4IOAS

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 25
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4ioaS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4ioaS02
1QRTA 5GAHW 3CF5S 4WCES 2RE8A 1O0CA 3AIIA 1QRSA 3DLLS 1O0BA 4JXXA 5DM6S 2ZJPS 4UY88 3PIOS 1FEUA 5GAEW 2ZJQS 5HL7S 2ZJRS 4H3SA 1EUQA 1GTRA 3J7ZV 2RD2A 1DFUP 4WFBS 4IO9S 5GADW 2HZ7A 4JYZA 4IOAS 3PIPS 1GTSA 5DM7S 1QTQA 5JVGS 4WF9S 4JXZA 5GAGW 5JVHS 1NYLA 4WFNS 4IOCS 4U67S 1ZJWA 1B75A 1EXDA 5BNZA 1D6KA 1QRUA 5IZNA 4P2BA 4WFAS 1EUYA
chains in the Genus database with same CATH superfamily
4H4KA 1TWCC 4E8BA 2L3UA 2VUMC 4A3BC 3HOXC 2A6HA 2RE8A 3CQZC 1IW7A 4XSZA 4YFKA 1QRSA 1BDFA 3DLLS 1TWHC 4C3JC 4A3EC 4A3FC 4GZYA 4BY1C 2KXYA 1TWFC 2O5IA 3GTKC 5HQHA 3W2VB 1SFOC 4YG2A 1DFUP 2JA6C 1Z85A 2E2IC 4L69A 4QJVA 2JA7C 2HZ7A 3S2HC 3I4NC 4JYZA 2R93C 2B63C 1R9TC 2R7ZC 3S1MC 5DM7S 4WF9S 5IYCC 4BY7C 3S15C 1SMYA 2PMZD 5C3EC 1K83C 1ZJWA 4LLGA 4BBSC 1B75A 4QIWD 1QRUA 4XLPA 3H3VD 4Y7NC 1EUYA 3X1LB 2GAEA 4C2MC 2O5JA 2KPUA 1QRTA 3KW2A 3HOZC 4G7OA 5C4XC 2A6EA 3CF5S 1Y1VC 1VHYA 2EGWA 1NXZA 1O0CA 1WCMC 4LK1A 4NOIA 5FLMC 5DM6S 2JA8C 2Y0SD 5IP9C 3GTMC 1FEUA 1UDXA 2ZJQS 4H3SA 1EUQA 3LYWA 4OIRA 3HOUC 1I6HC 3J7ZV 3S17C 3GTQC 3GTGC 4IO9S 1YNNA 3EQLA 2EGVA 4AYBD 1YNJA 2E2HC 2G6GA 3H0GC 4JXZA 2PICA 5IYBC 2WB1D 2YU9C 3PO3C 4BXXC 4X6AC 3S1RC 4U67S 3M4OC 4A3CC 4OIPA 3S1QC 2NVQC 4OIQA 4P2BA 2G5DA 2WAQD 4WFAS 5D4DA 3S1NC 1I6VA 2PI8A 5GAHW 3M3YC 1I50C 4WCES 2E2JC 3AIIA 3HKZD 5C4JC 3GTPC 3PO2C 1O0BA 1V6ZA 2PJJA 2ZJPS 4JXXA 4C3IC 3GTOC 4UY88 3HOYC 4A3LC 3PIOS 4KMUA 5GAEW 3GTJC 5HL7S 2ZJRS 4A3DC 3FKIC 4YFNA 4KN7A 3K7AC 3HOWC 4OIOA 2R92C 4WFBS 3WODA 4IOAS 3PIPS 2CX8A 2NVXC 2NWAA 4LJZA 3RZOC 5GAGW 4A3GC 5JVHS 1NYLA 2NVYC 4WFNS 4OINA 1Y1WC 4KN4A 3GTLC 3I4MC 3S14C 4A3KC 3S16C 4V194 4ZH4A 4A3JC 5IZNA 3DXJA 2JA5C 2NVTC 4G7ZA 1TWGC 5C44C 2CW0A 5IYDC 4A3IC 3RZDC 4XSXA 1I3QC 4BBRC 2A69A 2Z0YA 1HQMA 4G7HA 5TMCA 4YFXA 4MEXA 2PPBA 3HOVC 3CZBA 4XLNA 4Q5SA 2BE5A 1GTRA 4JK1A 4C3HC 4A3MC 1ZYRA 4Q4ZA 2RD2A 4MEYA 2KQ1A 4Y52C 4MQ9A 4A93C 5GADW 5TMFA 1GTSA 3W2WB 1QTQA 4J3CA 5JVGS 1VHKA 1TWAC 4IOCS 2A68A 3S2DC 1EXDA 5BNZA 2PA8D 5IP7C 2PNWA 1D6KA 2AE0X 2L5NA 4LK0A
