4IOAL

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
b'RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ioaL01
1Q7YO 1YJWN 1Q86O 3PIOL 3CCRN 1YJ9N 1NJIO 5JVGL 2OTJN 2ZJRL 1VQ6N 1W2BM 2QEXN 1VQLN 4IO9L 5GAGP 1VQON 4WFBL 1KD1O 1Q81O 5GADP 2ZJQL 3OW2M 4WFNL 3CCLN 3CPWM 1KQSM 3I55N 1K8AO 5H1SQ 3CCEN 4U67L 5DM7L 1JJ2M 1VQ5N 3G6EN 1YHQN 1VQ7N 1VQKN 1K73O 4WCEL 1VQ8N 1OVYA 3CCVN 1YIJN 5DM6L 1YI2N 2QA4N 3CCMN 4WFAL 1KC8O 1YJNN 4IOAL 1S72N 3CCSN 3G71N 4IOCL 3DLLL 5GAHP 2OTLN 3CCJN 1QVFM 3PIPL 4UY8O 3CF5L 3CMAN 3CC7N 1VQMN 3G4SN 3J7ZO 1YITN 5MLCQ 1N8RO 1ILYA 1Q82O 1K9MO 3CD6N 2ZJPL 3CCUN 1QVGM 3CXCM 5GAEP 4WF9L 3CC2N 1VQ4N 3CCQN 1M1KO 1VQPN 5HL7L 3CMEN 3I56N 1VQ9N 5JVHL 3CC4N 1VQNN 1M90O
chains in the Genus database with same CATH superfamily
1W97L 4CK1A 3HVTA 1CXQA 3NVKA 4JEPA 1NMNA 4RW9A 3TU5A 2JWLA 3AGKA 2FBYA 4N41A 1JLAA 3A0IX 2VWJA 1WAFA 3THVA 2UU9K 3A8YA 3U4LA 4BGAA 3ASMA 4CHZA 4QS7A 3D2FB 3AVMA 3GE1A 3PUFA 1DLOA 2OPQA 4KTZA 3LPUA 1HJRA 4I7FA 1OH7A 2HHHK 2ATQA 2G8UA 2VCPA 3VGKA 3LDSA 4JI6K 4IJAA 3FFKB 3NF6A 3HPGA 4ZHRA 4AILC 1ZBHA 3OHRA 4QAGA 4NYNA 4CJ4A 4X66K 5CZ2A 1HLUA 1FJGK 1Y97A 4A2BA 4O5BA 1YHQN 2XY7A 1HUXA 3VQAA 4C8MA 3ZSZA 3IRXA 4F9OA 4FLXA 3R1XA 1U48A 1WN7A 2FBVA 1KVBA 5FRMA 3OYIA 3J81O 1NGFA 1N5YA 4NXMK 3K2PA 4BY9C 3SBTA 1S9GA 1I39A 3KWGA 2VG5A 1QE1A 4DTXA 1QVFM 3HI0A 4XEIA 1NJXA 4FXDA 2G8VA 3E9PA 1GLAG 4PA1A 3VESA 1C0TA 1LW2A 4WQ5C 4FJMA 3KKSA 3WEEA 2ASMA 2HBKA 3VENA 4K25A 2YNIA 1ZBFA 4Y1CA 4CJRA 4V19S 4A62A 5AQUA 2PY5A 4GKJK 5AQSA 3HT3A 2YI1A 4ZTFA 1SUQA 1VSJA 2IDOA 4H5TA 5I3UA 1JCEA 1NGDA 3H6EA 4ISFA 3OA9A 2PFUA 3O5BA 2QXFA 4BC5A 2W42A 4A57A 1YAGA 1HNWK 4CZGA 3PV8A 1HQUA 3DI6A 1FK9A 3F9KA 1BI4A 1Z05A 3K9KA 4DR7K 2O8BB 4BR5A 1RDUA 2IIRA 3THYB 3OYEA 2HBLA 4U7BA 4IDHA 1VQLN 3DXMA 4Z4CA 3TSPA 4NYFA 1VQON 4X65K 1A5VA 4CBUA 2Z1HA 4CIFA 3L2VA 3RTVA 2ZJQL 4CEBA 2OCEA 1BDGA 4DV3K 1O1WA 3NH2A 3ZETA 3I0SA 1RDBA 5M1FA 5HRSA 4KTQA 3KLGA 1OH5A 4LY7A 1NK8A 1J9AA 1VQKN 4AHUA 1JXEA 1T05A 3ZX3A 4CFCA 3VTIA 1RTIA 1YI2N 2V51B 4WFAL 3K58A 4CGDA 4DU4A 1NU0A 1JKHA 2ITMA 5DK5A 2PAVA 3QB0A 1W7AA 2O8FB 1NJYA 1KRPA 3A5NC 4RW8A 4IFYA 4OX9K 1YUWA 1RT6A 4BVOA 2YJEA 4AQYK 1QZ5A 4DSLA 3NDKA 1UA0A 4JI5K 3SUQA 4FOEA 4YFUA 2D0AA 4ELUA 4MQ3A 1F21A 1K8KB 4FK0A 3C7NB 3QBXA 3NH1A 4CIGA 2NUBA 3TPQA 4NO7A 3D0PA 3EZ5A 2NNWA 3WNFA 4B1WB 1JLQA 2QM1A 2IS3A 2IC3A 1JLCA 3IFRA 1QHAA 4KFBA 2EWSA 4BDYA 4DR4K 5TKWA 2GEMA 5JVGL 2P9UA 3F9MA 4NLBA 2J4RA 3V6DA 3SQ0A 4FSVA 4EZ6A 2QWRA 3A5MC 3ENHA 3VQ4A 1D8YA 4KV8A 2QEXN 4DKWA 4F3OA 3BF3A 1QHTA 1JLBA 3OYCA 1TAUA 1YF5L 1GLLO 1RTJA 2I7NA 3SMPA 4DTSA 3I8DA 3ZLJA 1TK0A 5F2RA 4CJWA 4H0XB 2DFHA 1C0FA 3NCIA 4IEEA 4XH4A 2O8CA 2OA8A 5BPLA 3D7EO 3M6GA 4CESA 3QNNA 1ZYQA 1N33K 2AP1A 2P9PA 1BA0A 1RBUA 4A59A 1HPZA 4Q0BA 3D2EA 4BE1A 4CF8A 4NLCA 2B6AA 1RBVA 1G99A 1C0GA 3MCAB 3QFUA 1T44A 3FZFA 2VQEK 3OS2A 2GX9A 1S1TA 4FWRA 3AA2A 3MK6A 3O9QA 3H45C 4CVNE 4AM7A 2ZQBA 3O3FA 3O9RA 2FBXA 4IXCA 4CI6A 1XHZA 3E9OA 4HTLA 1P90A 2A6AA 1EKEA 3CFPA 1U4BA 4YNQA 3E1YA 3LZJA 3TTFA 2BGGA 3RR8A 4KTWA 4CECA 3T19A 4LSNA 1RT7A 2IVPA 5HROA 4DWIA 1X3NA 1QS4A 3KD5E 3CQXA 2AJQA 3CETA 4W5OA 4FJGA 3LDNA 1K9MO 2EX3A 1KVAA 2KFZA 1N34K 3M8RA 4DF8A 3CC2N 2E2NA 1CZAN 3L8BA 4JKGA 1Z26A 3BDPA 3MWTA 4JI2K 2P9KA 2KQ2A 1KAZA 4YORA 4IDKA 4LF6K 5JVHL 4E1NA 1S1VA 3A2FA 4K0KK 4GY2B 4YOYA 2HW3A 4M63C 2YNFA 3RMBA 5T7BA 4K8ZA 3LWMA 2LSNA 4IWVA 2F9TA 3SZ2A 3V81A 5AQHA 3OY9A 2A3ZA 1VSEA 4LFBK 1NJWA 1UA1A 2A1SA 2E1ZA 3A5LC 3DYAA 4PQUA 2ASOA 4DV5K 1KD1O 3VOVA 3WQTA 2UXCK 2IVNA 4RW4A 4CZLA 3C95A 3CCLN 4YOWA 4CJQA 1KTQA 1NWKA 4GKKK 3GG4A 3WT0A 3CPEA 1HNZK 3TAQA 4BWMA 3NBPA 3CCEN 4IKFA 2IAJA 3CJBA 1DEJA 3MXJA 1EP4A 2HB5A 3FZKA 1XC9A 1U49A 3DLHA 1NGGA 4E1JA 4WCEL 1YXQA 4FLYA 3R8EA 2CGJA 4B1XB 2Q3SA 2ZGZA 4CK3A 1IKYA 3O80A 2IOCA 2XHBA 5AQTA 3ZT2A 3FZMA 4JK8A 5CY4A 1A5WA 3VTHA 3ULEB 1J54A 3ZSQA 1TKDA 4IOCL 3VA3A 3LZIA 1BIUA 3D6RA 1LAWA 3TARA 4LH5A 2HMIA 3E9LA 4FWKA 3NF9A 3EY1A 3QNOA 4O8UA 3SMSA 3G4SN 4NCAA 1YITN 3ID8A 5MLCQ 3M1FA 3WXIA 3S9HA 2D0CA 4BRIA 4BC3A 3QEXA 1Q82O 2WBNA 1ATRA 3SPYA 1NK7A 1S22A 1ZBSA 3OVNA 5SZTA 4DQ8A 1RT3A 3Q7CA 1NLVA 4FLZA 2FSKA 4E7HA 3ZSWA 4L8RB 3S3OA 4QS9A 2OPSA 3ZX0A 3OYJA 3MN6A 4JKFA 3DXKB 4YY3K 3CJCA 3H08A 4DTNA 1YJWN 1MU2A 4C8KA 4FWOA 3HO1A 2QWLA 4A5AA 3CCRN 2P9LA 1YJ9N 4KPYA 4FW1A 3LALA 1ATNA 3I8BA 4FJHA 4F3TA 5ELZA 3MN9A 5CHIA 1GLCG 2YHXA 3ULDA 3BZCA 4O0IA 1JCGA 3QLHA 3VF2A 1OH6A 4XH5A 3CM6A 3AA4A 4BREA 3SAHA 2QWPA 3RMCA 2UUBK 1RDDA 3HOSA 1QTMA 1Q81O 2GWKA 4FO0A 4C8LA 3AVJA 2WFBA 1U2VA 4AF1A 4FWMA 3KK3A 3QIOA 1SKWA 3QMLA 4HVJA 3L6QA 2P5GA 3J7AP 3KHYA 2AA4A 4LF5K 1HR0K 5EY4A 4CJ5A 4A61A 4FJ5A 4FLWA 4O0JA 3S41A 3WNHA 4BR4A 2KTQA 4EHUA 2QKKA 4B1UB 1IKWA 3HYFA 4CJKA 1RTDA 4K8XA 5ADXA 3K5MA 2HHWA 5HLFA 2UYTA 1L3SA 1GLFO 4MLHA 1VQ8N 2E2OA 1HNXK 4NCBA 4CGFA 3HRGA 4LFAK 3FZHA 4BRCA 3V4IA 4OLBA 3SJJA 1RBRA 3CM5A 2Q0RA 3EZWA 5BR8K 3ZEUB 3KWIA 1C1CA 2XO7A 4CEAA 3CFOA 1HKGA 3K0SA 4BACA 3OYDA 4CF9A 2WONA 4BRHA 2O8DA 4BRKA 4I6MA 4JI0K 4CK2A 4FJKA 4OPKA 4CZJA 3EO3A 4CZIA 2HNDA 4W5NA 4DQQA 1VSDA 1JLGA 4BRFA 1I94K 4WF9L 3THWA 4BDPA 4I2PA 3I33A 3C6TA 5AQGA 2OZMA 4E19A 3UB5A 2P9IA 1E3MA 3OYGA 3VPZA 3V9SA 3O3HA 4JI4K 4FJJA 1VRUA 3LL3A 5LMUK 1YT3A 4F2SA 1WB9A 4M3YA 4DTJA 1EXQA 3TAMA 5LJVA 4YOTA 4PWDA 1X3MA 3SCXA 1D4XA 3EKSA 4JYAK 3M5RA 1N6QA 2OANA 2B4JA 1VQ6N 1B9FA 3SV3A 1Q9XA 3B8AX 5GAGP 4B3MK 4N76A 2YX6A 4H4MA 2WUSA 4CJ7A 5EU7A 3GDQA 3G0ZA 4Z4HA 5F0XA 3CG7A 5KGXA 4R79A 2P9NA 1S1WA 2BDPA 2YV0X 5AZIA 1N32K 1HQEA 5BRDA 3QDKA 3M8QA 2FLOA 4H5NA 3NF8A 2HF3A 4BC2A 1XMOK 3NMUA 3KLEA 3VEVA 2NRRA 3OS0A 4JHDA 4DTRA 1OVYA 3MEEA 5DM6L 5J1EA 5FROA 3L3VA 4FJLA 2GUPA 2QI2A 3AVGA 3J8AA 3O4WA 1WSHA 3TR8A 3KK2A 3LDPA 2QK9A 4RTFD 3KLIA 3CC7N 2NRXA 5FRNA 2HNZA 1U47A 1EQYA 3P83D 1N8RO 5AJ3K 3WEEB 3IAYA 2RPIA 1O13A 1NGEA 2D0BA 2W41A 2YNHA 4LFCK 1XUPO 3L2RA 3LP0A 4RWTA 3ZX2A 2QW9A 3D2FA 3T1AA 1X9SA 2YCHA 2P1JA 3I0RA 3CFRA 2GTDA 1M90O 4FM2A 2NZTA 2HBMA 1HYVA 5BN9A 2X74A 4FM0A 1RTHA 4X64K 3PIOL 2G8HA 4BRAA 2E5LK 3AGRA 2F4VK 1C1BA 4O5FA 4DHYA 2YNGA 4JI8K 3V9ZA 4FOIA 1NMDA 4JD2B 2ZJRL 1BI4B 3HPOA 4C1NK 4E0DA 3VQ8A 3TABA 4CHPA 5J2PA 1OKJA 3SAFA 3IS9A 1DTTA 4E7KA 1NK9A 1QQOA 3ZSYA 1TVRA 2Z1GA 4H0PA 5C24A 4M42A 3CJ7A 3OW2M 4KO0A 5AQWA 5JLHA 5LMNK 2KW4A 1KQSM 3VQCA 1Q18A 3DLRA 3DLEA 2NRZA 2DTUA 1GLJO 1MWKA 1SL0A 4KH4A 2JLEA 2YHAA 3TAEA 2D5RA 3AVIA 5KI6A 2F9WA 3HP6A 1EWRA 2Z1IA 5C2FA 5LL6Z 3CCVN 2FF3B 1HYZA 3RRHA 4DFKA 4B3TK 4CJSA 2QA4N 3QEIA 2E1YA 1XNRK 4FZYA 4IOAL 5CYQA 