4IOCF

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4iocF00
4IO9F 2ZJQF 1YJNI 3CC4I 3CF5F 4IOAF 2OTLI 3CD6I 3CMEI 1VQNI 3CCQI 2E34A 4UY8I 1VQLI 3CCRI 3CCUI 5DM7F 3CJTB 4IOCF 3CC7I 2FOWA 5GAGJ 3G4SI 1VQ4I 5DM6F 1YHQI 2OTJI 2ZJPF 3CCMI 5JVGF 1VQKI 3PIPF 3I56I 1VQ5I 1S72I 2E35A 5GAEJ 1ACIA 1YITI 2QA4I 3CCVI 3J7ZI 1VQPI 2NXNB 2K3FA 1HC8A 3I55I 2ZJRF 1VQ6I 2QEXI 3DLLF 5GAHJ 4V19K 5GADJ 2E36A 1FOXA 1Y39A 1YI2I 3J7YJ 1VQ7I 2JQ7A 1YIJI 1FOYA 3PIOF 3CCJI 1VQ9I 3CCLI 1QA6A 1FOWA 3CCSI 3CMAI 1VQMI 3CCEI 3G6EI 3G71I 1VQOI 2H8WA 3CC2I 1YJWI 1MMSA 1YJ9I 1VQ8I
chains in the Genus database with same CATH superfamily
5C3EJ 4DZJA 3GTJJ 3VB2A 3IRQA 5LD2C 3HJEA 1XG1A 3VSLA 1RNLA 5TISC 4QIWN 4IHVA 2CS3A 2AHQA 1XMKA 3K70D 2DA6A 2MA3A 4E7JA 3MZHA 1YW9A 4CHUA 2FA5A 2E1NA 3CJQB 1MD0A 5DM7F 1A6QA 2W82A 3OYGA 3W2AA 3F8NA 3T1BA 1O3QA 3FBIB 2GIZA 4XM3A 4F7ZA 4C2UA 1S7AA 3G2BA 1K78A 4UV9A 2KDZA 3E6BA 3ISPA 4L5IA 1JKPC 4L9NA 2G9WA 1IF1A 4BQOA 1ZREA 2JSCA 3CLQA 3V7RA 2ZC2A 3FKJA 4LLNA 2OF7A 1OKRA 1S3JA 2V1XA 2LY1A 1FMWA 2NVUB 1TQPA 4OAYA 1ACIA 2IS4A 1ZR2A 3Q0VA 1Z91A 1MNDA 3LFUA 2VQHA 1WH5A 2NNNA 5L3BA 1XCVA 3CDHA 5E20A 4OIRF 1HC8A 1RRJA 2LH9A 2V9KA 1TBXA 1FLIA 4W1UA 1LVAA 3DEWA 5CKTA 5FROA 3KEQA 3FXJA 3TOBA 5FLXK 3R0JA 2HVRA 1GVDA 4UUSA 2IGKA 3J80K 1USTA 2MC3A 2P81A 4CH7A 1LFUP 1X3ZB 5FLXZ 3HUGB 2UZKA 3E6MA 3RPUD 4FTHA 4BQAA 4M9ZA 2K9MA 3J80Z 3MAJA 3DKWA 1SMTA 5KNLA 2EFOA 3NAUA 3HOWJ 1G3TA 2LMDA 2JMWA 2W85A 4RB0A 1W5CC 4LB6B 5HLTA 3DCFA 5ICCA 4YELA 3CJRB 4X1EA 3L9FA 3OSFA 2AQEA 2RNJA 4OAZA 4ABZA 1AHDP 3SEZA 4OIOF 4Q5SF 2B0LA 2R7WA 3K4MA 4FCYA 2F5CA 2IW5A 1HW1A 3RKXA 1GDTA 2K9NA 3CDLA 5H20A 2R0QC 2CV0A 1OFCX 2GM4A 3WE3A 2DA2A 1X2MA 2YX4A 3BR1A 3K4BA 3KP2A 5B66C 3CCEI 3GTOJ 3WU0A 4Y52J 3R0AA 2K02A 4MHGA 3AKZA 3G71I 3CDIA 4OOIA 1PDNC 1W36C 1ODDA 2R7XA 5J47A 4A0XA 4PCQA 3MD2A 4BH9A 3D5LA 1J9IA 2FOKA 1XS9A 3ZN0A 2JJ7A 3G73A 3AG4H 4ETSA 5EG0B 2IPQX 5ICFA 3HGYA 4M3DA 5CVUA 5HDKA 3HOTA 1W4MA 5HNHA 1IV8A 2F5DA 2BOLA 2ME0A 1OLTA 1R36A 4GYIA 3U1KA 3A0BC 4AVPA 1TWFJ 1GVJA 5IT9K 1X4PA 2V9VA 1P7JA 3CLOA 3KEYA 1Z05A 4KUMA 2BW3A 1LE8A 4IOCF 2DA3A 2VQCA 4XRFA 4F93B 4HF1A 3NARA 2Y9YA 1UAAA 4RLQA 2DO7A 3M7GA 1IV6A 5IT9Z 2ZCWA 3JAMK 3ZMZA 3S93A 4ZZLA 4LIUA 5HS8A 3CUQA 3UNGC 1W7PB 2RQQA 2PBIA 5JLWA 3JSPA 4II3A 4WF2A 2XROA 4HQEA 1T33A 2DLLA 3M07A 3KX2A 3JAMZ 1Y1VJ 4E7IA 3S3NA 3DP7A 2D5VA 1RUOA 4IEJA 5FKKA 1R9TJ 5DTDA 3O3KA 2EA4A 1N77A 1U78A 1TWGJ 2BHYA 2VE8A 4XLHA 3WTVC 1O3TA 3S17J 3GO5A 2FQ3A 2P6SA 3I3LA 2A05A 1BOBA 4GFBA 1I27A 1U5TB 1MBKA 2XB5A 2P5LC 2BY3A 4R79A 2QEXI 3P7NA 2R7UA 3DLLF 2QUFA 2X85A 5D5UB 2A68F 4ZDOA 2DK8A 4E7KA 2XF7A 1N78A 4B48A 3H9GA 3QYFA 3IWZA 3AL0C 3F8FA 4V2FA 4O5VA 2IP2A 3K69A 4BE1A 3K1MA 5H6RA 3MKZA 4D5FA 3TW6A 2ISZA 4UVAA 1P92A 2WAEA 1W7PD 1STZA 2R7QA 1LNWA 5IT3A 1FOYA 3CCJI 1KU9A 2Q0OA 2ZNYA 1JE8A 5M5WJ 3MQ0A 1D8JA 5JLXA 4LG0A 1RC9A 4I0AA 4FE4A 1FYMA 3CMAI 5IYDJ 1E2XA 3BR0A 5J8CA 1IJWC 4I01A 2NS8A 1PP7U 2R7OA 4HA8A 1SFEA 3JRCA 3DQVC 3V8JA 2DFHA 4AWXB 4DJAA 2HTSA 3M9AA 3IH2A 2R5ZA 4RLFA 1XGMA 1HDPA 2VT2A 3D5SC 3E5XA 1DUXC 3HGGA 4UXNA 4IZZA 1AWCA 3S3MA 1JT0A 4P5OA 2DA7A 3KFWX 4ZTFA 5E79C 2R7TA 4BHCA 3BTJA 1QPMA 1HQCA 2H09A 2VB6A 1S8NA 3F0CA 5E3LA 3E1SA 1YTYA 4U0YA 2A6HF 5FO5A 2QF7A 4A12A 3HPGA 1QQIA 3Q3SA 1D8KA 3ZCOA 1O4XA 3SDBA 2PLYA 2L0KA 1ZG5A 2EB7A 2M8GX 2E34A 4UY8I 5HOOA 4AUXA 4XONA 3HOXJ 2W25A 4FX0A 2ZMEC 4DBRA 5AONA 1HW2A 5E3OA 1T56A 3CC7I 2JT1A 3AG1H 5DM6F 1JTYA 2VODA 1KYZA 3GBGA 5BOXA 5K5OA 2W00A 2X51A 2JVGA 4RB1A 1VQKI 2CUEA 2IT0A 1BW6A 2IA2A 1T6SA 3CP8A 5CQEA 3DV8A 4I02A 3BY6A 3SZTA 2LREA 1E3PA 3I71A 4RM2A 4Q4ZF 3PUBA 4BBRJ 2R92J 5F04A 2VI6A 1L3LA 3OIPA 2K3FA 3DU6A 4RAYA 4S0HB 2VE9A 3HDDA 1QZYA 2CW0F 1P6RA 1R5GA 1XGSA 1GV2A 3OMYA 1ZLJA 2V7FA 1TQIA 3IAM2 2DMPA 1VQ6I 2X9DA 1IXSB 2W48A 1ZELA 3OS2A 3GCMA 4Y33A 4JOMA 4EVIA 2HFHA 5GADJ 1XDSA 3HG9A 1T2KA 2L9SA 4EJUA 2HPMA 4G7OF 1P9QC 3E0JB 5D5WB 2XKPA 2R93J 2QQ9A 3I0TA 2NVXJ 3FBNB 3AAFA 2P4WA 2EZKA 3PQJA 4E7SA 4Y7NJ 3H3ZA 1ULYA 2VASA 3ZR8X 4IJAA 5E17F 5E1ZB 1T38A 2HXOA 2BY1A 3S1RJ 2XRNA 4CYCA 1LE8B 5L3GA 1FOWA 2STWA 2MYSA 1X58A 1IRGA 1BIBA 2IGOA 1TP4A 3CF2A 1MKMA 1ENHA 4M74A 4LD5A 5EYRA 4BL0B 2EFQA 2GZWA 1A5JA 4R1HA 5ERIA 3U1DA 2ACJA 2EH3A 3LMMA 3BR6A 5LFAA 4E7HA 1FEXA 1QHHD 5HLHA 4AIDA 1YW8A 1POGA 2A61A 1YO5C 1ZG1A 2WADA 3HSRA 1FSHA 4MLOA 1X1DA 1IRZA 1V4RA 4B43A 1FTTA 2L7FP 4N4NB 1VQNI 3KEOA 2PMZN 4M3BA 4M6XA 3PQKA 3IKVA 3F8CA 4BUPA 3FXKA 4IHWA 2RAEA 1WI3A 3RCOA 3QU3A 3K2AA 4UHTA 2LBFA 3JCUC 4A5NA 2DPDA 2QSGX 4XNFA 4I2OA 5EZHA 2E1MC 4AD9A 3NEUA 1IO2A 4B47A 3GFIA 1W36D 2LY2A 3ZQFA 3M1CA 2DQRA 4DOZA 1IAWA 3TOAA 2ZJPF 3AG3H 3ECHA 4CUGA 1FIAA 3RSNA 2R7VA 1Y1WJ 3QP6A 1U9NA 3D0SA 5F64A 3OOUA 2DW4A 2W7NA 2L9NA 5J8FA 3ZPLA 4RBOA 5TRDA 2VQLA 3H92A 4CCKA 2IS2A 1MW7A 5BQTA 5J1RA 4KMUX 4LG0B 4PSWA 2COBA 5J40A 1G2HA 1JI8A 1R1UA 4BQNA 4PJ0C 2MLGA 1HBXG 4AM3A 1HCRA 5LEJA 3BC8A 4C2MJ 2BVMA 3HOVJ 4LG3A 4A3IJ 2KMUA 2BYVE 1FBQA 2MGQA 3H36A 4M9SA 1A36A 3AL0B 2OAZA 3Q5FA 2DAOA 4HAMA 3DXJF 2LNBA 2Z16A 3KYCB 4GO1A 2P7CB 2FMYA 2WAQN 1XSDA 1ETVA 2VJIA 3X2QH 1UCRA 3S3OA 3P9KA 1S7OA 4XKWA 1H89C 1UHWA 2VJ5A 5IP6A 3H5AA 2EZHA 2A5WA 2L01A 1WVRA 3C7JA 5HS9A 2X1DA 4HPQA 2E5ZA 3MKWB 1JUSA 2XUBA 1BI2A 4MO7A 1D1AA 4KMFA 1IN7A 1YX3A 2ADUA 2CJJA 3OWTA 2FU4A 3CCLI 3S32A 3IRRA 4G9YA 3JRAA 3EPZA 4L9VA 1JHHA 4Z2YA 2BXYA 4KN4X 4KJZA 1EF4A 1HSTA 3RPUA 4LK1F 2ZKZA 1VQOI 3BQZA 3LA2A 1LDDA 3K2ZA 