4IOBA

Crystal structure of the ggdef domain of pa1120 (yfin or tpbb) from pseudomonas aeruginosa at 2.7 ang.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
161
structure length
161
Chain Sequence
LTSLPNRAFFEGRLSRALRDANEHREQLAVLFIDSDRFKEINDRLGHAAGDTVLVNIAMRIRGQLRESDLVARLGGDEFAVLLAPLASGADALRIADNIIASMQAPIRLSDGSTVSTSLTIGIALYPEHADTPAALLHDADMAMYIAKRQARGSRRLAELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Investigating the Allosteric Regulation of YfiN from Pseudomonas aeruginosa: Clues from the Structure of the Catalytic Domain.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
molecule keywords Diguanylate cyclase TpbB
total genus 45
structure length 161
sequence length 161
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2013-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iobA00
3T1AA 1ZETA 5FDLA 1D1UA 1RT1B 3IRXB 3MTKA 2B43A 1S97A 4J9MA 3CJ3A 1J5OB 4DL7A 1JIHA 1JLAB 4NLPA 2DPJA 4ECRA 3EPIA 3MR2A 1DTTA 4QPXA 3MR6A 1I6JA 2IM0A 3HVWA 3RB6A 3N6NA 4G1QA 4O3OA 4K4VA 4G3IA 3NAHA 4MIAA 1JLBA 2AWZA 4EBEA 5KFZA 2C2EA 3GYNA 4NLYA 1SH2A 3FDSA 2QV6A 4QW8A 4ZP7A 5F8NA 4MK9A 3Q8PB 1NHVA 3OLAA 2BANA 1D0EA 2BRLA 3N6MA 1JLFA 1TVRB 3PR5B 4K4SA 3MEGB 5KFOA 4DL5A 1C1CB 2J6UA 3FQKA 4NYZA 3NMAA 2RKIA 3CJ0A 5KFAA 2VG6A 4TY8B 3KLGB 5KFFA 5C42B 4I2PA 3KLFB 5J1EB 2ALZA 1HNVB 1J5OA 1RYRA 2WONA 1QUVA 2ILZA 3DRSB 2R8GA 4KB7A 5FDLB 5L1LA 3RAXA 3GV7B 2UVRA 2JLEA 1SUQA 3LAMA 3MECB 1RT4A 1N6QA 3PJXA 3QIDA 1S9EA 5DG7A 3BR9A 3T19A 4I7FB 3H2LA 2IBKA 2BRKA 1JXLA 4NLXA 1NHUA 4EO6A 1DLOB 4LQ9A 1TKTA 3M9OB 2D41A 3QLHB 4ECZA 2C2DA 3ITHA 3SFGA 2BE2A 3DLGA 3DOKA 2B6AB 4Q44A 4ED8A 2XI2A 3GV8B 4HYKA 1QE1A 2IM3A 4KV8B 4DG1B 1W25A 3D28A 5KG7A 4RU9A 2BQRA 2R8JA 5J2NB 1S48A 5DG9A 3NKYA 1HYSB 4H4OB 4EO8A 4YMEA 3OL8A 4H4OA 1RTIB 5C24A 5F8LA 4Q8FA 2ATLA 1TL3A 1JLQA 3CJ5A 4URGA 2DPIA 4KKOA 4NCGB 5KFEA 4B3OB 1C1BB 2VG7A 2AX1A 2WOMB 2OPPB 1RTDB 3I0SA 2VG5B 4IDKB 5JXSA 3M9NB 4DL3A 1C0UA 4NLTA 4TYBA 3I0SB 4PUOB 1S9GB 1UWBB 1CSJA 3QGIA 5KFIA 4EBCA 1FK9B 4B3OA 1LWCA 5DGAA 3C6UB 2R8IA 1RYSA 2GC8A 1RT4B 3PW2A 1S6QB 4ZPDA 5KFDA 3DRRB 3PR4A 4ZPBA 1REVB 3T5KA 1T05B 4QWAA 1WNEA 4WZMA 1DTQB 3V81A 5F8JA 2HNYB 3E01A 4DL2A 2IM1A 5CYQB 3LP2B 4O44B 2BE2B 3DOKB 3FQLA 5C25B 1C0TB 4K4XA 3GIMA 1RT7B 4ZVEA 4U7CA 1DLOA 4QW9A 4H54A 3DRPA 3I0RA 1S1XB 3UPFA 4GC7A 4MIBA 4RW4B 3CWJA 1RT5B 5KFCA 2HNDA 3OHBA 4ECXA 3FSIA 3V4IB 3OHAA 3V6DA 4ZMMA 3HVTA 3MECA 4WXOA 3V81B 4F4XA 4EEYA 5I42A 2ZD1A 3KLEA 1LWFB 2O5DA 3UDLA 5EWFA 2W8LA 5I3UB 3G6YA 1C0TA 4DL4A 2W9AA 2YKNB 3V6DB 3IGVA 3PW4A 2ASDA 2FLLA 2VA2A 4Y34A 3M8QA 1HQUA 3CDEA 1JLFB 3T5HA 3KJVB 2IC3B 1N5YA 4F4YA 4IG0A 4MK8A 3ICLA 5C25A 5J2NA 1XR7A 3CDWA 3E01B 2YNGB 4JV1A 1KLMB 2D3ZA 1JLQB 1C2PA 3ITHB 3MFIA 3T5LA 1JLGA 5KG6A 4NZ0A 2OPPA 2IC3A 4URSA 4RNNA 3DLEB 1FKPB 3CJ4A 3DLKB 4WFXA 3BQ0A 4ECTA 2UUTA 3GIKA 4DL6A 3RB0A 2YKNA 4O3PA 4JV2A 2B6AA 3DLGB 1S49A 1TKZB 4IG3A 1C0UB 4ZVFA 4PUOA 4LSNA 2WONB 5KFMA 1JX4A 1YVFA 5I42B 2WOMA 5KFVA 3GV5B 3V4IA 2E9RX 4I7FA 3IS9A 4KO0A 3C6TA 4ID5B 4ZP9A 3FRZA 3KLIB 4RUAA 1RTIA 5C24B 4OL8A 1SUQB 3H5XA 1TKTB 3GIJA 2IM2A 4QWCA 2OPRB 1BQNB 4U6PA 2ZE2A 4ICLA 3H5YA 3H4BA 2C28A 2AGQA 3MEEB 2E9TA 1S0OA 4GC6A 1SH0A 2HNYA 3ISND 3KLHB 5L1JA 3QLHA 1IKYB 1RT6A 4F50A 3M8PB 5J1EA 4J9KA 3KMSA 2XWYA 1HQEB 1RT5A 2XC9A 3MEGA 2BQUA 5KFYA 1S1VB 1SH3A 3DOLA 4J9OA 1N6QB 2E9ZA 1TP7A 3I5AA 4ZPCA 3RAQA 4ED0A 5EUHA 3H4DA 3MEDA 5D3GB 1RT2A 2JC1A 3TAMB 3QYYA 5CYQA 4FBTA 5J2MA 5F9LA 3NBPA 4ECQA 1JKHB 3H59A 4R0EA 3Q8RB 4X2BA 3PW7A 2RDJA 1JLCA 3LAKA 2I1RA 3KLHA 5J2PB 4NRTA 5HP1A 3GIIA 2OH2A 4H4MA 3MEEA 1JLAA 1RT2B 3TAMA 3OLBA 4TQSA 3KHHA 3OL9A 4F4ZA 3KK2A 1RT1A 3IRXA 3BGRB 4IQXA 4RZRA 4RW8A 2JC0A 3DOLB 3QZ8A 4K4WA 3V6HA 4JV0A 2D3UA 5HLFA 4ZVGA 4RW9B 1LW2A 4R5PB 3DMJA 3HVAA 4RW9A 2HNZB 1RA7A 1TKXA 2YNIB 4TY9A 4WXWA 5DGBA 2IMWP 1JLEA 2AGOA 4NLVA 1TKZA 1RTHB 3BGRA 3DRSA 3DYAA 3KK1A 5EWGA 4QWDA 1VRTA 1K1QA 4KHMA 4NLRA 4ZP6A 1IKVA 5HP1B 4TY8A 5J2PA 1RTHA 1N48A 5T14A 3RB3A 4MH8A 3KLIA 5KFHA 2IA6A 3DI6B 3NBPB 1RAJA 3QO9B 1KLMA 1IKVB 4TQRA 2R2SA 2EC0A 4PQUB 5CYMB 3G6XA 1VRTB 5HLFB 2OPSA 2I5JB 3MEDB 2BQ3A 4LSNB 5D3GA 2WB4A 4TXSA 1JLCB 4FS2A 2W7OA 5DQHA 1JLEB 1S1VA 3MFHA 5C42A 3KLFA 3GILA 1HQEA 3BSOA 4O4GB 3QIPA 2UUWA 1OS5A 1HMVB 3QGHA 4LSLA 4TN2A 1XR5A 3BJYA 2ZKUA 1XR6A 4RW7B 2GIQA 2YKMB 4RNFA 3EZUA 2UVWA 1FKOB 4WFZA 2WCXA 5F8MA 5K14A 3H5SA 3PJWA 2WHOA 3QO9A 5KFGA 3M8PA 2XGQA 5KG4A 3BREA 3CIZA 4YR3A 4O3SA 5KFPA 4YR0A 5KG3A 5EWEA 3Q8SB 2CJQA 3JSMA 1IKYA 2R2UA 3MR5A 4KFBA 2JEJA 3BSCA 3IG1B 4MFBB 2B5JA 2OPQB 3CJ2A 5DLFA 1EETA 5CYMA 4J9PA 5HROA 3SI8A 4K4YA 4K50A 4R5PA 4IFYB 1MU2B 2RDIA 4IOBA 1ZTTA 1UWBA 1RT6B 3UQSA 3BSAA 1RA6A 1T03B 1Z4UA 3MR3A 4IR9A 1TV6A 4ECYA 3KNAA 4ECWA 1LWEB 2RF2B 1GX5A 4YQWA 5KG0A 1LW0A 4KKOB 2HMIB 3DLKA 4DEZA 3TQ1A 1IKXB 1R0AB 4WYLA 4Y2CA 1T3NA 3VQSA 3DDKA 3LP1A 2JEGA 4I2QB 3LP1B 4NLOA 1JKHA 3C6TB 4ID5A 3V6JA 4IFVB 4KHRA 3PVXA 1IKXA 2HNZA 2WRMA 3HKWA 5JUMA 2W7PA 4J9SA 1R0AA 2FVPA 3LALA 1GX6A 4IRKA 4PWDB 4IH5A 1LWEA 1NNDA 4MKAA 2ASLA 1KHVA 5KG5A 4O3QA 3JYTA 2W9BA 4IKAA 1N5YB 4RNHA 1TL1A 