1JLEA 1T3VA 4JKCA 1RCHA 4MDBA 4CF1A 3AARA 3EEQA 2ZF5O 3WNGA 2WOMA 5KPTA 1OH8A 4F8RA 2Q97A 3OBWA 1QQCA 1HYSA 3HK2A 4HUEA 1BL3A 4I9QA 4ILHA 1S5JA 1U6ZA 4JKEA 3TSUA 2ZJPL 1QVGM 2O8BA 4M45A 4AH9A 5FLXO 3THYA 5GAEP 2HVHA 3SUNA 4DU3A 2P9SB 1ASWA 4CERA 1J6ZA 3VQBA 4G9ZA 4JRPA 2E4LA 1W0HA 1VQ9N 1Z25A 4CHNA 1IG8A 1V4SA 5I9EB 5E26A 2E20A 5BPMA 3ZSOA 5AQKA 1NKBA 4JV5K 2O4IA 5HOOA 3U8XA 3C6HA 3NGZA 3THXB 2G8IA 1FKOA 3LAKA 2YJFA 4UQGA 1T6DA 3IUCA 1YTUA 2HVIA 4KHQA 3RVCA 1HJOA 3G10A 2VG6A 1D9FA 4IBNA 5M1KA 3TAGA 3P4IA 3UKRA 1S3XA 3OYNA 4J2BA 4ICLA 4LH4A 4CEDA 5KPZA 1T7PA 4CEEA 1VSKA 4IZ9A 1BCMA 3AVHA 3MDQA 4JK9A 2V7ZA 4PHTX 1T8EA 4KHSA 4MLEA 1BWFO 3HM9A 4A2AA 3Q7BA 1JLFA 3V1RA 3NGIA 2HNYA 4JLHA 4JI1K 5AQLA 3OYAA 3RMDA 3V9WA 3CJAA 3KLFA 3ZT0A 5BPNA 2A5XA 1JJ2M 1XQSC 1NGHA 1LWEA 4JNEA 2O8FA 4CD1A 5EOYA 1VQ7N 2XY8A 3HXMA 1KAXA 1LV5A 4J2EA 3NHGA 4OO1J 4CBXA 4FJIA 4BWJA 3CERA 3B6OA 3ATUA 3HOTA 1ITGA 3O4QA 4W5RA 2YKMA 3VN5A 1K8KA 3HP9A 3K5LA 1YJNN 3C7NA 3O1WA 4EHTA 2PYLA 3N4QA 3O9UA 4AHSA 3P1GA 3VEXA 4UY8O 2UXBK 1X9WA 4Z4GA 3CF5L 2ZWHA 3AO1A 1WBDA 2RF2A 2F96A 1CZBA 4KHUA 3DLBA 3RSEB 1SAZA 1L3VA 3RR7A 1S6PA 4CJ3A 4DV2K 5GINA 4PY5A 3OYLA 4CCHA 3HZ6A 5AQNA 5C15A 3QEWA 2HHVA 3BP8A 3P31A 1IBLK 4DUYK 4KREA 2V7YA 1VQ4N 3CCQN 3PX4A 4BR9A 2P9KB 5AZJB 1TL3A 5J2QA 5JS2A 3EL2A 3CC4N 4DR3K 4KB1A 2X6SA 1HKBA 2ZD1A 4KHPK 4CBWA 4BC4A 1QSLA 1XNQK 2BANA 3QEPA 4KI6A 4HCBA 3DOLA 4DSFA 1SZ2A 2DY4A 3BEXA 2YHWA 1HMVA 4BGBA 4HHTA 3TSQA 1U45A 3ENBA 3C6AA 2OPPA 4IOXA 4DMNA 3QICA 4WFBL 4C8NA 3SUOA 3H3NO 4DR6K 3HSCA 3OTOK 1L5UA 3AO5A 3LM2A 5I42A 4FJXA 4FWSA 4B1YB 2F7TA 3VF6A 5JICA 4N56A 2E6LA 5BREA 4N47A 3LPTA 1SL2A 1RT2A 4BVPA 3CYMA 4CJEA 1SKSA 1Q9YA 1ZC6A 1NM1A 3VQQA 3OYKA 3EYZA 4CD3A 4CF2A 4FJ9A 5EVZA 4DSEA 4M3UA 2W6LA 2XY6A 3U9ZA 5J2NA 4B9VA 4B9UA 4DQPA 4CGHA 1S6QA 3BY5A 3KK1A 2D1KA 2G8WA 3FR0A 4PKIA 1TUYA 3W3DA 4CJUA 1Z6RA 2G8FA 4CHQA 3LDLA 4JN4A 4EP4A 3ZT3A 4F4KA 4FM1A 4CEZA 1NG9A 1KFDA 3BF1A 2WTUA 1GLDG 1B9DA 5AQIA 1TYQB 2A41A 1IJJA 2Q1NA 4B1VA 5F1XA 2Q36A 1BIZA 1CZ9A 3MN5A 1RDAA 2DPNA 5AQJA 4DCHA 1XWLA 1FKPA 1ILYA 3SPZA 5FPMA 3JSMA 1R0AA 4CF0A 3OBYA 1IBMK 3S3NA 3CD6N 4DV6K 3AO4A 1ZXOA 3UKUB 1G15A 1UOCA 3QBWA 3ZYYX 1DT9A 4BDZA 4NXNK 5HL7L 4KI4A 3CMEN 4DV1K 4H03B 4W5TA 1Q7YO 3PO5A 3ITHA 2B5JA 1Q86O 4CFAA 3U3YA 1RBSA 3PSIA 1EWQA 1TK5A 3LWLA 3T1YK 4KB0A 4JKAA 4AHVA 3TTDA 2E2PA 4DB3A 2Y1IA 4CHYA 3T7ZA 4OPAA 2X78A 2DFEA 3DRSA 3T69A 3BGRA 4GV3A 5KTQA 5BR9A 1W2BM 2E88A 4WQ5A 3DRRA 4DTOA 5ADXH 1BOTO 1ZBUA 4KHYA 1WLJA 3KTQA 1QQNA 2X6NA 1GLBG 1U2VB 2NLXA 3CPWM 4IG3A 2HOEA 4DUZK 2GV9A 4BR7A 1X1PA 1J5EK 3FLCO 1VSMA 3RRGA 3UIQA 4H0OA 4JI7K 4HUFA 5KRSA 5KPRA 1REVA 4FWPA 4FPAA 3ZT1A 4GMJB 4O55A 1TGOA 1N36K 5AQQA 4YOUA 3HM8A 4OGEA 3VMFB 2E6MA 4HWIA 3F5TA 4JI3K 5AFUA 4W5QA 3GL1A 5HRPA 2OZSA 4KHNA 4PUOA 4YOXA 3G71N 3DLLL 3T3FA 4K43A 2D0PA 2Y1JA 1JL2A 3PIPL 4HCCA 3K9JA 4JAXA 4CJPA 1XI1A 5FPEA 5HRNA 4Z4IA 3AVNA 1HRHA 1LW0A 3PY8A 3ZT4A 4CEFA 4CJTA 4IEIA 2A40A 2O8EB 1RDCA 4H8KA 4M3XA 5M1OA 4CZMA 3AA5X 2FSNA 2VQFK 3HVRA 3MAQA 3OYBA 1BISA 2Q31A 3DMJA 4GVEA 1K6YA 5C0YA 4CJFA 1XHXA 4CGJA 3EE9A 1S9EA 1D9DA 3GBTA 1VQNN 3NF7A 4ZTJA 4EFHA 3F2KA 4DSKA 4GVMA 1LWFA 5BRHA 1L3UA 4IJNA 1RT4A 4FK4A 3WXLA 2RKIA 4CIEA 2HF4A 3SQ2A 2JGUA 2ITGA 3SYZA 4JKHA 1ASUA 4E7IA 5M1PA 4RG8A 4CGIA 3BZKA 1D5AA 2YKNA 3F73A 2EHGA 3HL8A 3PX6A 3O08A 1IKXA 3MX2A 3U3GA 4DSIA 4OVLA 1UWBA 4FWNA 2GWJA 3KIOA 4J2AA 4BRNA 4FJNA 3OJUA 2P9NB 4H5WA 3KZBA 3E66A 5AZIB 4XH1A 4MDAA 3ZEUA 3DWLA 3RWUA 1BO5O 4CZKA 3ZSRA 3V1QA 1B92A 3G25A 1H1VA 2NRWA 3NVMA 4DF4A 2UXDK 3W0LA 2HHTA 3VEYA 4ISEA 1SKRA 1VSHA 5KQ8A 4YHHK 1S72N 1SL1A 3LDOA 2G8KA 2HHSA 3H3OB 4BRPA 3NE6A 1EETA 1TV6A 3JS6A 4OPJA 1BU6O 3CQYA 4BQLA 4FCYA 3CQ8A 3K5NA 3R3LA 4BR0A 3GOIA 1U04A 1DTQA 4RW6A 4KKOA 4DG1A 4DV7K 4FLUA 2Z1JA 1KAYA 3KK7A 3LAMA 3AY9A 4C1NI 1NNEA 3ZSXA 3DLKA 3I56N 1NGJA 5K14A 1LWCA 2GUIA 2W6KA 1QSYA 3E01A 2KZZA 2ETJA 1MWMA 3CHWA 4K41A 3U9DA 1WSGA 3MEDA 3UE5A 1ESVA 3VF4A 1CLQA 4BE0A 1QZ6A 4BRDA 4H0VB 4KAZA 3L4IA 4DV4K 5AR0A 1C1AA 3AVBA 4IO8A 3KLHA 2Q2RA 4C23A 4FJ8A 3FFIA 2CH5A 4DFJA 4L3QA 1ZBIA 4YDUA 5JS1A 4M7XA 4ISGA 4DFMA 4MO4A 2ZM6K 2P5OA 2XRIA 2KZMA 4QCLA 1DKGD 3ENOA 5LY3A 4Z4FA 1K8AO 5AQZA 2VGNA 3DJCA 3M3ZA 3V9XA 4FLTA 1RT5A 3N4PA 3SI6A 5FPDA 3VQDA 3WQUA 1WSJA 3G6EN 2BUPA 1VSFA 4CZEA 3DXMB 5C42A 4B9MA 1T6CA 5IWAK 4B3RK 4LF8K 2FXUA 4LSLA 4KRFA 4B9SA 4ID5A 3PX0A 3SNNA 3CCMN 3IKMA 4DTMA 2QWNA 3WXJA 2FSJA 3C94A 3MCPA 3VA0A 3IDHA 3ZETB 2V52B 3OYFA 2ZGYA 4B08A 4CEOA 4M3RA 3LP2A 3L2QA 5C2DA 1XMQK 3AVAA 3O9TA 1X9MA 4C8OA 3CMAN 1MA9B 3CJ9A 1ASVA 5DMRA 1QQMA 4AHTA 2Q0UA 3J7ZO 2JWKA 4RW7A 4JS4A 5AQMA 5CE3A 1FW6A 4EZ9A 4Q5VA 2A42A 3AA3A 4JKDA 3RMAA 3M8PA 4JD2A 4DR2K 1Q8IA 2VG7A 4CE9A 1GLEG 2YHBA 3VGMA 4BRMA 1RGIA 3AAQA 5AQOA 1OVQA 5AQYA 1M1KO 4KHWA 3ISNC 1GOBA 1NOYA 3AVKA 3LP1A 1WSEA 4HUGA 3CJ1A 4OJRA 1SQKA 1ZBLA 2PZSA 3B6PA 3QETA 1BA1A 3SK3A 2DFFA 3BUZB 3TWHA 2O4GA 5TKYA 4AHRA 2NRTA 2RN2A 2H3GX 2OTJN 4DFPA 4DQRA 1C0MA 3JXUA 3NAEA 4XIUA 1IV0A 4OPHA 4DU1A 2D0OA 4AHCA 3UKRB 1RNHA 3QESA 3ID6A 4N5SA 3V1OA 4ILJA 3LANA 4E1MA 1NK5A 4M3WA 2FBTA 3H1QA 1WNSA 2BE2A 3KD1E 3I55N 1A5XA 3C6UA 4H5RA 1Y64A 2ZE2A 4HTUA 3OJSA 1NGBA 2P9UB 3H1VX 5JMVA 4B1ZA 4I9LA 4BE2A 4DTPA 5E84A 4BRLA 3WXMB 1VQ5N 4FVMA 3CI5A 1HX1A 3EE8A 4B9LA 1X9JA 3VEOA 3MN7A 4O4GA 2I5JA 1YIJN 3VQ6A 4CFDA 1LOTB 3HBTA 4O44A 1KC8O 2P9SA 1NJZA 3CCSN 1E4GT 2O8CB 4OKJA 4BQZA 4B9NA 5M1QA 4NB4A 4MO5A 3FZLA 3AVCA 2P9PB 4M3TA 1VQMN 3HTVA 1RBTA 1CXUA 1WBBA 3D2EB 3KJVA 2P51A 3VQ7A 4FZZA 5SWMA 3THXA 5HRRA 1BGXT 3FE1A 3CCUN 4CEQA 3P5JA 3MEGA 4JRQA 4E7LA 3TAFA 5EXWA 4M3ZA 1TAQA 2ASPA 1VQPN 1BG3A 4CFBA 3OYMA 3WNEA 3VERA 3PSFA 1TK8A 4RCHA 4DV0K 1YVNA 1W9HA 4PL7A 3MECA 4CZHA 5KRTA 4JS5A 3L4QA 3JAMO 3J80O 4B8CA 1TL1A 4DLGA 2BTFA 3AO3A 3ZSVA 2F8TA 1KSPA 1L3TA 3DAWA 5CYMA 1KVCA 3ZCMA 1IBKK 2UUAK 5A2QO 5GIPA 5HP1A 3L2UA 4JKGB 4ELVA 1GOCA 2QWMA 4IO9L 3LM9A 1BCOA 4CGGA 1WAJA 1TKZA 4ID1A 3SUPA 3ATVA 4B8AB 5BRFA 3ALYA 3T1HK 4WQ4A 3A5OC 1SV5A 3DRPA 4DQSA 5CR4A 4DLEA 1R59O 1IG9A 2VWBA 2HSTA 2IVOA 4U67L 4OGCA 1E4FT 1NK4A 4E7JA 3VQPA 4FZXC 1YVUA 3MXMA 4NCGA 4PKHA 4CJVA 2PBDA 4YDUC 2QWQA 1FXXA 4G1QA 3RSEA 4CZFA 4J2DA 3VEZA 3LP3A 2HMPA 3KVGA 4ILGB 4BG8A 4DR1K 2KFNA 4A5BA 4JK7A 4X62K 3NH0A 1EO1A 3SQ4A 1VSLA 3VGLA 5AQPA 3HPHA 1RT1A 4R5PA 1BUPA 2OTLN 5AZJA 3SBGA 4H5VA 3O3GA 3IMXA 4LC9B 1KLMA 1WSFA 1BQMA 4KBOA 3NGYA 1S1UA 3QEVA 2CGKA 5EX5A 4F2RA 1C6VA 5FPNA 1WOQA 2NRVA 3MX5A 4O8KA 2WC9A 2QTDA 4Z4EA 4FWQA 3VEWA 4B9TA 4Y0WA 1HKCA 3QO9A 3K57A 