3DBHB 4HV6A 3RYPA 1IC8A 2ELHA 3J7AO 1ZQ3P 1R00A 2XRLA 2PI0A 4WK8F 2ZSIB 2EFNA 2BBYA 1YJ9I 1VQ8I 3VDXA 2FNPA 3LQRA 4KITB 4TV7A 2DDBA 3RIRA 1Z7LA 4EM0B 2JA5J 3BTCA 3LNQA 2LF8A 2ZMEB 3OYEA 4FASD 1ZG3A 3S1NJ 3W2WA 3LAJA 4HW0A 3GUDA 3MZ8A 1LPQA 4FETA 2ESHA 1T08B 1R1TA 4RA2A 3O8HA 2CWEA 1YHQI 3JTGA 1F43A 3VYSB 3HM5A 2P5VA 5HLGA 1HOMA 2BE5F 3PIPF 2K7LA 2X48A 2KDOA 3BCAA 4P55A 1D5VA 2DPUA 3SYTA 3A2KA 3L2CA 3BG6A 1YRNB 3DPTA 4E7LA 2XF5A 1PUFB 4DBQA 2HQ5A 2ZBKA 1J59A 4J01A 1RR8C 2LRDA 1ZARA 4V2GA 2CV2A 4O6JA 2FEZA 1UG0A 5GTIC 2ZJRF 3BCBA 5CVJA 3QOEA 3H5RA 2KRCA 4RGXA 1DQUA 2CQNA 4IL6C 3VWBA 3E6DA 3MKYB 3SJMA 1JTXA 4KISA 2HOSA 4II2A 5K5QA 4A69C 4A3FJ 2E1OA 3T0YA 2PMZA 1FOXA 4DIQA 1FP2A 3GVAA 5GPAA 2ICWG 4I0BA 3SDGA 1JKOC 3W6KB 1IUFA 2OC6A 2R7SA 1BR4A 3VYRB 3I4NJ 3HHGA 4IVNA 2IXSA 3ABTA 3OIOA 4MGRA 2HQRA 4RGSA 1T95A 2O5RA 4HRIA 2GXAA 1WKMA 4B4CA 1MJAA 3L09A 4M71A 2LSOA 2V4JC 3K4KA 3OL3A 2E2IJ 2QGUA 3I59B 2DT6A 1XGNA 3PL8A 2D1HA 3Q0WA 5B5EC 3JRIA 4A3GJ 2XPWA 5C4XJ 1GHCA 1OISA 2CQ7A 4A0ZA 2CV1A 2KL4A 4RS8A 5J3LA 4IHYA 4HF0A 5FJ8J 1OQYA 1SD6A 2V79A 3F21A 3I5UA 4B3XA 3S15J 1LDKB 5DD8A 1CQTA 1MBJA 2XGXA 2CFOA 4PUSA 1QBJA 1HW5A 2Z99A 2ISYA 3SXYA 1XX5A 3EQLF 2FXAA 2JPBA 3F72A 2M7BA 2KFDA 3BG5A 1HA8A 5CVIA 3DLAA 2LKXA 5C4JJ 5ICEA 2DK5A 2E1MB 5F27A 2LF7A 2XDVA 3DTIA 1CF7A 2WAQA 4A2UA 2O61A 2K27A 1G6NA 3CCRI 1LEBA 2EV6A 5D4RA 5LLQA 2G0EA 4Y13A 5HDGA 3DBRB 4B1RA 2BVLA 2R7RA 3BTLA 2CQKA 4MFEA 3RI4A 2WY8Q 5D4SA 4RB2C 4YIFA 1UZCA 1WCMJ 2LG4A 4XORA 3DKYA 3L2UA 1MSEC 1HKTA 1V3FA 2VBWA 3DEUA 1QPIA 2PG4A 3HL2A 4BJTA 5FRNA 2GQQA 2CFXA 4XLPF 4G7HF 3GZ6A 1UMQA 4A3CJ 3V42A 1YE9A 2DXIA 3GFJA 2BY2A 1DDNA 1LKXA 2Y9ZA 2M5WA 4BDYA 1ETWA 1BI3A 3TGNA 2LD5A 2V1NA 3G1MA 3GTPJ 1PVEA 2NVQJ 2OCEA 1U3EM 3C18A 4OU0A 4ON0A 5FRMA 2DFEA 2XAUA 5FD6A 1BC8C 3DF8A 4EJVA 1T0FC 4H4KC 4XLEA 4S05A 2F5EA 1X1AA 2PMUA 2L3DA 3JREA 4HQMA 4CCMA 5K7HA 2F6CA 2VQGA 3RKQA 3F6VA 5LRSA 4HOBA 5IOYA 2BY0A 3N05A 3ZQGA 3ZQQA 1ZLKA 4RAFA 1NG7A 1VQ9I 2OJED 1SFOJ 4AIKA 1L0OC 3ULQB 4HZFA 1E17A 3D5RC 3SFIA 4P96A 4G12A 3E6CC 4NBQA 2FMLA 2F2EA 4HX7A 1BR2A 3OYLA 4J00A 2KLOA 2A3SA 2OQRA 5EZGA 1T0FA 4LFUA 4HF2A 1FT9A 1BOAA 5D5XB 2B7EA 5CQGA 3O6BB 3H1CA 1OCCH 1RKTA 1MMSA 2Y69H 1YFHA 1R5HA 3FXLA 5LHIA 4BDZA 5E3MA 5FB2A 4X6AJ 2EIJH 3PNTA 1P7IA 3WTYC 3ASOH 3BJ6A 1MJBA 2FE3A 3ZQLA 1WJCA 2DA4A 1X1CA 3RZOJ 5CLSA 3PO2J 2QBYA 1RZ4A 2M8EA 2ZSHB 3L2RA 3A4CA 2JUCA 1IG7A 3CC4I 3J81K 1RR7A 4LGWA 2E71A 5DCFA 3C2GA 3F22A 2NOJB 2UUZA 2DFIA 4YFXF 2FJ1A 3J81Z 3RDIA 2EV0A 2O03A 1NHAA 3WTWC 1VQ4I 3LL7A 4I09A 3KP3A 1SAUA 4FE7A 2I8DA 1XMXA 2IGNA 4HNTA 2UXXA 3FMRA 1DGWY 2MD5A 4UNOA 2BEOA 3OR1C 2Y0SN 4PDKA 4H0EA 2A5YB 4GCVA 2CMPA 1B59A 1OCRH 3WU2C 3BJOA 3VOEA 4UVCA 5L3FA 1X1BA 4A6DA 3HHHA 3T8RA 1HXDA 2K4JA 2Y31A 2JN6A 3KIOA 4RGUA 1TNSA 1Z6TA 1RUNA 1QO0D 3NWSA 5E8GA 4G7ZF 2EK5A 4D5CA 2HYJA 1J0RA 2M7AA 2P7VB 1H9TA 2L7KA 3CMMA 3BPXA 3PO3J 2QSFX 4KIFA 2HOTA 3ASNH 3CESA 5EGOA 4OMZA 3SHFA 4IQJA 1REPC 1OMIA 4UB6C 1WWXA 3GMEA 4JQFA 1TWAJ 1JHFA 2PMHA 3I54A 1KU7A 3GX4X 2K9LA 4PK4A 3CJNA 1OCTC 4A3MJ 3HXLA 2RGVA 1JJ6C 1YW7A 2XAJA 1A31A 1CF7B 3PSFA 1YG2A 3J7YJ 1UFMA 2LC2A 2LKSA 1K6OA 1JGGA 4HSTA 2F48A 2VKHA 3KE2A 4M9XA 2DJNA 3D1NI 1T8IA 2GAUA 2GOXB 1MBGA 1MNEA 1YS7A 2RREA 3FWEA 1A35A 2V1UA 2JA2A 3ZRGA 3FM5A 4C3IJ 5D8KB 5FLVA 4KA4A 1Z1DA 1EKEA 5CVVA 3CC2I 3U2RA 4IPAA 3WTTC 3I58A 3KLNA 4J19A 4ZZDA 1TNTA 5LHGA 2D1VA 3IHUA 1RI7A 1IXCA 2MW8A 2QQBA 2DMQA 1Z3XA 1VNDA 5DS9A 2MD0A 4HX8A 4QTRA 3WG7H 2RN7A 4CDGA 2DN0A 3JW4A 3K7AJ 1SAXA 2P8TA 1YQAA 4WXHA 1VF9A 3PM1A 4L0YB 1O57A 1K6YA 3A02A 1B9MA 2EILH 2HDCA 2UXNA 2BHZA 1SD4A 3CMYA 4C3JJ 3N97A 4MQVA 3FM3A 2XGCA 1MJ9A 5FKMA 4NQWB 2OUMA 1K4TA 4BEHA 2OD5A 3QQAA 1ZRFA 5JI6A 3BWGA 3NRVA 1JKRC 5F08A 4BE0A 3ZQCA 2OTJI 3GTGJ 3I4PA 5DUIA 1R23A 4BAYA 4ENKA 5DEQA 1H88C 3CCMI 1AKHA 2QVOA 2JPCA 1MMGA 2VXZA 2ETHA 5IYBJ 2C6YA 2Q1ZB 5B3SH 3TL4X 3WG9A 4ITVA 2D45A 1YITI 1C0WA 1D3YA 3H3UA 4JP0A 4ENNA 2X6XA 3QYBA 5JHFA 2PN6A 5FKOA 2Q8KA 3OY9A 4G94A 2IJLA 4CGZA 3OYDA 2MLKA 4U0WA 1IN5A 4CA0A 2R7FA 4L9JA 4XIDA 2E5NA 3RYRA 4DZPA 4ZTJA 2RNGA 1AOYA 2IA1A 1B72B 3DPLC 3VODA 2CG4A 1O7LA 3ESWB 1DGRM 1LFBA 4ZYGA 1ZRDA 2VOPA 1Z21A 1PYVA 3Q0UA 3ZMUA 3BROA 1SC7A 3ABMH 5J6XA 2QBYB 1MBFA 1Q1VA 2RKHA 3OYAA 3C3WA 1FNNA 3B73A 2DOEA 2DU9A 1U8RA 2VXDA 2EZIA 4BXUA 2E2HJ 5BMZA 1JKQC 2ZMEA 4L0ZB 4P1WA 4OIQF 4GXOA 1YIOA 5LGTA 2YU9J 3BZCA 2JA6J 3VYTB 4JYKA 5HS7A 4MEYF 3OS0A 2V6EA 1LUJB 2Y75A 2QKMB 2Y0SA 4YFKF 4EATA 3F3XA 2ZO4A 4NUBA 3ELKA 2OPTA 2X1CA 3COAC 2DDAA 1VI0A 2DODA 3N4MA 1KYWA 2WA0A 4JX6A 3BG3A 2YR2A 3A1YA 1Y0UA 1ZH5A 1TT5B 2LFBA 1AU7A 3K0LA 5F1JA 3G1OA 1F4KA 1YRNA 3M4OJ 3IH4A 1B1BA 4XBFA 3EUKL 2KP6A 1LFPA 1H9GA 1SD7A 2DQLA 2XIGA 3HIFA 3W2VA 4D7MA 2ZJQF 3K4CA 3LSKA 3RQIA 1G3WA 3ZOBA 2DMUA 2OZUA 3QWLA 1IUYA 1ETQA 1PUFA 3ECOA 3K4JA 1IN4A 1V55H 4BGDA 1TT0A 2ID6A 2DTZA 2NOGA 3P9CA 3MFKA 1XCBA 2EJRA 1EA3A 5HODA 3VPRA 1ZKGA 2JA7J 3CJTB 4ZYHA 4B44A 5EGOB 1BM9A 3A01A 2WV0A 5GAGJ 3B6CA 5E3NA 1KQ0A 2TDXA 1PJRA 4XK4A 1ETXA 2XVCA 2OU2A 5L3CA 3GTKJ 2W1OA 4E4HA 5EDNA 4K2EA 2J5PA 1Y8QB 3JSOA 1YLFA 1W5TA 3CP2A 3VFZA 3HRUA 3BLYA 3VEPA 4IHSA 3S2DJ 2CQXA 4EGYA 5HNFA 4F92B 4XKCA 4I99C 3H0DA 4NHJA 4BHPA 3KZIC 1U6GA 1GT0C 4LLLA 2DI3A 2M0CA 1G59A 3GZNB 3MEXA 5F0CA 2NAZA 4UVBA 5FFXA 1B9NA 1Y0NA 3I59A 2F4MB 2FBHA 2HZTA 2XF6A 2DYSH 4E7ZA 3HOUJ 4PFPA 3BZ6A 1V5EA 2X6OA 3TMOA 2XSDC 3DU5A 4Q48A 1D0YA 2IVMA 1YS6A 5LGNA 2TCTA 4KNYA 2HQAA 