4IOAS

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 25
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4ioaS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4ioaS02
4P2BA 3PIOS 5HL7S 3PIPS 3CF5S 1QTQA 1QRUA 4WF9S 1O0CA 1QRSA 3J7ZV 4H3SA 5GAHW 4WFAS 5JVHS 1EUQA 5GAGW 4UY88 4U67S 4JXXA 4IOCS 1O0BA 3AIIA 2ZJQS 2ZJPS 2RE8A 1GTSA 1EUYA 1ZJWA 4WFNS 5IZNA 1D6KA 1QRTA 1FEUA 2RD2A 3DLLS 5DM6S 1GTRA 5GADW 1NYLA 5DM7S 5JVGS 4WFBS 2HZ7A 1EXDA 4JYZA 5GAEW 4IOAS 4JXZA 4IO9S 1B75A 2ZJRS 5BNZA 1DFUP 4WCES
chains in the Genus database with same CATH superfamily
4LK1A 3PIPS 3GTOC 4A3MC 3H3VD 3I4NC 1TWCC 4YFNA 2PNWA 2A68A 3GTKC 4OIQA 3GTGC 4LLGA 1QRSA 4JK1A 5GAHW 4A3EC 4A3GC 5C4XC 4X6AC 3S2HC 4UY88 2L5NA 3S16C 3I4MC 4IOCS 1TWAC 2JA6C 2JA5C 4WFNS 2KQ1A 3HOVC 1R9TC 4XSXA 2O5JA 3W2WB 2AE0X 1NYLA 3W2VB 5IP9C 3GTJC 2HZ7A 4A93C 4JYZA 2CW0A 3DXJA 1WCMC 1IW7A 4LJZA 2GAEA 2NVXC 4YG2A 5IYBC 4BY7C 3S1RC 4OINA 4C3HC 3PIOS 4YFKA 5TMFA 3M4OC 4A3FC 4G7ZA 4OIPA 3RZDC 2L3UA 4XLNA 3CZBA 1YNNA 4A3IC 2NVQC 3KW2A 2BE5A 1Y1VC 4XLPA 2WB1D 2JA8C 5GAGW 4NOIA 1VHYA 1YNJA 5D4DA 4L69A 4C2MC 1O0BA 1HQMA 2ZJQS 3LYWA 4Q4ZA 3RZOC 4Y7NC 4KN7A 3PO3C 3S15C 1EUYA 1FEUA 1D6KA 4LK0A 2A6HA 5DM6S 2PICA 4YFXA 4H4KA 3X1LB 4KN4A 2E2IC 5JVGS 4MEYA 2B63C 1EXDA 5GAEW 4JXZA 4A3KC 4IO9S 4V194 2NVTC 2NVYC 4XSZA 3M3YC 2ZJPS 3GTLC 1DFUP 2NWAA 4MQ9A 4P2BA 1TWGC 5HL7S 3S17C 2VUMC 4AYBD 3S14C 4Q5SA 2EGWA 5C44C 1I3QC 2R7ZC 1QTQA 4BXXC 4C3JC 5C3EC 4J3CA 3GTMC 4H3SA 2PI8A 5C4JC 2Y0SD 3WODA 4OIOA 1VHKA 3FKIC 2G5DA 1SMYA 4JXXA 3CQZC 3S2DC 4A3CC 5IYDC 3AIIA 2E2HC 2R92C 2PA8D 1GTSA 1ZJWA 5IZNA 1ZYRA 2KXYA 5IYCC 2RD2A 1TWHC 2Z0YA 1GTRA 2WAQD 3HOZC 4ZH4A 2EGVA 5GADW 1K83C 2O5IA 5DM7S 4OIRA 4G7OA 4A3BC 3GTQC 2R93C 3HOUC 4G7HA 2CX8A 5HQHA 2G6GA 4BBRC 2KPUA 4QIWD 2ZJRS 1Y1WC 4GZYA 3HKZD 1NXZA 3HOXC 1SFOC 2E2JC 3HOYC 3S1MC 5FLMC 1UDXA 4E8BA 4QJVA 3CF5S 4A3JC 2YU9C 1QRUA 4WF9S 4BY1C 1O0CA 3J7ZV 1I50C 2PPBA 4WFAS 5JVHS 4Y52C 5IP7C 1EUQA 4MEXA 2JA7C 3HOWC 3EQLA 3PO2C 3S1QC 2PJJA 4U67S 1Z85A 2A6EA 2RE8A 1QRTA 3S1NC 3H0GC 1V6ZA 4C3IC 4KMUA 1TWFC 4A3DC 3DLLS 4BBSC 1I6VA 1I6HC 1BDFA 4WFBS 4IOAS 4A3LC 3K7AC 2PMZD 3GTPC 5TMCA 2A69A 1B75A 5BNZA 4WCES
