4IOCF

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4iocF00
3CCMI 4V19K 2OTJI 1VQKI 2JQ7A 2QEXI 1QA6A 5GAHJ 1ACIA 1VQ6I 3CCLI 3CMEI 3CMAI 1YITI 2ZJRF 1YJ9I 5GAGJ 1FOYA 3CC4I 1VQPI 3CF5F 3J7ZI 3CCQI 1VQ4I 2E34A 3G71I 2E36A 2ZJQF 1YI2I 1VQNI 1YJNI 3CCJI 2ZJPF 1S72I 3CCRI 5DM7F 1VQ8I 3CC7I 3PIPF 4IOCF 3CD6I 1YJWI 1YHQI 3G4SI 3G6EI 1FOWA 5GADJ 3CC2I 1YIJI 3DLLF 2K3FA 1VQOI 5GAEJ 1VQMI 2E35A 1VQ5I 4IOAF 3CCUI 2H8WA 3CCEI 3CCSI 3CJTB 4IO9F 3I56I 1Y39A 4UY8I 3PIOF 1MMSA 1HC8A 2OTLI 1VQLI 5DM6F 3CCVI 2QA4I 1VQ9I 2FOWA 1FOXA 1VQ7I 3I55I 3J7YJ 5JVGF 2NXNB
chains in the Genus database with same CATH superfamily
2M87A 4IPAA 4F3QA 4A0XA 3S1QJ 4CCMA 2HR3A 4RS8A 3OYAA 2UZKA 2A5YB 2DU9A 3LAPA 4IRGA 2COBA 2CFXA 1R22A 4HPQA 4XKCA 2ME6A 1U3EM 1FMWA 5EG0B 2GIVA 4CH7A 2KRCA 3HRSA 1WVRA 4HQEA 3MN2A 4I99C 4AVPA 3GO5A 1ZGWA 2ISZA 2JWTA 3OYCA 3FXKA 2HU9A 2MG4A 2HQAA 2RC4A 3OYMA 4CDGA 2HYFA 1JE8A 2V9VA 1WJAA 2ID6A 3RZOJ 1H9TA 2ZSIB 2CQKA 3TW6A 1QQIA 3BG7A 4NNJA 3S1NJ 3B02A 1YG2A 3BZKA 3FKIJ 3BTJA 1VQPI 1XG1A 2ZO4A 3JRFA 3F22A 2DCEA 3CCQI 3BG3A 2A07F 4KJZA 2HOEA 2CUZA 1MMAA 2X6WA 4CZZA 1CF7B 1TP4A 3C7JA 3IWFA 1IN4A 3K6GA 4Y7NJ 1UG0A 3MEXA 4A12A 3CUQB 1T08B 1T6SA 1YI2I 1HKQA 4M3EA 2M8GX 1G6NA 4KIGA 1RETA 2QYOA 1IN6A 4PZJA 1AKHB 3IRQA 5IT3A 5DD8A 1Z21A 4RBOA 2ISYA 1R00A 4F91B 1YRNA 3F6OA 3G2BA 1I1SA 1XDSA 4XOPA 4ON0A 3KIOA 1FIPA 2VKVA 4OOIA 2ACJA 3JSOA 2R92J 2L7KA 3DBRB 1JT6A 2VASA 1T8IA 1MH4A 2FE3A 2I5UA 2XVCA 3CC2I 1H8AC 2IS1A 1WGXA 5EG0A 3I64A 1R49A 1ITYA 3SYTA 3GZ5A 5KNLA 3KP6A 3K2ZA 2ZCWA 2Y48A 3FMRA 1ZG1A 4PJMA 2ZMEC 3ABTA 4I0BA 3IUOA 1LDJA 2XB0X 4BH9A 2M45A 3R60A 2F6CA 3OYDA 3L2VA 2H8WA 2KPMA 1O7FA 2UV1A 4PFPA 3KETA 3ZOBA 2B0LA 2BY2A 2HS5A 4R79A 2DYSH 1PJRA 4LK0F 4BE0A 3FK6A 1XDUA 2X1EA 1K4TA 1HXDA 5EZGA 3FMSA 3LQRA 3CCVI 1MW7A 3V8LA 4MGRA 3FM5A 2R7FA 3HJEA 2GA2A 2AXLA 2F5FA 3I55I 3J7YJ 1CF7A 1ULYA 1TNTA 4RMNA 1GUUA 3ZPLA 1X4PA 2YS9A 3QP5A 5IYCJ 1J59A 4UXNA 1SFEA 2XKOA 3CUQA 2L9VA 4I2OA 2E2JJ 2QLZA 3HGYA 2JQ7A 2V1NA 3U1DA 4XSZF 5ILUA 1AKHA 3C2HA 5J8FA 1P7JA 5FLXZ 1FYMA 4ZTFA 2DMUA 2IJLA 4BNCA 3OYBA 4Y52J 2FQ4A 4C3JJ 4KNYA 1DQUA 3CF2A 5FGMA 3H35A 3BG5A 4V2GA 5JI6A 1O3SA 3GXOA 2H94A 3D5RC 4I01A 3RKQA 3PO3J 2LP0A 1A31A 5EJCA 1V3FA 1FSEA 4XICA 1KU3A 3A0BC 5K7HA 1B8IB 4CGZA 1U5TC 3WE2A 4BACA 1B72B 2DTRA 3CLOA 2K4BA 4EM1A 2O8KA 3NWSA 3GZNB 1RUNA 1TQIA 2KDZA 4U0YA 2OJED 2B9SA 1ZKGA 3G3ZA 5DCMB 1YJNI 1OFCX 1WJFA 2NS7A 2E2HJ 2DDBA 1JJ8C 2HEOA 4HV5A 2IVMA 2YR2A 1XCBA 3ZMSA 3WGHA 4M6XA 4YG2F 1VQ8I 4HAMA 4EJTA 2X9DA 4LJZF 3GCMA 3EUKL 4QIWN 2R93J 3KLNA 5D6FA 1RESA 3VWBA 1LFUP 1WRJA 4LD5A 2Q2EB 4DJAA 3OOPA 5E3NA 2CV2A 1OCZH 2QSHX 2EH3A 4XLFA 1HOMA 1CQTA 1IN7A 4LFUA 2O3FA 3HHHA 3RYPA 1Z9CA 2V26A 3LSKA 1D1CA 3V8KA 1JT0A 1ETQA 1Y0UA 2XKPA 4AIJA 2IPQX 1R5HA 4EQQA 4IOAF 4CYDA 2WA0A 3V7RA 3WHBA 3I56I 2NS0A 2DW4A 1SFKA 4J00A 1N78A 1P6RA 1S6LA 2KIMA 3S1MJ 4A3CJ 3ECHA 2MGQA 4IVNA 3D5LA 4BEHB 1K7AA 4S05A 2X1DA 1RIOH 5H2FC 3J81Z 1B8IA 3DKYA 2HKOA 3HOYJ 3HKZN 2VQGA 4JQFA 4NQWB 3N4MA 2COMA 4DBRA 1B72A 3MKYB 4A69C 3W6VA 3E5QA 3FXJA 2B63J 1MBFA 1HCRA 5CYVA 1I27A 2G9WA 3REOA 5BMZA 4IHTA 5DCMA 4M3GA 1WI3A 4KMUX 2L9SA 4FE7A 3O8HA 5F08A 1JI8A 4AYBN 3PM1A 5DEQA 2CQXA 2XGDA 2Y75A 3BTIA 2L3DA 2Q1ZB 1XC5A 2JPCA 2YX4A 3GTOJ 3HKZA 3QODA 2E7XA 2W4SA 2RREA 3TOBA 1H88C 3HUGB 1FP1D 3H3UA 3IAS2 4L18B 2JA8J 4IJAA 4E7IA 2Q2EA 2W48A 1UZCA 2NYXA 1F4KA 5J1RA 3EQLF 5ILSA 4GGGA 5M3MJ 2N8GA 5GAGJ 2DAOA 3I71A 4BY1J 2H1KA 1TQPA 2PBIA 2DA7A 5J40A 1PUEE 1R71A 3OS2A 1ZHFA 3CESA 4ITVA 3I4MJ 4LITA 1OCCH 1GHCA 5BNGA 5HLGA 1QZEA 4A93J 3GX4X 1IUFA 4ZDLA 1VQNI 5L3GA 1Z67A 1KQ0A 1LE8B 2IGNA 2PMZN 1LFBA 5DYMA 3ERED 1OCOH 4BEHA 3IL2A 2KRFA 3IAM2 4IL6C 3C2BA 3P9KA 2DPDA 2BXZA 2VBZA 3S2HJ 1FJLA 1YX3A 1LFPA 2ZFWA 3HL2A 4LLLA 2VKHA 2YPRA 3A1YA 3ABLH 1BJAA 3WU0A 1UJ8A 3ABMH 2WBMA 3K69A 4W97A 1LQ1A 3GW2A 1FBUA 3ASOH 3FXOA 5GADJ 2BW3A 2LRDA 1LB2A 4UUTA 1OCPA 3K70C 3KZIC 4JBAA 4HF2A 2P0WA 2M0MA 1TT5B 3HUGA 4F93B 4XONA 3RQIA 2OU2A 1B4AA 2O0YA 5LLQA 3CJTB 3PUFA 3GFIA 1X1DA 3KEYA 4YFXF 5CQEA 3J7AY 1J0RA 5TGTA 3LSRA 2CSOA 5D5XB 2EIJH 4U7BA 3DKXA 3JW4A 1A6QA 3J7AO 3LFKA 3LMMA 2LOOA 1JXSA 3CZ6A 2YSRA 3TKYA 3AL0B 1J7KA 3QPHA 2MSYA 4DIQA 4I0AA 2AO9A 3DXJF 2IS4A 3DBLB 3HBLA 4QTRA 4PDKA 1FOXA 6PAXA 2EFQA 4RB0A 1LUJB 1ZK8A 3WODF 5LGUA 1H89C 2M8EA 5A2QK 5B3SH 5GPAA 1GT0C 3PFYA 1Y1VJ 3DPLC 1OR7A 2ID3A 4V2FA 3GFMA 4XKWA 1OMIA 3H0GJ 2QQAA 4XLPF 1MMDA 3LSTA 2ZXJA 3K10A 3OL3A 4PGGA 4RM3A 4EEFG 1LE8A 3WU2C 4CA0A 4Q4ZF 1IV6A 1ZLKA 2KT0A 3IV5A 3ZQLA 5BPIA 2EA4A 2P4WA 2QKMB 5A2QZ 3S2WA 4PSXA 4PK4A 2L01A 3DFGA 4NC6A 2F2EA 5AIPA 1XGSA 5KAFC 2IXSA 5JR3A 2LY1A 2NAZA 2KQRA 5J4YA 4XLNF 1SC7A 1VF9A 4IF4A 2JMWA 1IG7A 3M4OJ 2R5ZB 1U8BA 2P5VA 2WTEA 2E60A 5J1UA 2F4IA 3WTTC 1R5ID 3OS0A 5LBQA 3J7ZI 9ANTA 1YOVB 2K9SA 2F4MB 5L3FA 2XUBA 1XGMA 4ENJA 1U2WA 1ZAOA 4R1HA 3SXYA 4F7ZA 1W1WE 2G7HA 2WV0A 2LTPA 2VQHA 3K1NA 4OMZA 3KPHA 2VC0A 1YLFA 4XR6A 1UHWA 1LVKA 2RN7A 1BR2A 2M30A 1NG6A 2FA5A 3CMYA 3JR9A 2DDAA 4KA4A 1OQYA 3SZTA 3UNGC 2DJIA 4Y3OA 1IRZA 2C6YA 2EJRA 1V54H 1XGOA 1HA8A 1OJLA 1HKSA 5CVVA 3WG7H 2I8DA 1Z7UA 3EYYA 3BJ6A 3KZZA 4FQGA 2PEXA 1BN5A 2M5WA 4KN4X 3GZ6A 1FOWA 2FNPA 3ZQIA 4HDUA 2LVSA 1NTCA 2A5WA 4PJ0C 5F0HA 3SEQA 2OBPA 1RPWA 2GOMA 3K4JA 1K6OA 3DKWA 1F1ZA 1Z05A 1ETYA 4BXUA 2BY3A 4BQQA 3CCSI 2OCCH 3A0HC 1YW8A 2GIZA 3HTSB 1E0EA 1ZGJA 1JJ6C 3RQ4A 1JKRC 2R5ZA 1ONVA 2HDWA 5E1XA 3SZGA 4XRMA 5GP9A 4CXFA 3CO7C 5FKMA 5EGOB 4XK4A 4B44A 3CP2A 3QPSA 2FEZA 3OYNA 4WXCA 1I3QJ 2M7BA 2MC3A 3PNYA 2MYSA 3H5RA 3V4GA 3W2VA 3M8JA 2CV0A 1VQ7I 3MZYA 2ZB9A 2HQNA 4JX5A 4YRVA 3H9QA 4A3DJ 1H9GA 1S3JA 3H3ZA 4ZYEA 4MQ9F 4FE4A 5GTHC 3TO7A 4D0PA 4HF0A 1ETVA 4M74A 2LH9A 3QQAA 2Z1DA 2X6OA 1TWCJ 2E1NA 2W24A 4M73A 5F27A 5IYDJ 1MJBA 4FHTA 3OY9A 1HW5A 2Z5UA 4XKVA 4FETA 5GAHJ 1UELB 2O7OA 4ZH4F 2IBDA 1G3SA 3N05A 1YE9A 1VNDA 1WKMA 2XGCA 3LSGA 1FOKA 1X1BA 2X1CA 2VKDA 2XPUA 5ED4A 3BOQA 2Z33A 1U6GA 3ML6A 1ETWA 2CO5A 4X6AJ 1FIAA 2L9NA 3PSFA 2MC4A 4Y33A 1ETOA 4EM2A 2DT7B 1FBSA 2ZC2A 3F8MA 3Q0UA 1QNTA 2EV6A 1B59A 3CF5F 2RAEA 1WWXA 4MTEA 4JX6A 1K61A 3H92A 1IGNA 4P55A 1XMKA 4LB5A 4IKFA 4XIDA 2STTA 1P4WA 2R7XA 4U7DA 2JA6J 1JUPA 1R4MB 4M3FA 2FX0A 2XAQA 3BP8A 4ZYGA 5BPDA 1F5TA 3SFIA 2NS8A 2DOEA 3OIPA 1HDDC 3RPQA 2XGXA 3MQ0A 3M7GA 2WC2A 1MBGA 1RKTA 3NAUA 