5FD5A 1OCZH 4XKBA 1RIOH 2P0WA 2CSOA 1OR7C 1QU3A 2KISA 3LOCA 4BY7J 1OYWA 3LSGA 1BBYA 3S14J 3BQYA 3ZQHA 3MVPA 4HG2A 3BPVA 3PIOF 1IRFA 2DJIA 5GTHC 5E18F 1TQMA 2H8RA 1QA6A 4BEHB 1BJAA 1IN6A 1ORKA 4ZC3A 5ED4A 2EZLA 2W57A 2GLOA 4IHXA 2NRAC 3G6EI 1EH8A 2I5UA 1ERDA 1AKHB 3E3VA 3GXOA 1RPWA 2L4AA 3LWFA 3ZP5A 4JX4A 1UB9A 5DDGA 3MMYB 4MEXF 2VJ4A 1QVTA 4QSHA 3P5JA 4RB3C 2HI3A 3V7CA 2NNYA 3W6JB 4ZDLA 2ELKA 4IO9F 2XPVA 2M4KA 1I3QJ 3FMQA 2DT7B 3JRGA 1YJNI 4YG2F 3GTQJ 2FBKA 3K4LA 4IOAF 4HDUA 1EV7A 2GA2A 3CMEI 2QM3A 4A3KJ 3QYEA 2E60A 5C44J 5B1BH 1B8IB 3G3ZA 1J09A 1GXPA 2LKPA 2JA8J 4DW6A 3OYCA 5IP9J 1S7EA 4G8XA 4XSXF 2L9VA 3AFHA 1BN5A 1WZ2A 2M4GA 4U7BA 4N4OB 1B6AA 5M5XJ 2JTVA 2H94A 4UUVA 5LRRA 4AC0A 3S16J 2V6CA 3HRSA 4A3EJ 1FY7A 2A07F 1I39A 2QQ8A 4KN7X 3S2HJ 3OYJA 3UKGA 2V26A 3K1PA 4QLCU 4MIMA 3F8BA 3PJRA 2CH0A 2CUJA 2YS9A 4AVZA 1WHUA 2DA5A 1D0ZA 4GYGA 1ZR4A 1BIAA 1A04A 5D5VB 1KA8A 3CCVI 3BOQA 5JVTA 1O3RA 3J7ZI 1LEAA 3GZ5A 3E5UA 1VQPI 2KJBA 4MNUA 4IRGA 3PNYA 4JX5A 3ZQ7A 2QENA 2Z3YA 1HKSA 2JSPA 2HOEA 1N75A 3E5QA 2E19A 4L9TA 1I6XA 3LAPA 3B6AA 3QODA 1K83J 1WPKA 2EFWA 2UV1A 3V4GA 1I1GA 1R4MB 5J4YA 2YX7A 2O7OA 3H35A 2V1DA 2DFFA 3K9TA 3OOPA 1WJDA 2E36A 4L5JA 3TDZC 1ZGWA 1CGPA 3FXMA 1I3AA 3MWMA 2WAFA 4KDPA 2DTRA 2MBFA 3TO9A 4F91B 3IWFA 4HDVA 3HPHA 3SFZA 2WB1N 4ENMA 2IRFG 4WCGA 1WFXA 3AG2H 5HDNA 2OBPA 2HVSA 3IP4B 2VJJA 5A2QZ 4HLYA 3ZN1A 2HZDA 3L2VA 2Y30A 1ON2A 4B8XA 2DMNA 2MG4A 4DGWB 3A01B 1KGSA 3LSJA 1VFCA 2F5VA 5CYVA 4KT6A 1J5YA 4ZDPA 1PUEE 4C30A 4N9IA 3L2WA 3V8KA 4AIHA 4DYRA 4S04A 3OIQA 2H8WA 3ROUA 1OYYA 4ESJA 2JZYA 2PFBA 5J1YA 1T39A 5BPDA 1MGTA 2DA1A 1IGNA 4N9HA 4U0VA 3WTSC 4CZZA 1KQ8A 2EQRA 3REOA 3CCYA 2EA2A 3HTUA 1MIJA 2ECCA 2VBYA 2KHMA 3HZJA 2FUG2 3DBLB 3RJPA 3JR9A 3KETA 3BR3A 1FZPB 1MMDA 3ABKH 4A3BJ 2LK2A 4CSWA 3CCQI 2JRTA 1U0JA 1OCOH 3LQQA 2KIQA 3QU6A 2CUFA 4RMNA 2K3PA 2W84A 5CPRB 4M6VA 2R5YA 2XV4S 2FOWA 3RTRA 3OS1A 2J5OA 4CICA 2HYGD 1Z3YA 2GWRA 1BA5A 5D6FA 2PJRB 1XMAA 3NWTA 4XRMA 2AXLA 3UR3C 4U87A 4AYBN 5EEHA 5JVGF 3I56I 2VUMJ 2FX0A 4W97A 4XOPA 4YFNF 1UG2A 4C3HJ 1P4WA 3RZDJ 3BJAA 2CW8A 3PFYA 5E1WA 3F6OA 2NXNB 1G3YA 1K7AA 2PJPA 1S9HA 3KPHA 1SVLA 4I98B 2Y0MA 1JXSA 2I10A 1R22A 2YSRA 2COMA 2EIMH 3V7SA 4WWCA 1BW5A 2IAIA 4XLNF 2XAQA 4LB5A 3MCZA 4BNCA 3CO7C 4MFDA 2HWVA 2CO5A 3FXUA 2K40A 2OCCH 1ZRCA 4XRSG 1WSUA 2VBXA 2HYFA 4A6EA 2FRHA 2XAFA 1ONVA 2O3FA 2B63J 1J7KA 1D1BA 3ONQA 3HKZN 4M3EA 3TDUC 2QSHX 2JRMA 4HV5A 2VKDA 5F6FA 2K5CA 1Y6IA 4I76A 3IC7A 3FZVA 5JFRA 5F1RA 2FSWA 2YU3A 2L5QA 2JQ7A 4HLXA 2LLKA 1WGXA 4CZCA 1X4OA 4XLCA 3SZGA 1JUPA 1WH7A 4YEJA 5M5YJ 4EV0A 2G7UA 2IEKA 4ZYAA 4NB5A 1HSJA 2H1LA 5AIQA 2BGCA 2O8XA 4NQWA 3KZZA 1I5ZA 1U2WA 1R7JA 3DEEA 4D1QA 1F1ZA 3E7LA 4XLFA 2K4BA 2L54A 3KP7A 2KJCA 4BYYA 4BXFA 1HKQA 4BJ6C 4PJJA 1I50J 1FP1D 4XN3A 3WTXC 1XDUA 4XL9A 1D5YA 2ZFUA 3M8EA 3BTIA 2R4GA 3WGGA 1BJZA 2FF4A 1TL8A 1WJAA 2ZXWH 2ZXJA 1LJ9A 1ZAOA 1ETYA 2FBIA 3WGIA 3DKXA 1MMAA 2D2WA 4Y3OA 1DU0A 1IDZA 3TBIA 2EINH 4PZJA 3ZMDA 1VQLI 4IHTA 4ANJA 5KK1A 3W6VA 2K9QA 2CRGA 4PJMA 2V9PA 4QWQA 1MMNA 1ZK8A 3RPQA 3CZ6A 3FX3A 3WE2A 2HTJA 2FQ4A 4E70A 1B72A 3ZXSA 4BXXJ 4ENJA 4Y4RA 2RV8A 3JRDA 4GDFA 2KIMA 2JUGA 3GEZA 5FKLA 2WB1A 1B4AA 4KYWA 3FK6A 3R61A 4Y15A 2EFPA 1S72I 1WQ2A 3I9V2 4WXCA 3WHCA 4A3JJ 1USSA 3BP8A 3PFIA 4Y17A 2WC2A 2UWMA 2MFZA 3BG7A 2K85A 3EETA 4FT8A 1MH3A 2KRHA 5D8LB 4EJWA 4RM3A 5F0FA 3ML6A 4RAGA 1RETA 3R60A 5K5RA 2HU9A 4IX7A 4BHBA 3I55I 4M73A 1ON1A 1G8XA 3L2QA 3GF2A 2EIKH 2GOMA 2GXGA 2HOAA 2ID3A 5BS6A 3IL2A 1E0EA 1FTZA 2WY7Q 2VONA 3LA7A 2L4MA 5KAFC 2HXIA 4PJLA 2ECBA 2FNAA 3H9JA 4EMSA 1BR1A 1WRJA 1J2XA 2XC7A 3I64A 3M3YJ 1R1VA 1Z0XA 3TW7A 1Y39A 1SEUA 4M72A 2WWYA 1YI2I 3LSHA 4E6KG 1JUMA 3CUQC 1FMVA 4BE2A 3C2HA 3FKIJ 1VQ7I 2KRFA 4L18B 4F55A 5FFZA 5ICGA 1WI9A 3ABLH 1IXRC 3PNVA 3U21A 1R6RA 4YIRX 3CCSI 2R5YB 3OV8A 3BDDA 2Q2EA 2ZXHA 3ZMTA 3K4NA 3DTKA 4AYBA 3M8JA 1SFUA 2HVQA 4WXDA 4PGHA 3ZMSA 4RGRA 3OR2C 1LDJA 3PSIA 2X6WA 3VYUB 4FISA 2IS6A 3KP5A 3L00A 1QRYA 1SVOA 1FOKA 1ZHFA 4G6QA 2KKOA 4Z6YA 1S29A 4NNJA 2RDPA 3K6GA 3GFMA 2OV7A 3U9GA 2Z33A 3DWLE 1APLC 3HSFA 5ILSA 4RDUA 2NYXA 3HSEA 3HEFA 2FD5A 5CJ9A 2G7HA 4FHTA 4M3GA 2KT0A 2X4HA 3QPHA 4LMYA 4XKVA 1UELB 4CCJA 1P4AA 4MTDA 4L5EA 4XMYA 3EDPA 3BR2A 2A69F 3HKZA 1QHGA 2AQFA 2EPFA 2HGCA 5K7FA 1FIPA 1X19A 3OYMA 5ILVA 5F0HA 1FWZA 3I4MJ 1OYIA 2KIUA 1SD5A 3C1DA 4HYEA 4KFCA 1MH4A 3S1QJ 2HQNA 3BT9A 1XSVA 3GYHX 1VQ5I 4NC8A 3ZMVA 2HDWA 3FF5A 1DPUA 2VKVA 3H5NA 3WTZA 1D1CA 1K4SA 4A93J 3OYKA 3OYFA 4CCNA 2M3AA 1W0UA 4WX9A 1UJ8A 4C9YA 4HX4A 3JTHA 3HRTA 1QZZA 2KIFA 2LDUA 5CVRA 4BKXA 4BJ5C 1MDMA 1Z67A 3GWZA 1XSXA 4BBSJ 1MSFC 4B3AA 4BQQA 5IPAA 2HKXA 2HNHA 2M0MA 2OZ6A 2QZ8A 2LYCA 5GAHJ 4V19K 4DNCA 1K78B 2VL8A 4PGGA 3H3VK 3R6SA 1G3SA 1ZN2A 4FQGA 1ZGAA 2H27A 3FXOA 5EF6A 1WJEA 3QAHA 5FKNA 4CO8A 2MH9A 2ZJ2A 3ERMA 3KZYA 3NQOA 1XGOA 4XICA 1NK2P 4MQ9F 3G1LA 2M2EA 1B8IA 3MZYA 2EV5A 1T98A 3HOSA 2B9SA 4XRSA 3M1EA 3LSIA 2TRTA 3OYIA 2LVSA 2JWTA 3KLOA 1VQMI 5E8IA 2O6GE 4IXAA 4HNVA 2E2JJ 2OA4A 3W3CA 3QOPA 1W0TA 4BACA 2GXBA 4UUSB 1Y8RB 3TEDA 5IY5H 4OIPF 4I7HA 2XAGA 1FBSA 1YJWI 3LSTA 1U8BA 3T8TA 1KU3A 1J75A 2JK3A 3ERED 3E97A 1X3UA 4CCLA 3LSPA 4AIJA 2MABA 1XB4A 5EEGA 2KPMA 5H2FC 5KHDA 4A0YA 4EGZA 2DOFA 1MNMC 2DMTA 1QVUA 2XHKA 3BG9A 4NC6A 5M3MJ 5J1UA 2L7MP 4LOCA 2DOAA 3WTUC 3SZPA 3IKTA 1VTNC 1E3OC 1ZGJA 3S8PA 1XPXA 1VZ0A 4D7NA 2XGDA 3BR5A 4PSXA 5DCMA 5LBQA 2M34A 2ESNA 1GUUA 5TJJA 1Q1HA 2RVCA 1UHSA 3P9IA 2YPRA 1IN8A 2MC4A 