2FJXA 2JEFA 4KE5A 3E51A 2XGPA 3GQCA 5KFWA 4O4RA 4IFVA 5J2QA 3DLEA 1EP4B 3N6LA 5KFSA 3M9MB 3I0RB 5KFTA 2FVQA 4XPCA 4IG0B 5F8IA 1TQLA 5KT7A 4TYAA 1S6PB 5KG1A 4WYWA 3OL6A 2V4RA 4ED3A 4ZHRA 1HPZB 1S1UA 5KFKA 3JSMB 2ZD1B 3M8QB 3KLEB 4I2PB 3KMQA 2W9CB 1QAJA 4MK7A 4J9RA 3NAIA 2W9CA 3BQ1A 4EYHB 4LQ3A 4NLDA 1QAIA 1RT3A 5KFLA 1BQMB 2OPRA 1LWFA 2AGPA 4Q45A 1S1WA 2HWIA 3MF5A 4WFYA 3PHEA 4XPEA 2R2TA 1ZTWA 2XCPA 4RW4A 5DQIA 4K4ZA 4FBUA 3BQ2A 4RNOA 2OPQA 3CVKA 3OSNA 2YNHA 3I5CA 5KT6A 3PZPA 1FKOA 4FS1A 1RT7A 4QWBA 3EPGA 5I3UA 2QE5A 1VRUB 4IDKA 3SFUA 1HNVA 3IN5A 3LP2A 4O44A 5L1KA 2R8KA 1KHWA 4NLGA 3QIPB 1C1BA 2VG7B 2VG6B 2HNDB 5DQGA 2HAIA 1DTQA 5F8HA 2R8HA 5J2QB 4WZQA 2XCAA 3DRPB 2WTFA 5KFBA 5KT2A 1IKWB 1S6PA 2FJWA 1S6QA 3RB4A 3I5BA 1BQMA 1EP4A 4ZVHA 2W8KA 4R8UB 1LW0B 5KFRA 2YNGA 2YNFA 3H5UA 4R8UA 4K4UA 1N56A 3DI6A 1HPZA 1S1UB 1S9GA 1T03A 1REVA 4RW7A 1T05A 4IG3B 1K1SA 3TVKA 4ED1A 1RTDA 3LP0A 1IKWA 4IFYA 1SV5A 2WK4A 1FKPA 1T94A 2GIRA 5KG2A 1SV5B 5HBMA 3IGNA 5F8GA 3DYAB 4MFBA 1TV6B 1JLGB 1S4FA 1VRUA 4HKQA 3JYTB 2V4QA 3CO9A 2I5JA 2OPSB 5C5JA 1U09A 3PW5A 2C22A 2FJVA 2HMIA 2YNHB 1TKXB 2YNIA 2XI3A 4IH6A 4MKBA 3HVTB 2ILYA 4NCGA 3KHGA 1IM4A 1HNIB 4RUCA 3KLGA 4EBDA 4QWEA 1TL3B 4KBIA 2IAJA 1TVRA 5L1IA 2B5JB 3DM2B 3IG1A 3G86A 4ZP8A 3KJVA 5KFJA 2UVVA 1MMLA 4IH7A 2JEIA 1RT3B 1HQUB 1EETB 5HROB 4ED2A 3KHLA 2RF2A 5KFUA 3KOAA 4KAIA 3G6VA 3QZ7A 3H98A 4KFBB 2YKMA 4JUZA 4G1QB 4TLRA 2BANB 4Q43A 4O3RA 2HWHA 1S0NA 3DMJB 3KK3A 2AX0A 5J2MB 5K14B 1C1CA 5KT4A 1HARA 4F4WA 3QGGA 1S0MA 2V9WA 1S1XA 4Q8EA 1FK9A 4RW8B 4M94A 1S1WB 1TL1B 4NLWA 1JLBB 1S10A 2FVCA 2W9BB 4M95A 2IJFA 3T5JA 3Q8QB 1RDRA 1HMVA 4LSLB 2AQ4A 4Q0BB 4PWDA 1RTJB 4PQUA 2RKIB 5L9XA 3OL7A 3KK3B 4Y2AA 4ZHRB 2CKWA 1N4LA 4IRCA 3DRRA 4I2QA 4J9QA 5DLGA 1DTTB 1RTJA 4ECVA 1S1TA 5KFNA 3C6UA 4EYIB 1LWCB 2ZE2B 4ICLB 4NRUA 4KV8A 4DG1A 1QE1B 5F9NA 3KK1B 3BSNA 2ASJA 2J6SA 3NL0A 4ED7A 3DM2A 3RBDA 3RBEA 4WE1A 2VG5A 3NGDA 1MU2A 2D7SA 4O4GA 3PW0A 3LANA 4NLQA 1LW2B 4O3NA 3HHKA 3KLVA 5DG8A 5KT5A 4RNMA 4K4TA 2FLPA 1S9EB 3CDUA 4Y3CA 4WE1B 4ZPAA 2FVRA 3FFIA 4NLUA 1HYSA 4J9LA 1S9FA 4ECSA 2FLNA 5KFXA 3KK2B 2UVUA 2F8EX 4IR1A 5HBMB 4J9NA 3UR0A 4KSEB 2AU0A 1BQNA 2IJNA 4RW6A 1S1TB 5KFQA 2R2RA 5KT3A 3OSPA 4YP3A 2VA3A 3FFIB 2BR0A 4XO0A 3LP0B 2J6TA 3H40A 2IAJB 5EDWA 4IRDA 2FVSA 3IS9B 4KO0B 4YR2A 4ED6A 2V0NA 3ISNC 4URQU 1HNIA 2YNFB 4RW6B 4ECUA 3KHRA 2C2RA 4Q0BA 4NLSA 3D5MA 4H4MB 3V6KA
chains in the Genus database with same CATH superfamily
3B54A 1QVFR 1ZETA 2AMCB 4NA2A 5DDRC 1S97A 2ZH7A 1J5OB 3SQGB 4DL7A 1JLAB 4NLPA 3V5RA 2DGOA 3BH7B 2QG9B 3IXQA 3EPIA 3BDPA 1IQTA 5IM0B 2VUGA 5ETVA 3HULA 4K4VA 2QRRA 1M0SA 3HDSA 4J9UE 1T9XA 4OI6A 4RBVA 2VKZG 3TO8A 4WTOB 2MQPA 1HNWJ 1Q95G 1WHWA 1AROP 3DXSX 2V68A 5F41A 5J1NA 1VQ8S 1LFWA 2YBVA 3DC2A 2ZBCA 2V69A 1UA1A 1D0EA 5EN1A 2BANA 5BR8J 4LF4F 4LF7J 1JLFA 1NCLA 5IQQA 2CRLA 3PR5B 2G0CA 4R0JA 1CBKA 1C1CB 3MOZA 2RKIA 2VG6A 3PRBA 5A0YA 2W2QP 5K20B 3FMWA 4I2PA 1WG4A 1YRTA 4FNHA 2NUHA 3RUBL 1J5OA 2B56A 1AZSA 1CS4A 1QUVA 2QGFB 3HHNB 1IVZA 1NZ8A 4C7QA 3GV7B 3GFZA 1IJEB 1N6QA 5AXMA 5DG7A 1DQ9A 3BR9A 3K5OA 3GFYA 3W64A 2IBKA 1AXQA 3KWMA 1NLKL 4BHQA 3KXDA 2ZH6A 4DHVA 4P73A 1NB7A 2AF6A 3B78A 3H2VE 4WIQA 4PPZA 3MHYA 1FTCA 1YJNS 3UE2A 3QLHB 3W9HA 3RR7A 2FZGB 4V19J 1QSSA 4ED8A 3PACA 3RAMA 5HQMA 2R7WA 4CLWA 1QE1A 4F67A 4KV8B 3CCJS 4U96A 5E33A 2Z56B 3SCIE 4ED5A 3WIVA 3D28A 2R8JA 4X64J 1FRHA 4Z37A 2NCKL 1NSQA 1N8RT 1JXEA 1S48A 2I8EA 1DFDA 2YVSA 2E5LJ 4EO8A 5F8LA 1P9QC 2KN4A 5BJRA 2G13A 1VK3A 4NASA 4URGA 2LDYA 4M5DB 4KKOA 5IS2A 1MSWD 1WELA 2HHUA 2NR0A 2DD8S 1R0CB 2BJ9A 2IVYA 3Q83A 4XIUA 1RTDB 1OQ6A 3M9NB 5JXSA 3M2RB 5D3GB 4PYAA 1WKKA 2I9SA 3QGIA 5KFIA 2QT7A 4B3OA 2DIUA 2BJ7A 2QJ3A 1LWCA 4N7TA 2LXFA 1U0HB 1YJ7A 2RE1A 3MAHA 5DGAA 3CULA 5HJYA 1XEZA 2GC8A 5LOQA 1Q8IA 5KFDA 2P6TA 1B0TA 2YQ3A 3SBMA 3PR4A 2K06A 1WF0A 1WNEA 2HWTA 4QWAA 4WZMA 1HWIA 4YUDA 1PAEX 2HNYB 4DQRA 3E01A 4RUBA 4DL2A 1SJFA 5CYQB 4JYAF 2CVIA 5G4DA 1C0TB 2LXUA 4EK2A 3CSKA 4K4XA 2DGTA 3GIMA 3DOMB 1UEVA 1LXNA 2FC8A 2HS3A 1FXDA 3GSDA 3VGUA 4LF5F 3J81Y 2VASA 1S1XB 2F9DA 2X3DA 2YKOA 3UPFA 2DR9A 1RCXB 1DHMA 4ECXA 4JI5J 1RT5B 2HNDA 3OHBA 1VQ9S 3A8EA 3I55S 3V4IB 4LR8A 4OX9F 3V6DA 2XY7A 4F4XA 5I42A 2EG1A 1TZ0A 2KXHA 3MD1A 3BV8A 1LWFB 5H1SV 3E3XA 3M8SA 2W8LA 2KVIA 5I3UB 1BGXT 4DL4A 2P9GA 1DBDA 1F9HA 2GVDB 3D6MB 2VDHA 2U1AA 1ACMB 4QIVA 2YKNB 3GLJA 4QIWD 3TQEA 4HI2A 2ASDA 2FLLA 4B9TA 1HHSA 6FD1A 2UXCJ 3M8QA 2HZAA 1HI1A 3B4MA 2QL9B 3DU5A 3I82A 2ZJPQ 4F02A 1FO1A 2FD2A 1H2VZ 1X5TA 4A46A 3TR5A 2DNNA 3KJVB 4MK8A 2V50A 2EW9A 3MEKA 3CD0A 4LFCF 3GP9A 3CDWA 3E01B 2YNGB 5D4LA 3RR8A 3TWZA 3H25A 2D3ZA 4W4MA 3T9ZA 3UN2A 4USVA 1C2PA 3ITHB 2MZ1A 1M1GA 4DU8A 1W26A 1WDDA 2IYGA 4WIIA 2C1EB 1Y5NB 3M32A 2OPPA 2IC3A 2DIVA 2VD3A 4HL9A 4OI2A 1U45A 4ZVRB 1HNZF 2BVZA 4C9DA 2ZH2A 1P1TA 4B3SF 3QT8A 4LRFA 4JI6F 4XTTA 1D3WA 1FDAA 4WFXA 4DL6A 3RB0A 4O3PA 2ZBIA 4M5JA 3QAUA 4ZVFA 5LL6d 1C0UB 1TUWA 1ZM3A 3GZ7A 4LSNA 4Y65A 3FZBA 2EBGA 3TP2A 2YXLA 3VR1A 5KFMA 1JX4A 2XSJA 2MB0B 4NCBA 1PBAA 2PMZD 2DBBA 3T1HF 4NOHA 4JI0J 3ILOA 3J81j 2GX8A 1FRXA 1RHQB 2NXUA 1Y3JA 4RUAA 4OL8A 