3EKUA 3K5OA 4E3SA 2HHQA 1I3AA 2GBZA 4FWLA 4JKBA 3O4NA 5J2MA 3SV4A 3PLAA 2VYPA 1VSIA 4LD0A 5AQXA 1NK6A 3TTCA 3AVFA 2D4WA 1NJIO 5IT9O 4Z94A 4H0TB 4MFBA 4EIAA 3IG1A 1EX4A 2HHXA 1HPMA 3O9SA 2KHOA 3V9UA 4PKGA 3OYHA 3PO4A 4DTUA 2F8SA 2VWKA 4H0YB 3WUHA 1DGKN 2R7YA 3TAPA 4BRQA 3DLGA 3MMVA 1P8ZA 2IGIA 1NKCA 5AFUH 5H1SQ 2P9LB 3QERA 3CIPA 1GOAA 1WUAA 4K42A 5JLFA 1SS6A 2QXLA 3VQ5A 2XY5A 3O1BA 2FF6A 5DM7L 3VQEA 1TYQA 5D3GA 1C0UA 4DQIA 1KXPA 3NFAA 1K73O 1WSIA 3VQ9A 3K59A 5C12A 5BN8A 2UUCK 1UAXA 4FW2A 3FGUA 5CZ1A 2BH1A 5GIOA 4FJ7A 5HBMA 4CW7B 2QWOA 4H4OA 3ULEA 4LF9K 5AQVA 3UKUA 4DSJA 3R9PA 4DS4A 1S1XA 1NKEA 3C0BA 2RHKA 2I7PA 3QFPA 4BG9A 2KLAA 3LDQA 4BROA 1VAZA 4PL8A 4DS5A 4QS8A 4CHOA 3S3MA 1HNIA 3MWPA 3U6FA 2NRHA 2KKZA 4KH6A 3AO2A 1LAVA 2HBJA 3P39A 4OKEA 3JYTA 3CXCM 4FVUA 1VRTA 4AM6A 4DR5K 2FC0A 4E89A 5C10A 1NGIA 3MXIA 4FYDA 5E41A 2VGMA 1VK0A 1RILA 3SJHA 3DXKA 2O8DB 4FL9A 2HHUA 1NGAA 1RDWX 4I6MB 1VHXA 4CJLA 3HSTB 3SAGA 4LF4K 4EP5A 3QIPA 3OS1A 3R6MA 1NK0A 4GNIA 4WE1A 3L3UA 5KGWA 3THWB 1KLNA 1NBWA 4M41A 4IFVA 4ELTA 3L0QA 5KQDA 2P9IB 5AQFA 2W40A 4GV9A 5M1NA 1IKVA 5GADP 4IFEA 3P38A 1JL1A 3EN9A 3WXKA 4WFNL 4GV6A 4LF7K 5LJWA 3AVLA 3H46O 3C65A 1KCFA 2E8AA 2YHYA 3L2WA 4B3OA 4OLAA 1BQNA 5C25A 3DM2A 1V4TA 4TSXA 1NGCA 4YOVA 3QINA 1QSSA 1MDUB 1LCUA 2OPRA 2QKBA 5B8HA 1YTAA 1JXBA 1BHLA 3O8MA 3TI0A 2O8EA 4IG0A 4B9QA 4WQ4C 2E2QA 4EAHD 3TANA 3AAPA 3SLCA 1TKXA 1J53A 1IO2A 1TKTA 5GAHP 4WYBA 2A1RA 4GW6A 1XC3A 3CCJN 1KFSA 2CGLA 2RE2A 4BRGA 3DOKA 1NOZA 3J7YP 5FDLA 3AV9A 4FLVA 1T03A 4M7YA 1TUUA 4BR2A 4B3SK 2OYQA 4J8FA 1J5OA 3SQ1A 2PYJA 1IH7A 3VETA 4JHDB 1HNVA 1JCFA 1ATSA 3D45A 4I2QA 3HJFA 4KH5A 3O6WA 4FK2A 3KKRA 2CH6A 2GELA 1RFQA 4OKKA 5AQRA 3M8SA 4Z0UA 4Y1DA 4FPBA 4QOZB
chains in the Genus database with same CATH topology
1W97L 3DXKB 3CJCA 1BA1A 3SK3A 1YJWN 3NVKA 4FWOA 3BUZB 4JEPA 2QWLA 4A5AA 3CCRN 2P9LA 3TU5A 1YJ9N 5TKYA 2JWLA 1ATNA 2NRTA 3AGKA 3I8BA 2H3GX 1SZ2A 5ELZA 3A0IX 2OTJN 3MN9A 3JXUA 3BEXA 2YHWA 1GLCG 2YHXA 5CHIA 4BGBA 3A8YA 4OPHA 2D0OA 1JCGA 3TSQA 3U4LA 3ENBA 3C6AA 4BGAA 3VF2A 4IOXA 4XH5A 4BREA 3SAHA 4QS7A 3UKRB 2QWPA 3D2FB 3QICA 3GE1A 4WFBL 3ID6A 4ILJA 3HOSA 3H3NO 1Q81O 2GWKA 4FO0A 2WFBA 1U2VA 3H1QA 4AF1A 4FWMA 3HSCA 3I55N 2VCPA 3QMLA 4H5RA 3LM2A 3L6QA 1Y64A 3KHYA 4FWSA 2AA4A 3VGKA 4B1YB 2F7TA 3VF6A 4IJAA 5JICA 3FFKB 5EY4A 1NGBA 2P9UB 3H1VX 4A61A 5BREA 3S41A 5JMVA 3OHRA 4B1ZA 4BVPA 4BR4A 5E84A 1HLUA 4BRLA 4EHUA 1ZC6A 4A2BA 4B1UB 1NM1A 3WXMB 1VQ5N 1YHQN 3CI5A 5ADXA 1HX1A 1HUXA 2UYTA 4CD3A 3EE8A 1GLFO 4MLHA 5EVZA 1VQ8N 1X9JA 2E2OA 4F9OA 3R1XA 3VEOA 3U9ZA 3MN7A 1YIJN 1NGFA 1LOTB 3HBTA 3HRGA 3FZHA 4BRCA 2D1KA 1KC8O 3FR0A 4PKIA 1TUYA 2P9SA 3W3DA 1Z6RA 3LDLA 4JN4A 4BY9C 3SBTA 3CCSN 1E4GT 3KWGA 2Q0RA 3EZWA 3ZEUB 3KWIA 4BQZA 3BF1A 1QVFM 1GLDG 3HI0A 5AQIA 1TYQB 5M1QA 4XEIA 4NB4A 4MO5A 2A41A 1HKGA 1IJJA 2Q1NA 4B1VA 5F1XA 2Q36A 3E9PA 3FZLA 1GLAG 2P9PB 3VESA 1VQMN 3HTVA 4WQ5C 4BRHA 3MN5A 4BRKA 3WEEA 2DPNA 4I6MA 5AQJA 4DCHA 1ILYA 2ASMA 2HBKA 3D2EB 5FPMA 4K25A 3VENA 3OBYA 4CZJA 3EO3A 4CZIA 3CD6N 3FE1A 3CCUN 4A62A 5AQUA 4BRFA 4WF9L 1ZXOA 5AQSA 2YI1A 3UKUB 3I33A 3QBWA 5EXWA 3ZYYX 1DT9A 5AQGA 2ASPA 1VQPN 1BG3A 2P9IA 3UB5A 5HL7L 3CMEN 4H5TA 3VPZA 1JCEA 3VERA 1NGDA 4H03B 3H6EA 4RCHA 1YVNA 4PL7A 4ISFA 4CZHA 3OA9A 2PFUA 1Q7YO 3O5BA 3LL3A 3L4QA 4BC5A 1Q86O 4A57A 2BTFA 5LJVA 1YAGA 4YOTA 4CZGA 1X3MA 1D4XA 1Z05A 3DAWA 3EKSA 3K9KA 4JKAA 4BR5A 1RDUA 2IIRA 2E2PA 3TTDA 4DB3A 3M5RA 2HBLA 3T7ZA 4OPAA 2OANA 5GIPA 3T69A 4U7BA 4IDHA 4GV3A 1VQ6N 4JKGB 5BR9A 1W2BM 2E88A 4WQ5A 3DXMA 2QWMA 1VQLN 4IO9L 3B8AX 3LM9A 3TSPA 5GAGP 1VQON 5ADXH 4CBUA 1BOTO 2YX6A 4CJ7A 2WUSA 3ATVA 2ZJQL 1QQNA 3GDQA 5BRFA 1GLBG 1U2VB 4WQ4A 2NLXA 3CPWM 1BDGA 5F0XA 3A5OC 4R79A 2P9NA 2HOEA 5CR4A 3ZETA 5AZIA 4BR7A 1R59O 5M1FA 2VWBA 2HSTA 2IVOA 3FLCO 3QDKA 4U67L 5BRDA 2FLOA 4H5NA 1E4FT 4H0OA 2HF3A 4BC2A 5KPRA 4PKHA 1VQKN 2PBDA 3NMUA 4FWPA 2NRRA 4FPAA 4YDUC 2QWQA 3RSEA 3VEVA 4JHDA 5AQQA 4CZFA 4YOUA 1OVYA 3HM8A 3VEZA 2HMPA 3KVGA 4ILGB 4BG8A 3VMFB 4HWIA 3ZX3A 3VTIA 5DM6L 3F5TA 1YI2N 5AFUA 3GL1A 2GUPA 2V51B 4WFAL 4A5BA 4JK7A 2QI2A 1EO1A 3VGLA 5AQPA 4YOXA 3J8AA 3G71N 1BUPA 3O4WA 2ITMA 3DLLL 3LDPA 4K43A 2OTLN 5AZJA 2D0PA 3SBGA 4RTFD 2PAVA 3PIPL 4H5VA 3IMXA 4LC9B 3K9JA 4JAXA 3QB0A 3CC7N 2NRXA 4KBOA 3A5NC 5FPEA 1YUWA 1EQYA 5JLFA 2CGKA 5EX5A 1N8RO 3WEEB 5FPNA 1WOQA 1O13A 2NRVA 4BVOA 2YJEA 3MX5A 1NGEA 1QZ5A 2WC9A 4O8KA 2QTDA 2W41A 4IEIA 1YITN 4FOEA 4FWQA 2A40A 3VEWA 1XUPO 5M1OA 4CZMA 2FSNA 1K8KB 4Y0WA 4RWTA 3ZX2A 3C7NB 1HKCA 3QBXA 3EKUA 3TPQA 2QW9A 3D2FA 4NO7A 2Q31A 2NNWA 4GVEA 5C0YA 4FWLA 2YCHA 4JKBA 4B1WB 3EE9A 3GBTA 3PLAA 2QM1A 2GTDA 1VQNN 2VYPA 1M90O 4EFHA 3F2KA 3IFRA 2NZTA 5AQXA 3TTCA 2HBMA 1QHAA 5BRHA 2EWSA 4IJNA 5BN9A 3WXLA 3PIOL 2D4WA 2HF4A 5TKWA 4BRAA 1NJIO 2GEMA 3AGRA 5JVGL 4O5FA 2P9UA 3F9MA 4H0TB 4JKHA 4NLBA 4FOIA 1NMDA 4JD2B 4DHYA 4EIAA 5M1PA 1HPMA 2J4RA 3O9SA 2ZJRL 2KHOA 4FSVA 2QWRA 4PKGA 4C1NK 3A5MC 3ENHA 1OKJA 2QEXN 4DKWA 4H0YB 3O08A 3SAFA 3MX2A 1QQOA 3BF3A 3WUHA 1DGKN 4H0PA 1YF5L 4BRQA 1GLLO 3CJ7A 2I7NA 3SMPA 3MMVA 3OW2M 4FWNA 2GWJA 1P8ZA 4BRNA 5AQWA 5JLHA 1KQSM 5F2RA 5AFUH 4H0XB 2P9NB 1C0FA 3KZBA 4H5WA 1Q18A 5H1SQ 2P9LB 3E66A 4IEEA 3CIPA 5AZIB 4XH1A 4XH4A 1WUAA 2NRZA 4K42A 3DWLA 1SS6A 4MDAA 2QXLA 3ZEUA 1BO5O 5BPLA 1GLJO 3O1BA 3D7EO 4CZKA 2FF6A 3M6GA 5DM7L 1TYQA 1MWKA 2AP1A 4KH4A 3G25A 1KXPA 1H1VA 2P9PA 2NRWA 1K73O 3NVMA 1BA0A 2F9WA 4A59A 3D2EA 5C12A 4NLCA 5BN8A 3W0LA 5C2FA 3CCVN 3FGUA 2BH1A 2FF3B 5GIOA 1G99A 1C0GA 3MCAB 3QFUA 3VEYA 4ISEA 2QA4N 1T44A 3FZFA 2QWOA 5KQ8A 2GX9A 3ULEA 2E1YA 4FWRA 5AQVA 3UKUA 3MK6A 3O9QA 3H45C 1S72N 4IOAL 4AM7A 3LDOA 3R9PA 1T3VA 4JKCA 3H3OB 3O9RA 3C0BA 2RHKA 2I7PA 4BRPA 4CI6A 4IXCA 4MDBA 3QFPA 3JS6A 3AARA 4BG9A 2KLAA 3E9OA 3LDQA 4HTLA 2ZF5O 1P90A 2A6AA 4BROA 1BU6O 3E1YA 5KPTA 3TTFA 3CQYA 1VAZA 4BQLA 2Q97A 3OBWA 4PL8A 4QS8A 2IVPA 3MWPA 1X3NA 3R3LA 3CQXA 4BR0A 2NRHA 2KKZA 4ILHA 4KH6A 3CETA 1U6ZA 3GOIA 3LDNA 4JKEA 1K9MO 3TSUA 2ZJPL 2HBJA 1QVGM 3P39A 3CXCM 5GAEP 4FVUA 3CC2N 2E2NA 2P9SB 4AM6A 1CZAN 1KAYA 4JKGA 3MWTA 3KK7A 1J6ZA 3AY9A 4C1NI 2P9KA 4YORA 1KAZA 5C10A 4G9ZA 1NGIA 3I56N 1VQ9N 1NGJA 5JVHL 2VGMA 1IG8A 1V4SA 3SJHA 3DXKA 5I9EB 4GY2B 5E26A 2E20A 5BPMA 4FL9A 1MWMA 3CHWA 4K41A 1NGAA 5AQKA 3U9DA 1RDWX 4I6MB 4YOYA 3UE5A 1ESVA 5HOOA 4M63C 3U8XA 3SAGA 3VF4A 3C6HA 1QZ6A 4BRDA 4H0VB 3R6MA 3L4IA 2YJFA 1T6DA 3IUCA 5AR0A 4GNIA 4IWVA 2F9TA 5AQHA 4IO8A 2A3ZA 1HJOA 3RVCA 2Q2RA 5M1KA 1NBWA 4C23A 3P4IA 2CH5A 1S3XA 4L3QA 3UKRA 2E1ZA 3A5LC 4YDUA 3L0QA 5KQDA 2P9IB 5KPZA 2ASOA 