4OMYA 4GRIA 1SMYF 5DD4A 1V5FA 2K86A 4XSZF 4AU7A 1TLHB 2H6CA 3HYIA 4QPOA 1HF0A 3L7WA 3B02A 1ZTRA 4JK1X 5BPIA 1U9OA 3RQ4A 1N25A 1IW7F 1KU2A 3KYDB 4XR6A 2E35A 5GAEJ 4U88A 3KP6A 1DP7P 4UUTA 3L1PA 2Q2EB 5KVRA 1FBUA 3HC7A 3S1MJ 1X1PA 5FLMJ 3FHZA 2NS0A 4KIGA 2DYRH 2Z1DA 4M6YA 5ILUA 3KYLA 3J7AY 1R5ID 2XSJC 5JHUA 2BW3B 3WU1B 1YOVB 2VT3A 1R4NB 5GPCA 2HPIA 2ZFWA 3SQNA 3SEQA 4ZJZA 5HVQC 1ETKA 4I6ZA 6PAXA 3GLLA 2RC4A 3M8FA 1A6IA 1R58A 2QCOA 1I6HJ 5LHHA 2IBDA 1RESA 2VLAA 3CUQB 2L2OA 1NK3P 3FK7A 1EH7A 2QQAA 1UHMA 4IRIA 4A5MA 3EYYA 4MTEA 3OSGA 2ELJA 3HTSB 2CUZA 2HR3A 4LJZF 4XOTA 4EM1A 4HEA2 4F52A 1FJLA 1XTAA 3EUAA 3WGHA 3K70C 2LP0A 2VOOA 2Z9OA 3KCCA 4O3MA 4RAZA 4U7DA 1LB2A 2MSYA 1NTCA 3BZKA 3ZGKA 4IRHA 2M87A 2M9HA 3H0GJ 3CTAA 1EH6A 2CYYA 2VC0A 4DQ2A 2PJRA 3DFGA 2E1CA 3EUHC 5GP9A 3HRMA 2VKEA 2JVHA 5LGUA 3ABUA 4XLAA 5KAIC 4GGGA 5EEAA 1I1SA 2LTPA 2XAHA 3LSRA 2IS1A 3QP5A 1Z6RA 1KQ9A 1FPQA 4KICA 4EM2A 2XB0X 4JBAA 1HLVA 4XQFA 4B09A 1TZLA 1MDMB 2E7WA 2H1KA 3CD6I 1LVKA 1DP3A 2X1EA 1QGPA 1FC3A 2OQGA 5L3DA 5LEKA 2W24A 3PUFA 3GTMJ 2KZGA 3FMSA 4YRVA 3CCUI 4LLGF 1QNTA 5HLIA 4ASNA 1BI1A 2LR8A 2XGEA 1OR7A 4IF4A 1YX5A 2HEOA 4X0GA 4LK0F 4ESFA 3EUHA 1NG6A 1PP8F 1XD7A 5DUKA 3K10A 2EWNA 2R5ZB 2X6YA 1FX7A 3FIWA 2O9LA 3FXQA 1WJFA 3I53A 2F5FA 3ZQIA 3LFKA 1F5TA 1P4XA 3WODF 3GW2A 5AIPA 3QRFF 3HBLA 2VC1A 4NDLA 1KZHA 1V5GA 2STTA 1IZ1A 2HDDA 1V54H 3JRHA 1F36A 1XC5A 4ZH4F 3Q9SA 5JR3A 1R71A 3TO6A 2M30A 3FDYA 5D6EA 3OYBA 4PFOA 1HDDC 3JRBA 5EJCA 2R3SA 1YYVA 1Z7UA 1S6LA 2E7XA 2YUSA 3Q9VA 4HBLA 4EJOA 1MBEA 3RKYA 1Z77A 1JJ8C 2GBYA 4UV8A 3MN2A 1TC3C 2Y2ZA 3HB9A 4G6TB 2AS5F 3QPTA 1TW2A 2M45A 2VN2A 5J4VA 2ZNZA 3QPLA 1JT6A 3CQZJ 1DPRA 2KZVA 1X3WB 2ME6A 1H0MA 1TTYA 2GIVA 2PX9A 2XPUA 3F23A 2KQRA 3KP4A 4DYCA 5K1YA 4UB8C 4OINF 1D0XA 2WTEA 1YIJI 3OYNA 3CO6C 2P6TA 2IGMA 3TKYA 5DV5A 1KONA 5IOZA 5DCMB 2QKLB 3TQNA 2A6EF 3O8GA 5BNGA 2W4SA 2F4OB 1SFKA 4KIBA 3VSKA 2NVTJ 4BU2A 1K79A 2RQPA 2O8KA 1FYLA 1GV5A 3IH3A 2H6BA 2XKOA 3H9QA 3IUOA 1MBHA 4BS9A 4LITA 3RKWA 1NH3A 4HSRA 4QPQA 5A2QK 1GXQA 2O0YA 2BZTA 1IRXA 1FYKA 4FX4A 4EJTA 5FGMA 5IYCJ 1K61A 2L7ZA 3F8MA 3V8LA 2Z5UA 2A6TA 2L02A 3HUGA 4ESBA 2QWWA 5DYMA 3MKLA 4Q47A 4R8HA 3TP0A 3CF5F 2VPRA 2OTLI 4N0BA 1G4DA 1W5SA 1WJBA 3C2BA 2LY9A 2M1BA 3GTLJ 1TWHJ 3GLXA 2N8GA 5L3EA 4CYCB 4CCOA 2VIXA 1W1WE 1SVMA 2QLZA 3FISA 3K1NA 4CXFA 2DCEA 2WV1A 2K9SA 3FXRA 5H6QA 4HNUA 3G4SI 5IP7J 4M3FA 4OWRB 3R4KA 3OL4A 1DU6A 2GA1A 2HKOA 1XN7A 3JRFA 3FHNA 3F9KA 3HOZJ 1LQ1A 1TWCJ 3A0HC 4KT5C 2CU7A 3A03A 1FSEA 4CYDA 3OYHA 1TW3A 2X0LA 4XN0A 4C2TA 1JGSA 1BL0A 1O7FA 1SFXA 2QA4I 1F9NA 3HOYJ 5M3FJ 2HS5A 1AA7A 5B1AH 2R7ZJ 1BC7C 5EG0A 2VPLA 2AXTC 3EYIA 1BI0A 4G6DA 4DYQA 1QZEA 1OPCA 2DT5A 2PQ8A 4LIVA 4A3LJ 2EBIA 1GLNA 2LBFB 2NS7A 1SANA 3CUOA 1WJ5A 1EJ9A 1X2NA 4D0PA 3IAS2 2BXZA 2CGPA 1M1EB 2QYOA 1P2FA 1ZYRF 3IV5A 3TP3A 1ETOA 2LOOA 4IKFA 2CW7A 2L9RA 3LA3A 3QPSA 4PJNA 1U5TC 1RKWA 1Z9CA 4ZYDA 5E1XA 2NVYJ 4P9FA 3LSMA 3GFLA 3TO7A 2XASA 1W7PA 1E3HA 1OJLA 1O3SA 2WBMA 5KCMA 4F3QA 2AO9A 3S2WA 3DPUA 2MH2A 4D9JA 2ZXIA 2IA0A 9ANTA 5TGTA 4BY1J 4NC7A 4EQQA 2R7DA 1R49A 2P5KA 1S5LC 2PEXA 2ZB9A 2BV6A 2Y48A 1ITYA 4A3DJ 2F4IA 1IDYA 3T5XA 1MZBA 4YIIA 2CQQA 2DBBA 1U5TA 3DTEA 3WHBA 1Y56A 1H8AC 4IQ4A 5K7ZA 1OCPA 2Z2SB 4EEFG 4P9UA 4ZYEA 3O2PE 2VBZA
chains in the Genus database with same CATH topology
4IO9F 2ZJQF 1YJNI 3CC4I 3CF5F 4IOAF 2OTLI 3CD6I 3CMEI 1VQNI 3CCQI 2E34A 4UY8I 1VQLI 3CCRI 3CCUI 5DM7F 3CJTB 4IOCF 3CC7I 2FOWA 5GAGJ 3G4SI 1VQ4I 5DM6F 1YHQI 2OTJI 2ZJPF 3CCMI 5JVGF 1VQKI 3PIPF 3I56I 1VQ5I 1S72I 2E35A 5GAEJ 1ACIA 1YITI 2QA4I 3CCVI 3J7ZI 1VQPI 2NXNB 2K3FA 1HC8A 3I55I 2ZJRF 1VQ6I 2QEXI 3DLLF 5GAHJ 4V19K 5GADJ 2E36A 1FOXA 1Y39A 1YI2I 3J7YJ 1VQ7I 2JQ7A 1YIJI 1FOYA 3PIOF 3CCJI 1VQ9I 3CCLI 1QA6A 1FOWA 3CCSI 3CMAI 1VQMI 3CCEI 3G6EI 3G71I 1VQOI 2H8WA 3CC2I 1YJWI 1MMSA 1YJ9I 1VQ8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO9 F;  2ZJQ F;  1YJN I;  3CC4 I;  3CF5 F;  4IOA F;  2OTL I;  3CD6 I;  3CME I;  1VQN I;  3CCQ I;  2E34 A;  4UY8 I;  1VQL I;  3CCR I;  3CCU I;  5DM7 F;  3CJT B;  4IOC F;  3CC7 I;  2FOW A;  5GAG J;  3G4S I;  1VQ4 I;  5DM6 F;  1YHQ I;  2OTJ I;  2ZJP F;  3CCM I;  5JVG F;  1VQK I;  3PIP F;  3I56 I;  1VQ5 I;  1S72 I;  2E35 A;  5GAE J;  1ACI A;  1YIT I;  2QA4 I;  3CCV I;  3J7Z I;  1VQP I;  2NXN B;  2K3F A;  1HC8 A;  3I55 I;  2ZJR F;  1VQ6 I;  2QEX I;  3DLL F;  5GAH J;  4V19 K;  5GAD J;  2E36 A;  1FOX A;  1Y39 A;  1YI2 I;  3J7Y J;  1VQ7 I;  2JQ7 A;  1YIJ I;  1FOY A;  3PIO F;  3CCJ I;  1VQ9 I;  3CCL I;  1QA6 A;  1FOW A;  3CCS I;  3CMA I;  1VQM I;  3CCE I;  3G6E I;  3G71 I;  1VQO I;  2H8W A;  3CC2 I;  1YJW I;  1MMS A;  1YJ9 I;  1VQ8 I; 
#chains in the Genus database with same CATH topology