chains in the Genus database with same CATH topology
4H4KA 1QRTA 5GAHW 3CF5S 4WCES 2RE8A 1O0CA 3AIIA 1QRSA 3DLLS 1O0BA 4JXXA 5DM6S 2ZJPS 4UY88 3PIOS 1FEUA 1UDXA 5GAEW 2ZJQS 5HL7S 2ZJRS 4H3SA 1EUQA 3W2VB 1GTRA 3J7ZV 2RD2A 1DFUP 4WFBS 4IO9S 5GADW 2HZ7A 4JYZA 4IOAS 3PIPS 1GTSA 3W2WB 5DM7S 1QTQA 5JVGS 4WF9S 4JXZA 5GAGW 5JVHS 1NYLA 4WFNS 4IOCS 4U67S 1ZJWA 1B75A 1EXDA 5BNZA 1D6KA 4V194 1QRUA 5IZNA 4P2BA 4WFAS 1EUYA 3X1LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QRT A;  5GAH W;  3CF5 S;  4WCE S;  2RE8 A;  1O0C A;  3AII A;  1QRS A;  3DLL S;  1O0B A;  4JXX A;  5DM6 S;  2ZJP S;  4UY8 8;  3PIO S;  1FEU A;  5GAE W;  2ZJQ S;  5HL7 S;  2ZJR S;  4H3S A;  1EUQ A;  1GTR A;  3J7Z V;  2RD2 A;  1DFU P;  4WFB S;  4IO9 S;  5GAD W;  2HZ7 A;  4JYZ A;  4IOA S;  3PIP S;  1GTS A;  5DM7 S;  1QTQ A;  5JVG S;  4WF9 S;  4JXZ A;  5GAG W;  5JVH S;  1NYL A;  4WFN S;  4IOC S;  4U67 S;  1ZJW A;  1B75 A;  1EXD A;  5BNZ A;  1D6K A;  1QRU A;  5IZN A;  4P2B A;  4WFA S;  1EUY A; 
#chains in the Genus database with same CATH topology
 4H4K A;  1TWC C;  4E8B A;  2L3U A;  2VUM C;  4A3B C;  3HOX C;  2A6H A;  2RE8 A;  3CQZ C;  1IW7 A;  4XSZ A;  4YFK A;  1QRS A;  1BDF A;  3DLL S;  1TWH C;  4C3J C;  4A3E C;  4A3F C;  4GZY A;  4BY1 C;  2KXY A;  1TWF C;  2O5I A;  3GTK C;  5HQH A;  3W2V B;  1SFO C;  4YG2 A;  1DFU P;  2JA6 C;  1Z85 A;  2E2I C;  4L69 A;  4QJV A;  2JA7 C;  2HZ7 A;  3S2H C;  3I4N C;  4JYZ A;  2R93 C;  2B63 C;  1R9T C;  2R7Z C;  3S1M C;  5DM7 S;  4WF9 S;  5IYC C;  4BY7 C;  3S15 C;  1SMY A;  2PMZ D;  5C3E C;  1K83 C;  1ZJW A;  4LLG A;  4BBS C;  1B75 A;  4QIW D;  1QRU A;  4XLP A;  3H3V D;  4Y7N C;  1EUY A;  3X1L B;  2GAE A;  4C2M C;  2O5J A;  2KPU A;  1QRT A;  3KW2 A;  3HOZ C;  4G7O A;  5C4X C;  2A6E A;  3CF5 S;  1Y1V C;  1VHY A;  2EGW A;  1NXZ A;  1O0C A;  1WCM C;  4LK1 A;  4NOI A;  5FLM C;  5DM6 S;  2JA8 C;  2Y0S D;  5IP9 C;  3GTM C;  1FEU A;  1UDX A;  2ZJQ S;  4H3S A;  1EUQ A;  3LYW A;  4OIR A;  3HOU C;  1I6H C;  3J7Z V;  3S17 C;  3GTQ C;  3GTG C;  