;  2KHO A;  3MN5 A;  3VMF B;  4CF0 A;  3ZSO A;  1IKV A;  5HP1 A;  2OAN A;  2YHX A;  1BQM A;  4E7J A;  1TKD A;  3CPE A;  1B9F A;  4H0P A;  3EL2 A;  3BP8 A;  5AQK A;  1JL2 A;  4FJG A;  2E5L K;  4X66 K;  3WNE A;  3KHY A;  2H3G X;  1BQN A;  3A8Y A;  2D0C A;  3KVG A;  2VQF K;  5BN8 A;  1DEJ A;  4E7L A;  1SKR A;  1BIZ A;  3THX A;  4E1M A;  2NRV A;  4PY5 A;  3NE6 A;  4MLH A;  3O1W A;  3BF3 A;  3O6W A;  3ATU A;  3AVL A;  1KLN A;  1ESV A;  1NJI O;  3LPT A;  1LV5 A;  5TKY A;  2PYJ A;  4KI6 A;  4CEC A;  5BR8 K;  1EXQ A;  3LDO A;  4DS5 A;  3A5L C;  1RFQ A;  3OA9 A;  5HOO A;  5DK5 A;  3LPU A;  4EZ9 A;  5EOY A;  4CFB A;  1IJJ A;  3DWL A;  4QAG A;  3SJH A;  1CXQ A;  4BR2 A;  3QEI A;  1C0M A;  1D4X A;  1JCF A;  2HOE A;  1HR0 K;  1YT3 A;  2ATQ A;  4FVU A;  1HNI A;  1VQ9 N;  3THY A;  1ZBF A;  3NH1 A;  3LDQ A;  2DFE A;  4FSV A;  3UKU B;  1Q86 O;  3K5O A;  4B1W B;  4W5R A;  2OYQ A;  3QBX A;  5H1S Q;  2OA8 A;  4FZZ A;  3CJ7 A;  3QBW A;  1SKS A;  3ZET A;  1VSH A;  3TSQ A;  3HPO A;  1VQ5 N;  1VSD A;  1XHZ A;  4CJT A;  4DSK A;  3K9K A;  4BC2 A;  3SJJ A;  4B1Y B;  3NF8 A;  2P9P B;  4KAZ A;  5AZI A;  3TPQ A;  4ILH A;  1KVB A;  5C24 A;  2QWO A;  4C1N I;  3HOT A;  4CHN A;  1BDG A;  1SAZ A;  1YVN A;  3M6G A;  5ADX A;  3ENH A;  4DUY K;  3VQ7 A;  1JLA A;  5M1Q A;  2FSK A;  3O08 A;  3CFP A;  1JLC A;  1KAY A;  5AQT A;  3P31 A;  3VA3 A;  1S22 A;  5BPL A;  4AHC A;  2KLA A;  2RN2 A;  1REV A;  4DV2 K;  1W9H A;  2KZM A;  4PHT X;  3O4W A;  2HST A;  1TL1 A;  1YAG A;  3QLH A;  1QQN A;  5J2M A;  4W5N A;  3MXJ A;  2OPS A;  3NF6 A;  4O0I A;  1W97 L;  3KLH A;  4IFV A;  2GEM A;  1ZBS A;  3U9D A;  2F8S A;  4RW7 A;  3RSE A;  3O9S A;  4B9Q A;  4QCL A;  4BE1 A;  3L2W A;  2RKI A;  4WQ4 A;  1VQO N;  1GLL O;  2QEX N;  3C0B A;  4NLC A;  4CJL A;  4M42 A;  3GOI A;  3CFR A;  4CCH A;  3LAM A;  4WFB L;  1XMQ K;  3TAN A;  1IKX A;  1QVF M;  4EAH D;  3ZCM A;  1NG9 A;  4DFM A;  4CJW A;  4CJ4 A;  4BR9 A;  4DSF A;  3K5L A;  1RDD A;  2W41 A;  4AF1 A;  1NGG A;  4KTZ A;  4Y0W A;  4AHR A;  3CMA N;  4HVJ A;  1RT6 A;  4DFK A;  2E6L A;  3FZK A;  3H08 A;  4CK2 A;  3V81 A;  1W2B M;  2ZJR L;  4BRM A;  1NGD A;  3JAM O;  4PL7 A;  4DSL A;  2UXB K;  5LMU K;  4FVM A;  1HRH A;  2F8T A;  4F3O A;  3OYD A;  3RMC A;  4AIL C;  1T03 A;  2P9I B;  4RW9 A;  1JL1 A;  3VGM A;  3ZYY X;  1FK9 A;  3KKR A;  4BRF A;  2OTL N;  4FJM A;  3QIO A;  3TU5 A;  1V4S A;  1D8Y A;  2Q31 A;  4NXN K;  4BRQ A;  3IMX A;  5EX5 A;  4RW6 A;  1VRT A;  3H45 C;  1YVU A;  3CM5 A;  3ZT4 A;  2HHS A;  5J1E A;  1D5A A;  1W7A A;  2YX6 A;  3O5B A;  4HCB A;  4BDY A;  4M3U A;  5AFU H;  5AQH A;  4OLA A;  2P9S B;  2DFH A;  4E1N A;  4H0Y B;  4CF8 A;  3L0Q A;  3RMD A;  1NGA A;  2HBM A;  1WSH A;  4JK9 A;  4DV7 K;  2OCE A;  4CZK A;  1L3V A;  3VQP A;  3P38 A;  3DXK B;  4PKG A;  4DV1 K;  2I7N A;  5TKW A;  3C65 A;  3VQ6 A;  2VYP A;  4AM6 A;  3SQ0 A;  3GDQ A;  4OGE A;  3CD6 N;  4GV3 A;  2W6L A;  3AAR A;  4CGG A;  1BUP A;  1SZ2 A;  1HUX A;  4H0V B;  4Y1D A;  1W0H A;  2X74 A;  5KTQ A;  3AVN A;  3D45 A;  1LW2 A;  3VF6 A;  1BU6 O;  1NM1 A;  3D2F A;  3VQA A;  5AZJ A;  1R0A A;  1CZ9 A;  4DFJ A;  1EET A;  4FK4 A;  3PY8 A;  1EO1 A;  3CC4 N;  1HKB A;  2E2O A;  1H1V A;  3J81 O;  1S6Q A;  1ATR A;  3V9Z A;  3O3G A;  4I6M A;  3DRS A;  3OW2 M;  4CFC A;  3K5N A;  3LAN A;  4NYN A;  4H03 B;  2AP1 A;  3HI0 A;  2UUC K;  3MEG A;  3NBP A;  2YHB A;  3TR8 A;  3BZK A;  1GOA A;  4JKH A;  4DV3 K;  2P9L B;  3NVM A;  2GWK A;  1SL0 A;  3GG4 A;  4AH9 A;  4DB3 A;  3ZSZ A;  5HRS A;  5K14 A;  4LC9 B;  