4ZPTR 2DRBA 1SUQB 1X0PA 2HHTA 1E6VB 3AD9C 2NXCA 4QWCA 1F5AA 2A2CA 2RVJA 5L39A 1BQNB 4L3NA 4ZIVA 1RWOB 3LW5C 2W4PA 4ICLA 5H9FJ 2BJDA 5FLXU 3H5YA 3H20A 2AGQA 4JI7J 2HS4A 4GC6A 4KPYA 3VGVA 4NEYA 3Q24A 2M4MA 4OZ5A 3KUEA 1VQ6S 3QLHA 1K8AT 1IKYB 1RT6A 2J0QD 4F50A 4NXNJ 1UCNA 4I56A 5E3PA 3DHWC 4CNYA 5J1EA 2C42A 1KBRA 4FZVA 4ZVTB 2RQKA 4CLZA 3KMSA 2XWYA 1HQEB 2QLFB 1YKWA 2FHJD 2ZDPA 3A3OB 4DV1F 1EB0A 1HR0J 2CFXA 5KFYA 1SH3A 2EPIA 3DOLA 1Q8KA 5D77A 5DRKA 2MGZA 2E9ZA 1TP7A 3TRGA 4RR5A 3ET6A 3I4HX 3I5AA 4Y2MA 4ED0A 1YITS 2VFSA 3KUHA 3FUYA 3TAMB 4QYZK 1LK5A 2LQ5A 1WC0A 4JI1J 1Q78A 3H8YA 1B70B 1O51A 3W62A 3OR2B 2DKOB 4EU0A 5F9LA 4GKKJ 2OSQA 5LJ3Y 3H59A 4WPAA 1RJJA 1JLCA 4NCAA 2HHXA 1IXKA 3MM6A 2KI2A 1YZ7A 5ETNA 4NRTA 5J2PB 1DJ0A 1RHKB 3SIPB 2JHEA 3LGHA 1M5OC 3KHHA 1CG2A 1APSA 1WORA 1SB6A 3D4JA 3IRXA 4X62F 5DM7Q 2QTWA 3IA0A 4IQXA 1ICEB 3HHLD 2MQNA 4RW8A 2HZCA 4M5IA 4AXIA 2FYXA 5HLFA 2D3UA 2FJBB 4HI1A 2WW8A 4U67Q 3PX0A 4NPOA 4ZVGA 1DAXA 3ZC4A 3FVYA 1CJKA 4R5PB 1J5EJ 4C3MA 4FDFA 4DV5F 4KGZB 3LUYA 4A8FA 1T9YA 3G8QA 2WVDA 3I9V9 4IO9Q 2VHGA 3DRSA 3SSSA 4F8RA 3MGJA 1RU1A 3RRHA 4KHMA 3BN7A 2KXFA 1JJCB 1WD6A 1Q0NA 2XYGB 4TY8A 4C6AA 5J2PA 1HL6A 1WSVA 1KS2A 1T11A 1D09B 4LR9A 3TA2A 4B9UA 5HVFA 3WZ0A 1SL0A 4DMZA 4ED4A 3K8VA 4MYUA 1H73A 5HL7Q 2KM8C 4GRSA 2R2SA 3ZZZA 5DDQC 2VU5A 5CAAA 1OY6A 1X8DA 2LA4A 2VPWB 3AT1B 3A1YG 2IVFB 2BQ3A 1D9DA 1FJGF 1NK7A 1N0VC 4FYDA 4GKJJ 1S1VA 2CPFA 3U02A 3MFHA 3PKMA 5C42A 3BKUA 2MSTA 2KHDA 2KH9A 4UQGA 1EHWA 1HBNA 2CNKB 3BJYA 3PXGa 2OFHX 1VQKS 2CQBA 2M3DA 2Q79A 4RW7B 2GIQA 2ZZNA 4RNFA 2MKKA 4B3RF 2UVWA 2HQFA 2M88A 2NUUG 3D6HB 2HPUA 1VYAA 1CJUB 1SQEA 2NSCA 4QU7A 2KRRA 3H90A 1HD0A 5HMZA 3D1QA 3FCVA 1N36J 2WHOA 3L9ZA 4BDPA 5CHCB 3MXHP 1WHXA 3Q2TC 1FJGJ 4JI2J 3BO2A 2B9YA 2CG4A 2VFVA 2ROGA 4YR3A 1URRA 3EM1A 3W9JA 4YR0A 5KG3A 3HT0A 4CH1A 2CQGA 2CJQA 4K0KF 3C3LA 1QTNB 2C2ZB 3QWPA 1B0VA 1JB0C 3OT9A 4KFBA 4DSIA 2ZH5A 4TU8A 3P5BP 1Y5LB 2FB0A 3D1HA 5E0OA 4CQ1A 6FDRA 3G2XA 5D15A 4ANCA 4NA1A 4K4YA 1ZZNA 3IFEA 2M8DB 4DV6F 2RDIA 3FCWA 4KJIA 1ZOTA 3I31A 1UWBA 5IFMA 3WHIA 1C4CA 3UQSA 1EQ0A 2CVEA 1VIOA 1HW9A 2QZ8A 2ROEA 2UP1A 4UY8T 4LF6J 4ECYA 3NGKA 1J5EF 3T41A 1WC5A 2AW0A 4I64A 5K8PA 1GX5A 3EGVA 5KG0A 4YQWA 4ECWA 4PG7A 2W4CA 3DLKA 3OW2R 3TQ1A 2AJ4A 1NK4A 1Q16B 1BHNA 2CNNB 4X4OA 5CZVA 2MKHA 3W5ZA 5CD4A 3DDKA 4X4RA 2CA9A 1H0HB 2KJWA 5LSLA 4NLOA 2RD5C 4F0KA 3V6JA 2IHR1 1TK5A 5BXIA 4N76A 2XMAA 2ZUGA 4EFAC 4IRKA 3I96A 3D1OA 2IRYA 4PWDB 4WKRA 2QC3A 3DGPA 1BC6A 1RAGB 5B09A 1GNKA 1IBMF 3MR7A 1K0TA 2NYHA 2K7JA 2GZOA 1KOOA 1N5YB 2MKIA 2FJXA 4FPRA 2JEFA 3JSRA 3VTIA 1TFYA 3GQCA 2XGPA 4DR2J 2DNKA 5KFWA 2F5GA 4E2FB 4YB7A 4DV6J 4QJVA 3BKTA 3DLEA 5KFSA 3N6LA 3P4UB 4RBTA 4DFMA 1JNRB 3FEXB 5D4OA 1FX4A 5F8IA 1TQLA 5KG1A 4FPIA 2ZJRQ 1NHKL 2IMOA 4FYVB 1MMDA 5HATA 2P5VA 2W9CB 2QLWA 5U47A 1YX2A 4NI2A 4J9RA 4K5RA 4LT6A 1NH7A 2J8AA 2MZQA 1LFPA 4Q5VA 4DR3F 1HHTP 1VIXA 2QYCA 1YLXA 1Q79A 1LNQA 1JWWA 3IBFB 5K8MA 3K57A 1G3OA 1ZM4A 3BO3A 1VC5A 2BM0A 3MF5A 3HI9A 4WFYA 2V5HG 4DPUA 1ZTWA 2A18A 1FRJA 4ZPWR 4RW4A 4K8RA 2F40A 4RNOA 1WUUA 2YNHA 2JFKA 1HNWF 4FS1A 3POTB 4QWBA 3OPKA 1YBAA 1NKCA 1VRUB 2AJ1A 3SCJE 4IDKA 3SFUA 1HNVA 4O44A 1QVGR 2F1FA 4JOUA 2OTLS 2VG7B 1RXOB 2XNQA 2XS2A 4H4KC 3UNYA 1DTQA 1T7PA 4FNIA 4P2MA 3C46A 1UVKA 5M2RA 5KT2A 3DLHA 2ZBQA 2GAGC 2FJWA 3K8WA 3NY0A 2HLUA 2E1CA 4XAKA 2Y1IA 2GQQA 2MMYA 2O3DA 1HA1A 4R8UB 3L3CA 4NI2B 4OYXA 4WK1A 2W8KA 2YNGA 3OUYA 2ZFHA 1X9MA 2J9DA 2KL8A 1VQPS 2XYPB 3CD6S 1K1SA 1GXUA 4ED1A 2DHXA 4ZS6A 4Y00A 2ERRA 3RRGA 1L3SA 4DSJA 3NMRA 4LF5J 3N28A 2XLIA 1T94A 1SV5B 2E7XA 1FFSB 2D9OA 4JI3F 3HFZB 4IQMA 1CQMA 3FRYA 3GYGA 4NE9C 4QR1A 4CLUA 5GADU 2XM3A 1ZM9A 4C4WA 4C0HA 3CJKB 3SSRA 3ISZA 4PAAA 2L3MA 2OPSB 2V4QA 3PW5A 2BDPA 3H42A 4P7VA 3TUZC 4IH6A 4CLFA 3FGVA 3BO4A 1CEZA 4L6V3 2EC2A 4EBDA 2XZTB 1TL3B 3AODA 1HW8A 2Y1JA 5AJ3J 1TVRA 1XMQJ 4F04B 4DV7J 3MPVA 4P75A 4ZP8A 2UVVA 5KFJA 2UUCJ 2JEIA 1SCJB 1RT3B 4C8KA 4B3RJ 2M0GB 3HD2A 2APOA 3D6TB 3AQPA 4OHXA 4ED2A 1SJ4P 4NMLA 1XN9A 4KAIA 2FDNA 3H98A 3QZ7A 4USTA 2YKMA 4JUZA 4ZVPB 4C0OC 4TLRA 2DO0A 3PO5A 4J37A 1NDPA 3DMJB 3PTWA 3MOJB 5J2MB 1BMQB 4V19X 1A0OB 3VZHA 5KT4A 4F25A 1S0MA 2V9WA 4B9VA 1S1XA 4CO0A 3P3DA 2UXDJ 1DQAA 1WOPA 5GAEU 1S1WB 2HYIB 1CJVB 1TL1B 1V3ZA 3BPSP 3DOMA 1RWVB 3FBFA 2VBXA 2R9LA 1FF2A 2W9BB 1I51B 1SC1B 2DNOA 1M5SA 3Q8QB 3OXLA 2ADCA 4QU6A 1RDRA 1WSRA 4U9RA 5HSPA 4DN0A 3TI0A 1TK8A 4IYQA 1RTJB 2GIFA 5L9XA 1QSYA 2FGCA 3ADAC 2PC6A 2FY8A 4Y2AA 1HLWA 4FKYA 2QEXS 4YDXA 4IRCA 1D9FA 2HFZA 4I2QA 4JV5F 2OI2A 1M5PC 2IY5B 1DTTB 3H0PA 3QSIA 3ZTSA 4D3GA 2L9DA 5ETMA 3FNNA 1W2BR 1NKEA 1TTHB 2BX6A 3I4PA 3KG0A 5C7PA 3C6UA 4EYIB 2MQLA 4C8OA 4L76A 2ZE2B 1U26A 4NRUA 4DG1A 3QJLA 1QE1B 4H4KA 3BSNA 5C2GA 2ASJA 4LF9F 4TKTA 4ED7A 3N5BA 1JNZB 1WOOA 2DNGA 1FEHA 3CGIA 2VG5A 1KQFB 5A2QY 2RDDA 2D7SA 1HBNB 1QAYA 1FDBA 2GMLA 4OI4A 2DK2A 2DYAA 4LUBA 1X9WA 3F73A 3CDUA 3EGWB 4WE1B 4Y3CA 3JQKA 4PXEA 3UDVA 4DR7J 2LQJA 4P52A 7FD1A 2FLNA 3MPDA 3CF5Q 4ECSA 4OX7A 3ELHA 3LF0A 5K9FA 3W8PA 3MUMP 2PGCA 2AU0A 2C3MA 2KYXA 5SUHA 5KFQA 1T95A 4LFBJ 4V1Ak 5GAGI 2RILA 3FFIB 3L7UA 2JL9A 4OX8A 4OZNA 