4IO9 S;  1YNN A;  3EQL A;  2EGV A;  4AYB D;  1YNJ A;  2E2H C;  2G6G A;  3H0G C;  4JXZ A;  2PIC A;  5IYB C;  2WB1 D;  2YU9 C;  3PO3 C;  4BXX C;  4X6A C;  3S1R C;  4U67 S;  3M4O C;  4A3C C;  4OIP A;  3S1Q C;  2NVQ C;  4OIQ A;  4P2B A;  2G5D A;  2WAQ D;  4WFA S;  5D4D A;  3S1N C;  1I6V A;  2PI8 A;  5GAH W;  3M3Y C;  1I50 C;  4WCE S;  2E2J C;  3AII A;  3HKZ D;  5C4J C;  3GTP C;  3PO2 C;  1O0B A;  1V6Z A;  2PJJ A;  2ZJP S;  4JXX A;  4C3I C;  3GTO C;  4UY8 8;  3HOY C;  4A3L C;  3PIO S;  4KMU A;  5GAE W;  3GTJ C;  5HL7 S;  2ZJR S;  4A3D C;  3FKI C;  4YFN A;  4KN7 A;  3K7A C;  3HOW C;  4OIO A;  2R92 C;  4WFB S;  3WOD A;  4IOA S;  3PIP S;  2CX8 A;  2NVX C;  2NWA A;  4LJZ A;  3RZO C;  5GAG W;  4A3G C;  5JVH S;  1NYL A;  2NVY C;  4WFN S;  4OIN A;  1Y1W C;  4KN4 A;  3GTL C;  3I4M C;  3S14 C;  4A3K C;  3S16 C;  4V19 4;  4ZH4 A;  4A3J C;  5IZN A;  3DXJ A;  2JA5 C;  2NVT C;  4G7Z A;  1TWG C;  5C44 C;  2CW0 A;  5IYD C;  4A3I C;  3RZD C;  4XSX A;  1I3Q C;  4BBR C;  2A69 A;  2Z0Y A;  1HQM A;  4G7H A;  5TMC A;  4YFX A;  4MEX A;  2PPB A;  3HOV C;  3CZB A;  4XLN A;  4Q5S A;  2BE5 A;  1GTR A;  4JK1 A;  4C3H C;  4A3M C;  1ZYR A;  4Q4Z A;  2RD2 A;  4MEY A;  2KQ1 A;  4Y52 C;  4MQ9 A;  4A93 C;  5GAD W;  5TMF A;  1GTS A;  3W2W B;  1QTQ A;  4J3C A;  5JVG S;  1VHK A;  1TWA C;  4IOC S;  2A68 A;  3S2D C;  1EXD A;  5BNZ A;  2PA8 D;  5IP7 C;  2PNW A;  1D6K A;  2AE0 X;  2L5N A;  4LK0 A; 
#chains in the Genus database with same CATH homology
 4H4K A;  1QRT A;  5GAH W;  3CF5 S;  4WCE S;  2RE8 A;  1O0C A;  3AII A;  1QRS A;  3DLL S;  1O0B A;  4JXX A;  5DM6 S;  2ZJP S;  4UY8 8;  3PIO S;  1FEU A;  1UDX A;  5GAE W;  2ZJQ S;  5HL7 S;  2ZJR S;  4H3S A;  1EUQ A;  3W2V B;  1GTR A;  3J7Z V;  2RD2 A;  1DFU P;  4WFB S;  4IO9 S;  5GAD W;  2HZ7 A;  4JYZ A;  4IOA S;  3PIP S;  1GTS A;  3W2W B;  5DM7 S;  1QTQ A;  5JVG S;  4WF9 S;  4JXZ A;  5GAG W;  5JVH S;  1NYL A;  4WFN S;  4IOC S;  4U67 S;  1ZJW A;  1B75 A;  1EXD A;  5BNZ A;  1D6K A;  4V19 4;  1QRU A;  5IZN A;  4P2B A;  4WFA S;  1EUY A;  3X1L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...