5GAE P;  1RDB A;  1LOT B;  4M41 A;  1RBS A;  1Q8I A;  4LF8 K;  4FOI A;  3I33 A;  1TVR A;  3AVG A;  3AY9 A;  3M8R A;  4YFU A;  4BQL A;  5CHI A;  4LF4 K;  5BRF A;  3SV3 A;  5HL7 L;  3HTV A;  3CJ1 A;  3VF4 A;  4CEF A;  3TAF A;  3CQX A;  1IG9 A;  4A57 A;  4BVO A;  4DU1 A;  3MEE A;  4IZ9 A;  2IVN A;  3KLF A;  4YHH K;  1CZA N;  1Y64 A;  3OBY A;  3EY1 A;  4F9O A;  4DSJ A;  1N34 K;  3FFK B;  3PUF A;  3S41 A;  4HUG A;  3PLA A;  3AO3 A;  1Z25 A;  1WAF A;  3AO5 A;  4CK3 A;  4B3S K;  1TUY A;  1VSJ A;  5AQL A;  5AQN A;  4LSN A;  4CIF A;  3K59 A;  1QZ5 A;  4FW1 A;  1VK0 A;  3U3G A;  1KQS M;  4BRG A;  2G8K A;  4C23 A;  3CJA A;  2I5J A;  3BDP A;  1ZYQ A;  1K73 O;  4CGI A;  3RTV A;  3K2P A;  1YI2 N;  1X3M A;  3HOS A;  3C6T A;  1C0T A;  3CM6 A;  1JLF A;  5LL6 Z;  1NK6 A;  1NGJ A;  1HQE A;  5C10 A;  3SMP A;  3ID6 A;  5CZ2 A;  3CQY A;  1S1X A;  2XRI A;  3O9U A;  4DSE A;  4L8R B;  4JK8 A;  3QEP A;  3VQ8 A;  4YOX A;  2VCP A;  4DLE A;  2WC9 A;  4KB1 A;  2QI2 A;  1KTQ A;  5FPE A;  2E4L A;  1WSI A;  3D2E B;  1OH6 A;  4M3Z A;  4HHT A;  3P5J A;  1YUW A;  3TAG A;  1RTH A;  3NVK A;  1FXX A;  4O44 A;  3U9Z A;  1UAX A;  4K41 A;  1L3T A;  1QSL A;  2LSN A;  3ID8 A;  2HMP A;  4IEI A;  5EU7 A;  4YY3 K;  3ZX0 A;  3LDP A;  5KQ8 A;  5JLF A;  4FJ8 A;  4FWS A;  3WQT A;  3ENO A;  3SUP A;  4CZE A;  4BR5 A;  3THW A;  1JXB A;  2OZS A;  3K9J A;  4B3O A;  3JXU A;  3R8E A;  5AQJ A;  4B3T K;  4JS4 A;  2IDO A;  5AQY A;  2GX9 A;  2QKB A;  2KFN A;  2BDP A;  3N4P A;  2VG5 A;  5AQZ A;  3OYH A;  1C1C A;  4QOZ B;  3ULD A;  4Z0U A;  3AVF A;  2QK9 A;  3KWG A;  3AVK A;  4FLY A;  3DLR A;  1TKZ A;  2G8V A;  2XO7 A;  4CE9 A;  2YJE A;  3C7N A;  1WSG A;  3L2Q A;  3SAF A;  3WEE A;  4CZG A;  5J2N A;  5BN9 A;  3OYL A;  3CCR N;  3VF2 A;  5ADX H;  4K43 A;  1Q18 A;  3AGK A;  3PO4 A;  3OYM A;  3ULE B;  4CHO A;  4B1V A;  1T6D A;  4CJV A;  4XEI A;  1VQ8 N;  2B4J A;  2GTD A;  4JKD A;  3SBT A;  1HNV A;  1GOB A;  3OBW A;  4DTU A;  3NAE A;  4FWR A;  4ID5 A;  1VSK A;  4BC5 A;  1N32 K;  3T3F A;  3VQ4 A;  2P9U B;  4FJX A;  3H46 O;  1BGX T;  1KXP A;  3ZX3 A;  3CPW M;  2HBK A;  1JXE A;  1J5E K;  3AA2 A;  1C0F A;  2V7Z A;  1LAW A;  3ZX2 A;  4B3R K;  4IOC L;  1TK5 A;  5AQI A;  1RTI A;  4FLV A;  1FKO A;  5E41 A;  4FXD A;  5D3G A;  4ILG B;  4ELU A;  4NCG A;  3OY9 A;  1K8A O;  4DUZ K;  2WUS A;  4A59 A;  4CED A;  5HBM A;  4B1X B;  3KKS A;  3LWM A;  3S3M A;  3UKR B;  3FZM A;  2NRT A;  1NGC A;  4YOR A;  3G25 A;  4NCA A;  4IDK A;  4BDZ A;  4JKE A;  4KH5 A;  3HO1 A;  1BI4 B;  3DMJ A;  3TSP A;  3I8B A;  5KQD A;  4FPB A;  4FJH A;  4O55 A;  4WFN L;  1BCO A;  1Y97 A;  4BRP A;  4V19 S;  1Z05 A;  1U4B A;  1X3N A;  1S1T A;  4WF9 L;  3C6H A;  4KKO A;  2HBL A;  1L3U A;  3O9R A;  3DLK A;  3MX5 A;  1KSP A;  4U7B A;  4B9U A;  3AGR A;  1BA0 A;  3DLB A;  3SUQ A;  2E2N A;  1YJW N;  3DXM A;  4CBU A;  3EE9 A;  3VEX A;  2XY6 A;  3CC7 N;  1N8R O;  2Q1N A;  4YOT A;  3QEX A;  3OS1 A;  5AQQ A;  1K8K B;  5I3U A;  1QZ6 A;  4AHU A;  4AHT A;  3VQD A;  2B5J A;  3T69 A;  1HJO A;  1XI1 A;  3QIN A;  1HNX K;  3OVN A;  4OVL A;  1KRP A;  4BRK A;  2YKN A;  2UXD K;  4OLB A;  3A5N C;  3D0P A;  4BDP A;  5EY4 A;  2YI1 A;  2HHV A;  2JWK A;  2O8E B;  2VGN A;  1BIS A;  3O1B A;  4X65 K;  1KC8 O;  2NNW A;  4W5T A;  3P4I A;  1X9J A;  1QHA A;  2W42 A;  4JK7 A;  1B92 A;  3AO1 A;  3C6A A;  4LH4 A;  1GLB G;  3RVC A;  3QIP A;  3V9X A;  3GE1 A;  4L3Q A;  2VQE K;  5AQV A;  3KJV A;  3VN5 A;  3L8B A;  4DR5 K;  3UE5 A;  3M5R A;  5SZT A;  4OJR A;  1QQC A;  3MMV A;  1KVC A;  