4IZ9A 4M7XA 2W40A 4ISGA 5AQFA 3VOVA 5M1NA 3WQTA 1KD1O 4GV9A 3MDQA 4JK9A 2V7ZA 2IVNA 4PHTX 5GADP 4IFEA 4MO4A 4MLEA 1BWFO 4CZLA 3P38A 3WXKA 3EN9A 4A2AA 4WFNL 3CCLN 4YOWA 3Q7BA 4GV6A 3G4SN 5LJWA 1DKGD 1NWKA 3H46O 3ENOA 3C65A 3GG4A 3WT0A 5LY3A 4Z94A 2E8AA 3CPEA 5AQLA 5AQZA 1K8AO 2YHYA 3CCEN 2VGNA 3DJCA 3M3ZA 3CJAA 3N4PA 5FPDA 5BPNA 2A5XA 1JJ2M 1XQSC 1NGHA 3CJBA 3WQUA 1DEJA 1V4TA 4JNEA 1NGCA 2BUPA 4CD1A 3FZKA 5EOYA 4YOVA 3G6EN 1MDUB 1KAXA 1LCUA 1NGGA 4CZEA 1VQ7N 4E1JA 3DXMB 4WCEL 1YXQA 4OO1J 1T6CA 3R8EA 2CGJA 4B1XB 4CBXA 2FXUA 2ZGZA 3CERA 3O80A 3ATUA 5B8HA 3HOTA 3O8MA 3CCMN 4B9QA 4WQ4C 5AQTA 3FZMA 3IKMA 2E2QA 4EAHD 2QWNA 3WXJA 1K8KA 4JK8A 2FSJA 3AAPA 3MCPA 3SLCA 3VTHA 3C7NA 3IDHA 3ULEB 3ZETB 1YJNN 3O1WA 2V52B 4EHTA 4IOCL 2ZGYA 3N4QA 5GAHP 3O9UA 4WYBA 1XC3A 3D6RA 3CCJN 3VEXA 5C2DA 2CGLA 3O9TA 4UY8O 3E9LA 2RE2A 4FWKA 4BRGA 3CMAN 3CF5L 2ZWHA 1MA9B 3CJ9A 1QQMA 2Q0UA 4M7YA 4O8UA 2JWKA 3SMSA 3J7ZO 1TUUA 3ID8A 5AQMA 4BR2A 5MLCQ 4J8FA 3M1FA 3WXIA 3RSEB 1SAZA 3VETA 4BRIA 4JHDB 5CE3A 1JCFA 2A42A 1ATSA 4JKDA 4BC3A 5GINA 1Q82O 2WBNA 1ATRA 4JD2A 1S22A 1ZBSA 3HZ6A 5AQNA 5C15A 1GLEG 3VGMA 3BP8A 3P31A 4BRMA 4KH5A 1RGIA 4DQ8A 2V7YA 3AAQA 3O6WA 1VQ4N 5AQOA 3CCQN 5AQYA 1M1KO 2CH6A 2GELA 1RFQA 3Q7CA 1NLVA 2FSKA 5AQRA 4BR9A 2P9KB 5AZJB 3EL2A 4QS9A 3CC4N 3CJ1A 4FPBA 3ZX0A 1HKBA 3MN6A 4JKFA 1SQKA 4CBWA 4BC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y O;  1YJW N;  1Q86 O;  3PIO L;  3CCR N;  1YJ9 N;  1NJI O;  5JVG L;  2OTJ N;  2ZJR L;  1VQ6 N;  1W2B M;  2QEX N;  1VQL N;  4IO9 L;  5GAG P;  1VQO N;  4WFB L;  1KD1 O;  1Q81 O;  5GAD P;  2ZJQ L;  3OW2 M;  4WFN L;  3CCL N;  3CPW M;  1KQS M;  3I55 N;  1K8A O;  5H1S Q;  3CCE N;  4U67 L;  5DM7 L;  1JJ2 M;  1VQ5 N;  3G6E N;  1YHQ N;  1VQ7 N;  1VQK N;  1K73 O;  4WCE L;  1VQ8 N;  1OVY A;  3CCV N;  1YIJ N;  5DM6 L;  1YI2 N;  2QA4 N;  3CCM N;  4WFA L;  1KC8 O;  1YJN N;  4IOA L;  1S72 N;  3CCS N;  3G71 N;  4IOC L;  3DLL L;  5GAH P;  2OTL N;  3CCJ N;  1QVF M;  3PIP L;  4UY8 O;  3CF5 L;  3CMA N;  3CC7 N;  1VQM N;  3G4S N;  3J7Z O;  1YIT N;  5MLC Q;  1N8R O;  1ILY A;  1Q82 O;  1K9M O;  3CD6 N;  2ZJP L;  3CCU N;  1QVG M;  3CXC M;  5GAE P;  4WF9 L;  3CC2 N;  1VQ4 N;  3CCQ N;  1M1K O;  1VQP N;  5HL7 L;  3CME N;  3I56 N;  1VQ9 N;  5JVH L;  3CC4 N;  1VQN N;  1M90 O; 
#chains in the Genus database with same CATH topology
 1W97 L;  4CK1 A;  3HVT A;  1CXQ A;  3NVK A;  4JEP A;  1NMN A;  4RW9 A;  3TU5 A;  2JWL A;  3AGK A;  2FBY A;  4N41 A;  1JLA A;  3A0I X;  2VWJ A;  1WAF A;  3THV A;  2UU9 K;  3A8Y A;  3U4L A;  4BGA A;  3ASM A;  4CHZ A;  4QS7 A;  3D2F B;  3AVM A;  3GE1 A;  3PUF A;  1DLO A;  2OPQ A;  4KTZ A;  3LPU A;  1HJR A;  4I7F A;  1OH7 A;  2HHH K;  2ATQ A;  2G8U A;  2VCP A;  3VGK A;  3LDS A;  4JI6 K;  4IJA A;  3FFK B;  3NF6 A;  3HPG A;  4ZHR A;  4AIL C;  1ZBH A;  3OHR A;  4QAG A;  4NYN A;  4CJ4 A;  4X66 K;  5CZ2 A;  1HLU A;  1FJG K;  1Y97 A;  4A2B A;  4O5B A;  1YHQ N;  2XY7 A;  1HUX A;  3VQA A;  4C8M A;  3ZSZ A;  3IRX A;  4F9O A;  4FLX A;  3R1X A;  1U48 A;  1WN7 A;  2FBV A;  1KVB A;  5FRM A;  3OYI A;  3J81 O;  1NGF A;  1N5Y A;  4NXM K;  3K2P A;  4BY9 C;  3SBT A;  1S9G A;  1I39 A;  3KWG A;  2VG5 A;  1QE1 A;  4DTX A;  1QVF M;  3HI0 A;  4XEI A;  1NJX A;  4FXD A;  2G8V A;  3E9P A;  1GLA G;  4PA1 A;  3VES A;  1C0T A;  1LW2 A;  4WQ5 C;  4FJM A;  3KKS A;  3WEE A;  2ASM A;  2HBK A;  3VEN A;  4K25 A;  2YNI A;  1ZBF A;  4Y1C A;  4CJR A;  4V19 S;  4A62 A;  5AQU A;  2PY5 A;  4GKJ K;  5AQS A;  3HT3 A;  2YI1 A;  4ZTF A;  1SUQ A;  1VSJ A;  2IDO A;  4H5T A;  5I3U A;  1JCE A;  1NGD A;  3H6E A;  4ISF A;  3OA9 A;  2PFU A;  3O5B A;  2QXF A;  4BC5 A;  2W42 A;  4A57 A;  1YAG A;  1HNW K;  4CZG A;  3PV8 A;  1HQU A;  3DI6 A;  1FK9 A;  3F9K A;  1BI4 A;  1Z05 A;  3K9K A;  4DR7 K;  2O8B B;  4BR5 A;  1RDU A;  2IIR A;  3THY B;  3OYE A;  2HBL A;  4U7B A;  4IDH A;  1VQL N;  3DXM A;  4Z4C A;  3TSP A;  4NYF A;  1VQO N;  4X65 K;  1A5V A;  4CBU A;  2Z1H A;  4CIF A;  3L2V A;  3RTV A;  2ZJQ L;  4CEB A;  2OCE A;  1BDG A;  4DV3 K;  1O1W A;  3NH2 A;  3ZET A;  3I0S A;  1RDB A;  5M1F A;  5HRS A;  4KTQ A;  3KLG A;  1OH5 A;  4LY7 A;  1NK8 A;  1J9A A;  1VQK N;  4AHU A;  1JXE A;  1T05 A;  3ZX3 A;  4CFC A;  3VTI A;  1RTI A;  1YI2 N;  2V51 B;  4WFA L;  3K58 A;  4CGD A;  4DU4 A;  1NU0 A;  1JKH A;  2ITM A;  5DK5 A;  2PAV A;  3QB0 A;  1W7A A;  2O8F B;  1NJY A;  1KRP A;  3A5N C;  4RW8 A;  4IFY A;  4OX9 K;  1YUW A;  1RT6 A;  4BVO A;  2YJE A;  4AQY K;  1QZ5 A;  4DSL A;  3NDK A;  1UA0 A;  4JI5 K;  3SUQ A;  4FOE A;  4YFU A;  2D0A A;  4ELU A;  4MQ3 A;  1F21 A;  1K8K B;  4FK0 A;  3C7N B;  3QBX A;  3NH1 A;  4CIG A;  2NUB A;  3TPQ A;  4NO7 A;  3D0P A;  3EZ5 A;  2NNW A;  3WNF A;  4B1W B;  1JLQ A;  2QM1 A;  2IS3 A;  2IC3 A;  1JLC A;  3IFR A;  1QHA A;  4KFB A;  2EWS A;  4BDY A;  4DR4 K;  5TKW A;  2GEM A;  5JVG L;  2P9U A;  3F9M A;  4NLB A;  2J4R A;  3V6D A;  3SQ0 A;  4FSV A;  4EZ6 A;  2QWR A;  3A5M C;  3ENH A;  3VQ4 A;  1D8Y A;  4KV8 A;  2QEX N;  4DKW A;  4F3O A;  3BF3 A;  1QHT A;  1JLB A;  3OYC A;  1TAU A;  1YF5 L;  1GLL O;  1RTJ A;  2I7N A;  3SMP A;  4DTS A;  3I8D A;  3ZLJ A;  1TK0 A;  5F2R A;  4CJW A;  4H0X B;  2DFH A;  1C0F A;  3NCI A;  4IEE A;  4XH4 A;  2O8C A;  2OA8 A;  5BPL A;  3D7E O;  3M6G A;  4CES A;  3QNN A;  1ZYQ A;  1N33 K;  2AP1 A;  2P9P A;  1BA0 A;  1RBU A;  4A59 A;  1HPZ A;  4Q0B A;  3D2E A;  4BE1 A;  4CF8 A;  4NLC A;  2B6A A;  1RBV A;  1G99 A;  1C0G A;  3MCA B;  3QFU A;  1T44 A;  3FZF A;  2VQE K;  3OS2 A;  2GX9 A;  1S1T A;  4FWR A;  3AA2 A;  3MK6 A;  3O9Q A;  3H45 C;  4CVN E;  4AM7 A;  2ZQB A;  3O3F A;  3O9R A;  2FBX A;  4IXC A;  4CI6 A;  1XHZ A;  3E9O A;  4HTL A;  1P90 A;  2A6A A;  1EKE A;  3CFP A;  1U4B A;  4YNQ A;  3E1Y A;  3LZJ A;  3TTF A;  2BGG A;  3RR8 A;  4KTW A;  4CEC A;  3T19 A;  4LSN A;  1RT7 A;  2IVP A;  5HRO A;  4DWI A;  1X3N A;  1QS4 A;  3KD5 E;  3CQX A;  2AJQ A;  3CET A;  4W5O A;  4FJG A;  3LDN A;  1K9M O;  2EX3 A;  1KVA A;  2KFZ A;  1N34 K;  3M8R A;  4DF8 A;  3CC2 N;  2E2N A;  1CZA N;  3L8B A;  4JKG A;  1Z26 A;  3BDP A;  3MWT A;  4JI2 K;  2P9K A;  2KQ2 A;  1KAZ A;  4YOR A;  4IDK A;  4LF6 K;  5JVH L;  4E1N A;  1S1V A;  3A2F A;  4K0K K;  4GY2 B;  4YOY A;  2HW3 A;  4M63 C;  2YNF A;  3RMB A;  5T7B A;  4K8Z A;  3LWM A;  2LSN A;  4IWV A;  2F9T A;  3SZ2 A;  3V81 A;  5AQH A;  3OY9 A;  2A3Z A;  1VSE A;  4LFB K;  1NJW A;  1UA1 A;  2A1S A;  2E1Z A;  3A5L C;  3DYA A;  4PQU A;  2ASO A;  4DV5 K;  1KD1 O;  3VOV A;  3WQT A;  2UXC K;  2IVN A;  