3DTIA 2IW5A 2TCTA 2H09A 2JVGA 2BY1A 2KJCA 2JTVA 3EUAA 2NOJB 1IJWC 3JAMZ 4ABZA 3MZHA 2M1BA 4I6ZA 2D5VA 1FTZA 3QU6A 5EF6A 4L9NA 4L0YB 3ZMUA 4BJ5C 1YIJI 1TTYA 2EV0A 2VXDA 1U0JA 2P7VB 3BCBA 4UNOA 3S14J 2IGOA 3I53A 3L2QA 2JJ7A 2K9MA 4AC0A 4ANJA 1SFUA 4E7KA 2CUJA 4XLEA 4D1QA 2EFNA 1MBKA 4PFOA 1QGPA 2DODA 3P9IA 1D0YA 5LRSA 5M5WJ 2VQLA 3BZ6A 2XV4S 3F21A 2CWEA 1BR1A 1F36A 2EIMH 1U9OA 5HS7A 1D8JA 2DTZA 1I3AA 1HW2A 2E1CA 4BQNA 2PJRB 2L02A 5FO5A 3VSLA 5TJJA 3S1RJ 4A3GJ 2DA4A 2FOKA 2M9HA 2YX7A 5GPCA 1D3YA 4WK8F 2Q8KA 4BXXJ 3TDZC 1AHDP 2WAEA 1FZPB 4HW0A 1MMGA 4OIOF 4P9UA 2BV6A 5ERIA 1HBXG 1T2KA 3Q9VA 4ASNA 2E1MC 1T38A 2ETHA 3D1NI 5IPAA 1IN5A 3ELKA 4BY7J 3A02A 1PP7U 2NNNA 3O6BB 1P92A 3K4BA 4N0BA 4I09A 2LSOA 3WTXC 4E7JA 1F43A 2J5PA 3G1LA 3CCLI 2XAFA 4PUSA 4GRIA 2HDDA 1BM9A 2HWVA 1O3QA 2XSJC 2HOSA 2CUEA 4MEXF 3AKZA 1ZN2A 5CKTA 1PVEA 3OL4A 1S8NA 1XS9A 5IT9Z 3LL7A 3IH3A 4NB5A 1I1GA 4QLCU 1IXCA 3BROA 3ZP5A 1ZR2A 1AWCA 2VUMJ 1IDZA 3F72A 1MDMB 1XD7A 2O5RA 2MH9A 2MD0A 5AIQA 4P1WA 3PL8A 2FBHA 4LOCA 1QPIA 3I5UA 3VDXA 3K7AJ 4LG3A 2QCOA 3CLQA 4N4OB 3P7NA 4BE2A 3OS1A 1HKTA 1LNWA 1DDNA 3E6CC 1Z91A 1Z6RA 2F5CA 4A0ZA 5DM7F 3BR2A 3TEDA 4WF2A 3H1CA 3KLOA 2IGMA 3VYUB 2A3SA 3BR0A 1J9IA 3CO6C 3FX3A 3LSIA 2KKOA 3ZMDA 1X2NA 3BWGA 4CCNA 2MLGA 4RGXA 2FU4A 4LK1F 5IP7J 1B6AA 5K7FA 3G6EI 2V6EA 4E4HA 1T0FC 5IP9J 1P9QC 2W7NA 1K6YA 1DPUA 2FJ1A 2XASA 2RNGA 2IT0A 1IV8A 3A4CA 1DPRA 2EINH 4OAZA 3KP3A 5JLXA 1D1BA 2NVUB 3RI4A 3HOWJ 3DP7A 2LBFB 4D7MA 4P9FA 2KRHA 2FSWA 4RB1A 2GLOA 4LMYA 4IZZA 1T56A 2JN6A 2VJJA 2K7LA 4B43A 4KDPA 4G94A 2XAUA 1GV5A 5J4VA 3JREA 3I4NJ 3EUHA 4EJVA 2EZKA 2XF5A 2R7WA 2EPFA 4B09A 5FKLA 4CCKA 4EATA 3IC7A 1V5GA 2LKSA 1E3OC 1FYLA 1EJ9A 2V9KA 3KP7A 2QBYB 2NXNB 3S93A 2CFOA 4RAYA 1MDMA 1V4RA 2UXXA 4C9YA 5HVQC 2Z9OA 1EF4A 4M3BA 5CVJA 1W0TA 5D6EA 2DK5A 2HNHA 1D0XA 4WWCA 3S3OA 1ZLJA 1OLTA 3IRRA 1BI2A 2QEXI 2VT2A 2GAUA 5LGNA 3TP3A 1XMAA 2M2EA 4OIRF 3F8FA 2QWWA 1VQ6I 3SHFA 4JK1X 2KZVA 4N4NB 2ZNZA 5IOZA 2E7WA 4DW6A 5J47A 1O4XA 1I6HJ 1GDTA 3E5UA 4DYQA 2F48A 2RVCA 3OV8A 4XOTA 1I39A 1RI7A 3OWTA 2LC2A 1ORKA 1X4OA 1ENHA 2D1VA 2D2WA 2XGEA 2BHYA 3GFJA 5CLSA 4CYCB 3ZRGA 3MKWB 3SJMA 4C2UA 1WJBA 3H9JA 3TMOA 2WAFA 1BL0A 2UWMA 1OISA 3W2WA 5HLIA 2VQCA 1POGA 2A68F 3PNTA 4BQAA 4HX7A 2LBFA 4NBQA 4ZYDA 3TBIA 1ZREA 1R7JA 1C0WA 3R6SA 2GXGA 5CVRA 2ZXWH 1YO5C 2E36A 1I6XA 3DLAA 5KAIC 2QSFX 4BGDA 1IN8A 3L1PA 3D5SC 3K4CA 4A5NA 3W3CA 3K0LA 5TRDA 2QM3A 2DQLA 3CJQB 2BOLA 2DO7A 1EH8A 3GVAA 5CJ9A 3ZGKA 2NVYJ 4DZPA 2BZTA 1ZH5A 2XRLA 1B9MA 2QBYA 2XAGA 3E6BA 2XRNA 4UV8A 3CD6I 1DU0A 3BJOA 1N25A 3G4SI 1ZTRA 3E0JB 3PSIA 2L9RA 2FBKA 3FHZA 3WTWC 3HM5A 3DLLF 2OA4A 4LIVA 5HNHA 3SDBA 4KITB 5GAEJ 5DDGA 3M3YJ 1D5VA 4L5JA 5E8GA 1JUMA 3I0TA 3BPXA 3OOUA 1BBYA 4KIBA 4ZZDA 2VLAA 4LGWA 4C2TA 1MBEA 1O7LA 1FBQA 4MIMA 3ZCOA 4OMYA 3DQVC 4UY8I 5FROA 1QZYA 2DFHA 3IHUA 4U0VA 4CYCA 3ROUA 5DTDA 4HRIA 3KCCA 4IHSA 2HGCA 4QSHA 4PJLA 4A3MJ 1ZG5A 2VC1A 3HRMA 4J01A 2Y9ZA 3LA3A 3TOAA 4BKXA 1R1TA 2AQFA 1D8KA 5L3EA 3VOEA 1LPQA 1FX7A 2OZUA 4L9VA 1MBJA 2LREA 3RPUD 2DA6A 1W5CC 4CUGA 5IOYA 3BJAA 4YIFA 3R61A 5F0CA 4HF1A 3DU6A 4NUBA 4F92B 2HOAA 3PO2J 1ETKA 4XLCA 3B73A 3QRFF 3Q9SA 2JK3A 4E7SA 3ERMA 1XMXA 2EFOA 1YFHA 4I02A 4YFNF 1UHSA 3RIRA 4HBLA 4A3FJ 2DMNA 1KU9A 5CQGA 2L2OA 2JSCA 2ZXHA 2VE8A 1TWGJ 1A5JA 3LQQA 5DCFA 3MFKA 4BUPA 1IRFA 3TW7A 1AA7A 2F5VA 1NK2P 1MSEC 3ABKH 3WE3A 2XHKA 2MA3A 2ZJ2A 3BZCA 5TISC 1X3ZB 4JX4A 3S16J 4L9JA 4UVBA 1BOBA 5AONA 2FNAA 3F9KA 5JLWA 4BXFA 2M7AA 3TP0A 1E3HA 2ZJPF 2H8RA 2V1XA 2NVQJ 3LSJA 1S72I 3GLLA 1LJ9A 5H6QA 4DYRA 1RNLA 2AXTC 3K1PA 1VZ0A 2CS3A 5FRMA 4AYBA 1VTNC 2OAZA 5E18F 1RZ4A 1FTTA 1MIJA 3EPZA 3HSFA 4F52A 4ESJA 5HNFA 2IAIA 1R23A 3FXQA 3R0AA 2EFWA 3BR3A 5EDNA 3FKJA 2LKXA 2JUGA 4DBQA 2KIUA 2B7EA 1MNDA 4G7ZF 2DOFA 2CQQA 2K3FA 1K78B 2LYCA 4A2UA 2LMDA 2OC6A 2DMQA 2HDCA 5JVTA 1VQMI 5F1RA 1APLC 5J3LA 3SFZA 2OD5A 4NQWA 1T33A 5E79C 1EA3A 1BC7C 3G1MA 3TL4X 3BQZA 2OF7A 2K9LA 3E7LA 1JGSA 2CYYA 3ONQA 3VYRB 1MKMA 3HC7A 4KT5C 2WWYA 4BYYA 5M5XJ 3PNVA 2PMZA 4XRSA 2W57A 1JHFA 3LAJA 2V7FA 4B3AA 3Q5FA 4V19K 3CJRB 3IWZA 1OCRH 2PG4A 4BE1A 5BQTA 3B6AA 3JRDA 3F8BA 4IQ4A 2ADUA 4CSWA 5ILVA 1XTAA 1WH5A 4RDUA 1OPCA 3HPHA 3LA7A 5GTIC 1LDKB 2ZKZA 1G4DA 5F64A 5HS9A 3JTGA 1R4NB 4YEJA 3FK7A 3SDGA 4AUXA 1GLNA 2LG4A 3SEZA 2PX9A 3CMEI 4FCYA 4IEJA 5F0FA 3WTUC 3CDLA 2STWA 3L2RA 1LEAA 2A6EF 1GXQA 3AG3H 1J75A 2K9NA 1A35A 2CW0F 1FOYA 2ZMEB 1K78A 4Q47A 4R8HA 3FWEA 3CJNA 2XC7A 3LFUA 2FMLA 1MJAA 5FKNA 3S17J 2X48A 3VB2A 1IO2A 2EILH 4BU2A 3MAJA 4LLNA 1T39A 5M5YJ 2JUCA 4ESFA 2X6YA 2BYVE 1K83J 4XSXF 3DV8A 4IHVA 1QPMA 3MKZA 3P9CA 2K27A 3VYSB 2WADA 3NEUA 5FB2A 2X85A 4XBFA 4X1EA 2HI3A 3DTEA 1MZBA 4D9JA 1WJDA 4EJOA 2BEOA 5D5UB 4AVZA 1FYKA 3IH4A 3CDIA 3GTJJ 3F8NA 1SFOJ 1QHGA 3RYRA 2V9PA 2RDPA 2PMUA 5CVUA 1FT9A 3KE2A 2PFBA 1SD5A 1HW1A 1R1VA 2M4KA 4A3EJ 4C3HJ 2E19A 1ZG3A 2JRTA 3GYHX 1I50J 2LFBA 2IEKA 2R7TA 3R0JA 3BR6A 3CCUI 5D4RA 2CU7A 2KLOA 1ZRFA 3KEOA 2AS5F 3N97A 1FY7A 4KISA 1WPKA 3DCFA 2DI3A 3MCZA 3HTUA 2Y0SN 4P5OA 4GYIA 3UR3C 1U5TB 3CUQC 2ZMEA 2Y69H 3D0SA 1Z6TA 3P5JA 1UB9A 1BJZA 5M3FJ 1DGRM 3FXUA 3QPLA 3ZMZA 3IKVA 2VL8A 2UXNA 1QRYA 4D7NA 3H36A 3LA2A 2BXYA 1S9HA 1FP2A 2RQQA 3CCMI 4FX0A 3L00A 3ZR8X 1IDYA 4BBSJ 1TWFJ 1G3YA 4HZFA 5H20A 2A61A 2J5OA 4MQVA 3T0YA 1SD7A 2ELHA 2FQ3A 3QYEA 3RKXA 1ACIA 5K1YA 4CCLA 3RCOA 2VOOA 5EYRA 1O57A 3K2AA 4GO1A 3GF2A 1X1PA 1IRXA 3L2UA 4XLHA 4M9XA 1TNSA 3RDIA 1ZRCA 4NHJA 2GM4A 4HNTA 1ZR4A 3JRIA 2ZJRF 4UV9A 1TW2A 2R7SA 4DYCA 4ZYHA 5E8IA 4B3XA 1R5GA 3NRVA 4ZZLA 4EJWA 3FF5A 3ZQHA 2KISA 1U8RA 1G8XA 1VQ4I 1SANA 2IS6A 4EV0A 2GXBA 3E5XA 1RR8C 2ZBKA 3KZYA 1I5ZA 2K3PA 1BIBA 4XLAA 5KK1A 2VE9A 2D1HA 2HYGD 4NDLA 4KYWA 5D8KB 2R7UA 2HPIA 2KFDA 2NVTJ 1MMNA 1IZ1A 1U5TA 1J2XA 3WTVC 3ISPA 4X0GA 1YTYA 2JA7J 1BW5A 2Z99A 1MBHA 2QQBA 1TLHB 2R7ZJ 4HNUA 1V55H 2VXZA 3QAHA 3JRBA 5CPRB 2BGCA 2EIKH 4MHGA 1R1UA 4CZCA 3CCRI 4IHWA 1WJEA 2HXOA 3F8CA 2P5KA 4BHPA 5JFRA 4BHCA 1QVTA 1D5YA 3E6MA 1R58A 2QQ8A 4A3KJ 1GVJA 3EETA 3OMYA 3T8RA 3MD2A 2YU3A 1YJWI 4H4KC 3M1CA 3M8EA 4AU7A 3RJPA 2QENA 2LF7A 3WGIA 1U78A 2FD5A 3AG1H 1EH6A 1LEBA 1FEXA 1Z1DA 5FD6A 3CP8A 2VBWA 4AM3A 1V5EA 3S8PA 2E35A 5EGOA 3BDDA 1MGTA 4FTHA 5HDNA 3HOTA 3KP2A 3F0CA 1CGPA 4IO9F 1P2FA 1K4SA 2R0QC 2EBIA 5LHIA 5E3MA 2H27A 5LRRA 1WFXA 1H0MA 3EDPA 4BAYA 4I98B 5DM6F 