3MWT A;  3KD1 E;  3CCE N;  2ASO A;  4DG1 A;  4KHY A;  1HLU A;  2E20 A;  2GBZ A;  3ZEU A;  3UB5 A;  3VET A;  2A1R A;  3DLH A;  4DSI A;  1GOC A;  4OKE A;  4DV5 K;  2G8F A;  1YIJ N;  3E01 A;  1NLV A;  5BRE A;  3M3Z A;  1JLQ A;  2FSN A;  3NGZ A;  2DY4 A;  2YNF A;  4OPA A;  3EZ5 A;  4C8M A;  4DHY A;  3HT3 A;  1XQS C;  4LF5 K;  4EIA A;  3E9P A;  3BY5 A;  4IOA L;  4B3M K;  1JJ2 M;  2GUI A;  3SV4 A;  4KRE A;  4C8L A;  1M90 O;  3P39 A;  2ZM6 K;  4ISG A;  4DLG A;  5J2Q A;  4N41 A;  1OH5 A;  2PY5 A;  1KD1 O;  3H1Q A;  3THX B;  3BF1 A;  1NK8 A;  3ATV A;  3V9U A;  3B6O A;  1DT9 A;  3VEY A;  3I0R A;  4FWL A;  3F2K A;  1NK4 A;  3H1V X;  3G10 A;  4CJ3 A;  1T7P A;  1ASU A;  3QNN A;  4BR4 A;  3DLG A;  4BG8 A;  3AVI A;  4GY2 B;  1OVQ A;  4OKK A;  3KLG A;  3G4S N;  2BGG A;  4H5N A;  1QSY A;  4YNQ A;  1DTQ A;  4PWD A;  3AVA A;  1DTT A;  3VA0 A;  1VQ4 N;  4JD2 A;  3WNH A;  4CZL A;  4FJI A;  5BPN A;  4CD3 A;  5C2F A;  3HP9 A;  1EP4 A;  4NCB A;  1HNW K;  2O8F A;  3THY B;  4YOV A;  2UUA K;  3TAM A;  5KRS A;  4JLH A;  3EE8 A;  2KW4 A;  4KHP K;  3T1H K;  1NNE A;  4DQ8 A;  2HHT A;  4H5V A;  3TAE A;  4RW4 A;  1NU0 A;  3SI6 A;  4Z94 A;  3LWL A;  1ITG A;  3ZET B;  5JS2 A;  2A3Z A;  4F3T A;  2V7Y A;  5E26 A;  4JKA A;  1NGH A;  1RDA A;  3AAQ A;  4CGD A;  1KCF A;  4Z4F A;  1TYQ A;  4CJP A;  3TAR A;  2QTD A;  3DYA A;  2OPP A;  5AZI B;  4JI6 K;  1DGK N;  1S72 N;  3CIP A;  2HVH A;  4BR7 A;  1YF5 L;  1J54 A;  1YIT N;  1ASV A;  3C94 A;  1I39 A;  2E88 A;  3AAP A;  3QET A;  2QW9 A;  1E4G T;  2CGL A;  3MX2 A;  2ZD1 A;  4CJR A;  4MLE A;  3ZSV A;  1VQN N;  4CD1 A;  4DR6 K;  3AA4 A;  5FDL A;  4ELV A;  4HTL A;  3OHR A;  2NRH A;  4BRH A;  2V51 B;  4FJ9 A;  5LJV A;  3PV8 A;  5FRN A;  4E7I A;  1CXU A;  3CJB A;  4A62 A;  3PIP L;  3DM2 A;  1RT2 A;  4FWN A;  3TAB A;  4XH5 A;  4DR2 K;  1RT5 A;  3RSE B;  5C25 A;  4K25 A;  1RTD A;  4C1N K;  3WUH A;  1QVG M;  3EN9 A;  1WBD A;  3CCS N;  5DM7 L;  1ZC6 A;  1T3V A;  3KIO A;  2HND A;  4LFA K;  1ATN A;  2JLE A;  3EKS A;  1NKC A;  4WFA L;  4JKG A;  1VHX A;  1A5W A;  5F2R A;  4EHT A;  1CLQ A;  4EHU A;  4CFD A;  4LF7 K;  1IKW A;  3SMS A;  3M8P A;  4OX9 K;  2QXF A;  3KD5 E;  4CJQ A;  5IWA K;  4ILJ A;  1RT4 A;  4LSL A;  4FJL A;  2BAN A;  1Q7Y O;  2HNZ A;  4GNI A;  2P51 A;  3L6Q A;  4O4G A;  2QA4 N;  4CGJ A;  4DF4 A;  3LDS A;  1YTA A;  5MLC Q;  1VQM N;  1ILY A;  4HWI A;  2AA4 A;  1NJY A;  3HYF A;  3DOL A;  4BRI A;  3HBT A;  4BAC A;  3QER A;  2O8B B;  4LFC K;  1EWQ A;  1SUQ A;  3JS6 A;  4CES A;  1RCH A;  4KV8 A;  3RR7 A;  3VGK A;  3IDH A;  2FBT A;  1HX1 A;  3J7Y P;  1RBU A;  1VQK N;  4O5B A;  3K57 A;  4JRP A;  4KTQ A;  4FJK A;  4J2D A;  2WOM A;  4IJA A;  4DU4 A;  5C2D A;  4DV6 K;  1KLM A;  4MDB A;  3VEO A;  4W5Q A;  3RMB A;  4CJE A;  3ZSY A;  3WXJ A;  4E89 A;  1WBB A;  3WXM B;  2IIR A;  4IG0 A;  4CF2 A;  1ASW A;  1RDW X;  3L3V A;  2ASM A;  3FZL A;  2RHK A;  2IS3 A;  3L2U A;  3VOV A;  2Q2R A;  2NLX A;  3I55 N;  2IVP A;  1SL2 A;  1N33 K;  5AQP A;  4GVE A;  2DFF A;  4RWT A;  4DTN A;  2JWL A;  4DMN A;  5JS1 A;  4C8O A;  4KHW A;  3RR8 A;  1HPM A;  1S1U A;  3QFU A;  4CGF A;  4CHY A;  1NWK A;  2W40 A;  3EKU A;  4EP4 A;  3HVT A;  2G8W A;  1I3A A;  1WOQ A;  2A6A A;  1EQY A;  3RMA A;  1U2V A;  3TSU A;  1BIU A;  1VSI A;  4OGC A;  4GV6 A;  4J8F A;  3VPZ A;  4YDU C;  3D2F B;  1LWF A;  3PSI A;  2ZF5 O;  3VER A;  5AZJ B;  4KRF A;  3CCJ N;  5GAH P;  5CE3 A;  4E3S A;  4H8K A;  5EVZ A;  4JI3 K;  1WN7 A;  1ZXO A;  4I2P A;  3V9S A;  4YDU A;  1NGI A;  3PX4 A;  4Z4G A;  4IKF