4RW4 A;  4CZL A;  3C95 A;  3CCL N;  4YOW A;  4CJQ A;  1KTQ A;  1NWK A;  4GKK K;  3GG4 A;  3WT0 A;  3CPE A;  1HNZ K;  3TAQ A;  4BWM A;  3NBP A;  3CCE N;  4IKF A;  2IAJ A;  3CJB A;  1DEJ A;  3MXJ A;  1EP4 A;  2HB5 A;  3FZK A;  1XC9 A;  1U49 A;  3DLH A;  1NGG A;  4E1J A;  4WCE L;  1YXQ A;  4FLY A;  3R8E A;  2CGJ A;  4B1X B;  2Q3S A;  2ZGZ A;  4CK3 A;  1IKY A;  3O80 A;  2IOC A;  2XHB A;  5AQT A;  3ZT2 A;  3FZM A;  4JK8 A;  5CY4 A;  1A5W A;  3VTH A;  3ULE B;  1J54 A;  3ZSQ A;  1TKD A;  4IOC L;  3VA3 A;  3LZI A;  1BIU A;  3D6R A;  1LAW A;  3TAR A;  4LH5 A;  2HMI A;  3E9L A;  4FWK A;  3NF9 A;  3EY1 A;  3QNO A;  4O8U A;  3SMS A;  3G4S N;  4NCA A;  1YIT N;  3ID8 A;  5MLC Q;  3M1F A;  3WXI A;  3S9H A;  2D0C A;  4BRI A;  4BC3 A;  3QEX A;  1Q82 O;  2WBN A;  1ATR A;  3SPY A;  1NK7 A;  1S22 A;  1ZBS A;  3OVN A;  5SZT A;  4DQ8 A;  1RT3 A;  3Q7C A;  1NLV A;  4FLZ A;  2FSK A;  4E7H A;  3ZSW A;  4L8R B;  3S3O A;  4QS9 A;  2OPS A;  3ZX0 A;  3OYJ A;  3MN6 A;  4JKF A;  3DXK B;  4YY3 K;  3CJC A;  3H08 A;  4DTN A;  1YJW N;  1MU2 A;  4C8K A;  4FWO A;  3HO1 A;  2QWL A;  4A5A A;  3CCR N;  2P9L A;  1YJ9 N;  4KPY A;  4FW1 A;  3LAL A;  1ATN A;  3I8B A;  4FJH A;  4F3T A;  5ELZ A;  3MN9 A;  5CHI A;  1GLC G;  2YHX A;  3ULD A;  3BZC A;  4O0I A;  1JCG A;  3QLH A;  3VF2 A;  1OH6 A;  4XH5 A;  3CM6 A;  3AA4 A;  4BRE A;  3SAH A;  2QWP A;  3RMC A;  2UUB K;  1RDD A;  3HOS A;  1QTM A;  1Q81 O;  2GWK A;  4FO0 A;  4C8L A;  3AVJ A;  2WFB A;  1U2V A;  4AF1 A;  4FWM A;  3KK3 A;  3QIO A;  1SKW A;  3QML A;  4HVJ A;  3L6Q A;  2P5G A;  3J7A P;  3KHY A;  2AA4 A;  4LF5 K;  1HR0 K;  5EY4 A;  4CJ5 A;  4A61 A;  4FJ5 A;  4FLW A;  4O0J A;  3S41 A;  3WNH A;  4BR4 A;  2KTQ A;  4EHU A;  2QKK A;  4B1U B;  1IKW A;  3HYF A;  4CJK A;  1RTD A;  4K8X A;  5ADX A;  3K5M A;  2HHW A;  5HLF A;  2UYT A;  1L3S A;  1GLF O;  4MLH A;  1VQ8 N;  2E2O A;  1HNX K;  4NCB A;  4CGF A;  3HRG A;  4LFA K;  3FZH A;  4BRC A;  3V4I A;  4OLB A;  3SJJ A;  1RBR A;  3CM5 A;  2Q0R A;  3EZW A;  5BR8 K;  3ZEU B;  3KWI A;  1C1C A;  2XO7 A;  4CEA A;  3CFO A;  1HKG A;  3K0S A;  4BAC A;  3OYD A;  4CF9 A;  2WON A;  4BRH A;  2O8D A;  4BRK A;  4I6M A;  4JI0 K;  4CK2 A;  4FJK A;  4OPK A;  4CZJ A;  3EO3 A;  4CZI A;  2HND A;  4W5N A;  4DQQ A;  1VSD A;  1JLG A;  4BRF A;  1I94 K;  4WF9 L;  3THW A;  4BDP A;  4I2P A;  3I33 A;  3C6T A;  5AQG A;  2OZM A;  4E19 A;  3UB5 A;  2P9I A;  1E3M A;  3OYG A;  3VPZ A;  3V9S A;  3O3H A;  4JI4 K;  4FJJ A;  1VRU A;  3LL3 A;  5LMU K;  1YT3 A;  4F2S A;  1WB9 A;  4M3Y A;  4DTJ A;  1EXQ A;  3TAM A;  5LJV A;  4YOT A;  4PWD A;  1X3M A;  3SCX A;  1D4X A;  3EKS A;  4JYA K;  3M5R A;  1N6Q A;  2OAN A;  2B4J A;  1VQ6 N;  1B9F A;  3SV3 A;  1Q9X A;  3B8A X;  5GAG P;  4B3M K;  4N76 A;  2YX6 A;  4H4M A;  2WUS A;  4CJ7 A;  5EU7 A;  3GDQ A;  3G0Z A;  4Z4H A;  5F0X A;  3CG7 A;  5KGX A;  4R79 A;  2P9N A;  1S1W A;  2BDP A;  2YV0 X;  5AZI A;  1N32 K;  1HQE A;  5BRD A;  3QDK A;  3M8Q A;  2FLO A;  4H5N A;  3NF8 A;  2HF3 A;  4BC2 A;  1XMO K;  3NMU A;  3KLE A;  3VEV A;  2NRR A;  3OS0 A;  4JHD A;  4DTR A;  1OVY A;  3MEE A;  5DM6 L;  5J1E A;  5FRO A;  3L3V A;  4FJL A;  2GUP A;  2QI2 A;  3AVG A;  3J8A A;  3O4W A;  1WSH A;  3TR8 A;  3KK2 A;  3LDP A;  2QK9 A;  4RTF D;  3KLI A;  3CC7 N;  2NRX A;  5FRN A;  2HNZ A;  1U47 A;  1EQY A;  3P83 D;  1N8R O;  5AJ3 K;  3WEE B;  3IAY A;  2RPI A;  1O13 A;  1NGE A;  2D0B A;  2W41 A;  2YNH A;  4LFC K;  1XUP O;  3L2R A;  3LP0 A;  4RWT A;  3ZX2 A;  2QW9 A;  3D2F A;  3T1A A;  1X9S A;  2YCH A;  2P1J A;  3I0R A;  3CFR A;  2GTD A;  1M90 O;  4FM2 A;  2NZT A;  2HBM A;  1HYV A;  5BN9 A;  2X74 A;  4FM0 A;  1RTH A;  4X64 K;  3PIO L;  2G8H A;  4BRA A;  2E5L K;  3AGR A;  2F4V K;  1C1B A;  4O5F A;  4DHY A;  2YNG A;  4JI8 K;  3V9Z A;  4FOI A;  1NMD A;  4JD2 B;  2ZJR L;  1BI4 B;  3HPO A;  4C1N K;  4E0D A;  3VQ8 A;  3TAB A;  4CHP A;  5J2P A;  1OKJ A;  3SAF A;  3IS9 A;  1DTT A;  4E7K A;  1NK9 A;  1QQO A;  3ZSY A;  1TVR A;  2Z1G A;  4H0P A;  5C24 A;  4M42 A;  3CJ7 A;  3OW2 M;  4KO0 A;  5AQW A;  5JLH A;  5LMN K;  2KW4 A;  1KQS M;  3VQC A;  1Q18 A;  3DLR A;  3DLE A;  2NRZ A;  2DTU A;  1GLJ O;  1MWK A;  1SL0 A;  4KH4 A;  2JLE A;  2YHA A;  3TAE A;  2D5R A;  3AVI A;  5KI6 A;  2F9W A;  3HP6 A;  1EWR A;  2Z1I A;  5C2F A;  5LL6 Z;  3CCV N;  2FF3 B;  1HYZ A;  3RRH A;  4DFK A;  4B3T K;  4CJS A;  2QA4 N;  3QEI A;  2E1Y A;  1XNR K;  4FZY A;  4IOA L;  5CYQ A;  1JLE A;  1T3V A;  4JKC A;  1RCH A;  4MDB A;  4CF1 A;  3AAR A;  3EEQ A;  2ZF5 O;  3WNG A;  2WOM A;  5KPT A;  1OH8 A;  4F8R A;  2Q97 A;  3OBW A;  1QQC A;  1HYS A;  3HK2 A;  4HUE A;  1BL3 A;  4I9Q A;  4ILH A;  1S5J A;  1U6Z A;  4JKE A;  3TSU A;  2ZJP L;  1QVG M;  2O8B A;  4M45 A;  4AH9 A;  5FLX O;  3THY A;  5GAE P;  2HVH A;  3SUN A;  4DU3 A;  2P9S B;  1ASW A;  4CER A;  1J6Z A;  3VQB A;  4G9Z A;  4JRP A;  2E4L A;  1W0H A;  1VQ9 N;  1Z25 A;  4CHN A;  1IG8 A;  1V4S A;  5I9E B;  5E26 A;  2E20 A;  5BPM A;  3ZSO A;  5AQK A;  1NKB A;  4JV5 K;  2O4I A;  5HOO A;  3U8X A;  3C6H A;  3NGZ A;  3THX B;  2G8I A;  1FKO A;  3LAK A;  2YJF A;  4UQG A;  1T6D A;  3IUC A;  1YTU A;  2HVI A;  4KHQ A;  3RVC A;  1HJO A;  3G10 A;  2VG6 A;  1D9F A;  4IBN A;  5M1K A;  3TAG A;  3P4I A;  3UKR A;  1S3X A;  3OYN A;  4J2B A;  4ICL A;  4LH4 A;  4CED A;  5KPZ A;  1T7P A;  4CEE A;  1VSK A;  4IZ9 A;  1BCM A;  3AVH A;  3MDQ A;  4JK9 A;  2V7Z A;  4PHT X;  1T8E A;  4KHS A;  4MLE A;  1BWF O;  3HM9 A;  4A2A A;  3Q7B A;  1JLF A;  3V1R A;  3NGI A;  2HNY A;  4JLH A;  4JI1 K;  5AQL A;  3OYA A;  3RMD A;  3V9W A;  3CJA A;  3KLF A;  3ZT0 A;  5BPN A;  2A5X A;  1JJ2 M;  1XQS C;  1NGH A;  1LWE A;  4JNE A;  2O8F A;  4CD1 A;  5EOY A;  1VQ7 N;  2XY8 A;  3HXM A;  1KAX A;  1LV5 A;  4J2E A;  3NHG A;  4OO1 J;  4CBX A;  4FJI A;  4BWJ A;  3CER A;  3B6O A;  3ATU A;  3HOT A;  1ITG A;  3O4Q A;  4W5R A;  2YKM A;  3VN5 A;  1K8K A;  3HP9 A;  3K5L A;  1YJN N;  3C7N A;  3O1W A;  4EHT A;  2PYL A;  3N4Q A;  3O9U A;  4AHS A;  3P1G A;  3VEX A;  4UY8 O;  2UXB K;  1X9W A;  4Z4G A;  3CF5 L;  2ZWH A;  3AO1 A;  1WBD A;  2RF2 A;  2F96 A;  1CZB A;  4KHU A;  3DLB A;  3RSE B;  1SAZ A;  1L3V A;  3RR7 A;  1S6P A;  4CJ3 A;  4DV2 K;  5GIN A;  4PY5 A;  3OYL A;  4CCH A;  3HZ6 A;  5AQN A;  5C15 A;  3QEW A;  2HHV A;  3BP8 A;  3P31 A;  1IBL K;  4DUY K;  4KRE A;  2V7Y A;  1VQ4 N;  3CCQ N;  3PX4 A;  4BR9 A;  2P9K B;  5AZJ B;  1TL3 A;  5J2Q A;  5JS2 A;  3EL2 A;  3CC4 N;  4DR3 K;  4KB1 A;  2X6S A;  1HKB A;  2ZD1 A;  4KHP K;  4CBW A;  4BC4 A;  