2RMLA 3H40A 2FLOA 3M6UA 2Z57B 1YRXA 3N9UC 4URQU 1HNIA 2ZUAA 2GHPA 5EX3A 3KHRA 3VAFA 2C2RA 4Q0BA 2W7AA 4ERDA 5LJ5Y 1QJHA 1NSAA 1VHIA 4NZ7A 4DV1J 2QL7B 1D1UA 1RT1B 2C2KB 3W60A 3FBBA 3VQTA 1RAAB 4OJ3A 3TEGA 3WC0A 5IM0A 4X64F 1RQ0A 3F56A 2OLWA 1LK7A 2C2OB 1I6JA 4G65A 5H9FK 4G3IA 5T41A 3NAHA 1JMTA 4KQZA 4JI7F 4QQBA 4MIAA 3EX7B 1Q86T 5KFZA 1SIZA 2C2EA 1I94J 3BGOP 3IAS9 4JI1F 3R5BA 3DHXA 1SH2A 2CJYB 2DB1A 3FDSA 5CCLA 1YSJA 2CQ4A 2QV6A 2BACA 4QW8A 4C97A 1L3TA 4OI1A 2CPIA 3AY0A 3Q8PB 3K59A 3OLAA 4CNZA 3R1LA 2BRLA 5FJ4A 2JOQA 4K4SA 3KKFA 2J76E 3L09A 4DL5A 3NMAA 1S6OA 2HGNA 2R42A 3CJ0A 2D3O1 1MNEA 1CJTB 3GPAA 3KLFB 1NRKA 2FJEB 4JB8B 5J1EB 2ALZA 1U6BA 2OEKA 1GXTA 2YH1A 5A6PA 4X4QA 1FRIA 2QSWA 3NNCA 3J80Y 5FDLB 2Y3YA 3CMES 1NAQA 3I87A 2W1BA 2MQMA 1RT4A 3MECB 3CJRA 3QIDA 3ZNJ1 1DURA 3GJQB 2CPXA 2V4JB 3NGRA 2PMWA 4L74A 3H2LA 4LF1A 2HFUA 4PZVA 3T19A 2QN6B 2G0IA 4EO6A 2B0GA 4X4NA 4LQ9A 1TKTA 4KGKA 4CTAB 4NYPA 3EICA 4AQYF 1UWAA 4ECZA 2DGUA 1X4CA 3ITHA 3SFGA 3DOKA 1FE4A 4RUHA 2FY1A 3C15B 3FK4A 2HG4A 2EFOA 3VAKA 4FVCA 3O3LA 4DG1B 5I3QA 5KG7A 4NMXA 1FNOA 2MQOA 4OZJA 3EGZA 4DZDA 3M32B 3ZFVA 4Q8FA 3KJQB 1JJHA 2G2YA 4OFZA 5IT0A 4OX9J 2DNRA 3CJ5A 2D74B 1C1BB 3VAGA 2OPPB 1NDCA 2X1GA 3OR1A 1WC6A 3I0SA 3M2UB 1NZAA 1NJIT 3G9CA 1C0UA 6AT1B 1S9GB 1UWBB 1W7WA 1CSJA 1UETA 1VHFA 3V2UC 1H2TZ 1ULRA 4DJBA 2MYFA 4WCEQ 4EBCA 5M2PA 4LIWA 2LQBA 4RWWA 2HW3A 4OZ0A 3QT6A 2GQCA 4X4TA 2AZ3A 3EDQB 3TYTA 1RYSA 1M5VC 4F7VA 3PIOQ 1RWMB 1S6UA 3K58A 2EKNA 2FC9A 4F3QA 3THVA 5C2CA 4ZPBA 2CPEA 3F41A 5A8RB 2AEJA 3Q8VA 1X60A 3GFHA 3UO0A 3CCES 1NXIA 1B3TA 2H65B 5F8JA 2AZ1A 4N77A 2Y8YA 3ZO7A 2IM1A 3SDEA 5B7WA 1NM2A 3LP2B 2BE2B 3LWMA 1RHRB 3FQLA 4DQQA 4WFAQ 1RT7B 1VR6A 4ZVEA 3U1MA 3RYLA 3LOUA 4DV4F 4P71A 4U7CA 1DLOA 4GKKF 3DRPA 2E5IA 3QAEA 3TZXA 1EJ7L 1K44A 4GC7A 4MIBA 4PR6A 3CWJA 3UCGA 4DPTA 2KG0A 1UEUA 2ZWPA 3OTOF 3FSIA 4ZMMA 3B82A 1VQSA 1K0VA 2ZD1A 1NPPA 3KLEA 5EWFA 1UTAA 2KRBA 5G0RB 3MM8A 1RP5A 3HX9A 1C0TA 3G6YA 1XQIA 3MMCB 3SCLE 4DPYA 1M90T 5ADZA 4DR1J 3QQCD 3V6DB 2W4DA 3PW4A 1BD6A 2CDRB 4Y34A 1SKUB 2ZBPA 1HQUA 5F0UA 4CDIA 3CDEA 1FEEA 2IFXA 3VV2B 3OQ2A 3HM9A 2NZCA 4F4YA 2QA4S 2DNQA 5C25A 3FZ2A 1P1LA 3OR1B 4F4AA 1YWXA 5B0BA 1WC3A 3NCPA 1XR7A 3WQPA 3D54A 2HQCA 5GVQA 3W5XA 3MM5B 1PGZA 2GMHA 2J7UA 3AD7C 3O1LA 5DS7A 2R7VA 3T5LA 1UZHA 3K5NA 1U1QA 2HK3A 4URSA 5LXYA 2RIJA 4QZVB 4I0WA 4ZIWA 1V3SA 3IM8A 5HQ8A 1WTFA 1GT8A 3HT3A 1XERA 2ZVSA 3EVWA 2BE9B 4HH1A 3BZQA 4PXDA 3T9NA 2E7WA 2HBRB 3CC7S 3BQ0A 4WFBQ 1WKJA 3NWRA 2CJKA 1UJ5A 2ZDOA 2NZ4A 5AXKA 2KKHA 4IG3A 4MAKA 1R8HA 4FYXB 4QYZJ 1U47A 3M05A 4ZOSA 1FRLA 3K7RA 1YVFA 3CO0P 4X4SA 3AOCA 1CJTA 1I3OB 3IS9A 4KO0A 2BZ2A 3C6TA 4UUWA 4JBCA 2HKEA 1RTIA 1A6LA 1KKHA 3H5XA 3UD5A 1TKTB 4UTGA 1SL2A 3BGFA 1PCAA 1LWXA 1S7IA 2E29A 2ZH3A 4MKYA 2XO6A 2EK6A 2C28A 2YX7A 1DARA 2QLBB 3MEEB 1IJFB 1OSDA 1WF1A 4WP8A 3OVAA 4DR3J 1S0OA 5D8HB 2C3UA 1O6XA 1K73T 2B4UA 2E7VA 3PYDA 3Q89A 5L1JA 2YWWA 5IT4A 1ZPWX 2YTCA 1RAOA 4OHZA 5IWAJ 4DUZJ 3M8PB 1MROB 1U2RA 5HMWA 9RUBA 1H38A 3PX6A 2XC9A 4ANEA 3JB9k 2PI5A 3QRRA 2BQUA 4U7UK 4CH7A 3QGPA 4YY3F 3MAQA 4J9OA 3NS6A 1N6QB 2XWXA 2KFYA 1B0PA 1Y3KA 1CULB 1NSKL 3C14B 4ZPCA 3A8KA 3CW2C 5F0WA 3R3TA 3H4DA 4U8YA 5E3RA 3SDEB 2BE7D 4FBTA 2F4VJ 1RTZA 3Q0AA 1U1NA 1FJ7A 2ADBA 1GK8A 1SPBP 2HQ3A 2CNOB 4ECQA 4MT1A 2GVZA 1UA0A 3E2EA 1JQGA 2QO3A 1JKHB 3R7SB 3Q8RB 4PQAA 2FVPA 3PIPQ 2MKJA 4DR5F 1HQ2A 1M5HA 3K89A 4ZJLA 3GJSB 1M1HA 4MKVA 5B0CA 2ZHAA 3MEEA 2MZTA 3GU0A 3TAMA 5FLXY 1YBUA 3OLBA 4FF4A 3OL9A 1WOSA 4X4UA 1RT1A 3BGRB 2JX2A 4C2MA 3TVYA 3T6JA 1LQ9A 2P9EA 3VVTA 5LMNF 4JV0A 3V6HA 4IOAQ 1U6ZA 4DQSA 2XMUA 3W61A 1LW2A 3MURP 4RW9A 2HNZB 2BABA 1WI6A 2DNHA 2E1RA 2F8HA 2LMIA 2YNIB 3C19A 4B9LA 4DUYJ 2EFVA 1QLNA 4W90B 2VODA 4ER8A 3UVJB 5AE3A 2FPHX 5IV3A 5AXNA 3DYAA 1X0FA 4DV0F 2PSZA 1IBLF 3I32A 5GADI 4AT1B 3CUNA 2BJ3A 4G6VB 1FI4A 3NS5A 4ILRA 3UR3C 3MMJA 2F9JA 4EZ6A 3TJ8A 1YJUA 2PEHA 1RTHA 1VBKA 2C3OA 3TJAA 5RUBA 5KFHA 1F3VA 2GAHC 1SI9A 8AT1B 4A8YA 1YIJS 3NBPB 4WU2A 2FTRA 3W2VB 2KFNA 1IKVB 2ZZTA 3HSJA 3ZTRA 4GO7X 5CYMB 2BUNA 1VRTB 4GVLA 2I5JB 3MEDB 5D3GA 4LSNB 4Y28C 4NWBA 1E6YB 1V6HA 4CM0A 4FS2A 3VGSA 2W7OA 3UCUP 2HSEB 2GVZB 5I4MA 3GILA 3S01A 3P49B 1G4CA 3BSOA 4O4GB 3QIPA 4FYWB 1OS5A 4LSLA 5HN0A 4CO4A 2D69A 1PYSB 1UKUA 5E7OB 2YKMB 2MQQA 2PO4A 5DZ6A 2RS2A 1D9AA 1SL1A 4WFZA 2HGLA 1Y9OA 2WCXA 4Z2XA 5EHHA 1FHTA 1YDLA 1F60B 2E5GA 1LV5A 4DF4A 3H5SA 3TARA 4FF1A 1FNXH 4C8ZA 1U7LA 1WWHA 2E5HA 4JV5J 5KFGA 3QPIA 3M8PA 4CYUA 1JK9B 2GNKA 4C0BA 2Z2LA 3TOQA 2KO1A 2MY8A 1EIYB 4O3SA 2PIIA 5KFPA 3Q8SB 3THTA 1B4SA 2GHWA 3PEJA 4BWJA 1X4FA 1KFSA 1H6KX 2ATCB 4LR7A 2C2MB 2MLXA 3JSMA 4J5OA 1F5CA 2F3JA 4I67A 1G2EA 3BSCA 4I6AA 1U4BA 3ENAA 2B5JA 2OPQB 3WDOA 3CJ2A 3UDEA 4F26A 5D0HA 1KTVA 1Q53A 3GE9A 1EETA 2WSCC 2XMWA 4LF2A 4RWXA 2RU3A 4J9PA 4R5PA 1NJWA 1PJ7A 3IWLA 3BB5A 3I56S 2XZDB 1VOMA 2ZBRA 4IOBA 1N52B 2VBYA 5D4NA 1IWGA 4HHJA 4YB1P 3KNAA 2A0FB 1LWEB 3OUYB 3HPOA 2RQ4A 4DCOB 3CPWR 4KKOB 1KQKA 3NGTA 4DUYF 1IKXB 1KRPA 4P72A 4B3SJ 1FJCA 4UF4A 3VQSA 3OFEA 3BGUA 1U8SA 4I2QB 2M52A 3KDNA 3LP1B 3SMZA 1V5IB 2VB6A 1R6VA 3M30A 4HEA9 4ID5A 2V8PA 2WRMA 