1Z77A 2GWRA 2EV5A 3S32A 3JRHA 1IAWA 3M9AA 5HODA 2R3SA 3JSPA 4RGUA 1VQ9I 5H6RA 2H6CA 3H5AA 3W6JB 2X0LA 5FJ8J 2VN2A 1X58A 2VBYA 1R36A 2KDOA 5JVGF 1SFXA 1JGGA 2XF7A 5EEAA 2X51A 3VSKA 1YRNB 3BG9A 3NQOA 2OZ6A 3QOPA 3ZQQA 5LHGA 1JKPC 3A2KA 3K9TA 1ON1A 3I59B 1UHMA 2RV8A 3OSGA 2VB6A 3TDUC 1D0ZA 2MABA 2Y0MA 3HG9A 3ZN0A 1X1CA 5HS8A 1KQ8A 3LNQA 1IW7F 1AOYA 2DA3A 1FNNA 4CCOA 1YW7A 2OQRA 4OAYA 3J80K 2M34A 2DMTA 1RUOA 3DWLE 1FSHA 2A6TA 2DBBA 1UG2A 4L5IA 3CC4I 3OYEA 2DA1A 1U9NA 4LIUA 1HDPA 2XIGA 3LOCA 5C4JJ 1PYVA 1YS7A 1T95A 5KHDA 3OYIA 3K70D 2GA1A 1NG7A 1Z7LA 2E1OA 1TT0A 2K5CA 4Y15A 3GTGJ 1L0OC 1BI1A 1XPXA 3OYLA 1W4MA 2ECCA 2XPWA 4A6DA 1N77A 4XL9A 2P5LC 1JTYA 1SAXA 1TW3A 3F3XA 5KCMA 3OSFA 2HOTA 2VJIA 3KEQA 2JZYA 3NWTA 1E17A 2DA2A 4G6DA 2CRGA 2CUFA 2IA0A 5ICEA 1PUFB 4LLGF 4WCGA 2R5YB 2QQ9A 2NNYA 2L5QA 3ZMTA 1RR7A 4XQFA 4B4CA 3ZQGA 4GDFA 3ASNH 4IQJA 4IHYA 2MBFA 5LFAA 1BOAA 1ODDA 4CICA 5C3EJ 4FT8A 4XKBA 4HLYA 4Z2YA 4FX4A 3ESWB 2W85A 2PJRA 2BVMA 1OCTC 2LK2A 1KONA 4U0WA 2Y30A 4PJNA 1EKEA 4Y4RA 3JRAA 1A6IA 3CCEI 1G2HA 5D5VB 5DD4A 1Y8QB 2OV7A 2DPUA 2LLKA 1K79A 5HLHA 1MJ9A 1OR7C 2VBXA 3RKWA 2DFIA 3C18A 2QA4I 3BT9A 5ICFA 3ECOA 3K4NA 4LG0B 1R6RA 2JVHA 4B47A 2DYRH 3M1EA 2M0CA 3BTCA 1DUXC 3WTZA 1IC8A 4HSRA 5DV5A 2GBYA 4II2A 5J1YA 4XMYA 2HKXA 1X19A 2FMYA 3CTAA 4AD9A 4BL0B 1S7OA 2LY2A 4FISA 3WHCA 2HXIA 2EA2A 1EH7A 3DBHB 3QP6A 2EZIA 3FXLA 4MFEA 2QKLB 5C44J 4PJJA 2ZXIA 4E7LA 2QGUA 3ZXSA 4BJTA 4PGHA 4ZYAA 2IP2A 3QWLA 1TWHJ 2DT5A 4D5FA 1NH3A 1PUFA 3BTLA 2R5YA 1IRGA 1LVAA 4H0EA 4ENNA 5E1WA 1ON2A 1YJ9I 3GTLJ 3Q0VA 4N9IA 3KP4A 3GLXA 1WCMJ 3KYLA 3HOSA 4I7HA 1DGWY 2JSPA 1STZA 3LSMA 4WXHA 2L7MP 2D45A 2A05A 4O6JA 2QSGX 2DFFA 4MFDA 3AL0C 2O6GE 2HTSA 3W2AA 2PI0A 3R4KA 1QZZA 4S04A 2IRFG 4HV6A 4D5CA 5L3CA 1GV2A 4K2EA 3C1DA 4JOMA 3ZQ7A 1TQMA 1LDDA 2PMHA 3MZ8A 5F6FA 2DLLA 1ZELA 3S2DJ 4ENMA 5FFZA 2M4GA 4BDYA 2Q0OA 4G7OF 2CW7A 2KP6A 2R7RA 4XN0A 2X4HA 5FLMJ 2AHQA 4LG0A 2JT1A 5DS9A 2VT3A 1WJ5A 3JTHA 2TRTA 2EWNA 2V1DA 3A01B 2R7DA 3AG4H 1S7EA 5IYBJ 1F9NA 1WHUA 3UKGA 1V5FA 4HEA2 2KIQA 1O3RA 2MLKA 2P6SA 1RRJA 2EB7A 3RZDJ 2QF7A 4F55A 2IGKA 2WB1N 2FUG2 3V8JA 1W0UA 1KZHA 1FPQA 1J5YA 2OQGA 5DUIA 4GFBA 1HQCA 4PCQA 4AWXB 1KA8A 5FLXK 4HA8A 4E6KG 2BBYA 2E2IJ 5BOXA 5HOOA 2F4OB 5B66C 4IX7A 1KGSA 1IUYA 3M07A 4G12A 1A04A 1MMSA 4HDVA 1Z3YA 4HLXA 1OYIA 2Z3YA 4RAFA 2WB1A 3MKLA 4S0HB 2DOAA 1XSDA 3QYFA 2PLYA 3GBGA 1X3UA 1P4AA 3DPUA 3BQYA 3GFLA 4G6TB 1HSJA 3GUDA 4YELA 3C3WA 2P7CB 4A3BJ 1UAAA 1VI0A 3Q0WA 1Q1HA 2V79A 4OU0A 4RGSA 4MEYF 1Z3XA 5E20A 4JP0A 1X2MA 5D4SA 2DT6A 5F04A 3H0DA 5FKOA 2CW8A 2A69F 3A03A 1HF0A 2HVQA 2NOGA 2FBIA 4LB6B 5FLVA 4HX8A 4C3IJ 2WAQN 3HXLA 3T5XA 2RGVA 4IRHA 4DZJA 4UUVA 1BI0A 3L7WA 1WJCA 3A01A 3K4LA 1QU3A 3OIOA 1HSTA 4HX4A 1YYVA 1IXSB 1JHHA 2HYJA 2HZDA 2OCEA 4GYGA 2Z2SB 1PP8F 4OIPF 2ESHA 1SD6A 4YFKF 2XSDC 4G9YA 4L9TA 3L2WA 2ELJA 1JUSA 5IP6A 1GVDA 3SQNA 4J19A 2E71A 3HB9A 1YX5A 4WXDA 3LSPA 4A3IJ 2WAQA 3S15J 3COAC 2DQRA 4E7HA 3S3NA 2K40A 2E34A 1P4XA 4BS9A 3G71I 1Y56A 2DK8A 3JRGA 2CG4A 3WG9A 2QVOA 3CUOA 3L09A 1XSXA 2WY8Q 5LD2C 2NVXJ 1REPC 3I54A 2BHZA 3KYCB 4HG2A 3I58A 3WTSC 1IXRC 5FRNA 2ZNYA 1G3TA 1SVOA 2P6TA 3GTMJ 5D5WB 1A36A 2O8XA 3J81K 2W82A 2CMPA 5BS6A 5B1AH 4O5VA 4KUMA 4B48A 2HPMA 3DTKA 1FC3A 1XSVA 2KIFA 3IH2A 5K7ZA 3K4KA 5K5OA 4KICA 2V1UA 2E1MB 3FBNB 3OYHA 2LF8A 2DA5A 3FXMA 1Y6IA 3VPRA 2WY7Q 4UB8C 2M3AA 4UVCA 3KFWX 2F5DA 5E1ZB 3AAFA 4HOBA 2ICWG 3K1MA 1VQ5I 1TZLA 2A6HF 4RLFA 1Y39A 4HQMA 3RPUA 2BW3B 5ICCA 3OYFA 4KFCA 1USTA 1Y0NA 2UUZA 2LNBA 1B9NA 1RC9A 3GTQJ 1KU2A 2VPRA 2RNJA 1W5TA 3HOZJ 1TL8A 1NK3P 3OR1C 2FOWA 1BC8C 4WX9A 1YW9A 2HVSA 1TWAJ 3HHGA 4ENKA 4GCVA 3Q3SA 5HLTA 4AIKA 3O8GA 1WQ2A 4P96A 5LGTA 1G59A 5K5RA 5L3BA 2ELKA 3TO9A 3U21A 3FMQA 3MMYB 5D8LB 2KZGA 2DXIA 2H6BA 3VODA 2XPVA 3GEZA 3O2PE 1QA6A 3CMMA 4QPOA 3RKYA 1W36C 1TC3C 2QZ8A 5EZHA 3V42A 4O3MA 2JRMA 5ICGA 1KYWA 3V7SA 3BR1A 4KN7X 5JHFA 2MFZA 3OYGA 1WSUA 1LKXA 1ZGAA 3FXRA 2L7FP 3HIFA 4CCJA 1DP7P 1EV7A 2FXAA 5DUKA 2DJNA 3DPTA 1OKRA 1SVLA 2GOXB 3PUBA 1BIAA 4A3JJ 1W5SA 2VJ5A 3GTKJ 4IHXA 3ZN1A 3DEWA 1MD0A 2KJBA 5EEHA 3ULQB 4RGRA 4W1UA 4RAZA 2LDUA 2RKHA 4CHUA 3IP4B 1FMVA 3V7CA 2R4GA 4QPQA 2CV1A 3OR2C 2PQ8A 4UHTA 2OUMA 3BY6A 4ESBA 1BA5A 1SMTA 3GMEA 1QO0D 1SMYF 2EZHA 3H9GA 4G7HF 1ZQ3P 5C4XJ 2W00A 5LEJA 1W7PB 3G1OA 1KU7A 4XN3A 2PJPA 1D1AA 1NHAA 2BVLA 4Y17A 2P8TA 2DMPA 3RTRA 2YUSA 2FF4A 2HQRA 3E1SA 3FZVA 4NC7A 3PIPF 1W7PD 2AQEA 5LHHA 2RQPA 1WZ2A 4IXAA 3O3KA 1BI3A 3HOVJ 2EFPA 3FHNA 4ZJZA 3WTYC 4A3LJ 2O61A 2TDXA 1ZARA 4YIIA 2XF6A 2HZTA 1X3WB 4CO8A 4RA2A 3L2CA 3G73A 5HDKA 3EUHC 2O03A 3BCAA 5CVIA 4EGZA 5IY5H 3HDDA 3CCYA 1L3LA 2XROA 1Z0XA 2XAHA 3U2RA 1R9TJ 3H3VK 1MNMC 2VIXA 3JRCA 3RSNA 4M71A 5F1JA 1T0FA 2Y31A 3PIOF 4DGWB 2KL4A 4M9ZA 1SVMA 3BPVA 2PN6A 3E97A 4RLQA 5JHUA 1OYYA 4A6EA 2R7QA 3T1BA 4EGYA 2W1OA 2JPBA 2KHMA 4E7ZA 4UUSB 2E5ZA 2DFEA 2O9LA 4M72A 4PSWA 4C30A 3LWFA 3MWMA 4XORA 3U1KA 3HOUJ 3ZMVA 3PFIA 3I3LA 3VFZA 4HNVA 3TQNA 3BC8A 1SD4A 1SEUA 2VOPA 3DF8A 1W7PA 4MLOA 1GXPA 1PDNC 4U87A 2G7UA 5KVRA 3W6KB 1JKOC 2JA5J 4YIRX 4ETSA 2L4AA 4BQOA 3QU3A 4RAGA 2ESNA 2LD5A 2L7ZA 4BJ6C 4HSTA 2KMUA 2VONA 3I9V2 2WV1A 3CMAI 5HDGA 1E2XA 2IA2A 1UCRA 4AIDA 1ZYRF 3NARA 3HOXJ 3BG6A 4OWRB 4DNCA 1S7AA 3L9FA 3DU5A 3BR5A 1HLVA 2Y0SA 2GZWA 4GXOA 2QUFA 5J6XA 1Y1WJ 1VFCA 4UVAA 3OYJA 4L0ZB 1FWZA 4BBRJ 2CQ7A 1XGNA 3MVPA 2GXAA 3FBIB 2LY9A 2HFHA 2LR8A 4Y13A 2XDVA 5FFXA 2GQQA 1X1AA 1FLIA 2K85A 4I76A 4UUSA 2Z16A 1DP3A 3S3MA 2EQRA 1JTXA 2L4MA 3AFHA 3CC7I 4C2MJ 4G6QA 2BE5F 1M1EB 4RB2C 4IOCF 3SZPA 4DOZA 1QHHD 5EEGA 1DU6A 1O3TA 1SAUA 3CDHA 4IRIA 3B6CA 2G0EA 1YHQI 4RM2A 4KIFA 3HRUA 1T98A 3F6VA 3HZJA 1ERDA 3VYTB 4U88A 1OYWA 3EYIA 2K02A 4NC8A 2OPTA 3AG2H 1E3PA 2K86A 4M6VA 2JA2A 1HC8A 2XB5A 4AIHA 3TGNA 3FISA 3E3VA 4BDZA 4EJUA 1XB4A 1YQAA 2ME0A 5E3LA 2IA1A 2P81A 3TO6A 4II3A 4MNUA 5B1BH 3OIQA 1KYZA 4ZC3A 2VJ4A 2EZLA 3DEUA 2HVRA 3KP5A 2VI6A 4ZDPA 4TV7A 2MD5A 2L54A 4EM0B 2ZFUA 2VODA 3E6DA 4Q5SF 4XM3A 2OTJI 4ZDOA 1G3WA 1VQKI 4KMFA 1P7IA 3C2GA 3QOEA 5J8CA 3ZQCA 2IS2A 4XRFA 3HYIA 4EMSA 2CH0A 2FRHA 1RKWA 1YIOA 4A0YA 4B8XA 1BW6A 3I4PA 2EK5A 4A5MA 1QVUA 1YS6A 4JYKA 4N9HA 3X2QH 2W84A 2ZSHB 5L3DA 4MTDA 1Q1VA 3ABUA 2E5NA 4OIQF 1YITI 2HTJA 2NRAC 1KQ9A 2MW8A 3HRTA 4DQ2A 3JAMK 2YU9J 2CQNA 4EVIA 3KYDB 3HSEA 4B1RA 3KX2A 4OINF 2BY0A 4E70A 1N75A 1ETXA 2VKEA 3OYKA 1XX5A 4L5EA 3PQJA 5LEKA 1AU7A 1Y8RB 3VEPA 2I10A 2ZJQF 2DN0A 3GTPJ 3FDYA 2V6CA 3GWZA 3BLYA 1WH7A 3WGGA 3CCJI 1WI9A 1S29A 2Y9YA 2K9QA 1XCVA 1UMQA 3WU1B 3CQZJ 1W36D 3U9GA 2R7VA 4XNFA 4Q48A 3HSRA 2H1LA 2W25A 3PQKA 5FD5A 3FIWA 2MH2A 4G8XA 1BR4A 2LKPA 3J80Z 4M3DA 2CGPA 4FASD 4HYEA 4UB6C 3QYBA 3PJRA 5K5QA 4M9SA 3HPGA 1TBXA 4BHBA 4M6YA 3QPTA 3M8FA 1VQOI 3F23A 4XRSG 1USSA 3IKTA 5FKKA 3JCUC 5E17F 1B1BA 2ECBA 2XAJA 4Z6YA 1IF1A 2VPLA 1MNEA 1J09A 2CJJA 2L0KA 3LSHA 2X6XA 3HEFA 4ZTJA 3FM3A 3T8TA 2K4JA 4MO7A 1VQLI 3H5NA 2OTLI 3ZQFA 1QBJA 3K4MA 1XN7A 3HGGA 4RB3C 1MSFC 1S5LC 4QWQA 3I59A 3DEEA 2R7OA 2HQ5A 2Y2ZA 1MH3A 4KT6A 5B5EC 1UFMA 5E3OA 1JKQC 5IT9K 1ZRDA 2F5EA 2V4JC