1QSL A;  1XNQ K;  2BAN A;  3QEP A;  4KI6 A;  4HCB A;  3DOL A;  4DSF A;  1SZ2 A;  2DY4 A;  3BEX A;  2YHW A;  1HMV A;  4BGB A;  4HHT A;  3TSQ A;  1U45 A;  3ENB A;  3C6A A;  2OPP A;  4IOX A;  4DMN A;  3QIC A;  4WFB L;  4C8N A;  3SUO A;  3H3N O;  4DR6 K;  3HSC A;  3OTO K;  1L5U A;  3AO5 A;  3LM2 A;  5I42 A;  4FJX A;  4FWS A;  4B1Y B;  2F7T A;  3VF6 A;  5JIC A;  4N56 A;  2E6L A;  5BRE A;  4N47 A;  3LPT A;  1SL2 A;  1RT2 A;  4BVP A;  3CYM A;  4CJE A;  1SKS A;  1Q9Y A;  1ZC6 A;  1NM1 A;  3VQQ A;  3OYK A;  3EYZ A;  4CD3 A;  4CF2 A;  4FJ9 A;  5EVZ A;  4DSE A;  4M3U A;  2W6L A;  2XY6 A;  3U9Z A;  5J2N A;  4B9V A;  4B9U A;  4DQP A;  4CGH A;  1S6Q A;  3BY5 A;  3KK1 A;  2D1K A;  2G8W A;  3FR0 A;  4PKI A;  1TUY A;  3W3D A;  4CJU A;  1Z6R A;  2G8F A;  4CHQ A;  3LDL A;  4JN4 A;  4EP4 A;  3ZT3 A;  4F4K A;  4FM1 A;  4CEZ A;  1NG9 A;  1KFD A;  3BF1 A;  2WTU A;  1GLD G;  1B9D A;  5AQI A;  1TYQ B;  2A41 A;  1IJJ A;  2Q1N A;  4B1V A;  5F1X A;  2Q36 A;  1BIZ A;  1CZ9 A;  3MN5 A;  1RDA A;  2DPN A;  5AQJ A;  4DCH A;  1XWL A;  1FKP A;  1ILY A;  3SPZ A;  5FPM A;  3JSM A;  1R0A A;  4CF0 A;  3OBY A;  1IBM K;  3S3N A;  3CD6 N;  4DV6 K;  3AO4 A;  1ZXO A;  3UKU B;  1G15 A;  1UOC A;  3QBW A;  3ZYY X;  1DT9 A;  4BDZ A;  4NXN K;  5HL7 L;  4KI4 A;  3CME N;  4DV1 K;  4H03 B;  4W5T A;  1Q7Y O;  3PO5 A;  3ITH A;  2B5J A;  1Q86 O;  4CFA A;  3U3Y A;  1RBS A;  3PSI A;  1EWQ A;  1TK5 A;  3LWL A;  3T1Y K;  4KB0 A;  4JKA A;  4AHV A;  3TTD A;  2E2P A;  4DB3 A;  2Y1I A;  4CHY A;  3T7Z A;  4OPA A;  2X78 A;  2DFE A;  3DRS A;  3T69 A;  3BGR A;  4GV3 A;  5KTQ A;  5BR9 A;  1W2B M;  2E88 A;  4WQ5 A;  3DRR A;  4DTO A;  5ADX H;  1BOT O;  1ZBU A;  4KHY A;  1WLJ A;  3KTQ A;  1QQN A;  2X6N A;  1GLB G;  1U2V B;  2NLX A;  3CPW M;  4IG3 A;  2HOE A;  4DUZ K;  2GV9 A;  4BR7 A;  1X1P A;  1J5E K;  3FLC O;  1VSM A;  3RRG A;  3UIQ A;  4H0O A;  4JI7 K;  4HUF A;  5KRS A;  5KPR A;  1REV A;  4FWP A;  4FPA A;  3ZT1 A;  4GMJ B;  4O55 A;  1TGO A;  1N36 K;  5AQQ A;  4YOU A;  3HM8 A;  4OGE A;  3VMF B;  2E6M A;  4HWI A;  3F5T A;  4JI3 K;  5AFU A;  4W5Q A;  3GL1 A;  5HRP A;  2OZS A;  4KHN A;  4PUO A;  4YOX A;  3G71 N;  3DLL L;  3T3F A;  4K43 A;  2D0P A;  2Y1J A;  1JL2 A;  3PIP L;  4HCC A;  3K9J A;  4JAX A;  4CJP A;  1XI1 A;  5FPE A;  5HRN A;  4Z4I A;  3AVN A;  1HRH A;  1LW0 A;  3PY8 A;  3ZT4 A;  4CEF A;  4CJT A;  4IEI A;  2A40 A;  2O8E B;  1RDC A;  4H8K A;  4M3X A;  5M1O A;  4CZM A;  3AA5 X;  2FSN A;  2VQF K;  3HVR A;  3MAQ A;  3OYB A;  1BIS A;  2Q31 A;  3DMJ A;  4GVE A;  1K6Y A;  5C0Y A;  4CJF A;  1XHX A;  4CGJ A;  3EE9 A;  1S9E A;  1D9D A;  3GBT A;  1VQN N;  3NF7 A;  4ZTJ A;  4EFH A;  3F2K A;  4DSK A;  4GVM A;  1LWF A;  5BRH A;  1L3U A;  4IJN A;  1RT4 A;  4FK4 A;  3WXL A;  2RKI A;  4CIE A;  2HF4 A;  3SQ2 A;  2JGU A;  2ITG A;  3SYZ A;  4JKH A;  1ASU A;  4E7I A;  5M1P A;  4RG8 A;  4CGI A;  3BZK A;  1D5A A;  2YKN A;  3F73 A;  2EHG A;  3HL8 A;  3PX6 A;  3O08 A;  1IKX A;  3MX2 A;  3U3G A;  4DSI A;  4OVL A;  1UWB A;  4FWN A;  2GWJ A;  3KIO A;  4J2A A;  4BRN A;  4FJN A;  3OJU A;  2P9N B;  4H5W A;  3KZB A;  3E66 A;  5AZI B;  4XH1 A;  4MDA A;  3ZEU A;  3DWL A;  3RWU A;  1BO5 O;  4CZK A;  3ZSR A;  3V1Q A;  1B92 A;  3G25 A;  1H1V A;  2NRW A;  3NVM A;  4DF4 A;  2UXD K;  3W0L A;  2HHT A;  3VEY A;  4ISE A;  1SKR A;  1VSH A;  5KQ8 A;  4YHH K;  1S72 N;  1SL1 A;  3LDO A;  2G8K A;  2HHS A;  3H3O B;  4BRP A;  3NE6 A;  1EET A;  1TV6 A;  3JS6 A;  4OPJ A;  1BU6 O;  3CQY A;  4BQL A;  4FCY A;  3CQ8 A;  3K5N A;  3R3L A;  4BR0 A;  3GOI A;  1U04 A;  1DTQ A;  4RW6 A;  4KKO A;  4DG1 A;  4DV7 K;  4FLU A;  2Z1J A;  1KAY A;  3KK7 A;  3LAM A;  3AY9 A;  4C1N I;  1NNE A;  3ZSX A;  3DLK A;  3I56 N;  1NGJ A;  5K14 A;  1LWC A;  2GUI A;  2W6K A;  1QSY A;  3E01 A;  2KZZ A;  2ETJ A;  1MWM A;  3CHW A;  4K41 A;  3U9D A;  1WSG A;  3MED A;  3UE5 A;  1ESV A;  3VF4 A;  1CLQ A;  4BE0 A;  1QZ6 A;  4BRD A;  4H0V B;  4KAZ A;  3L4I A;  4DV4 K;  5AR0 A;  1C1A A;  3AVB A;  4IO8 A;  3KLH A;  2Q2R A;  4C23 A;  4FJ8 A;  3FFI A;  2CH5 A;  4DFJ A;  4L3Q A;  1ZBI A;  4YDU A;  5JS1 A;  4M7X A;  4ISG A;  4DFM A;  4MO4 A;  2ZM6 K;  2P5O A;  2XRI A;  2KZM A;  4QCL A;  1DKG D;  3ENO A;  5LY3 A;  4Z4F A;  1K8A O;  5AQZ A;  2VGN A;  3DJC A;  3M3Z A;  3V9X A;  4FLT A;  1RT5 A;  3N4P A;  3SI6 A;  5FPD A;  3VQD A;  3WQU A;  1WSJ A;  3G6E N;  2BUP A;  1VSF A;  4CZE A;  3DXM B;  5C42 A;  4B9M A;  1T6C A;  5IWA K;  4B3R K;  4LF8 K;  2FXU A;  4LSL A;  4KRF A;  4B9S A;  4ID5 A;  3PX0 A;  3SNN A;  3CCM N;  3IKM A;  4DTM A;  2QWN A;  3WXJ A;  2FSJ A;  3C94 A;  3MCP A;  3VA0 A;  3IDH A;  3ZET B;  2V52 B;  3OYF A;  2ZGY A;  4B08 A;  4CEO A;  4M3R A;  3LP2 A;  3L2Q A;  5C2D A;  1XMQ K;  3AVA A;  3O9T A;  1X9M A;  4C8O A;  3CMA N;  1MA9 B;  3CJ9 A;  1ASV A;  5DMR A;  1QQM A;  4AHT A;  2Q0U A;  3J7Z O;  2JWK A;  4RW7 A;  4JS4 A;  5AQM A;  5CE3 A;  1FW6 A;  4EZ9 A;  4Q5V A;  2A42 A;  3AA3 A;  4JKD A;  3RMA A;  3M8P A;  4JD2 A;  4DR2 K;  1Q8I A;  2VG7 A;  4CE9 A;  1GLE G;  2YHB A;  3VGM A;  4BRM A;  1RGI A;  3AAQ A;  5AQO A;  1OVQ A;  5AQY A;  1M1K O;  4KHW A;  3ISN C;  1GOB A;  1NOY A;  3AVK A;  3LP1 A;  1WSE A;  4HUG A;  3CJ1 A;  4OJR A;  1SQK A;  1ZBL A;  2PZS A;  3B6P A;  3QET A;  1BA1 A;  3SK3 A;  2DFF A;  3BUZ B;  3TWH A;  2O4G A;  5TKY A;  4AHR A;  2NRT A;  2RN2 A;  2H3G X;  2OTJ N;  4DFP A;  4DQR A;  1C0M A;  3JXU A;  3NAE A;  4XIU A;  1IV0 A;  4OPH A;  4DU1 A;  2D0O A;  4AHC A;  3UKR B;  1RNH A;  3QES A;  3ID6 A;  4N5S A;  3V1O A;  4ILJ A;  3LAN A;  4E1M A;  1NK5 A;  4M3W A;  2FBT A;  3H1Q A;  1WNS A;  2BE2 A;  3KD1 E;  3I55 N;  1A5X A;  3C6U A;  4H5R A;  1Y64 A;  2ZE2 A;  4HTU A;  3OJS A;  1NGB A;  2P9U B;  3H1V X;  5JMV A;  4B1Z A;  4I9L A;  4BE2 A;  4DTP A;  5E84 A;  4BRL A;  3WXM B;  1VQ5 N;  4FVM A;  3CI5 A;  1HX1 A;  3EE8 A;  4B9L A;  1X9J A;  3VEO A;  3MN7 A;  4O4G A;  2I5J A;  1YIJ N;  3VQ6 A;  4CFD A;  1LOT B;  3HBT A;  4O44 A;  1KC8 O;  2P9S A;  1NJZ A;  3CCS N;  1E4G T;  2O8C B;  4OKJ A;  4BQZ A;  4B9N A;  5M1Q A;  4NB4 A;  4MO5 A;  3FZL A;  3AVC A;  2P9P B;  4M3T A;  1VQM N;  3HTV A;  1RBT A;  1CXU A;  1WBB A;  3D2E B;  3KJV A;  2P51 A;  3VQ7 A;  4FZZ A;  5SWM A;  3THX A;  5HRR A;  1BGX T;  3FE1 A;  3CCU N;  4CEQ A;  3P5J A;  3MEG A;  4JRQ A;  4E7L A;  3TAF A;  5EXW A;  4M3Z A;  1TAQ A;  2ASP A;  1VQP N;  1BG3 A;  4CFB A;  3OYM A;  3WNE A;  3VER A;  3PSF A;  1TK8 A;  4RCH A;  4DV0 K;  1YVN A;  1W9H A;  4PL7 A;  3MEC A;  4CZH A;  5KRT A;  