1H72C 5JUMA 4J9SA 1R0AA 1H7WA 2EC0A 2DO4A 2DCUB 5A8KA 1GX6A 1VISA 3JQMA 3ZTOA 4N56A 3W3SA 1NNDA 4C8YA 2G1DA 3C15A 1OQ3A 4WTYA 1D8YA 3UWTA 1RK8A 4RNHA 1S79A 3GYXB 2HRYA 3E51A 2OP5A 5GAHI 1NSPA 4O4RA 4IFVA 3M4XA 2CPDA 3LGMA 2AV5A 4UZCA 5AE2A 3I0RB 3WBZA 4ES3A 4A8KA 1U1OA 2LLZA 2XO7A 2G1HA 1WG5A 1X4HA 3JAMY 3OL6A 4DFPA 3CCUS 2CDQA 4ED3A 4ZHRA 4DV7F 4UQTA 5KFKA 2Z58B 3G82A 3KMQA 4I2PB 2UUCF 1QAJA 4MK7A 2GW8A 3NAIA 1SXLA 2W9CA 2JH3A 1IBKJ 4EYHB 1RT3A 1BQMB 2XHWA 1N5QA 2OPRA 3JTPA 2AGPA 4DXLA 2KB2A 2BBEA 2XULA 5A76A 4YN3B 1S1WA 2HFNA 4QOTA 2NXEA 5GAEI 3FSYA 1RHUB 4DV2F 1RI7A 2U2FA 3Q8YA 3QFWA 4PEOA 4FBUA 2ZC4A 3PFOA 1B64A 1X4EA 1U0SA 3CVKA 4PPDA 3CEDA 8ATCB 4P2XA 1U24A 2POKA 5IZHA 1VCTA 1RT7A 2XMTA 5E3AA 4J90A 1VDHA 2AIRB 2R8KA 2HQDA 3LP2A 4U7UD 4NLGA 2Y0BB 3W2WA 5MAOA 3S8SA 2VIHA 4KH1B 3PYEA 3P6YC 2F7VA 3GR0A 3HLUA 3LA0A 4USUA 3WIUA 1NK6A 4NL5A 2XCAA 1S59A 1H2UX 3DRPB 4LREA 5KFBA 1DY3A 5B08A 4DPWA 1S6PA 3EDRB 3CMAS 4AL5A 2ROPA 1F1BB 1S6QA 3J7YU 4USHA 4ZVHA 1S12A 1HKAA 1UVLA 4DOZA 2V9KA 3UW1A 1U1MA 4M5HA 1T9WA 2IVMA 2YNFA 3H5UA 3KG1A 4Q7AA 4R8UA 1TAQA 2DISA 1HPZA 2HIYA 2LYVA 3DI6A 4X4VA 2H3EB 1REVA 1T05A 3LP0A 3GTYX 1FRKA 2ZOGA 3QATA 4IFYA 1SV5A 3K2YA 1AT1B 3EZOA 4CZCA 2WK4A 5GMKa 2GIRA 3CNQP 3SQGA 5F8GA 2SXLA 5CA5A 3SSQA 1CC7A 3W2WB 4F2RA 2PA8D 5LT5A 1NK5A 4ALZA 4IOCQ 1VBZA 4LF8F 1JLGB 1L3UA 4HKQA 2DGVA 2HK2A 2J0WA 2BJ1A 3CO9A 2OELA 3CJSA 2AKWB 1U09A 4HT5A 4DZ6A 5GAGU 4TNOA 2HZVA 3EVMA 2Z4PA 1FWLA 5GMDA 3BBFA 2ILYA 4C8MA 3KHGA 4DR1F 1HNIB 3KLGA 4AD6A 4F36A 2B9EA 4OZLA 4QWEA 5MLCV 2PT0A 2BOAA 4HDHA 1T8EA 5ETKA 2HVIA 2P9CA 2VFRA 1REGX 3IG1A 5D0EA 3G86A 3H7HB 2KZMA 1KWMA 1RHJB 2BV3A 3PFEA 5GMEA 4ZCMA 1U2FA 5HROB 2HHSA 2DR5A 2RF2A 1CJUA 5KFUA 3OTOJ 3G6VA 1C4AA 2RT3A 4KFBB 2J9CA 4JI6J 5IC4B 2XTJP 1VLOA 1KNZA 4DX6A 1CQNA 5CYJA 4Q43A 4O3RA 2KT3A 2FIUA 3C16A 3DCAA 3GB0A 2DNPA 4F4WA 1UMJA 3QGGA 1MN9A 2CJBA 1P9YA 3U7JA 1BUXA 1FK9A 4M1KA 1VC6A 4NLWA 2L08A 4HLBA 3TUJC 2FVCA 3T1YF 2QL5B 4I6WA 4TQRA 4M95A 3EZ5A 3T5JA 2MHEA 3UNGC 5L46A 2KVQE 2ZZMA 2IRUA 3HSZA 3PKYA 4PQUA 3EYZA 3OL7A 2XQCA 2RQMA 4ZHRB 1RGVA 3CCZA 5D6GA 1FVQA 2PI4A 1CVJA 2DR6A 5DLGA 4HHHA 1RZMA 4LSZB 2AJ2A 5ETLA 3TJ9A 4YHHJ 1RTJA 1S1TA 2OTJS 4M5LA 2H1YA 4NXNF 3LWLA 2DHAA 4KV8A 3JSYA 5CQGA 1YHQS 4ZVUB 1KONA 2YPZA 4O23A 2XLKA 2KTQA 3RBEA 3HP6A 3VGTA 3NOGA 1S72S 1QUPA 1A9NB 4USKA 3BYRA 1CJKB 3LGNA 3NXZA 5ETTA 1D8ZA 2GO8A 2V2QA 3PCOB 4I68A 4OJGA 3W5YA 4QBUA 3MCOA 2L48A 5KT5A 3RU0A 1S9EB 2K1RA 2Z2MA 3CJ8A 1GEHA 2NXJA 3NCQA 2E44A 2L41A 2DVIA 3FFIA 3X3UA 5D0GA 4NLUA 3S6EA 1S9FA 2HGMA 2F8EX 3AQOA 1RWUA 5LXRA 4J9NA 4KSEB 3GG1A 1S1TB 2ZWOA 3AH6A 1RWPB 3PDNA 2R2RA 4ZCKA 3SV3A 2VA3A 3P5TL 3ZXWA 2A1BA 4XO0A 2UZAA 1U6FA 1HR0F 5EDWA 4FYYB 2QFIA 2P6SA 3IS9B 4KO0B 1T02A 4KRWA 2CAJA 2JSXA 4YB6A 4B3TJ 5DO2A 4EZ9A 4G1PA 4FXDA 4ETXA 3FKBA 2RB7A 4NLSA 3HVRA 3D5MA 2LDIA 3EWGA 1TFWA 3CJKA 5ETQA 4HDGA 3UFCX 1GMWA 3IRXB 2B43A 1IWAA 1IBCB 1SC4B 3OVSA 4WKYA 2DPJA 3R2CJ 2A6MA 2FJAB 5KOWA 4ECRA 1H3DA 2N3LA 4I4BA 1NEEA 1Q8BA 3IRWP 2IM0A 3HVWA 3R7NB 4ZK7M 3KFWX 2GQ2A 4G1QA 4HTJA 2HBYB 4O3OA 2ZHBA 3RB6A 4FN5A 1E6YA 1S77D 1T3OA 2YKAA 4DDFA 4EBEA 5IT9Y 2RHQB 2F4VF 2HBZB 4NXMF 3GYNA 3TVZA 3MM7B 3DDNA 3QRPA 4E8UA 1X7VA 3QSYB 4ZP7A 5F8NA 2RH3A 1X31C 4OZ1A 2AEMA 3QT7A 4DR4F 3N6MA 4C48A 1UW9A 1WEXA 1HBMB 1AB8A 3MAAA 1YGYA 4MMOA 3OJSA 1FXLA 3J7AN 2J6UA 2RUGA 3FQKA 3O44A 2XMVA 5KFAA 1Q8LA 3MCNA 4TY8B 3US5A 3KG4A 3ZTPA 3KLGB 3DLBA 1TAUA 2XHCA 3GJRB 1HNVB 1U1RA 2X51A 2R8GA 5G0RA 3DRSB 3HSGA 4KB7A 5L1LA 2Z2ZA 2E9TA 1E6VA 1FERA 1SUQA 1SBRA 1UFWA 2LCWA 2X7IA 3CCLS 2X1FA 4JI4F 1EKRA 1NPKA 2OKQA 4DLGA 2BRKA 2EI5A 1JXLA 1HI0P 1NHUA 4XDDA 4KHPJ 2IYIA 2WB1D 3NGSA 3M9OB 2D41A 2Z0GA 2FZKB 3MDFA 1AFIA 2C2DA 4YFUA 5E2QA 1QTMA 2B6AB 1I5OB 4WP9A 4HYKA 1YTYA 2CZVC 1R89A 1KLNA 4K7QA 2WSFC 2QIFA 2XSJB 1W25A 4PXBA 9ATCB 2KT2A 2WAQD 4RU9A 5J2NB 3I9ZA 5DG9A 3G96A 3NKYA 1HYSB 3UVJA 3FCHA 2P8IA 4H4OA 5C24A 2VJUA 1YJWS 2IJRA 1TL3A 4K2XA 5K5MA 5E3QA 1JLQA 2DCLA 2MKSA 2MSSA 4PKDB 2VBZA 4ZLLA 5KFEA 2Q3PA 2CQ3A 1F2GA 2GJIA 4LRDA 5FD1A 1GMVA 3BBBA 1N33J 2W24A 4DL3A 4P6QA 4NLTA 4PUOB 3DFEA 2C2NA 2AT1B 3I0SB 5DJBA 5HVGA 1QSLA 1GTEA 1RUSA 1HHQA 4PG4A 2CQ2A 2UUBF 2FJDB 2LU1A 1XNQF 5IXUA 1S6QB 3NGUA 4U95A 2GVDA 4QIGA 5KTQA 3DRRB 2VF3A 4LF8J 1ZAVA 3JTNA 1REVB 2HAFA 3T5KA 3CCSS 1T05B 5ETSA 1SKWA 3C66A 2XB2D 1DTQB 5L8RC 3N4WA 3BEGB 1F0XA 3MPUB 4OYWA 2CPJA 1XBWA 2RAQA 3OD2A 3T3FA 1RLCL 3U1NA 1RAFB 3R5JB 2OUGA 4O44B 4X84A 4A8SA 1XK8A 1X5SA 2M70A 2W2OP 3BS9A 4JI2F 3POTA 2W2PP 3HHLC 3PM9A 4LRBA 4DUTA 5K8NA 3TX0A 1XTZA 3LO3A 4QW9A 4H54A 1FA0A 3I0RA 2DXEA 3LPEA 4FF2A 4RW4B 1N5TA 2R7UA 5KFCA 2IPOB 1P8GA 3VAHA 4U8VA 3IWNC 2YH0A 3HVTA 3L7OA 1H7XA 1AA1B 1UPPA 3MECA 4WXOA 3V81B 1WEZA 2DNYA 2O5DA 1DZ5A 1X4GA 3HSDA 1BY9A 4B17A 4OYOA 2FUG9 4S0MA 2W9AA 2H48B 2ZH1A 3IGVA 2VQEJ 2VA2A 3A3PB 5LMNJ 1XWLA 2XYHB 3G82B 2DH7A 2BEFA 1IR1A 3JQJA 4LRAA 2DNZA 4KGXB 3T5HA 4FXWA 2DR8A 4IUFA 3IR5B 1N5YA 3GMGA 2O01C 2ZITA 3GFXA 3ICLA 4ZA1A 2ZKTA 2GJ2A 1B7FA 1U0HA 3DGPB 4BCAA 4JV1A 4KY3A 1IBLJ 1H74A 1U02A 2LEAA 4WP3A 1PO6A 2VL1A 1KTQA 5KG6A 1VK8A 