chains in the Genus database with same CATH topology
3CCMI 4V19K 2OTJI 1VQKI 2JQ7A 2QEXI 1QA6A 5GAHJ 1ACIA 1VQ6I 3CCLI 3CMEI 3CMAI 1YITI 2ZJRF 1YJ9I 5GAGJ 1FOYA 3CC4I 1VQPI 3CF5F 3J7ZI 3CCQI 1VQ4I 2E34A 3G71I 2E36A 2ZJQF 1YI2I 1VQNI 1YJNI 3CCJI 2ZJPF 1S72I 3CCRI 5DM7F 1VQ8I 3CC7I 3PIPF 4IOCF 3CD6I 1YJWI 1YHQI 3G4SI 3G6EI 1FOWA 5GADJ 3CC2I 1YIJI 3DLLF 2K3FA 1VQOI 5GAEJ 1VQMI 2E35A 1VQ5I 4IOAF 3CCUI 2H8WA 3CCEI 3CCSI 3CJTB 4IO9F 3I56I 1Y39A 4UY8I 3PIOF 1MMSA 1HC8A 2OTLI 1VQLI 5DM6F 3CCVI 2QA4I 1VQ9I 2FOWA 1FOXA 1VQ7I 3I55I 3J7YJ 5JVGF 2NXNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM I;  4V19 K;  2OTJ I;  1VQK I;  2JQ7 A;  2QEX I;  1QA6 A;  5GAH J;  1ACI A;  1VQ6 I;  3CCL I;  3CME I;  3CMA I;  1YIT I;  2ZJR F;  1YJ9 I;  5GAG J;  1FOY A;  3CC4 I;  1VQP I;  3CF5 F;  3J7Z I;  3CCQ I;  1VQ4 I;  2E34 A;  3G71 I;  2E36 A;  2ZJQ F;  1YI2 I;  1VQN I;  1YJN I;  3CCJ I;  2ZJP F;  1S72 I;  3CCR I;  5DM7 F;  1VQ8 I;  3CC7 I;  3PIP F;  4IOC F;  3CD6 I;  1YJW I;  1YHQ I;  3G4S I;  3G6E I;  1FOW A;  5GAD J;  3CC2 I;  1YIJ I;  3DLL F;  2K3F A;  1VQO I;  5GAE J;  1VQM I;  2E35 A;  1VQ5 I;  4IOA F;  3CCU I;  2H8W A;  3CCE I;  3CCS I;  3CJT B;  4IO9 F;  3I56 I;  1Y39 A;  4UY8 I;  3PIO F;  1MMS A;  1HC8 A;  2OTL I;  1VQL I;  5DM6 F;  3CCV I;  2QA4 I;  1VQ9 I;  2FOW A;  1FOX A;  1VQ7 I;  3I55 I;  3J7Y J;  5JVG F;  2NXN B; 
#chains in the Genus database with same CATH topology
 2M87 A;  4IPA A;  4F3Q A;  4A0X A;  3S1Q J;  4CCM A;  2HR3 A;  4RS8 A;  3OYA A;  2UZK A;  2A5Y B;  2DU9 A;  3LAP A;  4IRG A;  2COB A;  2CFX A;  1R22 A;  4HPQ A;  4XKC A;  2ME6 A;  1U3E M;  1FMW A;  5EG0 B;  2GIV A;  4CH7 A;  2KRC A;  3HRS A;  1WVR A;  4HQE A;  3MN2 A;  4I99 C;  4AVP A;  3GO5 A;  1ZGW A;  2ISZ A;  2JWT A;  3OYC A;  3FXK A;  2HU9 A;  2MG4 A;  2HQA A;  2RC4 A;  3OYM A;  4CDG A;  2HYF A;  1JE8 A;  2V9V A;  1WJA A;  2ID6 A;  3RZO J;  1H9T A;  2ZSI B;  2CQK A;  3TW6 A;  1QQI A;  3BG7 A;  4NNJ A;  3S1N J;  3B02 A;  1YG2 A;  3BZK A;  3FKI J;  3BTJ A;  1VQP I;  1XG1 A;  2ZO4 A;  3JRF A;  3F22 A;  2DCE A;  3CCQ I;  3BG3 A;  2A07 F;  4KJZ A;  2HOE A;  2CUZ A;  1MMA A;  2X6W A;  4CZZ A;  1CF7 B;  1TP4 A;  3C7J A;  3IWF A;  1IN4 A;  3K6G A;  4Y7N J;  1UG0 A;  3MEX A;  4A12 A;  3CUQ B;  1T08 B;  1T6S A;  1YI2 I;  1HKQ A;  4M3E A;  2M8G X;  1G6N A;  4KIG A;  1RET A;  2QYO A;  1IN6 A;  4PZJ A;  1AKH B;  3IRQ A;  5IT3 A;  5DD8 A;  1Z21 A;  4RBO A;  2ISY A;  1R00 A;  4F91 B;  1YRN A;  3F6O A;  3G2B A;  1I1S A;  1XDS A;  4XOP A;  4ON0 A;  3KIO A;  1FIP A;  2VKV A;  4OOI A;  2ACJ A;  3JSO A;  2R92 J;  2L7K A;  3DBR B;  1JT6 A;  2VAS A;  1T8I A;  1MH4 A;  2FE3 A;  2I5U A;  2XVC A;  3CC2 I;  1H8A C;  2IS1 A;  1WGX A;  5EG0 A;  3I64 A;  1R49 A;  1ITY A;  3SYT A;  3GZ5 A;  5KNL A;  3KP6 A;  3K2Z A;  2ZCW A;  2Y48 A;  3FMR A;  1ZG1 A;  4PJM A;  2ZME C;  3ABT A;  4I0B A;  3IUO A;  1LDJ A;  2XB0 X;  4BH9 A;  2M45 A;  3R60 A;  2F6C A;  3OYD A;  3L2V A;  2H8W A;  2KPM A;  1O7F A;  2UV1 A;  4PFP A;  3KET A;  3ZOB A;  2B0L A;  2BY2 A;  2HS5 A;  4R79 A;  2DYS H;  1PJR A;  4LK0 F;  4BE0 A;  3FK6 A;  1XDU A;  2X1E A;  1K4T A;  1HXD A;  5EZG A;  3FMS A;  3LQR A;  3CCV I;  1MW7 A;  3V8L A;  4MGR A;  3FM5 A;  2R7F A;  3HJE A;  2GA2 A;  2AXL A;  2F5F A;  3I55 I;  3J7Y J;  1CF7 A;  1ULY A;  1TNT A;  4RMN A;  1GUU A;  3ZPL A;  1X4P A;  2YS9 A;  3QP5 A;  5IYC J;  1J59 A;  4UXN A;  1SFE A;  2XKO A;  3CUQ A;  2L9V A;  4I2O A;  2E2J J;  2QLZ A;  3HGY A;  2JQ7 A;  2V1N A;  3U1D A;  4XSZ F;  5ILU A;  1AKH A;  3C2H A;  5J8F A;  1P7J A;  5FLX Z;  1FYM A;  4ZTF A;  2DMU A;  2IJL A;  4BNC A;  3OYB A;  4Y52 J;  2FQ4 A;  4C3J J;  4KNY A;  1DQU A;  3CF2 A;  5FGM A;  3H35 A;  3BG5 A;  4V2G A;  5JI6 A;  1O3S A;  3GXO A;  2H94 A;  3D5R C;  4I01 A;  3RKQ A;  3PO3 J;  2LP0 A;  1A31 A;  5EJC A;  1V3F A;  1FSE A;  4XIC A;  1KU3 A;  3A0B C;  5K7H A;  1B8I B;  4CGZ A;  1U5T C;  3WE2 A;  4BAC A;  1B72 B;  2DTR A;  3CLO A;  2K4B A;  4EM1 A;  2O8K A;  3NWS A;  3GZN B;  1RUN A;  1TQI A;  2KDZ A;  4U0Y A;  2OJE D;  2B9S A;  1ZKG A;  3G3Z A;  5DCM B;  1YJN I;  1OFC X;  1WJF A;  2NS7 A;  2E2H J;  2DDB A;  1JJ8 C;  2HEO A;  4HV5 A;  2IVM A;  2YR2 A;  1XCB A;  3ZMS A;  3WGH A;  4M6X A;  4YG2 F;  1VQ8 I;  4HAM A;  4EJT A;  2X9D A;  4LJZ F;  3GCM A;  3EUK L;  4QIW N;  2R93 J;  3KLN A;  5D6F A;  1RES A;  3VWB A;  1LFU P;  1WRJ A;  4LD5 A;  2Q2E B;  4DJA A;  3OOP A;  5E3N A;  2CV2 A;  1OCZ H;  2QSH X;  2EH3 A;  4XLF A;  1HOM A;  1CQT A;  1IN7 A;  4LFU A;  2O3F A;  3HHH A;  3RYP A;  1Z9C A;  2V26 A;  3LSK A;  1D1C A;  3V8K A;  1JT0 A;  1ETQ A;  1Y0U A;  2XKP A;  4AIJ A;  2IPQ X;  1R5H A;  4EQQ A;  4IOA F;  4CYD A;  2WA0 A;  3V7R A;  3WHB A;  3I56 I;  2NS0 A;  2DW4 A;  1SFK A;  4J00 A;  1N78 A;  1P6R A;  1S6L A;  2KIM A;  3S1M J;  4A3C J;  3ECH A;  2MGQ A;  4IVN A;  3D5L A;  4BEH B;  1K7A A;  4S05 A;  2X1D A;  1RIO H;  5H2F C;  3J81 Z;  1B8I A;  3DKY A;  2HKO A;  3HOY J;  3HKZ N;  2VQG A;  4JQF A;  4NQW B;  3N4M A;  2COM A;  4DBR A;  1B72 A;  3MKY B;  4A69 C;  3W6V A;  3E5Q A;  3FXJ A;  2B63 J;  1MBF A;  1HCR A;  5CYV A;  1I27 A;  2G9W A;  3REO A;  5BMZ A;  4IHT A;  5DCM A;  4M3G A;  1WI3 A;  4KMU X;  2L9S A;  4FE7 A;  3O8H A;  5F08 A;  1JI8 A;  4AYB N;  3PM1 A;  5DEQ A;  2CQX A;  2XGD A;  2Y75 A;  3BTI A;  2L3D A;  2Q1Z B;  1XC5 A;  2JPC A;  2YX4 A;  3GTO J;  3HKZ A;  3QOD A;  2E7X A;  2W4S A;  2RRE A;  3TOB A;  1H88 C;  3HUG B;  1FP1 D;  3H3U A;  3IAS 2;  4L18 B;  2JA8 J;  4IJA A;  4E7I A;  2Q2E A;  2W48 A;  1UZC A;  