 5C3E J;  4DZJ A;  3GTJ J;  3VB2 A;  3IRQ A;  5LD2 C;  3HJE A;  1XG1 A;  3VSL A;  1RNL A;  5TIS C;  4QIW N;  4IHV A;  2CS3 A;  2AHQ A;  1XMK A;  3K70 D;  2DA6 A;  2MA3 A;  4E7J A;  3MZH A;  1YW9 A;  4CHU A;  2FA5 A;  2E1N A;  3CJQ B;  1MD0 A;  5DM7 F;  1A6Q A;  2W82 A;  3OYG A;  3W2A A;  3F8N A;  3T1B A;  1O3Q A;  3FBI B;  2GIZ A;  4XM3 A;  4F7Z A;  4C2U A;  1S7A A;  3G2B A;  1K78 A;  4UV9 A;  2KDZ A;  3E6B A;  3ISP A;  4L5I A;  1JKP C;  4L9N A;  2G9W A;  1IF1 A;  4BQO A;  1ZRE A;  2JSC A;  3CLQ A;  3V7R A;  2ZC2 A;  3FKJ A;  4LLN A;  2OF7 A;  1OKR A;  1S3J A;  2V1X A;  2LY1 A;  1FMW A;  2NVU B;  1TQP A;  4OAY A;  1ACI A;  2IS4 A;  1ZR2 A;  3Q0V A;  1Z91 A;  1MND A;  3LFU A;  2VQH A;  1WH5 A;  2NNN A;  5L3B A;  1XCV A;  3CDH A;  5E20 A;  4OIR F;  1HC8 A;  1RRJ A;  2LH9 A;  2V9K A;  1TBX A;  1FLI A;  4W1U A;  1LVA A;  3DEW A;  5CKT A;  5FRO A;  3KEQ A;  3FXJ A;  3TOB A;  5FLX K;  3R0J A;  2HVR A;  1GVD A;  4UUS A;  2IGK A;  3J80 K;  1UST A;  2MC3 A;  2P81 A;  4CH7 A;  1LFU P;  1X3Z B;  5FLX Z;  3HUG B;  2UZK A;  3E6M A;  3RPU D;  4FTH A;  4BQA A;  4M9Z A;  2K9M A;  3J80 Z;  3MAJ A;  3DKW A;  1SMT A;  5KNL A;  2EFO A;  3NAU A;  3HOW J;  1G3T A;  2LMD A;  2JMW A;  2W85 A;  4RB0 A;  1W5C C;  4LB6 B;  5HLT A;  3DCF A;  5ICC A;  4YEL A;  3CJR B;  4X1E A;  3L9F A;  3OSF A;  2AQE A;  2RNJ A;  4OAZ A;  4ABZ A;  1AHD P;  3SEZ A;  4OIO F;  4Q5S F;  2B0L A;  2R7W A;  3K4M A;  4FCY A;  2F5C A;  2IW5 A;  1HW1 A;  3RKX A;  1GDT A;  2K9N A;  3CDL A;  5H20 A;  2R0Q C;  2CV0 A;  1OFC X;  2GM4 A;  3WE3 A;  2DA2 A;  1X2M A;  2YX4 A;  3BR1 A;  3K4B A;  3KP2 A;  5B66 C;  3CCE I;  3GTO J;  3WU0 A;  4Y52 J;  3R0A A;  2K02 A;  4MHG A;  3AKZ A;  3G71 I;  3CDI A;  4OOI A;  1PDN C;  1W36 C;  1ODD A;  2R7X A;  5J47 A;  4A0X A;  4PCQ A;  3MD2 A;  4BH9 A;  3D5L A;  1J9I A;  2FOK A;  1XS9 A;  3ZN0 A;  2JJ7 A;  3G73 A;  3AG4 H;  4ETS A;  5EG0 B;  2IPQ X;  5ICF A;  3HGY A;  4M3D A;  5CVU A;  5HDK A;  3HOT A;  1W4M A;  5HNH A;  1IV8 A;  2F5D A;  2BOL A;  2ME0 A;  1OLT A;  1R36 A;  4GYI A;  3U1K A;  3A0B C;  4AVP A;  1TWF J;  1GVJ A;  5IT9 K;  1X4P A;  2V9V A;  1P7J A;  3CLO A;  3KEY A;  1Z05 A;  4KUM A;  2BW3 A;  1LE8 A;  4IOC F;  2DA3 A;  2VQC A;  4XRF A;  4F93 B;  4HF1 A;  3NAR A;  2Y9Y A;  1UAA A;  4RLQ A;  2DO7 A;  3M7G A;  1IV6 A;  5IT9 Z;  2ZCW A;  3JAM K;  3ZMZ A;  3S93 A;  4ZZL A;  4LIU A;  5HS8 A;  3CUQ A;  3UNG C;  1W7P B;  2RQQ A;  2PBI A;  5JLW A;  3JSP A;  4II3 A;  4WF2 A;  2XRO A;  4HQE A;  1T33 A;  2DLL A;  3M07 A;  3KX2 A;  3JAM Z;  1Y1V J;  4E7I A;  3S3N A;  3DP7 A;  2D5V A;  1RUO A;  4IEJ A;  5FKK A;  1R9T J;  5DTD A;  3O3K A;  2EA4 A;  1N77 A;  1U78 A;  1TWG J;  2BHY A;  2VE8 A;  4XLH A;  3WTV C;  1O3T A;  3S17 J;  3GO5 A;  2FQ3 A;  2P6S A;  3I3L A;  2A05 A;  1BOB A;  4GFB A;  1I27 A;  1U5T B;  1MBK A;  2XB5 A;  2P5L C;  2BY3 A;  4R79 A;  2QEX I;  3P7N A;  2R7U A;  3DLL F;  2QUF A;  2X85 A;  5D5U B;  2A68 F;  4ZDO A;  2DK8 A;  4E7K A;  2XF7 A;  1N78 A;  4B48 A;  3H9G A;  3QYF A;  3IWZ A;  3AL0 C;  3F8F A;  4V2F A;  4O5V A;  2IP2 A;  3K69 A;  4BE1 A;  3K1M A;  5H6R A;  3MKZ A;  4D5F A;  3TW6 A;  2ISZ A;  4UVA A;  1P92 A;  2WAE A;  1W7P D;  1STZ A;  2R7Q A;  1LNW A;  5IT3 A;  1FOY A;  3CCJ I;  1KU9 A;  2Q0O A;  2ZNY A;  1JE8 A;  5M5W J;  3MQ0 A;  1D8J A;  5JLX A;  4LG0 A;  1RC9 A;  4I0A A;  4FE4 A;  1FYM A;  3CMA I;  5IYD J;  1E2X A;  3BR0 A;  5J8C A;  1IJW C;  4I01 A;  2NS8 A;  1PP7 U;  2R7O A;  4HA8 A;  1SFE A;  3JRC A;  3DQV C;  3V8J A;  2DFH A;  4AWX B;  4DJA A;  2HTS A;  3M9A A;  3IH2 A;  2R5Z A;  4RLF A;  1XGM A;  1HDP A;  2VT2 A;  3D5S C;  3E5X A;  1DUX C;  3HGG A;  4UXN A;  4IZZ A;  1AWC A;  3S3M A;  1JT0 A;  4P5O A;  2DA7 A;  3KFW X;  4ZTF A;  5E79 C;  2R7T A;  4BHC A;  3BTJ A;  1QPM A;  1HQC A;  2H09 A;  2VB6 A;  1S8N A;  3F0C A;  5E3L A;  3E1S A;  1YTY A;  4U0Y A;  2A6H F;  5FO5 A;  2QF7 A;  4A12 A;  3HPG A;  1QQI A;  3Q3S A;  1D8K A;  3ZCO A;  1O4X A;  3SDB A;  2PLY A;  2L0K A;  1ZG5 A;  2EB7 A;  2M8G X;  2E34 A;  4UY8 I;  5HOO A;  4AUX A;  4XON A;  3HOX J;  2W25 A;  4FX0 A;  2ZME C;  4DBR A;  5AON A;  1HW2 A;  5E3O A;  1T56 A;  3CC7 I;  2JT1 A;  3AG1 H;  5DM6 F;  1JTY A;  2VOD A;  1KYZ A;  3GBG A;  5BOX A;  5K5O A;  2W00 A;  2X51 A;  2JVG A;  4RB1 A;  1VQK I;  2CUE A;  2IT0 A;  1BW6 A;  2IA2 A;  1T6S A;  3CP8 A;  5CQE A;  3DV8 A;  4I02 A;  3BY6 A;  3SZT A;  2LRE A;  1E3P A;  3I71 A;  4RM2 A;  4Q4Z F;  3PUB A;  4BBR J;  2R92 J;  5F04 A;  2VI6 A;  1L3L A;  3OIP A;  2K3F A;  3DU6 A;  4RAY A;  4S0H B;  2VE9 A;  3HDD A;  1QZY A;  2CW0 F;  1P6R A;  1R5G A;  1XGS A;  1GV2 A;  3OMY A;  1ZLJ A;  2V7F A;  1TQI A;  3IAM 2;  2DMP A;  1VQ6 I;  2X9D A;  1IXS B;  2W48 A;  1ZEL A;  3OS2 A;  3GCM A;  4Y33 A;  4JOM A;  4EVI A;  2HFH A;  5GAD J;  1XDS A;  3HG9 A;  1T2K A;  2L9S A;  4EJU A;  2HPM A;  4G7O F;  1P9Q C;  3E0J B;  5D5W B;  2XKP A;  2R93 J;  2QQ9 A;  3I0T A;  2NVX J;  3FBN B;  3AAF A;  2P4W A;  2EZK A;  3PQJ A;  4E7S A;  4Y7N J;  3H3Z A;  1ULY A;  2VAS A;  3ZR8 X;  4IJA A;  5E17 F;  5E1Z B;  1T38 A;  2HXO A;  2BY1 A;  3S1R J;  2XRN A;  4CYC A;  1LE8 B;  5L3G A;  1FOW A;  2STW A;  2MYS A;  1X58 A;  1IRG A;  1BIB A;  2IGO A;  1TP4 A;  3CF2 A;  1MKM A;  1ENH A;  4M74 A;  4LD5 A;  5EYR A;  4BL0 B;  2EFQ A;  2GZW A;  1A5J A;  4R1H A;  5ERI A;  3U1D A;  2ACJ A;  2EH3 A;  3LMM A;  3BR6 A;  5LFA A;  4E7H A;  1FEX A;  1QHH D;  5HLH A;  4AID A;  1YW8 A;  1POG A;  2A61 A;  1YO5 C;  1ZG1 A;  2WAD A;  3HSR A;  1FSH A;  4MLO A;  1X1D A;  1IRZ A;  1V4R A;  4B43 A;  1FTT A;  2L7F P;  4N4N B;  1VQN I;  3KEO A;  2PMZ N;  4M3B A;  4M6X A;  3PQK A;  3IKV A;  3F8C A;  4BUP A;  3FXK A;  4IHW A;  2RAE A;  1WI3 A;  3RCO A;  3QU3 A;  3K2A A;  4UHT A;  2LBF A;  3JCU C;  4A5N A;  2DPD A;  2QSG X;  4XNF A;  4I2O A;  5EZH A;  2E1M C;  4AD9 A;  3NEU A;  1IO2 A;  4B47 A;  3GFI A;  1W36 D;  2LY2 A;  3ZQF A;  3M1C A;  2DQR A;  4DOZ A;  1IAW A;  3TOA A;  2ZJP F;  3AG3 H;  3ECH A;  4CUG A;  1FIA A;  3RSN A;  2R7V A;  1Y1W J;  3QP6 A;  1U9N A;  3D0S A;  5F64 A;  3OOU A;  2DW4 A;  2W7N A;  2L9N