4JS5 A;  3L4Q A;  3JAM O;  3J80 O;  4B8C A;  1TL1 A;  4DLG A;  2BTF A;  3AO3 A;  3ZSV A;  2F8T A;  1KSP A;  1L3T A;  3DAW A;  5CYM A;  1KVC A;  3ZCM A;  1IBK K;  2UUA K;  5A2Q O;  5GIP A;  5HP1 A;  3L2U A;  4JKG B;  4ELV A;  1GOC A;  2QWM A;  4IO9 L;  3LM9 A;  1BCO A;  4CGG A;  1WAJ A;  1TKZ A;  4ID1 A;  3SUP A;  3ATV A;  4B8A B;  5BRF A;  3ALY A;  3T1H K;  4WQ4 A;  3A5O C;  1SV5 A;  3DRP A;  4DQS A;  5CR4 A;  4DLE A;  1R59 O;  1IG9 A;  2VWB A;  2HST A;  2IVO A;  4U67 L;  4OGC A;  1E4F T;  1NK4 A;  4E7J A;  3VQP A;  4FZX C;  1YVU A;  3MXM A;  4NCG A;  4PKH A;  4CJV A;  2PBD A;  4YDU C;  2QWQ A;  1FXX A;  4G1Q A;  3RSE A;  4CZF A;  4J2D A;  3VEZ A;  3LP3 A;  2HMP A;  3KVG A;  4ILG B;  4BG8 A;  4DR1 K;  2KFN A;  4A5B A;  4JK7 A;  4X62 K;  3NH0 A;  1EO1 A;  3SQ4 A;  1VSL A;  3VGL A;  5AQP A;  3HPH A;  1RT1 A;  4R5P A;  1BUP A;  2OTL N;  5AZJ A;  3SBG A;  4H5V A;  3O3G A;  3IMX A;  4LC9 B;  1KLM A;  1WSF A;  1BQM A;  4KBO A;  3NGY A;  1S1U A;  3QEV A;  2CGK A;  5EX5 A;  4F2R A;  1C6V A;  5FPN A;  1WOQ A;  2NRV A;  3MX5 A;  4O8K A;  2WC9 A;  2QTD A;  4Z4E A;  4FWQ A;  3VEW A;  4B9T A;  4Y0W A;  1HKC A;  3QO9 A;  3K57 A;  3EKU A;  3K5O A;  4E3S A;  2HHQ A;  1I3A A;  2GBZ A;  4FWL A;  4JKB A;  3O4N A;  5J2M A;  3SV4 A;  3PLA A;  2VYP A;  1VSI A;  4LD0 A;  5AQX A;  1NK6 A;  3TTC A;  3AVF A;  2D4W A;  1NJI O;  5IT9 O;  4Z94 A;  4H0T B;  4MFB A;  4EIA A;  3IG1 A;  1EX4 A;  2HHX A;  1HPM A;  3O9S A;  2KHO A;  3V9U A;  4PKG A;  3OYH A;  3PO4 A;  4DTU A;  2F8S A;  2VWK A;  4H0Y B;  3WUH A;  1DGK N;  2R7Y A;  3TAP A;  4BRQ A;  3DLG A;  3MMV A;  1P8Z A;  2IGI A;  1NKC A;  5AFU H;  5H1S Q;  2P9L B;  3QER A;  3CIP A;  1GOA A;  1WUA A;  4K42 A;  5JLF A;  1SS6 A;  2QXL A;  3VQ5 A;  2XY5 A;  3O1B A;  2FF6 A;  5DM7 L;  3VQE A;  1TYQ A;  5D3G A;  1C0U A;  4DQI A;  1KXP A;  3NFA A;  1K73 O;  1WSI A;  3VQ9 A;  3K59 A;  5C12 A;  5BN8 A;  2UUC K;  1UAX A;  4FW2 A;  3FGU A;  5CZ1 A;  2BH1 A;  5GIO A;  4FJ7 A;  5HBM A;  4CW7 B;  2QWO A;  4H4O A;  3ULE A;  4LF9 K;  5AQV A;  3UKU A;  4DSJ A;  3R9P A;  4DS4 A;  1S1X A;  1NKE A;  3C0B A;  2RHK A;  2I7P A;  3QFP A;  4BG9 A;  2KLA A;  3LDQ A;  4BRO A;  1VAZ A;  4PL8 A;  4DS5 A;  4QS8 A;  4CHO A;  3S3M A;  1HNI A;  3MWP A;  3U6F A;  2NRH A;  2KKZ A;  4KH6 A;  3AO2 A;  1LAV A;  2HBJ A;  3P39 A;  4OKE A;  3JYT A;  3CXC M;  4FVU A;  1VRT A;  4AM6 A;  4DR5 K;  2FC0 A;  4E89 A;  5C10 A;  1NGI A;  3MXI A;  4FYD A;  5E41 A;  2VGM A;  1VK0 A;  1RIL A;  3SJH A;  3DXK A;  2O8D B;  4FL9 A;  2HHU A;  1NGA A;  1RDW X;  4I6M B;  1VHX A;  4CJL A;  3HST B;  3SAG A;  4LF4 K;  4EP5 A;  3QIP A;  3OS1 A;  3R6M A;  1NK0 A;  4GNI A;  4WE1 A;  3L3U A;  5KGW A;  3THW B;  1KLN A;  1NBW A;  4M41 A;  4IFV A;  4ELT A;  3L0Q A;  5KQD A;  2P9I B;  5AQF A;  2W40 A;  4GV9 A;  5M1N A;  1IKV A;  5GAD P;  4IFE A;  3P38 A;  1JL1 A;  3EN9 A;  3WXK A;  4WFN L;  4GV6 A;  4LF7 K;  5LJW A;  3AVL A;  3H46 O;  3C65 A;  1KCF A;  2E8A A;  2YHY A;  3L2W A;  4B3O A;  4OLA A;  1BQN A;  5C25 A;  3DM2 A;  1V4T A;  4TSX A;  1NGC A;  4YOV A;  3QIN A;  1QSS A;  1MDU B;  1LCU A;  2OPR A;  2QKB A;  5B8H A;  1YTA A;  1JXB A;  1BHL A;  3O8M A;  3TI0 A;  2O8E A;  4IG0 A;  4B9Q A;  4WQ4 C;  2E2Q A;  4EAH D;  3TAN A;  3AAP A;  3SLC A;  1TKX A;  1J53 A;  1IO2 A;  1TKT A;  5GAH P;  4WYB A;  2A1R A;  4GW6 A;  1XC3 A;  3CCJ N;  1KFS A;  2CGL A;  2RE2 A;  4BRG A;  3DOK A;  1NOZ A;  3J7Y P;  5FDL A;  3AV9 A;  4FLV A;  1T03 A;  4M7Y A;  1TUU A;  4BR2 A;  4B3S K;  2OYQ A;  4J8F A;  1J5O A;  3SQ1 A;  2PYJ A;  1IH7 A;  3VET A;  4JHD B;  1HNV A;  1JCF A;  1ATS A;  3D45 A;  4I2Q A;  3HJF A;  4KH5 A;  3O6W A;  4FK2 A;  3KKR A;  2CH6 A;  2GEL A;  1RFQ A;  4OKK A;  5AQR A;  3M8S A;  4Z0U A;  4Y1D A;  4FPB A;  4QOZ B; 
#chains in the Genus database with same CATH homology
 1W97 L;  3DXK B;  3CJC A;  1BA1 A;  3SK3 A;  1YJW N;  3NVK A;  4FWO A;  3BUZ B;  4JEP A;  2QWL A;  4A5A A;  3CCR N;  2P9L A;  3TU5 A;  1YJ9 N;  5TKY A;  2JWL A;  1ATN A;  2NRT A;  3AGK A;  3I8B A;  2H3G X;  1SZ2 A;  5ELZ A;  3A0I X;  2OTJ N;  3MN9 A;  3JXU A;  3BEX A;  2YHW A;  1GLC G;  2YHX A;  5CHI A;  4BGB A;  3A8Y A;  4OPH A;  2D0O A;  1JCG A;  3TSQ A;  3U4L A;  3ENB A;  3C6A A;  4BGA A;  3VF2 A;  4IOX A;  4XH5 A;  4BRE A;  3SAH A;  4QS7 A;  3UKR B;  2QWP A;  3D2F B;  3QIC A;  3GE1 A;  4WFB L;  3ID6 A;  4ILJ A;  3HOS A;  3H3N O;  1Q81 O;  2GWK A;  4FO0 A;  2WFB A;  1U2V A;  3H1Q A;  4AF1 A;  4FWM A;  3HSC A;  3I55 N;  2VCP A;  3QML A;  4H5R A;  3LM2 A;  3L6Q A;  1Y64 A;  3KHY A;  4FWS A;  2AA4 A;  3VGK A;  4B1Y B;  2F7T A;  3VF6 A;  4IJA A;  5JIC A;  3FFK B;  5EY4 A;  1NGB A;  2P9U B;  3H1V X;  4A61 A;  5BRE A;  3S41 A;  5JMV A;  3OHR A;  4B1Z A;  4BVP A;  4BR4 A;  5E84 A;  1HLU A;  4BRL A;  4EHU A;  1ZC6 A;  4A2B A;  4B1U B;  1NM1 A;  3WXM B;  1VQ5 N;  1YHQ N;  3CI5 A;  5ADX A;  1HX1 A;  1HUX A;  2UYT A;  4CD3 A;  3EE8 A;  1GLF O;  4MLH A;  5EVZ A;  1VQ8 N;  1X9J A;  2E2O A;  4F9O A;  3R1X A;  3VEO A;  3U9Z A;  3MN7 A;  1YIJ N;  1NGF A;  1LOT B;  3HBT A;  3HRG A;  3FZH A;  4BRC A;  2D1K A;  1KC8 O;  3FR0 A;  4PKI A;  1TUY A;  2P9S A;  3W3D A;  1Z6R A;  3LDL A;  4JN4 A;  4BY9 C;  3SBT A;  3CCS N;  1E4G T;  3KWG A;  2Q0R A;  3EZW A;  3ZEU B;  3KWI A;  4BQZ A;  3BF1 A;  1QVF M;  1GLD G;  3HI0 A;  5AQI A;  1TYQ B;  5M1Q A;  4XEI A;  4NB4 A;  4MO5 A;  2A41 A;  1HKG A;  1IJJ A;  2Q1N A;  4B1V A;  5F1X A;  2Q36 A;  3E9P A;  3FZL A;  1GLA G;  2P9P B;  3VES A;  1VQM N;  3HTV A;  4WQ5 C;  4BRH A;  3MN5 A;  4BRK A;  3WEE A;  2DPN A;  4I6M A;  5AQJ A;  4DCH A;  1ILY A;  2ASM A;  2HBK A;  3D2E B;  5FPM A;  4K25 A;  3VEN A;  3OBY A;  4CZJ A;  3EO3 A;  4CZI A;  3CD6 N;  3FE1 A;  3CCU N;  4A62 A;  5AQU A;  4BRF A;  4WF9 L;  1ZXO A;  5AQS A;  2YI1 A;  3UKU B;  3I33 A;  3QBW A;  5EXW A;  3ZYY X;  1DT9 A;  5AQG A;  2ASP A;  1VQP N;  1BG3 A;  2P9I A;  3UB5 A;  5HL7 L;  3CME N;  4H5T A;  3VPZ A;  1JCE A;  3VER A;  1NGD A;  4H03 B;  3H6E A;  4RCH A;  1YVN A;  4PL7 A;  4ISF A;  4CZH A;  3OA9 A;  2PFU A;  1Q7Y O;  3O5B A;  3LL3 A;  3L4Q A;  4BC5 A;  1Q86 O;  4A57 A;  2BTF A;  5LJV A;  1YAG A;  4YOT A;  4CZG A;  1X3M A;  1D4X A;  1Z05 A;  3DAW A;  3EKS A;  3K9K A;  4JKA A;  4BR5 A;  1RDU A;  2IIR A;  2E2P A;  3TTD A;  4DB3 A;  3M5R A;  2HBL A;  3T7Z A;  4OPA A;  2OAN A;  5GIP A;  3T69 A;  4U7B A;  4IDH A;  4GV3 A;  1VQ6 N;  4JKG B;  5BR9 A;  1W2B M;  2E88 A;  4WQ5 A;  3DXM A;  2QWM A;  1VQL N;  4IO9 L;  3B8A