A;  3NH2 A;  3MXI A;  5DMR A;  4I6M B;  1K9M O;  1GLE G;  3E66 A;  3H3N O;  4DTJ A;  2NRR A;  3G71 N;  3BEX A;  3TTC A;  1VSF A;  3O4N A;  3I0S A;  4G1Q A;  4N56 A;  1OVY A;  4EFH A;  3WT0 A;  4DU3 A;  4JI4 K;  3FGU A;  3CQ8 A;  5LMN K;  2IVO A;  2XY8 A;  3FFI A;  1WSE A;  1K6Y A;  4CW7 B;  3AVH A;  2O8D A;  1NK0 A;  4DTR A;  3CI5 A;  4FJN A;  2KFZ A;  3ZSX A;  3MAQ A;  2PZS A;  5LJW A;  4NYF A;  3B6P A;  4B9N A;  4FK2 A;  4BG9 A;  4DR4 K;  3LAK A;  2HF4 A;  4H0X B;  1JLE A;  3A0I X;  2KZZ A;  3L2V A;  2Z1H A;  2P9K A;  4JNE A;  4MO4 A;  3ZLJ A;  2E8A A;  3V1Q A;  2ITG A;  1O13 A;  3VES A;  3V9W A;  3EEQ A;  1BG3 A;  3FZF A;  2RE2 A;  3MEC A;  2CH6 A;  2NZT A;  3EYZ A;  3QDK A;  3A2F A;  3WXL A;  1I94 K;  3AVB A;  3A5M C;  3AO4 A;  1HKG A;  3HPH A;  1S1W A;  2UU9 K;  2Z1J A;  4JI8 K;  1XMO K;  1TGO A;  1S6P A;  1IO2 A;  1O1W A;  4CK1 A;  4CF9 A;  4IDH A;  4Q0B A;  4BY9 C;  3NF9 A;  3TAP A;  2F4V K;  2X6N A;  3F9M A;  2ITM A;  3VQB A;  2HMI A;  4CEB A;  1FJG K;  2NRZ A;  3C95 A;  3QES A;  4I9L A;  3L4I A;  3V1R A;  2PFU A;  3T19 A;  3HM8 A;  2QWN A;  4FLW A;  3SYZ A;  3NGY A;  3LDL A;  3ZT2 A;  1NGF A;  1RDU A;  3F9K A;  1XNR K;  2GV9 A;  1FKP A;  3SQ1 A;  4M3R A;  1IG8 A;  5AQW A;  5BR9 A;  1MWK A;  3ZT1 A;  4B9L A;  2JGU A;  4PUO A;  3HSC A;  3LDN A;  1RBR A;  1P90 A;  2YHW A;  2A1S A;  5FPN A;  2Y1I A;  4WQ5 C;  1NBW A;  3OYN A;  1ATS A;  4JRQ A;  1XHX A;  2P9N A;  3M8S A;  3VQE A;  4IG3 A;  5AQX A;  4JI0 K;  4IJN A;  2KKZ A;  2KTQ A;  3ALY A;  4LH5 A;  3R1X A;  2NUB A;  1S9E A;  4Y1C A;  3G0Z A;  4LY7 A;  3THW B;  2Y1J A;  5SWM A;  2IAJ A;  4RTF D;  4B9M A;  4BC4 A;  2YNI A;  4JI1 K;  4CVN E;  3WNF A;  3SQ4 A;  4C8N A;  3ASM A;  3MCP A;  3OYI A;  2GUP A;  1VSE A;  3SK3 A;  4JHD A;  3NDK A;  5B8H A;  1VQ6 N;  5C12 A;  1U04 A;  1XWL A;  3DLL L;  5JLH A;  3M8Q A;  1LAV A;  3AVC A;  5AFU A;  3SZ2 A;  2CGK A;  3C7N B;  4BQZ A;  1D9F A;  2ZGZ A;  5BRD A;  1GLD G;  2ZGY A;  4CEO A;  4F2R A;  1Q82 O;  1E3M A;  1BHL A;  2Z1I A;  5JIC A;  2OPQ A;  3QML A;  3VTH A;  4BC3 A;  4DQP A;  4FZX C;  1G15 A;  3IKM A;  4I7F A;  2F96 A;  2IGI A;  4M7Y A;  2E6M A;  1NMD A;  4CJ5 A;  3HK2 A;  1XC9 A;  3SUN A;  1TKX A;  1RT7 A;  4Z4I A;  1VQL N;  3VQC A;  4H0T B;  2O8C B;  2WON A;  1CZB A;  5HRR A;  3MDQ A;  4R79 A;  2D0P A;  5I42 A;  3VQ9 A;  3PX6 A;  3WQU A;  2HHW A;  2E1Y A;  2YJF A;  4F4K A;  2PBD A;  3I56 N;  4N76 A;  5AQU A;  2HHU A;  1ZBL A;  2QWP A;  3HVR A;  3LM2 A;  3SPY A;  5AQF A;  5A2Q O;  1TAU A;  1BL3 A;  2FF3 B;  3W3D A;  2RPI A;  1T44 A;  1NKE A;  2YHA A;  1WB9 A;  3CCU N;  3LP1 A;  3G6E N;  2F9W A;  3GBT A;  4MQ3 A;  3NH0 A;  4FLU A;  3O9Q A;  3CCM N;  4BE0 A;  3DRP A;  1LWE A;  5HRP A;  1QTM A;  4HTU A;  5HRO A;  4HUE A;  2HW3 A;  5IT9 O;  4JAX A;  5GIO A;  1X9S A;  4KPY A;  4CZH A;  1RIL A;  4NB4 A;  4BRL A;  3IS9 A;  3CF5 L;  5F1X A;  4FLZ A;  4FW2 A;  5C42 A;  4E1J A;  4B1U B;  4ID1 A;  3OYK A;  3O4Q A;  4OO1 J;  4LFB K;  4N5S A;  2HB5 A;  3CET A;  5C0Y A;  2J4R A;  3PSF A;  3OS0 A;  3DRR A;  2VWJ A;  2QM1 A;  3DJC A;  5JVH L;  5GAD P;  4IO9 L;  5FRM A;  1TUU A;  2D0A A;  4M3T A;  4DR7 K;  3LL3 A;  3CCV N;  3Q7B A;  4BWJ A;  5E84 A;  3LZJ A;  1X9M A;  3OYB A;  3N4Q A;  3HPG A;  4CIG A;  4PKI A;  1J6Z A;  2FBY A;  4PKH A;  4ICL A;  4O5F A;  3DXM B;  2A41 A;  4CGH A;  1EX4 A;  3MN6 A;  1NKB A;  3IG1 A;  5CR4 A;  4ZTF A;  1IH7 A;  4OKJ A;  4H0O A;  3F73 A;  2YNG A;  1SQK A;  1BOT O;  1U48 A;  1Z6R A;  2BTF A;  2FSJ A;  4WE1 A;  1NK9 