4B9NA 1X4AA 2CADA 4AE5A 4A8OA 4DX7A 1ZBTA 1X5OA 1ITPA 3DLEB 4L3KA 4ID8A 4TLQA 5H9EJ 1ZYQA 1FKPB 2WVBA 3CJ4A 2R7RA 3R5CA 2JDJA 2VONA 3M30B 4F2SA 3J81U 1Y7PA 2UUTA 1KVKA 3GIKA 2YKNA 2E5JA 1UVMA 3HK2A 3SV4A 4B9MA 4ZKAA 4WK3A 1TKZB 4LBIA 2A2DA 1IM6A 2OAUA 3CCWA 3HHLA 2M5YA 3L95X 2OIHA 3MMAB 2MDAA 5I42B 2WOMA 3GV5B 5A8KB 3V4IA 4GKJF 1VQOS 2ZH9A 2XNRA 2RRNA 4ID5B 3KLIB 3MCMA 5C24B 4F0MA 2XY6A 1UVIA 4C3KA 5BYQA 2IM2A 4FVMA 3T6BA 3VVUA 3GIJA 4U6PA 4A48A 3H4BA 4W92B 5AE1A 2VQEF 1EZZB 2WSEC 3C2PA 1LXJA 3ISND 4DR7F 5IT9U 2EXUA 1RKIA 2WVCA 2K1RB 3PYGA 2HLTA 1ZA1B 2D9PA 3JS9A 4A8MP 5JVHQ 2J5AA 2VOOA 1FT8A 2C3PA 1F2HA 3MEGA 3BBCA 1NUEA 3IO1A 3R7BB 3G4SS 3TA1A 2QMWA 2B8QA 3HJFA 1RT2A 2JC1A 2YPYA 1RADB 4P2SA 4Q2LA 5CYQA 3RRKA 1RWKB 3WX8A 3PX4A 2B9WA 2KZZA 1BWEA 3Q23A 1RCOB 3M1VB 5J1PA 3VCDA 1W2IA 2VZ9A 4DWIA 3RW6A 2OJ3A 3TZYA 3TX8A 3ONQA 3HZGA 3Q2SC 3K5PA 2CPZA 1KFDA 3OFFA 5A8WA 3AOAA 1Q7LB 1EAYC 3LPYA 1OPZA 3MWBA 4PYDA 5HP1A 2B7CB 1U48A 2UV8A 1JLAA 3UN3A 3MMBB 2ZH8A 3IP0A 4HR2A 1KDNA 3KK2A 2BOPA 2QSFA 4K0KJ 1S99A 4ANDA 2ZNZA 3IAM9 2OO4A 4RZRA 2CUYA 2JC0A 3DOLB 3QZ8A 2H54B 1QAXA 2FQQB 3S1TA 1MG7A 4CTAA 4RW9B 5HQLA 2RRAA 1QY7A 4XDCA 4OV6A 1EQMA 3DMJA 3HVAA 2MY7A 1MWQA 1RA7A 1TKXA 4WXWA 4ZVQB 5F3ZA 2IRXA 3OFHA 1UEKA 4ZDNA 5DGBA 2AGOA 1BLUA 2NQPA 1RTHB 2CZ4A 3BGRA 4WWSA 2JJ4D 3KK1A 5DETA 4QWDA 3B8HA 1VRTA 3PYFA 2FHJA 3QMQA 2MLZA 1K1QA 2PDAA 4PWWA 4NLRA 4ZP6A 1IKVA 2R7QA 5A0YB 1XJWB 2ZM6F 5A8WB 5A6WA 1N88A 5HP1B 1CPZA 1TL7A 3RB3A 1UW4A 4ZITA 3DI6B 3M1VA 1RAJA 1OSCA 3GJTB 2BW2A 2PFDA 3MM9B 2MEWA 3QO9B 2EVZA 3DDIA 5EGYA 4DL0C 3VAIA 1L3VA 5IV4A 2HRUA 5HLFB 4OI3A 3UN5A 2EKYA 1MWZA 2WB4A 3BDEA 4DQPA 4TXSA 4ZJQA 2ZEJA 1BQXA 1JLCB 1Y00A 3AA8A 2CNLB 3W9IA 3J80U 1KD1T 2HFSA 5DQHA 1UJ6A 3ILJA 4JI0F 3T1HJ 1J27A 4B9SA 1T9TA 4UW2A 3KLFA 1U25A 2FHKA 3PEHA 1HMVB 4LFAF 1NJZA 1XR5A 1GXLA 1NH8A 2H5EA 2ZKUA 4NX9A 1TKDA 1FXRA 1XR6A 4LF6F 1HWJA 3OV7A 3EZUA 1CULA 1FKOB 3EJMA 5EX0A 1F3FA 2R3VA 3BH6B 3TA0A 2VICA 1FNMA 3DRYA 3KNGA 3MPYA 5K14A 2V8VA 3PJWA 3MM9A 5JMNA 1N34F 1HWUA 2MKCA 3C14A 3QO9A 1MROA 2MLYA 4X66F 1G1XA 2FZCB 4USJC 4K4UA 1UFKA 1PG5B 2YWEA 3BREA 4AUKA 3OTCA 4A47A 5IQ6A 5HK4A 4DF8A 1RWWB 2QMUB 1U1LA 1OYEA 1PJ6A 1FVSA 2O1PA 1IKYA 2Q1LA 4X65F 3J7A1 4QCLA 4B08A 4C11B 3O5TB 3MR5A 1GMWD 1TL5A 2QA4G 1YJ9S 1WJ9A 4MFBB 2EFNA 1CC8A 4Y0FA 3VAMA 3GCWP 2ZOFA 3ZZYA 4K50A 3SI8A 3D67A 2BMBA 2XG8A 5FIIA 1MU2B 1FESA 2JRSA 2OMOA 1RT6B 1VFJA 3BSAA 2DXFA 4RPFA 4P74A 1IUJA 1RLDA 1Z4UA 2V2KA 3MR3A 1TV6A 4IR9A 2DGXA 3AFGA 1JXVA 4M5KA 4CLPA 2ZNYA 2ZH4A 1VI7A 3CC4S 1LW0A 1B7YB 2HMIB 3GIRA 1R0AB 4WYLA 3M2VA 2BM1A 1T3NA 3GR1A 1VJWA 3LP1A 3ETOA 4DN9A 2JEGA 5DZ7A 1U1KA 2B7BB 5CCMA 2N7YA 2OD6A 3C6TB 5M2UA 4IFVB 4KHRA 3HXMA 2AJQA 1IKXA 1HD1A 4WU3A 2H51B 3HKWA 3N5FA 1F9FA 2W7PA 2E1MC 3LALA 2HVZA 3S7RA 1I94F 4B3MJ 1LWEA 2DGWA 4MKAA 4IO1A 1KHVA 2M9KA 4O3QA 3JYTA 3LH2S 3M2RA 4IKAA 5A2QU 2W9BA 3RBXA 4GVBB 1SJ3P 1AW0A 5HVHA 1CJVA 1TL1A 2PN6A 2CPYA 4AFFA 4DPOA 4KE5A 4DV4J 2AHOB 3PJ9A 3MMBA 2YQ1A 4M5DA 1KQSR 5J2QA 1K9MT 1EP4B 3M9MB 4JI4J 5KFTA 2AJ0A 3ILLA 3CTRA 1Y4ZB 1Q81T 1RAHB 4OHYA 4TYAA 2VOPA 4CRJA 2EK1A 2VFUA 4WYWA 2V4RA 3R1HA 1BXNA 2MJUA 4CH0S 1S1UA 2ZD1B 5HMXA 4QR2A 1KQGB 4OYBA 2O67A 3KLEB 3M8RA 4PCQA 2CQPA 3AB2B 4UOHA 2MKYA 1OWXA 2F8MA 1RKJA 2IDEA 4NLDA 1QAIA 3G87A 2LU2A 3P45B 4Q2MA 5KFLA 5ITHA 4UY85 2A10A 4BBYA 1PIEA 1VGYA 5DDOC 4Q45A 2R2TA 1VRQC 1S4EA 2ZJQQ 4AXJA 5THWA 1NK0A 5DQIA 3E8OA 2QLXA 3TEHB 2Y1RI 1YJTA 3MUTP 4NEZA 2XY5A 2Q66A 2OPQA 4O0IA 3I5CA 1FKOA 1HWKA 3MMAA 3MM8B 3OTDA 3AOBA 4M8LA 3EPGA 1WTBA 3GG0A 3M2UA 1XIQA 2J9EA 3A8IA 1ZA2B 3NRBA 5L1KA 3IM9A 1C1BA 1ZM2A 2VG6B 3CXCR 4KC5A 2HNDB 4AL6A 5J2QB 5AXLA 1VQ4S 3KTQA 4DPXA 2KHCA 2UUAF 4OI0A 1YG0A 2DNLA 2LQ9A 2A6OA 1OO0B 4GVBA 1KEKA 2DRDA 3I5BA 4Y6IA 2JFDA 3RB4A 2YWGA 1EP4A 3NNHA 1PBUA 3OXFA 5ETPA 3A4TA 3B6BA 4OYAA 2RSQA 3D3BJ 3V4MA 5KFRA 3AB4B 1EKSA 3D68A 2MZRA 2JLFA 2ZOMA 3D3CJ 1TUVA 4M63A 3R8YA 4USMA 5L38A 1S1UB 1S9GA 2NPFA 3A12A 1N56A 1T03A 5A8RA 4RW7A 3R2DJ 4IG3B 3ZZOA 3TVKA 3KJFB 1AYEA 4RO0A 2V6AA 1IKWA 4ZLPA 3HFKA 2PD1A 2LP4A 4CM2A 2K2PA 1FKPA 2F65A 1HI8A 5HBMA 4OHVA 3DYAB 2GFFA 3W65A 4TU7A 2DJWA 1FX2A 4MFBA 3OTEA 2VQFF 4DSFA 4I1TA 1VRUA 3OTBA 5BYRA 1SQFA 2I5JA 3MD3A 4B02A 4TU9A 3QWUA 1SVDA 4DS4A 2HMIA 2YNHB 1TKXB 2LFVA 2XI3A 3HZEA 4MKBA 4CI0B 4DBQA 2L9WA 2L9NA 1IM4A 1N4LA 1VQNS 4RUCA 3K5LA 4DS5A 2J0XA 4OZ3A 3R27A 5L1IA 1IBKF 2BXJA 2CWKA 3DM2B 1YBTA 1ZZFA 4N47A 2RJZA 1HQUB 3R5AA 1U49A 1S0VA 3KHLA 1G7CB 1TR0A 4F3OA 3A13A 1FCAA 3ENQA 3KOAA 2HHHJ 1KSPA 5HAOA 1A7GE 1VQYA 2N4DA 4G1QB 2DHGA 3ZZ0A 3AJ1A 3RJMB 2HWHA 1RE1B 1VJQA 4OJHA 3KK3A 3ZTQA 1S0NA 1P6TA 2AX0A 3D2WA 4CWBA 1C1CA 1HARA 2V4JA 3DN9A 4EGLA 4LFCJ 4Q8EA 3ZZPA 4KGMA 1R0BG 3BR8A 2JWNA 4BC9A 1N34J 1CS4B 3H2UB 4OHWA 5E3CA 4ZJOA 4RBUA 4X66J 1QD1A 1TMJA 1VS3A 1X5PA 2HFOA 1HMVA 2P2CB 3EMTA 2XLJA 4OMFG 4C8NA 1WC4A 3W63A 2KG1A 1KC8T 2RKIB 3HFVA 3I6PA 4GMKA 4Q0BB 4PWDA 3SQOP 2NS1B 3NNAA 2DGSA 3FEZA 3DRRA 3RTVA 3JAMU 4J9QA 3PRDA 2LEPA 1HNZJ 2V8GA 1GQEA 3GONA 4ECVA 4PXCA 5KFNA 4DUZF 2XMMA 3TUPA 3M7VA 5F9NA 1T9VA 4FXVA 1UAWA 1UL3A 2KM8B 