A;  5J8F A;  3ZPL A;  4RBO A;  5TRD A;  2VQL A;  3H92 A;  4CCK A;  2IS2 A;  1MW7 A;  5BQT A;  5J1R A;  4KMU X;  4LG0 B;  4PSW A;  2COB A;  5J40 A;  1G2H A;  1JI8 A;  1R1U A;  4BQN A;  4PJ0 C;  2MLG A;  1HBX G;  4AM3 A;  1HCR A;  5LEJ A;  3BC8 A;  4C2M J;  2BVM A;  3HOV J;  4LG3 A;  4A3I J;  2KMU A;  2BYV E;  1FBQ A;  2MGQ A;  3H36 A;  4M9S A;  1A36 A;  3AL0 B;  2OAZ A;  3Q5F A;  2DAO A;  4HAM A;  3DXJ F;  2LNB A;  2Z16 A;  3KYC B;  4GO1 A;  2P7C B;  2FMY A;  2WAQ N;  1XSD A;  1ETV A;  2VJI A;  3X2Q H;  1UCR A;  3S3O A;  3P9K A;  1S7O A;  4XKW A;  1H89 C;  1UHW A;  2VJ5 A;  5IP6 A;  3H5A A;  2EZH A;  2A5W A;  2L01 A;  1WVR A;  3C7J A;  5HS9 A;  2X1D A;  4HPQ A;  2E5Z A;  3MKW B;  1JUS A;  2XUB A;  1BI2 A;  4MO7 A;  1D1A A;  4KMF A;  1IN7 A;  1YX3 A;  2ADU A;  2CJJ A;  3OWT A;  2FU4 A;  3CCL I;  3S32 A;  3IRR A;  4G9Y A;  3JRA A;  3EPZ A;  4L9V A;  1JHH A;  4Z2Y A;  2BXY A;  4KN4 X;  4KJZ A;  1EF4 A;  1HST A;  3RPU A;  4LK1 F;  2ZKZ A;  1VQO I;  3BQZ A;  3LA2 A;  1LDD A;  3K2Z A;  3DBH B;  4HV6 A;  3RYP A;  1IC8 A;  2ELH A;  3J7A O;  1ZQ3 P;  1R00 A;  2XRL A;  2PI0 A;  4WK8 F;  2ZSI B;  2EFN A;  2BBY A;  1YJ9 I;  1VQ8 I;  3VDX A;  2FNP A;  3LQR A;  4KIT B;  4TV7 A;  2DDB A;  3RIR A;  1Z7L A;  4EM0 B;  2JA5 J;  3BTC A;  3LNQ A;  2LF8 A;  2ZME B;  3OYE A;  4FAS D;  1ZG3 A;  3S1N J;  3W2W A;  3LAJ A;  4HW0 A;  3GUD A;  3MZ8 A;  1LPQ A;  4FET A;  2ESH A;  1T08 B;  1R1T A;  4RA2 A;  3O8H A;  2CWE A;  1YHQ I;  3JTG A;  1F43 A;  3VYS B;  3HM5 A;  2P5V A;  5HLG A;  1HOM A;  2BE5 F;  3PIP F;  2K7L A;  2X48 A;  2KDO A;  3BCA A;  4P55 A;  1D5V A;  2DPU A;  3SYT A;  3A2K A;  3L2C A;  3BG6 A;  1YRN B;  3DPT A;  4E7L A;  2XF5 A;  1PUF B;  4DBQ A;  2HQ5 A;  2ZBK A;  1J59 A;  4J01 A;  1RR8 C;  2LRD A;  1ZAR A;  4V2G A;  2CV2 A;  4O6J A;  2FEZ A;  1UG0 A;  5GTI C;  2ZJR F;  3BCB A;  5CVJ A;  3QOE A;  3H5R A;  2KRC A;  4RGX A;  1DQU A;  2CQN A;  4IL6 C;  3VWB A;  3E6D A;  3MKY B;  3SJM A;  1JTX A;  4KIS A;  2HOS A;  4II2 A;  5K5Q A;  4A69 C;  4A3F J;  2E1O A;  3T0Y A;  2PMZ A;  1FOX A;  4DIQ A;  1FP2 A;  3GVA A;  5GPA A;  2ICW G;  4I0B A;  3SDG A;  1JKO C;  3W6K B;  1IUF A;  2OC6 A;  2R7S A;  1BR4 A;  3VYR B;  3I4N J;  3HHG A;  4IVN A;  2IXS A;  3ABT A;  3OIO A;  4MGR A;  2HQR A;  4RGS A;  1T95 A;  2O5R A;  4HRI A;  2GXA A;  1WKM A;  4B4C A;  1MJA A;  3L09 A;  4M71 A;  2LSO A;  2V4J C;  3K4K A;  3OL3 A;  2E2I J;  2QGU A;  3I59 B;  2DT6 A;  1XGN A;  3PL8 A;  2D1H A;  3Q0W A;  5B5E C;  3JRI A;  4A3G J;  2XPW A;  5C4X J;  1GHC A;  1OIS A;  2CQ7 A;  4A0Z A;  2CV1 A;  2KL4 A;  4RS8 A;  5J3L A;  4IHY A;  4HF0 A;  5FJ8 J;  1OQY A;  1SD6 A;  2V79 A;  3F21 A;  3I5U A;  4B3X A;  3S15 J;  1LDK B;  5DD8 A;  1CQT A;  1MBJ A;  2XGX A;  2CFO A;  4PUS A;  1QBJ A;  1HW5 A;  2Z99 A;  2ISY A;  3SXY A;  1XX5 A;  3EQL F;  2FXA A;  2JPB A;  3F72 A;  2M7B A;  2KFD A;  3BG5 A;  1HA8 A;  5CVI A;  3DLA A;  2LKX A;  5C4J J;  5ICE A;  2DK5 A;  2E1M B;  5F27 A;  2LF7 A;  2XDV A;  3DTI A;  1CF7 A;  2WAQ A;  4A2U A;  2O61 A;  2K27 A;  1G6N A;  3CCR I;  1LEB A;  2EV6 A;  5D4R A;  5LLQ A;  2G0E A;  4Y13 A;  5HDG A;  3DBR B;  4B1R A;  2BVL A;  2R7R A;  3BTL A;  2CQK A;  4MFE A;  3RI4 A;  2WY8 Q;  5D4S A;  4RB2 C;  4YIF A;  1UZC A;  1WCM J;  2LG4 A;  4XOR A;  3DKY A;  3L2U A;  1MSE C;  1HKT A;  1V3F A;  2VBW A;  3DEU A;  1QPI A;  2PG4 A;  3HL2 A;  4BJT A;  5FRN A;  2GQQ A;  2CFX A;  4XLP F;  4G7H F;  3GZ6 A;  1UMQ A;  4A3C J;  3V42 A;  1YE9 A;  2DXI A;  3GFJ A;  2BY2 A;  1DDN A;  1LKX A;  2Y9Z A;  2M5W A;  4BDY A;  1ETW A;  1BI3 A;  3TGN A;  2LD5 A;  2V1N A;  3G1M A;  3GTP J;  1PVE A;  2NVQ J;  2OCE A;  1U3E M;  3C18 A;  4OU0 A;  4ON0 A;  5FRM A;  2DFE A;  2XAU A;  5FD6 A;  1BC8 C;  3DF8 A;  4EJV A;  1T0F C;  4H4K C;  4XLE A;  4S05 A;  2F5E A;  1X1A A;  2PMU A;  2L3D A;  3JRE A;  4HQM A;  4CCM A;  5K7H A;  2F6C A;  2VQG A;  3RKQ A;  3F6V A;  5LRS A;  4HOB A;  5IOY A;  2BY0 A;  3N05 A;  3ZQG A;  3ZQQ A;  1ZLK A;  4RAF A;  1NG7 A;  1VQ9 I;  2OJE D;  1SFO J;  4AIK A;  1L0O C;  3ULQ B;  4HZF A;  1E17 A;  3D5R C;  3SFI A;  4P96 A;  4G12 A;  3E6C C;  4NBQ A;  2FML A;  2F2E A;  4HX7 A;  1BR2 A;  3OYL A;  4J00 A;  2KLO A;  2A3S A;  2OQR A;  5EZG A;  1T0F A;  4LFU A;  4HF2 A;  1FT9 A;  1BOA A;  5D5X B;  2B7E A;  5CQG A;  3O6B B;  3H1C A;  1OCC H;  1RKT A;  1MMS A;  2Y69 H;  1YFH A;  1R5H A;  3FXL A;  5LHI A;  4BDZ A;  5E3M A;  5FB2 A;  4X6A J;  2EIJ H;  3PNT A;  1P7I A;  3WTY C;  3ASO H;  3BJ6 A;  1MJB A;  2FE3 A;  3ZQL A;  1WJC A;  2DA4 A;  1X1C A;  3RZO J;  5CLS A;  3PO2 J;  2QBY A;  1RZ4 A;  2M8E A;  2ZSH B;  3L2R A;  3A4C A;  2JUC A;  1IG7 A;  3CC4 I;  3J81 K;  1RR7 A;  4LGW A;  2E71 A;  5DCF A;  3C2G A;  3F22 A;  2NOJ B;  2UUZ A;  2DFI A;  4YFX F;  2FJ1 A;  3J81 Z;  3RDI A;  2EV0 A;  2O03 A;  1NHA A;  3WTW C;  1VQ4 I;  3LL7 A;  4I09 A;  3KP3 A;  1SAU A;  4FE7 A;  2I8D A;  1XMX A;  2IGN A;  4HNT A;  2UXX A;  3FMR A;  1DGW Y;  2MD5 A;  4UNO A;  2BEO A;  3OR1 C;  2Y0S N;  4PDK A;  4H0E A;  2A5Y B;  4GCV A;  2CMP A;  1B59 A;  1OCR H;  3WU2 C;  3BJO A;  3VOE A;  4UVC A;  5L3F A;  1X1B A;  4A6D A;  3HHH A;  3T8R A;  1HXD A;  2K4J A;  2Y31 A;  2JN6 A;  3KIO A;  4RGU A;  1TNS A;  1Z6T A;  1RUN A;  1QO0 D;  3NWS A;  5E8G A;  4G7Z F;  2EK5 A;  4D5C A;  2HYJ A;  1J0R A;  2M7A A;  2P7V B;  1H9T A;  2L7K A;  3CMM A;  3BPX A;  3PO3 J;  2QSF X;  4KIF A;  2HOT