A;  3S3O A;  1VQ7 N;  5AQS A;  3UIQ A;  3QIC A;  3R3L A;  4F2S A;  2DPN A;  1S3X A;  2NRX A;  4CJ7 A;  1P8Z A;  2FBX A;  3WXK A;  2QWR A;  3OS2 A;  2HHQ A;  1NGB A;  1C6V A;  3LP3 A;  3ZT0 A;  1TK8 A;  2D4W A;  4E0D A;  2F7T A;  4MFB A;  4LF9 K;  2ASP A;  3QEW A;  3UKU A;  4N47 A;  3LAL A;  3QEV A;  2ZQB A;  4KHU A;  3ZEU B;  2W6K A;  1E4F T;  1J9A A;  1GLJ O;  2E2Q A;  1VRU A;  5M1O A;  3J80 O;  3D6R A;  3HZ6 A;  4DTX A;  1RBT A;  3SAG A;  4FWO A;  2P9P A;  4KB0 A;  4FJ7 A;  1HNZ K;  1JLB A;  1DLO A;  3O9T A;  2XY7 A;  1KAX A;  4FYD A;  2HHX A;  1RT1 A;  2QWM A;  2R7Y A;  3NMU A;  1X1P A;  2BUP A;  2VWK A;  2YCH A;  3AA5 X;  1ZBU A;  2YNH A;  2QXL A;  4KO0 A;  2P5O A;  1TK0 A;  2FXU A;  3J8A A;  3L3U A;  3ZSQ A;  1T05 A;  4CIE A;  1N6Q A;  4A5B A;  3K0S A;  5BRH A;  4M63 C;  4FK0 A;  4BRE A;  2Q3S A;  3K58 A;  4A61 A;  3ZSR A;  3ZSW A;  4H4M A;  3HRG A;  2HF3 A;  3IRX A;  1C0G A;  4K42 A;  1Q9X A;  2D0O A;  4DQQ A;  1RGI A;  4RG8 A;  3VQQ A;  4BRA A;  3QB0 A;  1ZBH A;  2ETJ A;  1HYZ A;  3RWU A;  5KRT A;  4XH4 A;  3OYJ A;  4WYB A;  4KTW A;  1Q9Y A;  4O8K A;  4JD2 B;  2GWJ A;  3U6F A;  2A40 A;  1U47 A;  4FPA A;  3SPZ A;  3DAW A;  2O8F B;  3NCI A;  3VEN A;  5M1F A;  1QQO A;  1UOC A;  5KPR A;  5CZ1 A;  3KK1 A;  4KH6 A;  3DLE A;  4JI2 K;  4FM0 A;  1U6Z A;  4WQ4 C;  5KGW A;  4IFE A;  1JKH A;  3LM9 A;  2VGM A;  4YOU A;  5AQM A;  1XNQ K;  4H4O A;  5JMV A;  5T7B A;  4KI4 A;  1IBM K;  4JEP A;  1HKC A;  2P9I A;  4K0K K;  1TYQ B;  3VEV A;  3MED A;  3D7E O;  1NJW A;  4GVM A;  1UA0 A;  4NXM K;  4EP5 A;  1TV6 A;  4BRN A;  1IV0 A;  4TSX A;  1IBK K;  4Z4E A;  3OYA A;  1U49 A;  5GIN A;  1HJR A;  3HL8 A;  3U3Y A;  4H5W A;  2Q0R A;  4AQY K;  4LF6 K;  4CHP A;  3R9P A;  2P5G A;  5FRO A;  3CXC M;  4Z4C A;  2P9S A;  1WSJ A;  3QO9 A;  1WSF A;  2RF2 A;  5M1P A;  2WFB A;  5CY4 A;  4MO5 A;  3HST B;  2G8H A;  4JS5 A;  3O8M A;  3WXI A;  3T7Z A;  3DXK A;  4DQS A;  1YJN N;  1KFD A;  4B8C A;  1SS6 A;  4OPH A;  1QE1 A;  4PL8 A;  2O8B A;  4DR1 K;  2BE2 A;  3OTO K;  4HUF A;  4HCC A;  3FR0 A;  1S5J A;  4RCH A;  4FWM A;  3KK3 A;  3HM9 A;  4BR0 A;  2FF6 A;  2E2P A;  4JKG B;  4QS9 A;  4DQR A;  3THV A;  1C1A A;  4IO8 A;  1OH7 A;  4WCE L;  3LZI A;  1NOZ A;  4E7H A;  4CBW A;  1A5X A;  1YTU A;  4ISE A;  5CYQ A;  4CBX A;  1Z26 A;  4CHZ A;  3RRG A;  3EZW A;  3W0L A;  1NOY A;  4FCY A;  3SAH A;  3V4I A;  2ZWH A;  3ISN C;  4R5P A;  4FM2 A;  4XH1 A;  2CH5 A;  3L4Q A;  4AHS A;  4M3W A;  3DOK A;  4Q5V A;  1VSL A;  3T1A A;  3OJS A;  2P9L A;  4H5T A;  1GLF O;  3M1F A;  3MCA B;  4KHQ A;  4M45 A;  3P1G A;  5J2P A;  3NHG A;  4IXC A;  3TAQ A;  1VQP N;  4CJS A;  4FLT A;  4KHS A;  4K8X A;  4M7X A;  3FE1 A;  4CEA A;  3PO5 A;  4BE2 A;  4CJU A;  3AVM A;  4B9T A;  3T1Y K;  2O4G A;  3E1Y A;  4BRC A;  2FLO A;  1JCE A;  5AR0 A;  4DS4 A;  4BWM A;  2EX3 A;  3SNN A;  5BPM A;  3CCQ N;  5FPD A;  1N36 K;  1J5O A;  5DM6 L;  4JI7 K;  1ZBI A;  4OPJ A;  5AQG A;  2Q36 A;  1BO5 O;  3KZB A;  1N5Y A;  1U2V B;  1JCG A;  3MN7 A;  4DF8 A;  4W5O A;  1C1B A;  3LP0 A;  3SBG A;  2O4I A;  2ZJP L;  3KK7 A;  1YJ9 N;  4CJK A;  4JKF A;  4QS7 A;  1OH8 A;  3EO3 A;  3IFR A;  3CME N;  3VQ5 A;  4CER A;  3E9L A;  3IAY A;  3ZT3 A;  5GIP A;  1SV5 A;  3HJF A;  3S3N A;  3P83 D;  2GEL A;  5KPZ A;  3CHW A;  1UWB A;  4B1Z A;  2QKK A;  5AJ3 K;  2AJQ A;  4A2A A;  4X64 K;  3K5M A;  3C6U A;  2KQ2 A;  4IWV A;  3TTF A;  1WNS A;  1JLG A;  4OPK A;  3NGI A;  2UUB K;  1R59 O;  4H5R A;  1F21 A;  1HYS A;  2OZM A;  3D2E A;  2P1J A;  1L5U A;  4M3Y A;  