3NL0A 4OYPA 3DGVA 3DM2A 3EVOA 4ITSA 2ASYA 5E41A 3RBDA 2GS8A 2V34A 1NKBA 2ABYA 3NGDA 3PW0A 4JI3J 1RU2A 2DITA 4GO5X 3FBCA 4K59A 4NLQA 1SIWB 1K47A 3HHKA 4OIXA 3HJVA 4PWUA 5DG8A 4RNMA 4K4TA 1TK0A 1RACB 4ZPAA 2FLPA 1FFGB 4JI8J 3CE8A 2R7SA 5CD4H 4USIA 4NXMJ 1BWVA 1HYSA 2PFFB 2UVUA 2YKQA 2G0JA 3U27A 3KK2B 1HNXF 1JJ2R 3IR7B 3J7ZT 1OJ4A 3OFGA 3QBCA 2Y0SD 2KYZA 4QR0A 3BKFA 2IAJB 1YI2S 4F4KA 2FVSA 4ED6A 1FD2A 1OYDA 2V8HA 4X4PA 3ISNC 4A4JA 4YR2A 2W01A 4RW6B 1HBUB 4ZCLA 4ECUA 4QPTA 2DTJA 4H4MB 2XBPA 3TZWA 2CQ1A 2KU7A 4BC7A 3V6KA 3T1AA 1SJRA 3K5MA 4B3MF 3R6GB 2VH7A 3HCXA 5FDLA 3MTKA 3CB4A 4J9MA 3QJJA 3DKDA 3CJ3A 4ATNA 1JIHA 5K8OA 3CMQA 3R6LB 4MTPA 3BGLA 2G2ZA 3MR2A 1DTTA 4N8NA 3PNIA 4QPXA 3MR6A 2F63A 2I38A 1HBMA 3MAAB 3N6NA 4LIRA 2XMKA 4OYZA 2JZ5A 4Y2KA 5B0FA 4W98A 1RBLA 1JLBA 1EARA 1Z2ZA 2AWZA 1NBEB 2QFJA 3MM7A 3G71S 3NCRA 1GMUA 1ELOA 2EBEA 2EFPA 2R7OA 2XEXA 1QM9A 2OFGX 4NLYA 1Z2LA 1HBUA 5D4PA 1N33F 2B9XA 1XNRF 1R8CA 4MK9A 3VHQA 1NHVA 1IBMJ 1G6BA 4DU7A 2V2ZA 3TAPA 2X3GA 2KJVA 1TVRB 3MEGB 5KFOA 4ELVA 1KVJA 4E0DA 1L3KA 1U2CA 4NYZA 3RBZA 1X4DA 3VZIA 2CJXB 5KFFA 5C42B 3NWGA 4C8LA 5B0DA 3CCVS 1RYRA 2WONA 2ILZA 3EE3A 4OV1A 2GCFA 3RAXA 2UVRA 2JLEA 4CIOA 1HFEL 4AL7A 3LAMA 4YS2A 1VMBA 1X9SA 3PO4A 3M6XA 3PJXA 1S9EA 4UT4A 1XMOF 3OJUA 4UOFA 4I7FB 2DGQA 4NLXA 2BJEA 1DLOB 1LKZA 4L72B 1H98A 2HIQA 4HACA 3QJPA 2Z2YB 1FDNA 1R8BA 1VC0A 1UP1A 2BE2A 3DLGA 3IR6B 4UOGA 4Q44A 2VQFJ 2XI2A 3IWXA 2YX4A 3GV8B 2IM3A 2CQDA 1WACA 4CO2A 2BQRA 2B4VA 2EFQA 3D0HE 4H4OB 4QIFA 4YMEA 2K8GA 3HHDA 3OL8A 1RTIB 2ATLA 1SKRA 2A3JA 3PHTA 4UZBA 4A8XA 2DPIA 2NYIA 4CP5A 4NCGB 4B3OB 1RABB 2VG7A 2WOMB 2AX1A 1GFWB 2CQIA 1FFWB 2RRBA 4LRCA 2VG5B 4IDKB 3W8GA 4DSLA 4TYBA 4JI5F 1OPIA 1N54B 1UFLA 3EXYA 3R5DA 2DH9A 1FK9B 3O2IA 2R7TA 4M5GA 3W66A 1S57A 3C6UB 3O6QA 2R8IA 1PKUA 3N79A 3KYLA 2J0SD 1M1KT 2K3IA 1RT4B 1WC1A 3O8WA 4ZPDA 3PW2A 2DH8A 1ZAWA 2V2VA 3D6FB 1PILA 1R6YA 3D0GE 5HMYA 1O5JA 1WEYA 2FHMA 3IMQJ 3CC2S 1P27B 1BE4A 4UUXA 3V81A 1HIYA 3R5GA 1GAOA 4DR6F 2COLA 3DOKB 4DCPB 4NYOA 5C25B 4N5SA 2EFGA 3CDBA 3VWSA 3A8JA 4EI2A 3UDCA 2MGZB 2OGUA 1YJRA 1FJEB 3AHPA 3CCMS 2G4BA 1N5VA 1YK9A 1NJXA 2NLWA 3OHAA 5LMUJ 4P7TA 4WJBA 2CG8A 2Y1LB 4K5SA 4EEYA 3UDLA 2AYBA 1AZSB 1ZPVA 1R3NA 5CXTA 2HEKA 1DQ8A 3F0NA 2DY9A 2HVHA 3FEYB 1TL4A 2HRTA 3EUNA 1T9UA 5HO4A 1QDUB 1VLYA 1OY8A 3P96A 4AQYJ 4NZ6A 4LF7F 2J7WA 1JLFB 2CJAA 2VPZB 4F0HA 2WZ1A 2IC3B 2M8HA 2RUSA 4IG0A 3OBIA 2B8PA 4N8OA 5J2NA 3M8WA 4KHPF 3L7PA 2JNJA 3FBEA 5D0RA 1KLMB 3WC2A 3K17A 3B4DA 1JLQB 2DT9A 1NO8A 3MFIA 1VQ5S 1JLGA 3HF5A 4LF9J 1FD8A 4NZ0A 4L73A 4WF9Q 2I0XA 4CO1A 2ZVIA 2D3OR 1XMBA 4RNNA 1Z1ZA 3CJTA 1YRUA 2HHVA 3PG9A 2EG2A 4E98A 2XMJA 2Z30B 4OYMA 3DLKB 4FP9A 4ECTA 2GMJA 2JVRA 2Q6BA 3TZZA 2XS7A 1Q4RA 4JV2A 2B6AA 3ETMA 1YZ6A 1S49A 2BA9A 3DLGB 1WF2A 4RX6A 2OD4A 2PMHA 2I6WA 2WONB 1Q1KA 4AYBD 1AUDA 4PUOA 2OEJA 3QT5A 5HI7A 2Q43A 2YWFA 4DLEA 1NK8A 4LMZA 5KFVA 2OSRA 2YWKA 3M6WA 2E9RX 1WI8A 2VPYB 4I7FA 4CLLA 4ZP9A 4DV3F 1WDTA 3FRZA 4JI8F 3GWCA 4JP8A 2NXNA 2OHDA 1UVJA 1RWNB 2OPRB 4HT7A 2DRAA 1NU4A 1N0UA 2MZSA 2RHSB 4J91A 2ZE2A 4LJMA 3UD3P 3W7BA 3AXMA 3JSBA 1N5SA 2YY3A 4Z7YA 3MZIA 1SH0A 1Y11A 2DY1A 1NDLA 2HNYA 3IC1A 5DDPC 1AFJA 2UV8G 3KLHB 1N32J 3PY8A 1WHYA 4A8QA 1VBYA 2LEBA 2H5JB 2RS8A 2IBOA 1R8AA 1NJYA 1RT5A 4LBHA 4C3LA 3UD4P 2WBRA 2DHHA 4J7CA 3THPA 3IBWA 1S1VB 3SYZA 3J7Z5 2GO9A 3AD8C 4LFAJ 2W2MP 3RAQA 3KJNB 4B3TF 1RB0A 3CJQA 5EUHA 2Y9HA 2YKPA 2H4YB 3MEDA 3MTJA 3Q86A 3AJDA 3BYPA 3QYYA 4ZVSB 4ES1A 4FF3A 1DRZA 5J2MA 1URNA 3P8BB 2LKZA 4L75A 2AYMA 1SKSA 3C8YA 3NBPA 2N82B 4MJKA 4HVZA 4R0EA 4X2BA 3CD7A 3PW7A 2RDJA 3LAKA 4PABA 3VAJA 2I1RA 3KLHA 4EUVA 2AD9A 1N32F 2WVEA 2NSBA 2D1CA 3IBCB 2J9DE 3DRXA 5ETRA 5JJBA 3GIIA 4H4MA 2AYGA 2OH2A 2VC0A 3Q22A 1RT2B 4LVNP 3RG6A 3U1LA 3ZZRA 3CT9A 4DX8H 1RWXB 4TQSA 4F4ZA 4BS2A 1OMSA 1MMNA 1NMEB 3DLJA 1N36F 1UPMB 2DR7A 2W25A 7FDRA 4K4WA 1R27B 2JVOA 2YWHA 2CWXA 3LQVA 2RU9A 3UI3A 2KXNB 4TY9A 3FMBA 4TVAB 3Q8UA 3BN4A 1JLEA 1V9OA 1WG1A 2ZHOA 4ZLJA 2Y8WA 4NLVA 2PA3A 4YEAA 1TKZA 1FDDA 2WBMA 3NLCA 4ELUA 1OIAA 2EWHA 3JYTB 3G8SA 5EWGA 5B0AA 3QFHA 4ELTA 4X65J 2OMLA 1R7IA 3M8ZA 1N48A 4Y2IA 4NA3A 5T14A 2E1PA 2AP6A 4UOCA 2MPUA 4MH8A 3KLIA 4CYUB 2DXDA 4ZCIA 4HACB 1IQZA 3R97A 2X1BA 3UCZP 2IA6A 1Y10A 2BJ8A 3T1YJ 4YOEA 1KLMA 4PRFA 4PQUB 2PEBA 1Y5IB 2B4OA 3FC9A 1FWPA 4ENOA 3G6XA 2UXBF 2CJ9A 2LA6A 2OPSA 4OLPA 3CCQS 1FRMA 3HHLB 4ILLA 4YDDB 3HKZD 4OZ2A 4HHUA 4PG5A 5HANA 2GA7A 2QYGA 4FKXA 4QIEA 4CLSA 1JLEB 3L4BC 4DSEA 3ZNUA 3HMJG 4M5NA 2QA2A 4YY3J 1HQEA 1PSDA 2IIHA 3GCXP 4RKUC 3BF4A 3VF0B 2UUWA 5JVGQ 3QGHA 4TN2A 4CLYA 4CO3A 2HVEA 2OEMA 2CZ9A 2V8DA 5B0EA 3ET6B 3EXCX 4DX5A 1UZDA 3OR2A 1RBOB 3HD1A 2DEJA 5F8MA 2I2YA 2W2NP 1PYOB 4PG8A 1RBAA 2E5LF 3MM6B 1O8BA 1LEOA 3AJ2A 3NS7B 3W2VA 4I69A 2EEYA 5E5NA 4EWTA 2XGQA 2M7SA 1L5UA 1TUGB 2H9ZA 2VPXB 3TAQA 5KG4A 1EX8A 3CIZA 1Q5VA 4ZN1A 1Q82T 2YQ0A 2MTLA 2AJFE 5EWEA 4DR6J 2UU9F 4P10A 1B99A 2CPHA 2KT5A 2JLGA 3ENWA 1ZH5A 1SC3B 2R2UA 2R7XA 2BKNA 4OQJA 2JEJA 3IG1B 1M5KC 4HTIA 4DV2J 1NPRA 5DLFA 1YJVA 2DHSA 3ILIA 5HROA 5CYMA 2J7KA 5KAKA 2RQCA 4IFYB 4P9SA 3CCRS 3X1LB 1IR2A 3F44A 1KVIA 3CD5A 