2NYX A;  1F4K A;  5J1R A;  3EQL F;  5ILS A;  4GGG A;  5M3M J;  2N8G A;  5GAG J;  2DAO A;  3I71 A;  4BY1 J;  2H1K A;  1TQP A;  2PBI A;  2DA7 A;  5J40 A;  1PUE E;  1R71 A;  3OS2 A;  1ZHF A;  3CES A;  4ITV A;  3I4M J;  4LIT A;  1OCC H;  1GHC A;  5BNG A;  5HLG A;  1QZE A;  4A93 J;  3GX4 X;  1IUF A;  4ZDL A;  1VQN I;  5L3G A;  1Z67 A;  1KQ0 A;  1LE8 B;  2IGN A;  2PMZ N;  1LFB A;  5DYM A;  3ERE D;  1OCO H;  4BEH A;  3IL2 A;  2KRF A;  3IAM 2;  4IL6 C;  3C2B A;  3P9K A;  2DPD A;  2BXZ A;  2VBZ A;  3S2H J;  1FJL A;  1YX3 A;  1LFP A;  2ZFW A;  3HL2 A;  4LLL A;  2VKH A;  2YPR A;  3A1Y A;  3ABL H;  1BJA A;  3WU0 A;  1UJ8 A;  3ABM H;  2WBM A;  3K69 A;  4W97 A;  1LQ1 A;  3GW2 A;  1FBU A;  3ASO H;  3FXO A;  5GAD J;  2BW3 A;  2LRD A;  1LB2 A;  4UUT A;  1OCP A;  3K70 C;  3KZI C;  4JBA A;  4HF2 A;  2P0W A;  2M0M A;  1TT5 B;  3HUG A;  4F93 B;  4XON A;  3RQI A;  2OU2 A;  1B4A A;  2O0Y A;  5LLQ A;  3CJT B;  3PUF A;  3GFI A;  1X1D A;  3KEY A;  4YFX F;  5CQE A;  3J7A Y;  1J0R A;  5TGT A;  3LSR A;  2CSO A;  5D5X B;  2EIJ H;  4U7B A;  3DKX A;  3JW4 A;  1A6Q A;  3J7A O;  3LFK A;  3LMM A;  2LOO A;  1JXS A;  3CZ6 A;  2YSR A;  3TKY A;  3AL0 B;  1J7K A;  3QPH A;  2MSY A;  4DIQ A;  4I0A A;  2AO9 A;  3DXJ F;  2IS4 A;  3DBL B;  3HBL A;  4QTR A;  4PDK A;  1FOX A;  6PAX A;  2EFQ A;  4RB0 A;  1LUJ B;  1ZK8 A;  3WOD F;  5LGU A;  1H89 C;  2M8E A;  5A2Q K;  5B3S H;  5GPA A;  1GT0 C;  3PFY A;  1Y1V J;  3DPL C;  1OR7 A;  2ID3 A;  4V2F A;  3GFM A;  4XKW A;  1OMI A;  3H0G J;  2QQA A;  4XLP F;  1MMD A;  3LST A;  2ZXJ A;  3K10 A;  3OL3 A;  4PGG A;  4RM3 A;  4EEF G;  1LE8 A;  3WU2 C;  4CA0 A;  4Q4Z F;  1IV6 A;  1ZLK A;  2KT0 A;  3IV5 A;  3ZQL A;  5BPI A;  2EA4 A;  2P4W A;  2QKM B;  5A2Q Z;  3S2W A;  4PSX A;  4PK4 A;  2L01 A;  3DFG A;  4NC6 A;  2F2E A;  5AIP A;  1XGS A;  5KAF C;  2IXS A;  5JR3 A;  2LY1 A;  2NAZ A;  2KQR A;  5J4Y A;  4XLN F;  1SC7 A;  1VF9 A;  4IF4 A;  2JMW A;  1IG7 A;  3M4O J;  2R5Z B;  1U8B A;  2P5V A;  2WTE A;  2E60 A;  5J1U A;  2F4I A;  3WTT C;  1R5I D;  3OS0 A;  5LBQ A;  3J7Z I;  9ANT A;  1YOV B;  2K9S A;  2F4M B;  5L3F A;  2XUB A;  1XGM A;  4ENJ A;  1U2W A;  1ZAO A;  4R1H A;  3SXY A;  4F7Z A;  1W1W E;  2G7H A;  2WV0 A;  2LTP A;  2VQH A;  3K1N A;  4OMZ A;  3KPH A;  2VC0 A;  1YLF A;  4XR6 A;  1UHW A;  1LVK A;  2RN7 A;  1BR2 A;  2M30 A;  1NG6 A;  2FA5 A;  3CMY A;  3JR9 A;  2DDA A;  4KA4 A;  1OQY A;  3SZT A;  3UNG C;  2DJI A;  4Y3O A;  1IRZ A;  2C6Y A;  2EJR A;  1V54 H;  1XGO A;  1HA8 A;  1OJL A;  1HKS A;  5CVV A;  3WG7 H;  2I8D A;  1Z7U A;  3EYY A;  3BJ6 A;  3KZZ A;  4FQG A;  2PEX A;  1BN5 A;  2M5W A;  4KN4 X;  3GZ6 A;  1FOW A;  2FNP A;  3ZQI A;  4HDU A;  2LVS A;  1NTC A;  2A5W A;  4PJ0 C;  5F0H A;  3SEQ A;  2OBP A;  1RPW A;  2GOM A;  3K4J A;  1K6O A;  3DKW A;  1F1Z A;  1Z05 A;  1ETY A;  4BXU A;  2BY3 A;  4BQQ A;  3CCS I;  2OCC H;  3A0H C;  1YW8 A;  2GIZ A;  3HTS B;  1E0E A;  1ZGJ A;  1JJ6 C;  3RQ4 A;  1JKR C;  2R5Z A;  1ONV A;  2HDW A;  5E1X A;  3SZG A;  4XRM A;  5GP9 A;  4CXF A;  3CO7 C;  5FKM A;  5EGO B;  4XK4 A;  4B44 A;  3CP2 A;  3QPS A;  2FEZ A;  3OYN A;  4WXC A;  1I3Q J;  2M7B A;  2MC3 A;  3PNY A;  2MYS A;  3H5R A;  3V4G A;  3W2V A;  3M8J A;  2CV0 A;  1VQ7 I;  3MZY A;  2ZB9 A;  2HQN A;  4JX5 A;  4YRV A;  3H9Q A;  4A3D J;  1H9G A;  1S3J A;  3H3Z A;  4ZYE A;  4MQ9 F;  4FE4 A;  5GTH C;  3TO7 A;  4D0P A;  4HF0 A;  1ETV A;  4M74 A;  2LH9 A;  3QQA A;  2Z1D A;  2X6O A;  1TWC J;  2E1N A;  2W24 A;  4M73 A;  5F27 A;  5IYD J;  1MJB A;  4FHT A;  3OY9 A;  1HW5 A;  2Z5U A;  4XKV A;  4FET A;  5GAH J;  1UEL B;  2O7O A;  4ZH4 F;  2IBD A;  1G3S A;  3N05 A;  1YE9 A;  1VND A;  1WKM A;  2XGC A;  3LSG A;  1FOK A;  1X1B A;  2X1C A;  2VKD A;  2XPU A;  5ED4 A;  3BOQ A;  2Z33 A;  1U6G A;  3ML6 A;  1ETW A;  2CO5 A;  4X6A J;  1FIA A;  2L9N A;  3PSF A;  2MC4 A;  4Y33 A;  1ETO A;  4EM2 A;  2DT7 B;  1FBS A;  2ZC2 A;  3F8M A;  3Q0U A;  1QNT A;  2EV6 A;  1B59 A;  3CF5 F;  2RAE A;  1WWX A;  4MTE A;  4JX6 A;  1K61 A;  3H92 A;  1IGN A;  4P55 A;  1XMK A;  4LB5 A;  4IKF A;  4XID A;  2STT A;  1P4W A;  2R7X A;  4U7D A;  2JA6 J;  1JUP A;  1R4M B;  4M3F A;  2FX0 A;  2XAQ A;  3BP8 A;  4ZYG A;  5BPD A;  1F5T A;  3SFI A;  2NS8 A;  2DOE A;  3OIP A;  1HDD C;  3RPQ A;  2XGX A;  3MQ0 A;  3M7G A;  2WC2 A;  1MBG A;  1RKT A;  3NAU A;  3DTI A;  2IW5 A;  2TCT A;  2H09 A;  2JVG A;  2BY1 A;  2KJC A;  2JTV A;  3EUA A;  2NOJ B;  1IJW C;  3JAM Z;  4ABZ A;  3MZH A;  2M1B A;  4I6Z A;  2D5V A;  1FTZ A;  3QU6 A;  5EF6 A;  4L9N A;  4L0Y B;  3ZMU A;  4BJ5 C;  1YIJ I;  1TTY A;  2EV0 A;  2VXD A;  1U0J A;  2P7V B;  3BCB A;  4UNO A;  3S14 J;  2IGO A;  3I53 A;  3L2Q A;  2JJ7 A;  2K9M A;  4AC0 A;  4ANJ A;  1SFU A;  4E7K A;  2CUJ A;  4XLE A;  4D1Q A;  2EFN A;  1MBK A;  4PFO A;  1QGP A;  2DOD A;  3P9I A;  1D0Y A;  5LRS A;  5M5W J;  2VQL A;  3BZ6 A;  2XV4 S;  3F21 A;  2CWE A;  1BR1 A;  1F36 A;  2EIM H;  1U9O A;  5HS7 A;  1D8J A;  2DTZ A;  1I3A A;  1HW2 A;  2E1C A;  4BQN A;  2PJR B;  2L02 A;  5FO5 A;  3VSL A;  5TJJ A;  3S1R J;  4A3G J;  2DA4 A;  2FOK A;  2M9H A;  2YX7 A;  5GPC A;  1D3Y A;  4WK8 F;  2Q8K A;  4BXX J;  3TDZ C;  1AHD P;  2WAE A;  1FZP B;  4HW0 A;  1MMG A;  4OIO F;  4P9U A;  2BV6 A;  5ERI A;  1HBX G;  1T2K A;  3Q9V A;  4ASN A;  2E1M C;  1T38 A;  2ETH A;  3D1N I;  5IPA A;  1IN5 A;  3ELK A;  4BY7 J;  3A02 A;  1PP7 U;  2NNN A;  3O6B B;  1P92 A;  3K4B A;  4N0B A;  4I09 A;  2LSO A;  3WTX C;  4E7J A;  1F43 A;  2J5P A;  3G1L A;  3CCL I;  2XAF A;  4PUS A;  4GRI A;  2HDD A;  1BM9 A;  2HWV A;  1O3Q A;  2XSJ C;  2HOS A;  2CUE A;  4MEX F;  3AKZ A;  1ZN2 A;  5CKT A;  1PVE A;  3OL4 A;  1S8N A;  1XS9 A;  5IT9 Z;  3LL7 A;  3IH3 A;  4NB5 A;  1I1G A;  4QLC U;  1IXC A;  3BRO A;  3ZP5 A;  1ZR2 A;  1AWC A;  2VUM J;  1IDZ A;  3F72 A;  1MDM B;  1XD7 A;  2O5R A;  2MH9 A;  2MD0 A;  5AIQ A;  4P1W A;  3PL8 A;  2FBH A;  4LOC A;  1QPI A;  3I5U A;  3VDX A;  3K7A J;  4LG3 A;  2QCO A;  3CLQ A;  4N4O B;  3P7N A;  4BE2 A;  3OS1 A;  1HKT A;  1LNW A;  1DDN A;  3E6C C;  1Z91 A;  1Z6R A;  2F5C A;  4A0Z A;  5DM7 F;  3BR2 A;  3TED A;  4WF2 A;  3H1C A;  3KLO A;  2IGM A;  3VYU B;  2A3S A;  3BR0 A;  1J9I A;  3CO6 C;  3FX3 A;  3LSI A;  2KKO A;  3ZMD A;  1X2N A;  3BWG A;  4CCN A;  2MLG A;  4RGX A;  2FU4 A;  4LK1 