X;  3LM9 A;  3TSP A;  5GAG P;  1VQO N;  5ADX H;  4CBU A;  1BOT O;  2YX6 A;  4CJ7 A;  2WUS A;  3ATV A;  2ZJQ L;  1QQN A;  3GDQ A;  5BRF A;  1GLB G;  1U2V B;  4WQ4 A;  2NLX A;  3CPW M;  1BDG A;  5F0X A;  3A5O C;  4R79 A;  2P9N A;  2HOE A;  5CR4 A;  3ZET A;  5AZI A;  4BR7 A;  1R59 O;  5M1F A;  2VWB A;  2HST A;  2IVO A;  3FLC O;  3QDK A;  4U67 L;  5BRD A;  2FLO A;  4H5N A;  1E4F T;  4H0O A;  2HF3 A;  4BC2 A;  5KPR A;  4PKH A;  1VQK N;  2PBD A;  3NMU A;  4FWP A;  2NRR A;  4FPA A;  4YDU C;  2QWQ A;  3RSE A;  3VEV A;  4JHD A;  5AQQ A;  4CZF A;  4YOU A;  1OVY A;  3HM8 A;  3VEZ A;  2HMP A;  3KVG A;  4ILG B;  4BG8 A;  3VMF B;  4HWI A;  3ZX3 A;  3VTI A;  5DM6 L;  3F5T A;  1YI2 N;  5AFU A;  3GL1 A;  2GUP A;  2V51 B;  4WFA L;  4A5B A;  4JK7 A;  2QI2 A;  1EO1 A;  3VGL A;  5AQP A;  4YOX A;  3J8A A;  3G71 N;  1BUP A;  3O4W A;  2ITM A;  3DLL L;  3LDP A;  4K43 A;  2OTL N;  5AZJ A;  2D0P A;  3SBG A;  4RTF D;  2PAV A;  3PIP L;  4H5V A;  3IMX A;  4LC9 B;  3K9J A;  4JAX A;  3QB0 A;  3CC7 N;  2NRX A;  4KBO A;  3A5N C;  5FPE A;  1YUW A;  1EQY A;  5JLF A;  2CGK A;  5EX5 A;  1N8R O;  3WEE B;  5FPN A;  1WOQ A;  1O13 A;  2NRV A;  4BVO A;  2YJE A;  3MX5 A;  1NGE A;  1QZ5 A;  2WC9 A;  4O8K A;  2QTD A;  2W41 A;  4IEI A;  1YIT N;  4FOE A;  4FWQ A;  2A40 A;  3VEW A;  1XUP O;  5M1O A;  4CZM A;  2FSN A;  1K8K B;  4Y0W A;  4RWT A;  3ZX2 A;  3C7N B;  1HKC A;  3QBX A;  3EKU A;  3TPQ A;  2QW9 A;  3D2F A;  4NO7 A;  2Q31 A;  2NNW A;  4GVE A;  5C0Y A;  4FWL A;  2YCH A;  4JKB A;  4B1W B;  3EE9 A;  3GBT A;  3PLA A;  2QM1 A;  2GTD A;  1VQN N;  2VYP A;  1M90 O;  4EFH A;  3F2K A;  3IFR A;  2NZT A;  5AQX A;  3TTC A;  2HBM A;  1QHA A;  5BRH A;  2EWS A;  4IJN A;  5BN9 A;  3WXL A;  3PIO L;  2D4W A;  2HF4 A;  5TKW A;  4BRA A;  1NJI O;  2GEM A;  3AGR A;  5JVG L;  4O5F A;  2P9U A;  3F9M A;  4H0T B;  4JKH A;  4NLB A;  4FOI A;  1NMD A;  4JD2 B;  4DHY A;  4EIA A;  5M1P A;  1HPM A;  2J4R A;  3O9S A;  2ZJR L;  2KHO A;  4FSV A;  2QWR A;  4PKG A;  4C1N K;  3A5M C;  3ENH A;  1OKJ A;  2QEX N;  4DKW A;  4H0Y B;  3O08 A;  3SAF A;  3MX2 A;  1QQO A;  3BF3 A;  3WUH A;  1DGK N;  4H0P A;  1YF5 L;  4BRQ A;  1GLL O;  3CJ7 A;  2I7N A;  3SMP A;  3MMV A;  3OW2 M;  4FWN A;  2GWJ A;  1P8Z A;  4BRN A;  5AQW A;  5JLH A;  1KQS M;  5F2R A;  5AFU H;  4H0X B;  2P9N B;  1C0F A;  3KZB A;  4H5W A;  1Q18 A;  5H1S Q;  2P9L B;  3E66 A;  4IEE A;  3CIP A;  5AZI B;  4XH1 A;  4XH4 A;  1WUA A;  2NRZ A;  4K42 A;  3DWL A;  1SS6 A;  4MDA A;  2QXL A;  3ZEU A;  1BO5 O;  5BPL A;  1GLJ O;  3O1B A;  3D7E O;  4CZK A;  2FF6 A;  3M6G A;  5DM7 L;  1TYQ A;  1MWK A;  2AP1 A;  4KH4 A;  3G25 A;  1KXP A;  1H1V A;  2P9P A;  2NRW A;  1K73 O;  3NVM A;  1BA0 A;  2F9W A;  4A59 A;  3D2E A;  5C12 A;  4NLC A;  5BN8 A;  3W0L A;  5C2F A;  3CCV N;  3FGU A;  2BH1 A;  2FF3 B;  5GIO A;  1G99 A;  1C0G A;  3MCA B;  3QFU A;  3VEY A;  4ISE A;  2QA4 N;  1T44 A;  3FZF A;  2QWO A;  5KQ8 A;  2GX9 A;  3ULE A;  2E1Y A;  4FWR A;  5AQV A;  3UKU A;  3MK6 A;  3O9Q A;  3H45 C;  1S72 N;  4IOA L;  4AM7 A;  3LDO A;  3R9P A;  1T3V A;  4JKC A;  3H3O B;  3O9R A;  3C0B A;  2RHK A;  2I7P A;  4BRP A;  4CI6 A;  4IXC A;  4MDB A;  3QFP A;  3JS6 A;  3AAR A;  4BG9 A;  2KLA A;  3E9O A;  3LDQ A;  4HTL A;  2ZF5 O;  1P90 A;  2A6A A;  4BRO A;  1BU6 O;  3E1Y A;  5KPT A;  3TTF A;  3CQY A;  1VAZ A;  4BQL A;  2Q97 A;  3OBW A;  4PL8 A;  4QS8 A;  2IVP A;  3MWP A;  1X3N A;  3R3L A;  3CQX A;  4BR0 A;  2NRH A;  2KKZ A;  4ILH A;  4KH6 A;  3CET A;  1U6Z A;  3GOI A;  3LDN A;  4JKE A;  1K9M O;  3TSU A;  2ZJP L;  2HBJ A;  1QVG M;  3P39 A;  3CXC M;  5GAE P;  4FVU A;  3CC2 N;  2E2N A;  2P9S B;  4AM6 A;  1CZA N;  1KAY A;  4JKG A;  3MWT A;  3KK7 A;  1J6Z A;  3AY9 A;  4C1N I;  2P9K A;  4YOR A;  1KAZ A;  5C10 A;  4G9Z A;  1NGI A;  3I56 N;  1VQ9 N;  1NGJ A;  5JVH L;  2VGM A;  1IG8 A;  1V4S A;  3SJH A;  3DXK A;  5I9E B;  4GY2 B;  5E26 A;  2E20 A;  5BPM A;  4FL9 A;  1MWM A;  3CHW A;  4K41 A;  1NGA A;  5AQK A;  3U9D A;  1RDW X;  4I6M B;  4YOY A;  3UE5 A;  1ESV A;  5HOO A;  4M63 C;  3U8X A;  3SAG A;  3VF4 A;  3C6H A;  1QZ6 A;  4BRD A;  4H0V B;  3R6M A;  3L4I A;  2YJF A;  1T6D A;  3IUC A;  5AR0 A;  4GNI A;  4IWV A;  2F9T A;  5AQH A;  4IO8 A;  2A3Z A;  1HJO A;  3RVC A;  2Q2R A;  5M1K A;  1NBW A;  4C23 A;  3P4I A;  2CH5 A;  1S3X A;  4L3Q A;  3UKR A;  2E1Z A;  3A5L C;  4YDU A;  3L0Q A;  5KQD A;  2P9I B;  5KPZ A;  2ASO A;  4IZ9 A;  4M7X A;  2W40 A;  4ISG A;  5AQF A;  3VOV A;  5M1N A;  3WQT A;  1KD1 O;  4GV9 A;  3MDQ A;  4JK9 A;  2V7Z A;  2IVN A;  4PHT X;  5GAD P;  4IFE A;  4MO4 A;  4MLE A;  1BWF O;  4CZL A;  3P38 A;  3WXK A;  3EN9 A;  4A2A A;  4WFN L;  3CCL N;  4YOW A;  3Q7B A;  4GV6 A;  3G4S N;  5LJW A;  1DKG D;  1NWK A;  3H46 O;  3ENO A;  3C65 A;  3GG4 A;  3WT0 A;  5LY3 A;  4Z94 A;  2E8A A;  3CPE A;  5AQL A;  5AQZ A;  1K8A O;  2YHY A;  3CCE N;  2VGN A;  3DJC A;  3M3Z A;  3CJA A;  3N4P A;  5FPD A;  5BPN A;  2A5X A;  1JJ2 M;  1XQS C;  1NGH A;  3CJB A;  3WQU A;  1DEJ A;  1V4T A;  4JNE A;  1NGC A;  2BUP A;  4CD1 A;  3FZK A;  5EOY A;  4YOV A;  3G6E N;  1MDU B;  1KAX A;  1LCU A;  1NGG A;  4CZE A;  1VQ7 N;  4E1J A;  3DXM B;  4WCE L;  1YXQ A;  4OO1 J;  1T6C A;  3R8E A;  2CGJ A;  4B1X B;  4CBX A;  2FXU A;  2ZGZ A;  3CER A;  3O80 A;  3ATU A;  5B8H A;  3HOT A;  3O8M A;  3CCM N;  4B9Q A;  4WQ4 C;  5AQT A;  3FZM A;  3IKM A;  2E2Q A;  4EAH D;  2QWN A;  3WXJ A;  1K8K A;  4JK8 A;  2FSJ A;  3AAP A;  3MCP A;  3SLC A;  3VTH A;  3C7N A;  3IDH A;  3ULE B;  3ZET B;  1YJN N;  3O1W A;  2V52 B;  4EHT A;  4IOC L;  2ZGY A;  3N4Q A;  5GAH P;  3O9U A;  4WYB A;  1XC3 A;  3D6R A;  3CCJ N;  3VEX A;  5C2D A;  2CGL A;  3O9T A;  4UY8 O;  3E9L A;  2RE2 A;  4FWK A;  4BRG A;  3CMA N;  3CF5 L;  2ZWH A;  1MA9 B;  3CJ9 A;  1QQM A;  2Q0U A;  4M7Y A;  4O8U A;  2JWK A;  3SMS A;  3J7Z O;  1TUU A;  3ID8 A;  5AQM A;  4BR2 A;  5MLC Q;  4J8F A;  3M1F A;  3WXI A;  3RSE B;  1SAZ A;  3VET A;  4BRI A;  4JHD B;  5CE3 A;  1JCF A;  2A42 A;  1ATS A;  4JKD A;  4BC3 A;  5GIN A;  1Q82 O;  2WBN A;  1ATR A;  4JD2 A;  1S22 A;  1ZBS A;  3HZ6 A;  5AQN A;  5C15 A;  1GLE G;  3VGM A;  3BP8 A;  3P31 A;  4BRM A;  4KH5 A;  1RGI A;  4DQ8 A;  2V7Y A;  3AAQ A;  3O6W A;  1VQ4 N;  5AQO A;  3CCQ N;  5AQY A;  1M1K O;  2CH6 A;  2GEL A;  1RFQ A;  3Q7C A;  1NLV A;  2FSK A;  5AQR A;  4BR9 A;  2P9K B;  5AZJ B;  3EL2 A;  4QS9 A;  3CC4 N;  3CJ1 A;  4FPB A;  3ZX0 A;  1HKB A;  3MN6 A;  4JKF A;  1SQK A;  4CBW A;  4BC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...