5LMUF 2K3KA 3ULHA 2B3TB 1ZTTA 1F9EB 2UUAJ 2VBWA 1RA6A 4CLTA 4DV0J 1T03B 2DNMA 4KR0B 2DEIA 4KPCA 2RF2B 2VJVA 1OY9A 5H9EK 4X62J 2LECA 1RISA 4PG6A 4DEZA 4ZLNA 2CQHA 5CH7B 1T0TV 2AEFA 2HQGA 4Y2CA 4ZN3A 4RL1A 5B0GA 2UU9J 3NOCA 3FSXA 2Z8QA 1ROFA 3JXOA 2J8SA 1JKHA 1FWKA 2BKPA 3CCTA 3PVXA 1IN0A 2HNZA 3CDAA 4YB5A 4ZPVR 1V5VA 1KP6A 1U1PA 4ILMA 4IH5A 1RAEB 2C3YA 1MN7A 3W1YC 2ASLA 4K2JA 5KG5A 1SC6A 3MMCA 2QLJB 1J2VA 4RJVA 4RLEA 5IC6B 5L9NA 5I3PA 4BWMA 2MJNA 2ACYA 2E66A 3NEKA 4CCHA 1MW7A 2VDIA 2BYCA 2FVQA 4MIWA 3WX4A 7AT1B 4IG0B 4XPCA 3NG8A 4HH0A 1S6PB 2R4FA 5KT7A 3HO1A 2AYEA 4XK8C 5BR8F 2VKRA 4LF4J 3KUGA 1HPZB 4CT9A 3JSMB 4G1IA 3M8QB 4C98A 4USWA 2VC1A 1XC9A 4A8WA 2CQCA 3BQ1A 5AJ3F 1XMQF 4ZVOB 1LOUA 4LQ3A 4DCJB 2RNEA 2HFVA 1VQLS 2HS0A 1LWFA 1V3RA 2CIMA 3PRVA 1KR4A 3EGNA 4KT0C 3SXLA 4MYTA 2HWIA 5BYSA 3PHEA 1WHVA 4XPEA 5IWAF 2CYYA 2XCPA 1FKAF 4K4ZA 2HHQA 5D78A 1ZS6A 3G8TA 5F3TA 3BQ2A 2GJFA 2QMXA 3AXKA 2VFTA 3OSNA 3MUVP 1HWLA 5KT6A 3PZPA 1PC5A 2CXEA 2HBQB 1R43A 5I3UA 2CQ0A 2QE5A 3RGIA 2HURA 3IN5A 1PJ5A 3NP5A 1HBOA 1KHWA 2QA1A 1KOHA 3QIPB 3MPWA 3N0VA 2KFZA 1SJ1A 5AT1B 3D7SB 2HAIA 2KDOA 5DQGA 5F8HA 2R8HA 4DV3J 4WZQA 3D66A 1R8PA 4DI6A 2VV5A 2MQ8A 1AUSL 2WTFA 1IKWB 2BKOA 2HHWA 4DV5J 1BQMA 4RU2A 3D0IE 2G2OA 3TNVA 4YHHF 4DFJA 4N41A 1LW0B 2BW7A 4O0NA 1GH8A 3CIMA 2GV1A 3SZ2A 3LTOA 4JYAJ 2QX0A 1S5ZA 4F3MA 1RTDA 2M2BA 1UVNA 3VALA 2F4FA 3JTOA 1RSCA 3OXGA 4KYZA 5KG2A 5LSOA 3IGNA 2IDLA 2MXYA 4Z7CA 4ES2A 2ALYB 2N7CA 2E1AA 1TV6B 4CLKA 3ZZUA 2ZM6J 4J9KA 2UXBJ 1IR0A 1S4FA 4J9VA 2FJVA 5C5JA 4LVOP 3ENVA 2WVFA 3MM5A 2FHOB 2YNIA 2UUBJ 1XNQJ 2N4CA 3HVTB 4CO5A 4NCGA 2XS5A 2V63A 2N3OA 1FE0A 3HHEA 3FJ2A 4KBIA 2IAJA 1KN6A 2G9OA 5CABA 2B5JB 1NK9A 2LVWA 4QYRA 5GAHU 3QRQA 1X4BA 3KJVA 1NDKA 4KH0B 1MMLA 4IH7A 2NPIA 4CT8A 1RHMB 1EETB 1Y0HA 3D9BA 3BPDA 4DQIA 4ETZA 3MI7X 1HBOB 4LFBF 4C11A 3RW7A 4OYIA 3AAWB 3RZAA 4DR2F 2O66A 1R31A 1HNXJ 2BANB 1F5BA 3N01A 2V94A 3A3NB 1PYTA 2MHNA 3GSIA 3G6ES 5K14B 1TELA 2XZWA 4OX6A 2HQIA 3DNCA 4P2FA 3TUIC 3OVBA 1S7HA 1MLAA 4RW8B 4M94A 1JLBB 2V67A 4D3HA 1S10A 2NREA 3PV8A 1PAUB 3KDOA 4I6YA 2GHVC 1Q7YT 2IJFA 1GTHA 1NB2A 3MCSA 4LSLB 3TANA 1VQMS 2AQ4A 4DSKA 1SJQA 4KGVB 5ETOA 3KK3B 2GGPB 4OLOA 1O0PA 1TMMA 1UJ4A 4KTQA 2CKWA 3R9LA 5KOXA 4EMDA 3QNWB 2YX1A 5LSRA 2UXCF 1WKLA 3DLLQ 1JJ4A 4DR4J 3DXBA 3M2VB 2WW4A 4KIAA 4LBPA 3SEOA 5DM6Q 1U8WA 2HHPA 3DU6A 5T7LB 1LWCB 2HVDA 4ICLB 1YQHA 2B51A 1ZAXA 2IMWP 2ZC3A 3KK1B 2J6SA 1S76D 2XSFA 5CZXA 2K7KA 1CLFA 4DFKA 4WE1A 2ACMA 2H5IB 1MWYA 1FTRA 2MZJA 1MU2A 4O4GA 3LANA 3C16B 1LW2B 4O3NA 1XNRJ 3BM7A 3KLVA 2H4WB 2B4PA 2FVRA 2Q6CA 1TL7B 1SQGA 5SZTA 2UXDF 4J9LA 4IR1A 3M6VA 2LXIA 1F6TA 5KFXA 2C22A 2X1AA 5IOLA 2FGOA 4WBFA 5HBMB 4DR5J 3UR0A 3K0JA 4M5MA 4R25A 1BQNA 2IJNA 3ZZTA 4RW6A 8RUCA 3J7YI 3OSPA 5KT3A 4OJ1A 4YP3A 3SCKE 1Q5YA 2BR0A 3LP0B 1TU0B 2J6TA 2HHHF 1VQ7S 1XMOJ 1PC4A 1RAIB 4IRDA 1I1GA 4WFNQ 1VBXA 2V0NA 2GGPA 3AA9A 5HJXA 4BLGA 2YNFB 5LM7E 2PE8A 5T7LA 2LQ8A 3M8YA 2IA0A 3TW0A
chains in the Genus database with same CATH topology
1QVFR 1ZETA 4NA2A 5DDRC 1S97A 2ZH7A 1J5OB 3SQGB 4DL7A 1JLAB 4NLPA 3V5RA 2DGOA 3IXQA 3EPIA 3BDPA 1IQTA 5IM0B 2VUGA 4K4VA 2QRRA 1M0SA 3HDSA 4OI6A 4ILMA 3TO8A 4RBVA 2VKZG 2MQPA 1WHWA 1AROP 3DXSX 5F41A 5J1NA 1VQ8S 1LFWA 3DC2A 2ZBCA 1UA1A 1D0EA 5EN1A 2BANA 4LF4F 1JLFA 5IQQA 2CRLA 3PR5B 2G0CA 4R0JA 1C1CB 3MOZA 2RKIA 2VG6A 3PRBA 5A0YA 3FMWA 4I2PA 1WG4A 1YRTA 4FNHA 2NUHA 1J5OA 2B56A 1QUVA 3HHNB 4C7QA 3GV7B 3GFZA 1IJEB 1N6QA 5AXMA 5DG7A 1DQ9A 3BR9A 3K5OA 3GFYA 2IBKA 1AXQA 3KWMA 4BHQA 2ZH6A 4DHVA 1NB7A 2AF6A 3B78A 3H2VE 4PPZA 3MHYA 1FTCA 1YJNS 3UE2A 3QLHB 3RR7A 4V19J 1QSSA 4ED8A 3PACA 3RAMA 2R7WA 1QE1A 4F67A 4KV8B 3CCJS 3SCIE 5E33A 4ED5A 3D28A 2R8JA 1FRHA 4Z37A 1DFDA 1N8RT 1JXEA 1S48A 2I8EA 2YVSA 4EO8A 5F8LA 1P9QC 2KN4A 5BJRA 2G13A 1VK3A 4URGA 2LDYA 4M5DB 4KKOA 5IS2A 1MSWD 1WELA 2HHUA 2NR0A 2DD8S 2IVYA 4XIUA 1RTDB 1OQ6A 3M9NB 5JXSA 3M2RB 2I9SA 3QGIA 5KFIA 2QT7A 4B3OA 2DIUA 1LWCA 5DGAA 2LXFA 3MAHA 2RE1A 3CULA 1XEZA 2GC8A 1Q8IA 5KFDA 2P6TA 1B0TA 2YQ3A 3PR4A 1WF0A 1WNEA 2HWTA 4QWAA 4WZMA 1HWIA 4YUDA 4DQRA 2HNYB 3E01A 4DL2A 1SJFA 5CYQB 4JYAF 2CVIA 5G4DA 1C0TB 2LXUA 4K4XA 3CSKA 2DGTA 3GIMA 1UEVA 1LXNA 2FC8A 2HS3A 1FXDA 3GSDA 4LF5F 3J81Y 2VASA 1S1XB 2F9DA 2YKOA 3UPFA 2DR9A 4NCBA 1DHMA 4ECXA 1RT5B 2HNDA 3OHBA 1VQ9S 3A8EA 3I55S 3V4IB 3V6DA 4OX9F 2XY7A 4F4XA 5I42A 2EG1A 1TZ0A 2KXHA 3MD1A 5H1SV 1LWFB 3M8SA 3E3XA 2W8LA 2KVIA 5I3UB 1BGXT 4DL4A 2P9GA 1DBDA 3ZZRA 2N7CA 4QIVA 3Q22A 2U1AA 1YHQS 2YKNB 4QIWD 4HI2A 2ASDA 2FLLA 4B9TA 1HHSA 6FD1A 3M8QA 1HI1A 3B4MA 3DU5A 3I82A 2ZJPQ 4F02A 1FO1A 2FD2A 1H2VZ 1X5TA 4A46A 3TR5A 2DNNA 3KJVB 4MK8A 2EW9A 3MEKA 3CD0A 4LFCF 3CDWA 3E01B 2YNGB 5D4LA 3RR8A 3H25A 2D3ZA 3T9ZA 1C2PA 3ITHB 2MZ1A 4WIIA 2IYGA 1Y5NB 3M32A 2VD3A 2IC3A 2DIVA 2OPPA 4HL9A 4OI2A 1U45A 1HNZF 4C9DA 2BVZA 1P1TA 4B3SF 4JI6F 1D3WA 1FDAA 4WFXA 4DL6A 3RB0A 4O3PA 2ZBIA 3QAUA 4ZVFA 5LL6d 1C0UB 1ZM3A 3GZ7A 4LSNA 4Y65A 3TP2A 3FZBA 2EBGA 2ZH2A 3VR1A 5KFMA 1JX4A 2XSJA 2MB0B 2PMZD 2DBBA 3T1HF 4NOHA 2GX8A 1FRXA 2NXUA 4RUAA 1Y3JA 4OL8A 2HHTA 4ZPTR 2DRBA 1SUQB 1X0PA 1E6VB 4QWCA 1F5AA 2A2CA