F;  5IP7 J;  1B6A A;  5K7F A;  3G6E I;  2V6E A;  4E4H A;  1T0F C;  5IP9 J;  1P9Q C;  2W7N A;  1K6Y A;  1DPU A;  2FJ1 A;  2XAS A;  2RNG A;  2IT0 A;  1IV8 A;  3A4C A;  1DPR A;  2EIN H;  4OAZ A;  3KP3 A;  5JLX A;  1D1B A;  2NVU B;  3RI4 A;  3HOW J;  3DP7 A;  2LBF B;  4D7M A;  4P9F A;  2KRH A;  2FSW A;  4RB1 A;  2GLO A;  4LMY A;  4IZZ A;  1T56 A;  2JN6 A;  2VJJ A;  2K7L A;  4B43 A;  4KDP A;  4G94 A;  2XAU A;  1GV5 A;  5J4V A;  3JRE A;  3I4N J;  3EUH A;  4EJV A;  2EZK A;  2XF5 A;  2R7W A;  2EPF A;  4B09 A;  5FKL A;  4CCK A;  4EAT A;  3IC7 A;  1V5G A;  2LKS A;  1E3O C;  1FYL A;  1EJ9 A;  2V9K A;  3KP7 A;  2QBY B;  2NXN B;  3S93 A;  2CFO A;  4RAY A;  1MDM A;  1V4R A;  2UXX A;  4C9Y A;  5HVQ C;  2Z9O A;  1EF4 A;  4M3B A;  5CVJ A;  1W0T A;  5D6E A;  2DK5 A;  2HNH A;  1D0X A;  4WWC A;  3S3O A;  1ZLJ A;  1OLT A;  3IRR A;  1BI2 A;  2QEX I;  2VT2 A;  2GAU A;  5LGN A;  3TP3 A;  1XMA A;  2M2E A;  4OIR F;  3F8F A;  2QWW A;  1VQ6 I;  3SHF A;  4JK1 X;  2KZV A;  4N4N B;  2ZNZ A;  5IOZ A;  2E7W A;  4DW6 A;  5J47 A;  1O4X A;  1I6H J;  1GDT A;  3E5U A;  4DYQ A;  2F48 A;  2RVC A;  3OV8 A;  4XOT A;  1I39 A;  1RI7 A;  3OWT A;  2LC2 A;  1ORK A;  1X4O A;  1ENH A;  2D1V A;  2D2W A;  2XGE A;  2BHY A;  3GFJ A;  5CLS A;  4CYC B;  3ZRG A;  3MKW B;  3SJM A;  4C2U A;  1WJB A;  3H9J A;  3TMO A;  2WAF A;  1BL0 A;  2UWM A;  1OIS A;  3W2W A;  5HLI A;  2VQC A;  1POG A;  2A68 F;  3PNT A;  4BQA A;  4HX7 A;  2LBF A;  4NBQ A;  4ZYD A;  3TBI A;  1ZRE A;  1R7J A;  1C0W A;  3R6S A;  2GXG A;  5CVR A;  2ZXW H;  1YO5 C;  2E36 A;  1I6X A;  3DLA A;  5KAI C;  2QSF X;  4BGD A;  1IN8 A;  3L1P A;  3D5S C;  3K4C A;  4A5N A;  3W3C A;  3K0L A;  5TRD A;  2QM3 A;  2DQL A;  3CJQ B;  2BOL A;  2DO7 A;  1EH8 A;  3GVA A;  5CJ9 A;  3ZGK A;  2NVY J;  4DZP A;  2BZT A;  1ZH5 A;  2XRL A;  1B9M A;  2QBY A;  2XAG A;  3E6B A;  2XRN A;  4UV8 A;  3CD6 I;  1DU0 A;  3BJO A;  1N25 A;  3G4S I;  1ZTR A;  3E0J B;  3PSI A;  2L9R A;  2FBK A;  3FHZ A;  3WTW C;  3HM5 A;  3DLL F;  2OA4 A;  4LIV A;  5HNH A;  3SDB A;  4KIT B;  5GAE J;  5DDG A;  3M3Y J;  1D5V A;  4L5J A;  5E8G A;  1JUM A;  3I0T A;  3BPX A;  3OOU A;  1BBY A;  4KIB A;  4ZZD A;  2VLA A;  4LGW A;  4C2T A;  1MBE A;  1O7L A;  1FBQ A;  4MIM A;  3ZCO A;  4OMY A;  3DQV C;  4UY8 I;  5FRO A;  1QZY A;  2DFH A;  3IHU A;  4U0V A;  4CYC A;  3ROU A;  5DTD A;  4HRI A;  3KCC A;  4IHS A;  2HGC A;  4QSH A;  4PJL A;  4A3M J;  1ZG5 A;  2VC1 A;  3HRM A;  4J01 A;  2Y9Z A;  3LA3 A;  3TOA A;  4BKX A;  1R1T A;  2AQF A;  1D8K A;  5L3E A;  3VOE A;  1LPQ A;  1FX7 A;  2OZU A;  4L9V A;  1MBJ A;  2LRE A;  3RPU D;  2DA6 A;  1W5C C;  4CUG A;  5IOY A;  3BJA A;  4YIF A;  3R61 A;  5F0C A;  4HF1 A;  3DU6 A;  4NUB A;  4F92 B;  2HOA A;  3PO2 J;  1ETK A;  4XLC A;  3B73 A;  3QRF F;  3Q9S A;  2JK3 A;  4E7S A;  3ERM A;  1XMX A;  2EFO A;  1YFH A;  4I02 A;  4YFN F;  1UHS A;  3RIR A;  4HBL A;  4A3F J;  2DMN A;  1KU9 A;  5CQG A;  2L2O A;  2JSC A;  2ZXH A;  2VE8 A;  1TWG J;  1A5J A;  3LQQ A;  5DCF A;  3MFK A;  4BUP A;  1IRF A;  3TW7 A;  1AA7 A;  2F5V A;  1NK2 P;  1MSE C;  3ABK H;  3WE3 A;  2XHK A;  2MA3 A;  2ZJ2 A;  3BZC A;  5TIS C;  1X3Z B;  4JX4 A;  3S16 J;  4L9J A;  4UVB A;  1BOB A;  5AON A;  2FNA A;  3F9K A;  5JLW A;  4BXF A;  2M7A A;  3TP0 A;  1E3H A;  2ZJP F;  2H8R A;  2V1X A;  2NVQ J;  3LSJ A;  1S72 I;  3GLL A;  1LJ9 A;  5H6Q A;  4DYR A;  1RNL A;  2AXT C;  3K1P A;  1VZ0 A;  2CS3 A;  5FRM A;  4AYB A;  1VTN C;  2OAZ A;  5E18 F;  1RZ4 A;  1FTT A;  1MIJ A;  3EPZ A;  3HSF A;  4F52 A;  4ESJ A;  5HNF A;  2IAI A;  1R23 A;  3FXQ A;  3R0A A;  2EFW A;  3BR3 A;  5EDN A;  3FKJ A;  2LKX A;  2JUG A;  4DBQ A;  2KIU A;  2B7E A;  1MND A;  4G7Z F;  2DOF A;  2CQQ A;  2K3F A;  1K78 B;  2LYC A;  4A2U A;  2LMD A;  2OC6 A;  2DMQ A;  2HDC A;  5JVT A;  1VQM I;  5F1R A;  1APL C;  5J3L A;  3SFZ A;  2OD5 A;  4NQW A;  1T33 A;  5E79 C;  1EA3 A;  1BC7 C;  3G1M A;  3TL4 X;  3BQZ A;  2OF7 A;  2K9L A;  3E7L A;  1JGS A;  2CYY A;  3ONQ A;  3VYR B;  1MKM A;  3HC7 A;  4KT5 C;  2WWY A;  4BYY A;  5M5X J;  3PNV A;  2PMZ A;  4XRS A;  2W57 A;  1JHF A;  3LAJ A;  2V7F A;  4B3A A;  3Q5F A;  4V19 K;  3CJR B;  3IWZ A;  1OCR H;  2PG4 A;  4BE1 A;  5BQT A;  3B6A A;  3JRD A;  3F8B A;  4IQ4 A;  2ADU A;  4CSW A;  5ILV A;  1XTA A;  1WH5 A;  4RDU A;  1OPC A;  3HPH A;  3LA7 A;  5GTI C;  1LDK B;  2ZKZ A;  1G4D A;  5F64 A;  5HS9 A;  3JTG A;  1R4N B;  4YEJ A;  3FK7 A;  3SDG A;  4AUX A;  1GLN A;  2LG4 A;  3SEZ A;  2PX9 A;  3CME I;  4FCY A;  4IEJ A;  5F0F A;  3WTU C;  3CDL A;  2STW A;  3L2R A;  1LEA A;  2A6E F;  1GXQ A;  3AG3 H;  1J75 A;  2K9N A;  1A35 A;  2CW0 F;  1FOY A;  2ZME B;  1K78 A;  4Q47 A;  4R8H A;  3FWE A;  3CJN A;  2XC7 A;  3LFU A;  2FML A;  1MJA A;  5FKN A;  3S17 J;  2X48 A;  3VB2 A;  1IO2 A;  2EIL H;  4BU2 A;  3MAJ A;  4LLN A;  1T39 A;  5M5Y J;  2JUC A;  4ESF A;  2X6Y A;  2BYV E;  1K83 J;  4XSX F;  3DV8 A;  4IHV A;  1QPM A;  3MKZ A;  3P9C A;  2K27 A;  3VYS B;  2WAD A;  3NEU A;  5FB2 A;  2X85 A;  4XBF A;  4X1E A;  2HI3 A;  3DTE A;  1MZB A;  4D9J A;  1WJD A;  4EJO A;  2BEO A;  5D5U B;  4AVZ A;  1FYK A;  3IH4 A;  3CDI A;  3GTJ J;  3F8N A;  1SFO J;  1QHG A;  3RYR A;  2V9P A;  2RDP A;  2PMU A;  5CVU A;  1FT9 A;  3KE2 A;  2PFB A;  1SD5 A;  1HW1 A;  1R1V A;  2M4K A;  4A3E J;  4C3H J;  2E19 A;  1ZG3 A;  2JRT A;  3GYH X;  1I50 J;  2LFB A;  2IEK A;  2R7T A;  3R0J A;  3BR6 A;  3CCU I;  5D4R A;  2CU7 A;  2KLO A;  1ZRF A;  3KEO A;  2AS5 F;  3N97 A;  1FY7 A;  4KIS A;  1WPK A;  3DCF A;  2DI3 A;  3MCZ A;  3HTU A;  2Y0S N;  4P5O A;  4GYI A;  3UR3 C;  1U5T B;  3CUQ C;  2ZME A;  2Y69 H;  3D0S A;  1Z6T A;  3P5J A;  1UB9 A;  1BJZ A;  5M3F J;  1DGR M;  3FXU A;  3QPL A;  3ZMZ A;  3IKV A;  2VL8 A;  2UXN A;  1QRY A;  4D7N A;  3H36 A;  3LA2 A;  2BXY A;  1S9H A;  1FP2 A;  2RQQ A;  3CCM I;  4FX0 A;  3L00 A;  3ZR8 X;  1IDY A;  4BBS J;  1TWF J;  1G3Y A;  4HZF A;  5H20 A;  2A61 A;  2J5O A;  4MQV A;  3T0Y A;  1SD7 A;  2ELH A;  2FQ3 A;  3QYE A;  3RKX A;  1ACI A;  5K1Y A;  4CCL A;  3RCO A;  2VOO A;  5EYR A;  1O57 A;  3K2A A;  4GO1 A;  3GF2 A;  1X1P A;  1IRX A;  3L2U A;  4XLH A;  4M9X A;  1TNS A;  3RDI A;  1ZRC A;  4NHJ A;  2GM4 A;  4HNT A;  1ZR4 A;  3JRI A;  2ZJR F;  4UV9 A;  1TW2 A;  2R7S A;  4DYC A;  4ZYH A;  5E8I A;  4B3X A;  