A;  3ASN H;  3CES A;  5EGO A;  4OMZ A;  3SHF A;  4IQJ A;  1REP C;  1OMI A;  4UB6 C;  1WWX A;  3GME A;  4JQF A;  1TWA J;  1JHF A;  2PMH A;  3I54 A;  1KU7 A;  3GX4 X;  2K9L A;  4PK4 A;  3CJN A;  1OCT C;  4A3M J;  3HXL A;  2RGV A;  1JJ6 C;  1YW7 A;  2XAJ A;  1A31 A;  1CF7 B;  3PSF A;  1YG2 A;  3J7Y J;  1UFM A;  2LC2 A;  2LKS A;  1K6O A;  1JGG A;  4HST A;  2F48 A;  2VKH A;  3KE2 A;  4M9X A;  2DJN A;  3D1N I;  1T8I A;  2GAU A;  2GOX B;  1MBG A;  1MNE A;  1YS7 A;  2RRE A;  3FWE A;  1A35 A;  2V1U A;  2JA2 A;  3ZRG A;  3FM5 A;  4C3I J;  5D8K B;  5FLV A;  4KA4 A;  1Z1D A;  1EKE A;  5CVV A;  3CC2 I;  3U2R A;  4IPA A;  3WTT C;  3I58 A;  3KLN A;  4J19 A;  4ZZD A;  1TNT A;  5LHG A;  2D1V A;  3IHU A;  1RI7 A;  1IXC A;  2MW8 A;  2QQB A;  2DMQ A;  1Z3X A;  1VND A;  5DS9 A;  2MD0 A;  4HX8 A;  4QTR A;  3WG7 H;  2RN7 A;  4CDG A;  2DN0 A;  3JW4 A;  3K7A J;  1SAX A;  2P8T A;  1YQA A;  4WXH A;  1VF9 A;  3PM1 A;  4L0Y B;  1O57 A;  1K6Y A;  3A02 A;  1B9M A;  2EIL H;  2HDC A;  2UXN A;  2BHZ A;  1SD4 A;  3CMY A;  4C3J J;  3N97 A;  4MQV A;  3FM3 A;  2XGC A;  1MJ9 A;  5FKM A;  4NQW B;  2OUM A;  1K4T A;  4BEH A;  2OD5 A;  3QQA A;  1ZRF A;  5JI6 A;  3BWG A;  3NRV A;  1JKR C;  5F08 A;  4BE0 A;  3ZQC A;  2OTJ I;  3GTG J;  3I4P A;  5DUI A;  1R23 A;  4BAY A;  4ENK A;  5DEQ A;  1H88 C;  3CCM I;  1AKH A;  2QVO A;  2JPC A;  1MMG A;  2VXZ A;  2ETH A;  5IYB J;  2C6Y A;  2Q1Z B;  5B3S H;  3TL4 X;  3WG9 A;  4ITV A;  2D45 A;  1YIT I;  1C0W A;  1D3Y A;  3H3U A;  4JP0 A;  4ENN A;  2X6X A;  3QYB A;  5JHF A;  2PN6 A;  5FKO A;  2Q8K A;  3OY9 A;  4G94 A;  2IJL A;  4CGZ A;  3OYD A;  2MLK A;  4U0W A;  1IN5 A;  4CA0 A;  2R7F A;  4L9J A;  4XID A;  2E5N A;  3RYR A;  4DZP A;  4ZTJ A;  2RNG A;  1AOY A;  2IA1 A;  1B72 B;  3DPL C;  3VOD A;  2CG4 A;  1O7L A;  3ESW B;  1DGR M;  1LFB A;  4ZYG A;  1ZRD A;  2VOP A;  1Z21 A;  1PYV A;  3Q0U A;  3ZMU A;  3BRO A;  1SC7 A;  3ABM H;  5J6X A;  2QBY B;  1MBF A;  1Q1V A;  2RKH A;  3OYA A;  3C3W A;  1FNN A;  3B73 A;  2DOE A;  2DU9 A;  1U8R A;  2VXD A;  2EZI A;  4BXU A;  2E2H J;  5BMZ A;  1JKQ C;  2ZME A;  4L0Z B;  4P1W A;  4OIQ F;  4GXO A;  1YIO A;  5LGT A;  2YU9 J;  3BZC A;  2JA6 J;  3VYT B;  4JYK A;  5HS7 A;  4MEY F;  3OS0 A;  2V6E A;  1LUJ B;  2Y75 A;  2QKM B;  2Y0S A;  4YFK F;  4EAT A;  3F3X A;  2ZO4 A;  4NUB A;  3ELK A;  2OPT A;  2X1C A;  3COA C;  2DDA A;  1VI0 A;  2DOD A;  3N4M A;  1KYW A;  2WA0 A;  4JX6 A;  3BG3 A;  2YR2 A;  3A1Y A;  1Y0U A;  1ZH5 A;  1TT5 B;  2LFB A;  1AU7 A;  3K0L A;  5F1J A;  3G1O A;  1F4K A;  1YRN A;  3M4O J;  3IH4 A;  1B1B A;  4XBF A;  3EUK L;  2KP6 A;  1LFP A;  1H9G A;  1SD7 A;  2DQL A;  2XIG A;  3HIF A;  3W2V A;  4D7M A;  2ZJQ F;  3K4C A;  3LSK A;  3RQI A;  1G3W A;  3ZOB A;  2DMU A;  2OZU A;  3QWL A;  1IUY A;  1ETQ A;  1PUF A;  3ECO A;  3K4J A;  1IN4 A;  1V55 H;  4BGD A;  1TT0 A;  2ID6 A;  2DTZ A;  2NOG A;  3P9C A;  3MFK A;  1XCB A;  2EJR A;  1EA3 A;  5HOD A;  3VPR A;  1ZKG A;  2JA7 J;  3CJT B;  4ZYH A;  4B44 A;  5EGO B;  1BM9 A;  3A01 A;  2WV0 A;  5GAG J;  3B6C A;  5E3N A;  1KQ0 A;  2TDX A;  1PJR A;  4XK4 A;  1ETX A;  2XVC A;  2OU2 A;  5L3C A;  3GTK J;  2W1O A;  4E4H A;  5EDN A;  4K2E A;  2J5P A;  1Y8Q B;  3JSO A;  1YLF A;  1W5T A;  3CP2 A;  3VFZ A;  3HRU A;  3BLY A;  3VEP A;  4IHS A;  3S2D J;  2CQX A;  4EGY A;  5HNF A;  4F92 B;  4XKC A;  4I99 C;  3H0D A;  4NHJ A;  4BHP A;  3KZI C;  1U6G A;  1GT0 C;  4LLL A;  2DI3 A;  2M0C A;  1G59 A;  3GZN B;  3MEX A;  5F0C A;  2NAZ A;  4UVB A;  5FFX A;  1B9N A;  1Y0N A;  3I59 A;  2F4M B;  2FBH A;  2HZT A;  2XF6 A;  2DYS H;  4E7Z A;  3HOU J;  4PFP A;  3BZ6 A;  1V5E A;  2X6O A;  3TMO A;  2XSD C;  3DU5 A;  4Q48 A;  1D0Y A;  2IVM A;  1YS6 A;  5LGN A;  2TCT A;  4KNY A;  2HQA A;  5FD5 A;  1OCZ H;  4XKB A;  1RIO H;  2P0W A;  2CSO A;  1OR7 C;  1QU3 A;  2KIS A;  3LOC A;  4BY7 J;  1OYW A;  3LSG A;  1BBY A;  3S14 J;  3BQY A;  3ZQH A;  3MVP A;  4HG2 A;  3BPV A;  3PIO F;  1IRF A;  2DJI A;  5GTH C;  5E18 F;  1TQM A;  2H8R A;  1QA6 A;  4BEH B;  1BJA A;  1IN6 A;  1ORK A;  4ZC3 A;  5ED4 A;  2EZL A;  2W57 A;  2GLO A;  4IHX A;  2NRA C;  3G6E I;  1EH8 A;  2I5U A;  1ERD A;  1AKH B;  3E3V A;  3GXO A;  1RPW A;  2L4A A;  3LWF A;  3ZP5 A;  4JX4 A;  1UB9 A;  5DDG A;  3MMY B;  4MEX F;  2VJ4 A;  1QVT A;  4QSH A;  3P5J A;  4RB3 C;  2HI3 A;  3V7C A;  2NNY A;  3W6J B;  4ZDL A;  2ELK A;  4IO9 F;  2XPV A;  2M4K A;  1I3Q J;  3FMQ A;  2DT7 B;  3JRG A;  1YJN I;  4YG2 F;  3GTQ J;  2FBK A;  3K4L A;  4IOA F;  4HDU A;  1EV7 A;  2GA2 A;  3CME I;  2QM3 A;  4A3K J;  3QYE A;  2E60 A;  5C44 J;  5B1B H;  1B8I B;  3G3Z A;  1J09 A;  1GXP A;  2LKP A;  2JA8 J;  4DW6 A;  3OYC A;  5IP9 J;  1S7E A;  4G8X A;  4XSX F;  2L9V A;  3AFH A;  1BN5 A;  1WZ2 A;  2M4G A;  4U7B A;  4N4O B;  1B6A A;  5M5X J;  2JTV A;  2H94 A;  4UUV A;  5LRR A;  4AC0 A;  3S16 J;  2V6C A;  3HRS A;  4A3E J;  1FY7 A;  2A07 F;  1I39 A;  2QQ8 A;  4KN7 X;  3S2H J;  3OYJ A;  3UKG A;  2V26 A;  3K1P A;  4QLC U;  4MIM A;  3F8B A;  3PJR A;  2CH0 A;  2CUJ A;  2YS9 A;  4AVZ A;  1WHU A;  2DA5 A;  1D0Z A;  4GYG A;  1ZR4 A;  1BIA A;  1A04 A;  5D5V B;  1KA8 A;  3CCV I;  3BOQ A;  5JVT A;  1O3R A;  3J7Z I;  1LEA A;  3GZ5 A;  3E5U A;  1VQP I;  2KJB A;  4MNU A;  4IRG A;  3PNY A;  4JX5 A;  3ZQ7 A;  2QEN A;  2Z3Y A;  1HKS A;  2JSP A;  2HOE A;  1N75 A;  3E5Q A;  2E19 A;  4L9T A;  1I6X A;  3LAP A;  3B6A A;  3QOD A;  1K83 J;  1WPK A;  2EFW A;  