4BGA A;  3VEW A;  4DTO A;  2EHG A;  1T8E A;  2F9T A;  4I9Q A;  2O8D B;  4CFA A;  4FZY A;  5EXW A;  4E7K A;  1WUA A;  2V52 B;  4PQU A;  4DFP A;  4FJJ A;  3OYE A;  3LP2 A;  3KK2 A;  4CEE A;  4B8A B;  3JYT A;  2X6S A;  2UXC K;  1C0U A;  2G8U A;  3NFA A;  1NK5 A;  3O3F A;  4PA1 A;  4BRD A;  1VAZ A;  4AM7 A;  1D9D A;  4K8Z A;  2WTU A;  1NJZ A;  2VG6 A;  4KHN A;  1MU2 A;  2P9K B;  3A5O C;  1IBL K;  4FWQ A;  4DQI A;  1RTJ A;  1KVA A;  1OKJ A;  3J7A P;  3CCL N;  1RBV A;  2A5X A;  4GV9 A;  4C8K A;  2OPR A;  1RDC A;  3ENB A;  5M1N A;  3I8D A;  1RNH A;  4NLB A;  4YOW A;  3KTQ A;  4CI6 A;  4JI5 K;  1LCU A;  2HNY A;  1KAZ A;  4CZI A;  3TWH A;  3KLE A;  4F8R A;  2QWL A;  1BCM A;  2VG7 A;  1YXQ A;  3TI0 A;  1MWM A;  3MWP A;  1G99 A;  4CZM A;  5HRN A;  4E19 A;  4M3X A;  2OTJ N;  1HMV A;  1GLC G;  4J2E A;  2UYT A;  3SUO A;  1GLA G;  1HYV A;  1LW0 A;  3KLI A;  4FO0 A;  1TAQ A;  3SLC A;  4WQ5 A;  3ULE A;  3VGL A;  3MXM A;  1QSS A;  4A2B A;  1BA1 A;  3BZC A;  5ELZ A;  3CC2 N;  3CFO A;  3Q7C A;  3FLC O;  4CJF A;  4XIU A;  4J2A A;  1WAJ A;  4IFY A;  3CJC A;  4GKJ K;  4DV0 K;  4DV4 K;  2QWQ A;  1MDU B;  1U45 A;  3FZH A;  4QS8 A;  4UQG A;  5F0X A;  1A5V A;  4O0J A;  4J2B A;  2XY5 A;  1Q81 O;  3V1O A;  4AHV A;  4CEQ A;  3AV9 A;  3VTI A;  5FLX O;  1M1K O;  4FL9 A;  4JN4 A;  3CG7 A;  2P9U A;  3J7Z O;  3SCX A;  2G8I A;  2A42 A;  1NGE A;  2P9N B;  1SKW A;  4JKC A;  4A5A A;  4Z4H A; 
#chains in the Genus database with same CATH homology
 1VQ7 N;  4IOX A;  2I7P A;  5AQS A;  3BUZ B;  4C1N K;  4IZ9 A;  2IVN A;  3QIC A;  3R3L A;  3WEE B;  3WUH A;  1QVG M;  1CZA N;  1Y64 A;  3EN9 A;  3F5T A;  3OBY A;  2DPN A;  4JKB A;  4BRO A;  3CCS N;  4F9O A;  4O8U A;  5DM7 L;  3FFK B;  1ZC6 A;  3E9O A;  1S3X A;  1T3V A;  2CGJ A;  4FWK A;  2NRX A;  3S41 A;  4CJ7 A;  1P8Z A;  2Q0U A;  3PLA A;  3WXK A;  5M1K A;  3UKR A;  2QWR A;  1ATN A;  4UY8 O;  3EKS A;  1BWF O;  1NGB A;  4WFA L;  1MA9 B;  4JKG A;  1TUY A;  5F2R A;  5AQL A;  5AQN A;  4EHT A;  2E1Z A;  4EHU A;  2D4W A;  1QZ5 A;  1KQS M;  4JHD B;  2BH1 A;  2F7T A;  3SMS A;  2D1K A;  4KBO A;  3U8X A;  4BRG A;  1XUP O;  2ASP A;  3UKU A;  3CJA A;  4BGB A;  4C23 A;  4ILJ A;  1K73 O;  5LY3 A;  3ZEU B;  1Q7Y O;  4GNI A;  5I9E B;  1E4F T;  3L6Q A;  2QA4 N;  1YI2 N;  1X3M A;  3HOS A;  3VEZ A;  1GLJ O;  2E2Q A;  5M1O A;  1NGJ A;  3D6R A;  3HZ6 A;  5MLC Q;  3MN9 A;  3SAG A;  5C10 A;  3SMP A;  4FWO A;  3ID6 A;  2P9P A;  1VQM N;  3CQY A;  1ILY A;  4HWI A;  3GL1 A;  3O9U A;  3O9T A;  2AA4 A;  1KAX A;  4JK8 A;  4BRI A;  2Q97 A;  3HBT A;  3TTD A;  2QWM A;  4YOX A;  5GAG P;  2VCP A;  3NMU A;  2BUP A;  2NRW A;  2WC9 A;  2QI2 A;  5KPT A;  2YCH A;  5FPE A;  3JS6 A;  4IEE A;  2QXL A;  3VGK A;  4MDA A;  3B8A X;  3CER A;  3IDH A;  2HBJ A;  3D2E B;  1HX1 A;  1VQK N;  2FXU A;  3J8A A;  4IJA A;  5C2D A;  4A5B A;  2VWB A;  3VEO A;  4MDB A;  4ISF A;  1YUW A;  3H6E A;  4DCH A;  5BRH A;  4M63 C;  3NVK A;  3WXJ A;  4BRE A;  2PAV A;  2EWS A;  1K8K A;  2IIR A;  3U9Z A;  3WXM B;  4A61 A;  4K41 A;  5AQO A;  1RDW X;  2ASM A;  3U4L A;  3FZL A;  2RHK A;  3ID8 A;  5C15 A;  3VOV A;  2Q2R A;  3HRG A;  2NLX A;  2HMP A;  4IEI A;  1QQM A;  3I55 N;  2HF3 A;  2ZJQ L;  2IVP A;  3ZX0 A;  1C0G A;  3LDP A;  5KQ8 A;  5JLF A;  4K42 A;  4GVE A;  5AQP A;  5JVG L;  4FWS A;  3WQT A;  3ENO A;  4FOE A;  4CZE A;  2D0O A;  4RWT A;  1RGI A;  2JWL A;  4NO7 A;  5FPM A;  4BR5 A;  1XC3 A;  3R6M A;  3KWI A;  1DKG D;  4FWP A;  3QFP A;  3K9J A;  4BRA A;  3QB0 A;  4DKW A;  3PIO L;  1YHQ N;  1HPM A;  