chains in the Genus database with same CATH topology
4P2BA 3PIOS 5HL7S 3PIPS 1UDXA 3CF5S 1QTQA 1QRUA 4WF9S 1O0CA 1QRSA 3J7ZV 4H3SA 5GAHW 4WFAS 5JVHS 1EUQA 5GAGW 4UY88 4U67S 4JXXA 4IOCS 1O0BA 3AIIA 2ZJQS 2ZJPS 2RE8A 1GTSA 1EUYA 1ZJWA 4WFNS 5IZNA 1D6KA 1QRTA 1FEUA 2RD2A 3DLLS 5DM6S 1GTRA 3W2WB 5GADW 4H4KA 3X1LB 3W2VB 1NYLA 5DM7S 5JVGS 4WFBS 2HZ7A 1EXDA 4JYZA 5GAEW 4IOAS 4JXZA 4IO9S 4V194 1B75A 2ZJRS 5BNZA 1DFUP 4WCES
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P2B A;  3PIO S;  5HL7 S;  3PIP S;  3CF5 S;  1QTQ A;  1QRU A;  4WF9 S;  1O0C A;  1QRS A;  3J7Z V;  4H3S A;  5GAH W;  4WFA S;  5JVH S;  1EUQ A;  5GAG W;  4UY8 8;  4U67 S;  4JXX A;  4IOC S;  1O0B A;  3AII A;  2ZJQ S;  2ZJP S;  2RE8 A;  1GTS A;  1EUY A;  1ZJW A;  4WFN S;  5IZN A;  1D6K A;  1QRT A;  1FEU A;  2RD2 A;  3DLL S;  5DM6 S;  1GTR A;  5GAD W;  1NYL A;  5DM7 S;  5JVG S;  4WFB S;  2HZ7 A;  1EXD A;  4JYZ A;  5GAE W;  4IOA S;  4JXZ A;  4IO9 S;  1B75 A;  2ZJR S;  5BNZ A;  1DFU P;  4WCE S; 
#chains in the Genus database with same CATH topology
 4LK1 A;  3PIP S;  3GTO C;  4A3M C;  3H3V D;  3I4N C;  1TWC C;  4YFN A;  2PNW A;  2A68 A;  3GTK C;  4OIQ A;  3GTG C;  4LLG A;  1QRS A;  4JK1 A;  5GAH W;  4A3E C;  4A3G C;  5C4X C;  4X6A C;  3S2H C;  4UY8 8;  2L5N A;  3S16 C;  3I4M C;  4IOC S;  1TWA C;  2JA6 C;  2JA5 C;  4WFN S;  2KQ1 A;  3HOV C;  1R9T C;  4XSX A;  2O5J A;  3W2W B;  2AE0 X;  1NYL A;  3W2V B;  5IP9 C;  3GTJ C;  2HZ7 A;  4A93 C;  4JYZ A;  2CW0 A;  3DXJ A;  1WCM C;  1IW7 A;  4LJZ A;  2GAE A;  2NVX C;  4YG2 A;  5IYB C;  4BY7 C;  3S1R C;  4OIN A;  4C3H C;  3PIO S;  4YFK A;  5TMF A;  3M4O C;  4A3F C;  4G7Z A;  4OIP A;  3RZD C;  2L3U A;  4XLN A;  3CZB A;  1YNN A;  4A3I C;  2NVQ C;  3KW2 A;  2BE5 A;  1Y1V C;  4XLP A;  2WB1 D;  2JA8 C;  5GAG W;  4NOI A;  1VHY A;  1YNJ A;  5D4D A;  4L69 A;  4C2M C;  1O0B A;  1HQM A;  2ZJQ S;  3LYW A;  4Q4Z A;  3RZO C;  4Y7N C;  4KN7 A;  3PO3 C;  3S15 C;  1EUY A;  1FEU A;  1D6K A;  4LK0 A;  2A6H A;  5DM6 S;  2PIC A;  4YFX A;  4H4K A;  