1R5G A;  3NRV A;  4ZZL A;  4EJW A;  3FF5 A;  3ZQH A;  2KIS A;  1U8R A;  1G8X A;  1VQ4 I;  1SAN A;  2IS6 A;  4EV0 A;  2GXB A;  3E5X A;  1RR8 C;  2ZBK A;  3KZY A;  1I5Z A;  2K3P A;  1BIB A;  4XLA A;  5KK1 A;  2VE9 A;  2D1H A;  2HYG D;  4NDL A;  4KYW A;  5D8K B;  2R7U A;  2HPI A;  2KFD A;  2NVT J;  1MMN A;  1IZ1 A;  1U5T A;  1J2X A;  3WTV C;  3ISP A;  4X0G A;  1YTY A;  2JA7 J;  1BW5 A;  2Z99 A;  1MBH A;  2QQB A;  1TLH B;  2R7Z J;  4HNU A;  1V55 H;  2VXZ A;  3QAH A;  3JRB A;  5CPR B;  2BGC A;  2EIK H;  4MHG A;  1R1U A;  4CZC A;  3CCR I;  4IHW A;  1WJE A;  2HXO A;  3F8C A;  2P5K A;  4BHP A;  5JFR A;  4BHC A;  1QVT A;  1D5Y A;  3E6M A;  1R58 A;  2QQ8 A;  4A3K J;  1GVJ A;  3EET A;  3OMY A;  3T8R A;  3MD2 A;  2YU3 A;  1YJW I;  4H4K C;  3M1C A;  3M8E A;  4AU7 A;  3RJP A;  2QEN A;  2LF7 A;  3WGI A;  1U78 A;  2FD5 A;  3AG1 H;  1EH6 A;  1LEB A;  1FEX A;  1Z1D A;  5FD6 A;  3CP8 A;  2VBW A;  4AM3 A;  1V5E A;  3S8P A;  2E35 A;  5EGO A;  3BDD A;  1MGT A;  4FTH A;  5HDN A;  3HOT A;  3KP2 A;  3F0C A;  1CGP A;  4IO9 F;  1P2F A;  1K4S A;  2R0Q C;  2EBI A;  5LHI A;  5E3M A;  2H27 A;  5LRR A;  1WFX A;  1H0M A;  3EDP A;  4BAY A;  4I98 B;  5DM6 F;  1Z77 A;  2GWR A;  2EV5 A;  3S32 A;  3JRH A;  1IAW A;  3M9A A;  5HOD A;  2R3S A;  3JSP A;  4RGU A;  1VQ9 I;  5H6R A;  2H6C A;  3H5A A;  3W6J B;  2X0L A;  5FJ8 J;  2VN2 A;  1X58 A;  2VBY A;  1R36 A;  2KDO A;  5JVG F;  1SFX A;  1JGG A;  2XF7 A;  5EEA A;  2X51 A;  3VSK A;  1YRN B;  3BG9 A;  3NQO A;  2OZ6 A;  3QOP A;  3ZQQ A;  5LHG A;  1JKP C;  3A2K A;  3K9T A;  1ON1 A;  3I59 B;  1UHM A;  2RV8 A;  3OSG A;  2VB6 A;  3TDU C;  1D0Z A;  2MAB A;  2Y0M A;  3HG9 A;  3ZN0 A;  1X1C A;  5HS8 A;  1KQ8 A;  3LNQ A;  1IW7 F;  1AOY A;  2DA3 A;  1FNN A;  4CCO A;  1YW7 A;  2OQR A;  4OAY A;  3J80 K;  2M34 A;  2DMT A;  1RUO A;  3DWL E;  1FSH A;  2A6T A;  2DBB A;  1UG2 A;  4L5I A;  3CC4 I;  3OYE A;  2DA1 A;  1U9N A;  4LIU A;  1HDP A;  2XIG A;  3LOC A;  5C4J J;  1PYV A;  1YS7 A;  1T95 A;  5KHD A;  3OYI A;  3K70 D;  2GA1 A;  1NG7 A;  1Z7L A;  2E1O A;  1TT0 A;  2K5C A;  4Y15 A;  3GTG J;  1L0O C;  1BI1 A;  1XPX A;  3OYL A;  1W4M A;  2ECC A;  2XPW A;  4A6D A;  1N77 A;  4XL9 A;  2P5L C;  1JTY A;  1SAX A;  1TW3 A;  3F3X A;  5KCM A;  3OSF A;  2HOT A;  2VJI A;  3KEQ A;  2JZY A;  3NWT A;  1E17 A;  2DA2 A;  4G6D A;  2CRG A;  2CUF A;  2IA0 A;  5ICE A;  1PUF B;  4LLG F;  4WCG A;  2R5Y B;  2QQ9 A;  2NNY A;  2L5Q A;  3ZMT A;  1RR7 A;  4XQF A;  4B4C A;  3ZQG A;  4GDF A;  3ASN H;  4IQJ A;  4IHY A;  2MBF A;  5LFA A;  1BOA A;  1ODD A;  4CIC A;  5C3E J;  4FT8 A;  4XKB A;  4HLY A;  4Z2Y A;  4FX4 A;  3ESW B;  2W85 A;  2PJR A;  2BVM A;  1OCT C;  2LK2 A;  1KON A;  4U0W A;  2Y30 A;  4PJN A;  1EKE A;  4Y4R A;  3JRA A;  1A6I A;  3CCE I;  1G2H A;  5D5V B;  5DD4 A;  1Y8Q B;  2OV7 A;  2DPU A;  2LLK A;  1K79 A;  5HLH A;  1MJ9 A;  1OR7 C;  2VBX A;  3RKW A;  2DFI A;  3C18 A;  2QA4 I;  3BT9 A;  5ICF A;  3ECO A;  3K4N A;  4LG0 B;  1R6R A;  2JVH A;  4B47 A;  2DYR H;  3M1E A;  2M0C A;  3BTC A;  1DUX C;  3WTZ A;  1IC8 A;  4HSR A;  5DV5 A;  2GBY A;  4II2 A;  5J1Y A;  4XMY A;  2HKX A;  1X19 A;  2FMY A;  3CTA A;  4AD9 A;  4BL0 B;  1S7O A;  2LY2 A;  4FIS A;  3WHC A;  2HXI A;  2EA2 A;  1EH7 A;  3DBH B;  3QP6 A;  2EZI A;  3FXL A;  4MFE A;  2QKL B;  5C44 J;  4PJJ A;  2ZXI A;  4E7L A;  2QGU A;  3ZXS A;  4BJT A;  4PGH A;  4ZYA A;  2IP2 A;  3QWL A;  1TWH J;  2DT5 A;  4D5F A;  1NH3 A;  1PUF A;  3BTL A;  2R5Y A;  1IRG A;  1LVA A;  4H0E A;  4ENN A;  5E1W A;  1ON2 A;  1YJ9 I;  3GTL J;  3Q0V A;  4N9I A;  3KP4 A;  3GLX A;  1WCM J;  3KYL A;  3HOS A;  4I7H A;  1DGW Y;  2JSP A;  1STZ A;  3LSM A;  4WXH A;  2L7M P;  2D45 A;  2A05 A;  4O6J A;  2QSG X;  2DFF A;  4MFD A;  3AL0 C;  2O6G E;  2HTS A;  3W2A A;  2PI0 A;  3R4K A;  1QZZ A;  4S04 A;  2IRF G;  4HV6 A;  4D5C A;  5L3C A;  1GV2 A;  4K2E A;  3C1D A;  4JOM A;  3ZQ7 A;  1TQM A;  1LDD A;  2PMH A;  3MZ8 A;  5F6F A;  2DLL A;  1ZEL A;  3S2D J;  4ENM A;  5FFZ A;  2M4G A;  4BDY A;  2Q0O A;  4G7O F;  2CW7 A;  2KP6 A;  2R7R A;  4XN0 A;  2X4H A;  5FLM J;  2AHQ A;  4LG0 A;  2JT1 A;  5DS9 A;  2VT3 A;  1WJ5 A;  3JTH A;  2TRT A;  2EWN A;  2V1D A;  3A01 B;  2R7D A;  3AG4 H;  1S7E A;  5IYB J;  1F9N A;  1WHU A;  3UKG A;  1V5F A;  4HEA 2;  2KIQ A;  1O3R A;  2MLK A;  2P6S A;  1RRJ A;  2EB7 A;  3RZD J;  2QF7 A;  4F55 A;  2IGK A;  2WB1 N;  2FUG 2;  3V8J A;  1W0U A;  1KZH A;  1FPQ A;  1J5Y A;  2OQG A;  5DUI A;  4GFB A;  1HQC A;  4PCQ A;  4AWX B;  1KA8 A;  5FLX K;  4HA8 A;  4E6K G;  2BBY A;  2E2I J;  5BOX A;  5HOO A;  2F4O B;  5B66 C;  4IX7 A;  1KGS A;  1IUY A;  3M07 A;  4G12 A;  1A04 A;  1MMS A;  4HDV A;  1Z3Y A;  4HLX A;  1OYI A;  2Z3Y A;  4RAF A;  2WB1 A;  3MKL A;  4S0H B;  2DOA A;  1XSD A;  3QYF A;  2PLY A;  3GBG A;  1X3U A;  1P4A A;  3DPU A;  3BQY A;  3GFL A;  4G6T B;  1HSJ A;  3GUD A;  4YEL A;  3C3W A;  2P7C B;  4A3B J;  1UAA A;  1VI0 A;  3Q0W A;  1Q1H A;  2V79 A;  4OU0 A;  4RGS A;  4MEY F;  1Z3X A;  5E20 A;  4JP0 A;  1X2M A;  5D4S A;  2DT6 A;  5F04 A;  3H0D A;  5FKO A;  2CW8 A;  2A69 F;  3A03 A;  1HF0 A;  2HVQ A;  2NOG A;  2FBI A;  4LB6 B;  5FLV A;  4HX8 A;  4C3I J;  2WAQ N;  3HXL A;  3T5X A;  2RGV A;  4IRH A;  4DZJ A;  4UUV A;  1BI0 A;  3L7W A;  1WJC A;  3A01 A;  3K4L A;  1QU3 A;  3OIO A;  1HST A;  4HX4 A;  1YYV A;  1IXS B;  1JHH A;  2HYJ A;  2HZD A;  2OCE A;  4GYG A;  2Z2S B;  1PP8 F;  4OIP F;  2ESH A;  1SD6 A;  4YFK F;  2XSD C;  4G9Y A;  4L9T A;  3L2W A;  2ELJ A;  1JUS A;  5IP6 A;  1GVD A;  3SQN A;  4J19 A;  2E71 A;  3HB9 A;  1YX5 A;  4WXD A;  3LSP A;  4A3I J;  2WAQ A;  3S15 J;  3COA C;  2DQR A;  4E7H A;  3S3N A;  2K40 A;  2E34 A;  1P4X A;  4BS9 A;  3G71 I;  1Y56 A;  2DK8 A;  3JRG A;  2CG4 A;  3WG9 A;  2QVO A;  3CUO A;  3L09 A;  1XSX A;  2WY8 Q;  5LD2 C;  2NVX J;  1REP C;  3I54 A;  2BHZ A;  3KYC B;  4HG2 A;  3I58 A;  3WTS C;  1IXR C;  5FRN A;  2ZNY A;  1G3T A;  1SVO A;  2P6T A;  3GTM J;  5D5W B;  1A36 A;  2O8X A;  3J81 K;  2W82 A;  2CMP A;  5BS6 A;  5B1A H;  4O5V A;  4KUM A;  4B48 A;  2HPM A;  3DTK A;  1FC3 A;  1XSV A;  2KIF A;  3IH2 A;  5K7Z A;  3K4K A;  5K5O A;  4KIC A;  2V1U A;  2E1M B;  3FBN B;  3OYH A;  2LF8 A;  2DA5 A;  3FXM A;  1Y6I A;  3VPR A;  2WY7 Q;  4UB8 C;  2M3A A;  4UVC A;  3KFW X;  2F5D A;  5E1Z