3JXU A;  3QFU A;  3R8E A;  5AQJ A;  1NWK A;  2W40 A;  3MK6 A;  5AQY A;  2GX9 A;  3EKU A;  3H3O B;  5AQR A;  4XH4 A;  1WOQ A;  2A6A A;  2YHY A;  3N4P A;  1EQY A;  5AQZ A;  4WYB A;  1U2V A;  3TSU A;  4O8K A;  3CJ9 A;  4JD2 B;  2GWJ A;  4GV6 A;  2A40 A;  4J8F A;  3VPZ A;  4YOY A;  4FPA A;  3DAW A;  4YDU C;  3KWG A;  3D2F B;  3VER A;  3VEN A;  2ZF5 O;  5AZJ B;  5M1F A;  1QQO A;  4BVP A;  4CZF A;  5KPR A;  5GAH P;  5CE3 A;  1V4T A;  3CCJ N;  3O80 A;  5EVZ A;  4KH6 A;  1ZXO A;  1U6Z A;  4WQ4 C;  4YDU A;  1NGI A;  4IFE A;  3LM9 A;  2VGM A;  4CZJ A;  2YJE A;  4YOU A;  5AQM A;  3C7N A;  5JMV A;  4G9Z A;  3IUC A;  1T6C A;  4JEP A;  4I6M B;  4KH4 A;  1HKC A;  3WEE A;  2WBN A;  2P9I A;  4CZG A;  1K9M O;  5BN9 A;  3CCR N;  3VF2 A;  5ADX H;  4K43 A;  1GLE G;  1Q18 A;  3AGK A;  3E66 A;  4U67 L;  3H3N O;  1TYQ B;  3ULE B;  3VEV A;  4B1V A;  3D7E O;  1T6D A;  2KHO A;  2NRR A;  3G71 N;  3MN5 A;  3BEX A;  3VMF B;  4XEI A;  1VQ8 N;  3TTC A;  2OAN A;  2GTD A;  4JKD A;  4BRN A;  2YHX A;  3CPE A;  4H0P A;  3SBT A;  1OVY A;  3EL2 A;  3BP8 A;  3OBW A;  5AQK A;  3WT0 A;  4EFH A;  5GIN A;  4H5W A;  4FWR A;  3FGU A;  2Q0R A;  2IVO A;  3KHY A;  4BC5 A;  2H3G X;  3A8Y A;  3KVG A;  3R9P A;  3SAF A;  3CXC M;  5BN8 A;  2P9S A;  1DEJ A;  3CI5 A;  2P9U B;  3H46 O;  1KXP A;  3ZX3 A;  3CPW M;  5M1P A;  2HBK A;  2NRV A;  2WFB A;  4MO5 A;  5LJW A;  4BG9 A;  4MLH A;  3O1W A;  3BF3 A;  3O6W A;  3O8M A;  3ATU A;  1C0F A;  2V7Z A;  3WXI A;  2HF4 A;  3T7Z A;  3DXK A;  4H0X B;  1YJN N;  3ZX2 A;  1ESV A;  4IOC L;  5AQI A;  1NJI O;  1SS6 A;  4OPH A;  3A0I X;  5TKY A;  3LDO A;  4ILG B;  3A5L C;  4PL8 A;  2P9K A;  4JNE A;  1RFQ A;  4MO4 A;  3OA9 A;  2E8A A;  5HOO A;  1K8A O;  1O13 A;  2WUS A;  5EOY A;  4A59 A;  3VES A;  1IJJ A;  1BG3 A;  3DWL A;  3SJH A;  4BR2 A;  3FR0 A;  1D4X A;  3FZF A;  4B1X B;  2RE2 A;  1JCF A;  2HOE A;  2CH6 A;  2NZT A;  4RCH A;  3QDK A;  3UKR B;  3FZM A;  4FWM A;  4BR0 A;  2FF6 A;  2E2P A;  3WXL A;  4JKG B;  4QS9 A;  3A5M C;  2NRT A;  1HKG A;  4FVU A;  1NGC A;  1VQ9 N;  4YOR A;  3G25 A;  3LDQ A;  4IO8 A;  4WCE L;  4FSV A;  3UKU B;  1Q86 O;  4CBW A;  4B1W B;  4JKE A;  3QBX A;  5H1S Q;  4ISE A;  4KH5 A;  3CJ7 A;  4CBX A;  3TSP A;  3I8B A;  4IDH A;  3QBW A;  5KQD A;  4BY9 C;  3EZW A;  3ZET A;  3F9M A;  3W0L A;  2ITM A;  4FPB A;  3TSQ A;  1VQ5 N;  3SAH A;  4WFN L;  2ZWH A;  4BRP A;  2NRZ A;  1Z05 A;  3K9K A;  1X3N A;  4BC2 A;  4B1Y B;  3L4I A;  4XH1 A;  2P9P B;  2CH5 A;  2PFU A;  4WF9 L;  3C6H A;  3HM8 A;  2QWN A;  2HBL A;  5AZI A;  3TPQ A;  4ILH A;  3L4Q A;  3LDL A;  2QWO A;  3O9R A;  1NGF A;  4C1N I;  1RDU A;  3HOT A;  3MX5 A;  1BDG A;  4U7B A;  2P9L A;  1SAZ A;  1YVN A;  3M6G A;  4H5T A;  1IG8 A;  1GLF O;  3AGR A;  5ADX A;  1BA0 A;  3ENH A;  3M1F A;  3MCA B;  5AQW A;  5M1Q A;  5BR9 A;  2FSK A;  1MWK A;  3O08 A;  2E2N A;  1KAY A;  3HSC A;  3LDN A;  4IXC A;  3DXM A;  5AQT A;  1YJW N;  4CBU A;  3P31 A;  1VQP N;  1S22 A;  3EE9 A;  1P90 A;  5BPL A;  3VEX A;  2KLA A;  2YHW A;  5FPN A;  4PHT X;  3CC7 N;  1N8R O;  3O4W A;  4M7X A;  2HST A;  3FE1 A;  4WQ5 C;  2Q1N A;  4YOT A;  1NBW A;  5AQQ A;  1K8K B;  1ATS A;  1QQN A;  1YAG A;  1QZ6 A;  2P9N A;  3E1Y A;  3T69 A;  1HJO A;  1W97 L;  4BRC A;  2FLO A;  5AQX A;  2GEM A;  4IJN A;  1ZBS A;  1JCE A;  5AR0 A;  2KKZ A;  3U9D A;  4BRK A;  3RSE A;  3O9S A;  3R1X A;  4B9Q A;  5BPM A;  3A5N C;  3CCQ N;  5FPD A;  4WQ4 A;  1VQO N;  1GLL O;  5EY4 A;  2YI1 A;  2QEX N;  3C0B A;  4NLC A;  5DM6 L;  2JWK A;  3GOI A;  2VGN A;  3O1B A;  1KC8 