3X1L B;  4KN4 A;  2E2I C;  5JVG S;  4MEY A;  2B63 C;  1EXD A;  5GAE W;  4JXZ A;  4A3K C;  4IO9 S;  4V19 4;  2NVT C;  2NVY C;  4XSZ A;  3M3Y C;  2ZJP S;  3GTL C;  1DFU P;  2NWA A;  4MQ9 A;  4P2B A;  1TWG C;  5HL7 S;  3S17 C;  2VUM C;  4AYB D;  3S14 C;  4Q5S A;  2EGW A;  5C44 C;  1I3Q C;  2R7Z C;  1QTQ A;  4BXX C;  4C3J C;  5C3E C;  4J3C A;  3GTM C;  4H3S A;  2PI8 A;  5C4J C;  2Y0S D;  3WOD A;  4OIO A;  1VHK A;  3FKI C;  2G5D A;  1SMY A;  4JXX A;  3CQZ C;  3S2D C;  4A3C C;  5IYD C;  3AII A;  2E2H C;  2R92 C;  2PA8 D;  1GTS A;  1ZJW A;  5IZN A;  1ZYR A;  2KXY A;  5IYC C;  2RD2 A;  1TWH C;  2Z0Y A;  1GTR A;  2WAQ D;  3HOZ C;  4ZH4 A;  2EGV A;  5GAD W;  1K83 C;  2O5I A;  5DM7 S;  4OIR A;  4G7O A;  4A3B C;  3GTQ C;  2R93 C;  3HOU C;  4G7H A;  2CX8 A;  5HQH A;  2G6G A;  4BBR C;  2KPU A;  4QIW D;  2ZJR S;  1Y1W C;  4GZY A;  3HKZ D;  1NXZ A;  3HOX C;  1SFO C;  2E2J C;  3HOY C;  3S1M C;  5FLM C;  1UDX A;  4E8B A;  4QJV A;  3CF5 S;  4A3J C;  2YU9 C;  1QRU A;  4WF9 S;  4BY1 C;  1O0C A;  3J7Z V;  1I50 C;  2PPB A;  4WFA S;  5JVH S;  4Y52 C;  5IP7 C;  1EUQ A;  4MEX A;  2JA7 C;  3HOW C;  3EQL A;  3PO2 C;  3S1Q C;  2PJJ A;  4U67 S;  1Z85 A;  2A6E A;  2RE8 A;  1QRT A;  3S1N C;  3H0G C;  1V6Z A;  4C3I C;  4KMU A;  1TWF C;  4A3D C;  3DLL S;  4BBS C;  1I6V A;  1I6H C;  1BDF A;  4WFB S;  4IOA S;  4A3L C;  3K7A C;  2PMZ D;  3GTP C;  5TMC A;  2A69 A;  1B75 A;  5BNZ A;  4WCE S; 
#chains in the Genus database with same CATH homology
 4P2B A;  3PIO S;  5HL7 S;  3PIP S;  1UDX A;  3CF5 S;  1QTQ A;  1QRU A;  4WF9 S;  1O0C A;  1QRS A;  3J7Z V;  4H3S A;  5GAH W;  4WFA S;  5JVH S;  1EUQ A;  5GAG W;  4UY8 8;  4U67 S;  4JXX A;  4IOC S;  1O0B A;  3AII A;  2ZJQ S;  2ZJP S;  2RE8 A;  1GTS A;  1EUY A;  1ZJW A;  4WFN S;  5IZN A;  1D6K A;  1QRT A;  1FEU A;  2RD2 A;  3DLL S;  5DM6 S;  1GTR A;  3W2W B;  5GAD W;  4H4K A;  3X1L B;  3W2V B;  1NYL A;  5DM7 S;  5JVG S;  4WFB S;  2HZ7 A;  1EXD A;  4JYZ A;  5GAE W;  4IOA S;  4JXZ A;  4IO9 S;  4V19 4;  1B75 A;  2ZJR S;  5BNZ A;  1DFU P;  4WCE S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...