B;  3AAF A;  4HOB A;  2ICW G;  3K1M A;  1VQ5 I;  1TZL A;  2A6H F;  4RLF A;  1Y39 A;  4HQM A;  3RPU A;  2BW3 B;  5ICC A;  3OYF A;  4KFC A;  1UST A;  1Y0N A;  2UUZ A;  2LNB A;  1B9N A;  1RC9 A;  3GTQ J;  1KU2 A;  2VPR A;  2RNJ A;  1W5T A;  3HOZ J;  1TL8 A;  1NK3 P;  3OR1 C;  2FOW A;  1BC8 C;  4WX9 A;  1YW9 A;  2HVS A;  1TWA J;  3HHG A;  4ENK A;  4GCV A;  3Q3S A;  5HLT A;  4AIK A;  3O8G A;  1WQ2 A;  4P96 A;  5LGT A;  1G59 A;  5K5R A;  5L3B A;  2ELK A;  3TO9 A;  3U21 A;  3FMQ A;  3MMY B;  5D8L B;  2KZG A;  2DXI A;  2H6B A;  3VOD A;  2XPV A;  3GEZ A;  3O2P E;  1QA6 A;  3CMM A;  4QPO A;  3RKY A;  1W36 C;  1TC3 C;  2QZ8 A;  5EZH A;  3V42 A;  4O3M A;  2JRM A;  5ICG A;  1KYW A;  3V7S A;  3BR1 A;  4KN7 X;  5JHF A;  2MFZ A;  3OYG A;  1WSU A;  1LKX A;  1ZGA A;  3FXR A;  2L7F P;  3HIF A;  4CCJ A;  1DP7 P;  1EV7 A;  2FXA A;  5DUK A;  2DJN A;  3DPT A;  1OKR A;  1SVL A;  2GOX B;  3PUB A;  1BIA A;  4A3J J;  1W5S A;  2VJ5 A;  3GTK J;  4IHX A;  3ZN1 A;  3DEW A;  1MD0 A;  2KJB A;  5EEH A;  3ULQ B;  4RGR A;  4W1U A;  4RAZ A;  2LDU A;  2RKH A;  4CHU A;  3IP4 B;  1FMV A;  3V7C A;  2R4G A;  4QPQ A;  2CV1 A;  3OR2 C;  2PQ8 A;  4UHT A;  2OUM A;  3BY6 A;  4ESB A;  1BA5 A;  1SMT A;  3GME A;  1QO0 D;  1SMY F;  2EZH A;  3H9G A;  4G7H F;  1ZQ3 P;  5C4X J;  2W00 A;  5LEJ A;  1W7P B;  3G1O A;  1KU7 A;  4XN3 A;  2PJP A;  1D1A A;  1NHA A;  2BVL A;  4Y17 A;  2P8T A;  2DMP A;  3RTR A;  2YUS A;  2FF4 A;  2HQR A;  3E1S A;  3FZV A;  4NC7 A;  3PIP F;  1W7P D;  2AQE A;  5LHH A;  2RQP A;  1WZ2 A;  4IXA A;  3O3K A;  1BI3 A;  3HOV J;  2EFP A;  3FHN A;  4ZJZ A;  3WTY C;  4A3L J;  2O61 A;  2TDX A;  1ZAR A;  4YII A;  2XF6 A;  2HZT A;  1X3W B;  4CO8 A;  4RA2 A;  3L2C A;  3G73 A;  5HDK A;  3EUH C;  2O03 A;  3BCA A;  5CVI A;  4EGZ A;  5IY5 H;  3HDD A;  3CCY A;  1L3L A;  2XRO A;  1Z0X A;  2XAH A;  3U2R A;  1R9T J;  3H3V K;  1MNM C;  2VIX A;  3JRC A;  3RSN A;  4M71 A;  5F1J A;  1T0F A;  2Y31 A;  3PIO F;  4DGW B;  2KL4 A;  4M9Z A;  1SVM A;  3BPV A;  2PN6 A;  3E97 A;  4RLQ A;  5JHU A;  1OYY A;  4A6E A;  2R7Q A;  3T1B A;  4EGY A;  2W1O A;  2JPB A;  2KHM A;  4E7Z A;  4UUS B;  2E5Z A;  2DFE A;  2O9L A;  4M72 A;  4PSW A;  4C30 A;  3LWF A;  3MWM A;  4XOR A;  3U1K A;  3HOU J;  3ZMV A;  3PFI A;  3I3L A;  3VFZ A;  4HNV A;  3TQN A;  3BC8 A;  1SD4 A;  1SEU A;  2VOP A;  3DF8 A;  1W7P A;  4MLO A;  1GXP A;  1PDN C;  4U87 A;  2G7U A;  5KVR A;  3W6K B;  1JKO C;  2JA5 J;  4YIR X;  4ETS A;  2L4A A;  4BQO A;  3QU3 A;  4RAG A;  2ESN A;  2LD5 A;  2L7Z A;  4BJ6 C;  4HST A;  2KMU A;  2VON A;  3I9V 2;  2WV1 A;  3CMA I;  5HDG A;  1E2X A;  2IA2 A;  1UCR A;  4AID A;  1ZYR F;  3NAR A;  3HOX J;  3BG6 A;  4OWR B;  4DNC A;  1S7A A;  3L9F A;  3DU5 A;  3BR5 A;  1HLV A;  2Y0S A;  2GZW A;  4GXO A;  2QUF A;  5J6X A;  1Y1W J;  1VFC A;  4UVA A;  3OYJ A;  4L0Z B;  1FWZ A;  4BBR J;  2CQ7 A;  1XGN A;  3MVP A;  2GXA A;  3FBI B;  2LY9 A;  2HFH A;  2LR8 A;  4Y13 A;  2XDV A;  5FFX A;  2GQQ A;  1X1A A;  1FLI A;  2K85 A;  4I76 A;  4UUS A;  2Z16 A;  1DP3 A;  3S3M A;  2EQR A;  1JTX A;  2L4M A;  3AFH A;  3CC7 I;  4C2M J;  4G6Q A;  2BE5 F;  1M1E B;  4RB2 C;  4IOC F;  3SZP A;  4DOZ A;  1QHH D;  5EEG A;  1DU6 A;  1O3T A;  1SAU A;  3CDH A;  4IRI A;  3B6C A;  2G0E A;  1YHQ I;  4RM2 A;  4KIF A;  3HRU A;  1T98 A;  3F6V A;  3HZJ A;  1ERD A;  3VYT B;  4U88 A;  1OYW A;  3EYI A;  2K02 A;  4NC8 A;  2OPT A;  3AG2 H;  1E3P A;  2K86 A;  4M6V A;  2JA2 A;  1HC8 A;  2XB5 A;  4AIH A;  3TGN A;  3FIS A;  3E3V A;  4BDZ A;  4EJU A;  1XB4 A;  1YQA A;  2ME0 A;  5E3L A;  2IA1 A;  2P81 A;  3TO6 A;  4II3 A;  4MNU A;  5B1B H;  3OIQ A;  1KYZ A;  4ZC3 A;  2VJ4 A;  2EZL A;  3DEU A;  2HVR A;  3KP5 A;  2VI6 A;  4ZDP A;  4TV7 A;  2MD5 A;  2L54 A;  4EM0 B;  2ZFU A;  2VOD A;  3E6D A;  4Q5S F;  4XM3 A;  2OTJ I;  4ZDO A;  1G3W A;  1VQK I;  4KMF A;  1P7I A;  3C2G A;  3QOE A;  5J8C A;  3ZQC A;  2IS2 A;  4XRF A;  3HYI A;  4EMS A;  2CH0 A;  2FRH A;  1RKW A;  1YIO A;  4A0Y A;  4B8X A;  1BW6 A;  3I4P A;  2EK5 A;  4A5M A;  1QVU A;  1YS6 A;  4JYK A;  4N9H A;  3X2Q H;  2W84 A;  2ZSH B;  5L3D A;  4MTD A;  1Q1V A;  3ABU A;  2E5N A;  4OIQ F;  1YIT I;  2HTJ A;  2NRA C;  1KQ9 A;  2MW8 A;  3HRT A;  4DQ2 A;  3JAM K;  2YU9 J;  2CQN A;  4EVI A;  3KYD B;  3HSE A;  4B1R A;  3KX2 A;  4OIN F;  2BY0 A;  4E70 A;  1N75 A;  1ETX A;  2VKE A;  3OYK A;  1XX5 A;  4L5E A;  3PQJ A;  5LEK A;  1AU7 A;  1Y8R B;  3VEP A;  2I10 A;  2ZJQ F;  2DN0 A;  3GTP J;  3FDY A;  2V6C A;  3GWZ A;  3BLY A;  1WH7 A;  3WGG A;  3CCJ I;  1WI9 A;  1S29 A;  2Y9Y A;  2K9Q A;  1XCV A;  1UMQ A;  3WU1 B;  3CQZ J;  1W36 D;  3U9G A;  2R7V A;  4XNF A;  4Q48 A;  3HSR A;  2H1L A;  2W25 A;  3PQK A;  5FD5 A;  3FIW A;  2MH2 A;  4G8X A;  1BR4 A;  2LKP A;  3J80 Z;  4M3D A;  2CGP A;  4FAS D;  4HYE A;  4UB6 C;  3QYB A;  3PJR A;  5K5Q A;  4M9S A;  3HPG A;  1TBX A;  4BHB A;  4M6Y A;  3QPT A;  3M8F A;  1VQO I;  3F23 A;  4XRS G;  1USS A;  3IKT A;  5FKK A;  3JCU C;  5E17 F;  1B1B A;  2ECB A;  2XAJ A;  4Z6Y A;  1IF1 A;  2VPL A;  1MNE A;  1J09 A;  2CJJ A;  2L0K A;  3LSH A;  2X6X A;  3HEF A;  4ZTJ A;  3FM3 A;  3T8T A;  2K4J A;  4MO7 A;  1VQL I;  3H5N A;  2OTL I;  3ZQF A;  1QBJ A;  3K4M A;  1XN7 A;  3HGG A;  4RB3 C;  1MSF C;  1S5L C;  4QWQ A;  3I59 A;  3DEE A;  2R7O A;  2HQ5 A;  2Y2Z A;  1MH3 A;  4KT6 A;  5B5E C;  1UFM A;  5E3O A;  1JKQ C;  5IT9 K;  1ZRD A;  2F5E A;  2V4J C; 
#chains in the Genus database with same CATH homology
 3CCM I;  4V19 K;  2OTJ I;  1VQK I;  2JQ7 A;  2QEX I;  1QA6 A;  5GAH J;  1ACI A;  1VQ6 I;  3CCL I;  3CME I;  3CMA I;  1YIT I;  2ZJR F;  1YJ9 I;  5GAG J;  1FOY A;  3CC4 I;  1VQP I;  3CF5 F;  3J7Z I;  3CCQ I;  1VQ4 I;  2E34 A;  3G71 I;  2E36 A;  2ZJQ F;  1YI2 I;  1VQN I;  1YJN I;  3CCJ I;  2ZJP F;  1S72 I;  3CCR I;  5DM7 F;  1VQ8 I;  3CC7 I;  3PIP F;  4IOC F;  3CD6 I;  1YJW I;  1YHQ I;  3G4S I;  3G6E I;  1FOW A;  5GAD J;  3CC2 I;  1YIJ I;  3DLL F;  2K3F A;  1VQO I;  5GAE J;  1VQM I;  2E35 A;  1VQ5 I;  4IOA F;  3CCU I;  2H8W A;  3CCE I;  3CCS I;  3CJT B;  4IO9 F;  3I56 I;  1Y39 A;  4UY8 I;  3PIO F;  1MMS A;  1HC8 A;  2OTL I;  1VQL I;  5DM6 F;  3CCV I;  2QA4 I;  1VQ9 I;  2FOW A;  1FOX A;  1VQ7 I;  3I55 I;  3J7Y J;  5JVG F;  2NXN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...