O;  5AQG A;  2NNW A;  4RTF D;  4BC4 A;  4WFB L;  2Q36 A;  1QVF M;  3P4I A;  4EAH D;  1BO5 O;  1X9J A;  1QHA A;  3KZB A;  4JK7 A;  1U2V B;  3C6A A;  1JCG A;  1GLB G;  3RVC A;  3MN7 A;  3GE1 A;  3MCP A;  4BR9 A;  4L3Q A;  5AQV A;  3SBG A;  2GUP A;  2W41 A;  4AF1 A;  3UE5 A;  3KK7 A;  2ZJP L;  3SK3 A;  1NGG A;  3M5R A;  1YJ9 N;  4JKF A;  4JHD A;  4QS7 A;  4Y0W A;  3CMA N;  3MMV A;  3EO3 A;  3IFR A;  5B8H A;  3CME N;  5C12 A;  1VQ6 N;  3MWT A;  3FZK A;  3DLL L;  1W2B M;  2ZJR L;  3CCE N;  2ASO A;  5JLH A;  4BRM A;  1HLU A;  2E20 A;  1NGD A;  3ZEU A;  5AFU A;  4PL7 A;  3E9L A;  3UB5 A;  3VET A;  3C7N B;  2CGK A;  5GIP A;  4BQZ A;  2GEL A;  2P9I B;  2ZGZ A;  3CHW A;  1GLD G;  2ZGY A;  5BRD A;  5KPZ A;  1YIJ N;  4B1Z A;  3VGM A;  3ZYY X;  1NLV A;  5BRE A;  1Q82 O;  4A2A A;  3M3Z A;  5JIC A;  4BRF A;  3QML A;  3VTH A;  4BC3 A;  2OTL N;  2FSN A;  3IKM A;  4IWV A;  3TU5 A;  1V4S A;  3TTF A;  2Q31 A;  4M7Y A;  4OPA A;  4DHY A;  1NMD A;  4BRQ A;  3IMX A;  5EX5 A;  1R59 O;  1XQS C;  3H45 C;  4H5R A;  4EIA A;  3E9P A;  1VQL N;  4IOA L;  4H0T B;  3D2E A;  3MDQ A;  4R79 A;  2D0P A;  4BGA A;  3VEW A;  2YX6 A;  3O5B A;  3WQU A;  1JJ2 M;  2E1Y A;  2YJF A;  2F9T A;  1M90 O;  3P39 A;  5AFU H;  4ISG A;  2PBD A;  5AQH A;  2P9S B;  3I56 N;  5EXW A;  1WUA A;  2V52 B;  5AQU A;  1KD1 O;  3H1Q A;  4H0Y B;  3BF1 A;  3L0Q A;  3ATV A;  1NGA A;  2HBM A;  4JK9 A;  2QWP A;  4CZK A;  1DT9 A;  3VEY A;  3LM2 A;  4FWL A;  3P38 A;  3DXK B;  4PKG A;  5AQF A;  2I7N A;  4BRD A;  1VAZ A;  3F2K A;  5TKW A;  2FF3 B;  3W3D A;  4AM7 A;  3C65 A;  1T44 A;  3H1V X;  2VYP A;  4AM6 A;  2P9K B;  3GDQ A;  3A5O C;  3CCU N;  4FWQ A;  3CD6 N;  3G6E N;  2F9W A;  3GBT A;  4BR4 A;  4GV3 A;  3O9Q A;  1OKJ A;  3AAR A;  4BG8 A;  3CCM N;  3CCL N;  4GY2 B;  3G4S N;  4H5N A;  1BUP A;  1SZ2 A;  2A5X A;  4GV9 A;  1HUX A;  3ENB A;  4JAX A;  5M1N A;  4H0V B;  5GIO A;  1VQ4 N;  4JD2 A;  4CZH A;  4NLB A;  4YOW A;  4CZL A;  4CI6 A;  5BPN A;  1LCU A;  4CD3 A;  4NB4 A;  1KAZ A;  4CZI A;  4BRL A;  5C2F A;  3VF6 A;  1BU6 O;  3CF5 L;  1NM1 A;  5F1X A;  3D2F A;  2QWL A;  4YOV A;  5AZJ A;  1YXQ A;  1MWM A;  3MWP A;  1G99 A;  4CZM A;  1EO1 A;  3EE8 A;  4E1J A;  3CC4 N;  4B1U B;  1HKB A;  4OO1 J;  2OTJ N;  2E2O A;  1H1V A;  4DQ8 A;  4H5V A;  1GLC G;  1ATR A;  3CET A;  5C0Y A;  2J4R A;  2UYT A;  4Z94 A;  1GLA G;  3ZET B;  2QM1 A;  4I6M A;  2A3Z A;  2V7Y A;  5E26 A;  3DJC A;  1NGH A;  4JKA A;  5GAD P;  5JVH L;  3AAQ A;  4FO0 A;  3SLC A;  4WQ5 A;  4IO9 L;  1TYQ A;  3ULE A;  3VGL A;  1TUU A;  3OW2 M;  4A2B A;  1BA1 A;  5ELZ A;  2QTD A;  3CC2 N;  4H03 B;  2AP1 A;  3FLC O;  3HI0 A;  3LL3 A;  3Q7C A;  5AZI B;  1DGK N;  3CCV N;  3CIP A;  3Q7B A;  1S72 N;  5E84 A;  1YF5 L;  3CJC A;  4BR7 A;  1YIT N;  4JKH A;  2E88 A;  1MDU B;  2QWQ A;  2P9L B;  3AAP A;  3N4Q A;  3NVM A;  2QW9 A;  4PKI A;  1J6Z A;  1E4G T;  2GWK A;  2CGL A;  3MX2 A;  3FZH A;  4QS8 A;  4MLE A;  1VQN N;  4PKH A;  4CD1 A;  5F0X A;  4O5F A;  3GG4 A;  4HTL A;  3DXM B;  2A41 A;  1Q81 O;  3OHR A;  3MN6 A;  3VTI A;  4DB3 A;  2NRH A;  4LC9 B;  1M1K O;  4FL9 A;  5CR4 A;  4BRH A;  2V51 B;  5GAE P;  1LOT B;  4JN4 A;  5LJV A;  2P9U A;  4H0O A;  4FOI A;  3I33 A;  3J7Z O;  3CJB A;  4A62 A;  3AY9 A;  2A42 A;  1NGE A;  3PIP L;  4BQL A;  1SQK A;  2P9N B;  5CHI A;  1BOT O;  5BRF A;  5HL7 L;  3HTV A;  3CJ1 A;  4FWN A;  3VF4 A;  1Z6R A;  4JKC A;  4XH5 A;  3CQX A;  2BTF A;  2FSJ A;  4A57 A;  4A5A A;  3RSE B;  4BVO A;  4K25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...