2UV1 A;  3V4G A;  1I1G A;  1R4M B;  5J4Y A;  2YX7 A;  2O7O A;  3H35 A;  2V1D A;  2DFF A;  3K9T A;  3OOP A;  1WJD A;  2E36 A;  4L5J A;  3TDZ C;  1ZGW A;  1CGP A;  3FXM A;  1I3A A;  3MWM A;  2WAF A;  4KDP A;  2DTR A;  2MBF A;  3TO9 A;  4F91 B;  3IWF A;  4HDV A;  3HPH A;  3SFZ A;  2WB1 N;  4ENM A;  2IRF G;  4WCG A;  1WFX A;  3AG2 H;  5HDN A;  2OBP A;  2HVS A;  3IP4 B;  2VJJ A;  5A2Q Z;  4HLY A;  3ZN1 A;  2HZD A;  3L2V A;  2Y30 A;  1ON2 A;  4B8X A;  2DMN A;  2MG4 A;  4DGW B;  3A01 B;  1KGS A;  3LSJ A;  1VFC A;  2F5V A;  5CYV A;  4KT6 A;  1J5Y A;  4ZDP A;  1PUE E;  4C30 A;  4N9I A;  3L2W A;  3V8K A;  4AIH A;  4DYR A;  4S04 A;  3OIQ A;  2H8W A;  3ROU A;  1OYY A;  4ESJ A;  2JZY A;  2PFB A;  5J1Y A;  1T39 A;  5BPD A;  1MGT A;  2DA1 A;  1IGN A;  4N9H A;  4U0V A;  3WTS C;  4CZZ A;  1KQ8 A;  2EQR A;  3REO A;  3CCY A;  2EA2 A;  3HTU A;  1MIJ A;  2ECC A;  2VBY A;  2KHM A;  3HZJ A;  2FUG 2;  3DBL B;  3RJP A;  3JR9 A;  3KET A;  3BR3 A;  1FZP B;  1MMD A;  3ABK H;  4A3B J;  2LK2 A;  4CSW A;  3CCQ I;  2JRT A;  1U0J A;  1OCO H;  3LQQ A;  2KIQ A;  3QU6 A;  2CUF A;  4RMN A;  2K3P A;  2W84 A;  5CPR B;  4M6V A;  2R5Y A;  2XV4 S;  2FOW A;  3RTR A;  3OS1 A;  2J5O A;  4CIC A;  2HYG D;  1Z3Y A;  2GWR A;  1BA5 A;  5D6F A;  2PJR B;  1XMA A;  3NWT A;  4XRM A;  2AXL A;  3UR3 C;  4U87 A;  4AYB N;  5EEH A;  5JVG F;  3I56 I;  2VUM J;  2FX0 A;  4W97 A;  4XOP A;  4YFN F;  1UG2 A;  4C3H J;  1P4W A;  3RZD J;  3BJA A;  2CW8 A;  3PFY A;  5E1W A;  3F6O A;  2NXN B;  1G3Y A;  1K7A A;  2PJP A;  1S9H A;  3KPH A;  1SVL A;  4I98 B;  2Y0M A;  1JXS A;  2I10 A;  1R22 A;  2YSR A;  2COM A;  2EIM H;  3V7S A;  4WWC A;  1BW5 A;  2IAI A;  4XLN F;  2XAQ A;  4LB5 A;  3MCZ A;  4BNC A;  3CO7 C;  4MFD A;  2HWV A;  2CO5 A;  3FXU A;  2K40 A;  2OCC H;  1ZRC A;  4XRS G;  1WSU A;  2VBX A;  2HYF A;  4A6E A;  2FRH A;  2XAF A;  1ONV A;  2O3F A;  2B63 J;  1J7K A;  1D1B A;  3ONQ A;  3HKZ N;  4M3E A;  3TDU C;  2QSH X;  2JRM A;  4HV5 A;  2VKD A;  5F6F A;  2K5C A;  1Y6I A;  4I76 A;  3IC7 A;  3FZV A;  5JFR A;  5F1R A;  2FSW A;  2YU3 A;  2L5Q A;  2JQ7 A;  4HLX A;  2LLK A;  1WGX A;  4CZC A;  1X4O A;  4XLC A;  3SZG A;  1JUP A;  1WH7 A;  4YEJ A;  5M5Y J;  4EV0 A;  2G7U A;  2IEK A;  4ZYA A;  4NB5 A;  1HSJ A;  2H1L A;  5AIQ A;  2BGC A;  2O8X A;  4NQW A;  3KZZ A;  1I5Z A;  1U2W A;  1R7J A;  3DEE A;  4D1Q A;  1F1Z A;  3E7L A;  4XLF A;  2K4B A;  2L54 A;  3KP7 A;  2KJC A;  4BYY A;  4BXF A;  1HKQ A;  4BJ6 C;  4PJJ A;  1I50 J;  1FP1 D;  4XN3 A;  3WTX C;  1XDU A;  4XL9 A;  1D5Y A;  2ZFU A;  3M8E A;  3BTI A;  2R4G A;  3WGG A;  1BJZ A;  2FF4 A;  1TL8 A;  1WJA A;  2ZXW H;  2ZXJ A;  1LJ9 A;  1ZAO A;  1ETY A;  2FBI A;  3WGI A;  3DKX A;  1MMA A;  2D2W A;  4Y3O A;  1DU0 A;  1IDZ A;  3TBI A;  2EIN H;  4PZJ A;  3ZMD A;  1VQL I;  4IHT A;  4ANJ A;  5KK1 A;  3W6V A;  2K9Q A;  2CRG A;  4PJM A;  2V9P A;  4QWQ A;  1MMN A;  1ZK8 A;  3RPQ A;  3CZ6 A;  3FX3 A;  3WE2 A;  2HTJ A;  2FQ4 A;  4E70 A;  1B72 A;  3ZXS A;  4BXX J;  4ENJ A;  4Y4R A;  2RV8 A;  3JRD A;  4GDF A;  2KIM A;  2JUG A;  3GEZ A;  5FKL A;  2WB1 A;  1B4A A;  4KYW A;  3FK6 A;  3R61 A;  4Y15 A;  2EFP A;  1S72 I;  1WQ2 A;  3I9V 2;  4WXC A;  3WHC A;  4A3J J;  1USS A;  3BP8 A;  3PFI A;  4Y17 A;  2WC2 A;  2UWM A;  2MFZ A;  3BG7 A;  2K85 A;  3EET A;  4FT8 A;  1MH3 A;  2KRH A;  5D8L B;  4EJW A;  4RM3 A;  5F0F A;  3ML6 A;  4RAG A;  1RET A;  3R60 A;  5K5R A;  2HU9 A;  4IX7 A;  4BHB A;  3I55 I;  4M73 A;  1ON1 A;  1G8X A;  3L2Q A;  3GF2 A;  2EIK H;  2GOM A;  2GXG A;  2HOA A;  2ID3 A;  5BS6 A;  3IL2 A;  1E0E A;  1FTZ A;  2WY7 Q;  2VON A;  3LA7 A;  2L4M A;  5KAF C;  2HXI A;  4PJL A;  2ECB A;  2FNA A;  3H9J A;  4EMS A;  1BR1 A;  1WRJ A;  1J2X A;  2XC7 A;  3I64 A;  3M3Y J;  1R1V A;  1Z0X A;  3TW7 A;  1Y39 A;  1SEU A;  4M72 A;  2WWY A;  1YI2 I;  3LSH A;  4E6K G;  1JUM A;  3CUQ C;  1FMV A;  4BE2 A;  3C2H A;  3FKI J;  1VQ7 I;  2KRF A;  4L18 B;  4F55 A;  5FFZ A;  5ICG A;  1WI9 A;  3ABL H;  1IXR C;  3PNV A;  3U21 A;  1R6R A;  4YIR X;  3CCS I;  2R5Y B;  3OV8 A;  3BDD A;  2Q2E A;  2ZXH A;  3ZMT A;  3K4N A;  3DTK A;  4AYB A;  3M8J A;  1SFU A;  2HVQ A;  4WXD A;  4PGH A;  3ZMS A;  4RGR A;  3OR2 C;  1LDJ A;  3PSI A;  2X6W A;  3VYU B;  4FIS A;  2IS6 A;  3KP5 A;  3L00 A;  1QRY A;  1SVO A;  1FOK A;  1ZHF A;  4G6Q A;  2KKO A;  4Z6Y A;  1S29 A;  4NNJ A;  2RDP A;  3K6G A;  3GFM A;  2OV7 A;  3U9G A;  2Z33 A;  3DWL E;  1APL C;  3HSF A;  5ILS A;  4RDU A;  2NYX A;  3HSE A;  3HEF A;  2FD5 A;  5CJ9 A;  2G7H A;  4FHT A;  4M3G A;  2KT0 A;  2X4H A;  3QPH A;  4LMY A;  4XKV A;  1UEL B;  4CCJ A;  1P4A A;  4MTD A;  4L5E A;  4XMY A;  3EDP A;  3BR2 A;  2A69 F;  3HKZ A;  1QHG A;  2AQF A;  2EPF A;  2HGC A;  5K7F A;  1FIP A;  1X19 A;  3OYM A;  5ILV A;  5F0H A;  1FWZ A;  3I4M J;  1OYI A;  2KIU A;  1SD5 A;  3C1D A;  4HYE A;  4KFC A;  1MH4 A;  3S1Q J;  2HQN A;  3BT9 A;  1XSV A;  3GYH X;  1VQ5 I;  4NC8 A;  3ZMV A;  2HDW A;  3FF5 A;  1DPU A;  2VKV A;  3H5N A;  3WTZ A;  1D1C A;  1K4S A;  4A93 J;  3OYK A;  3OYF A;  4CCN A;  2M3A A;  1W0U A;  4WX9 A;  1UJ8 A;  4C9Y A;  4HX4 A;  3JTH A;  3HRT A;  1QZZ A;  2KIF A;  2LDU A;  5CVR A;  4BKX A;  4BJ5 C;  1MDM A;  1Z67 A;  3GWZ A;  1XSX A;  4BBS J;  1MSF C;  4B3A A;  4BQQ A;  5IPA A;  2HKX A;  2HNH A;  2M0M A;  2OZ6 A;  2QZ8 A;  2LYC A;  5GAH J;  4V19 K;  4DNC A;  1K78 B;  2VL8 A;  4PGG A;  3H3V K;  3R6S A;  1G3S A;  1ZN2 A;  4FQG A;  1ZGA A;  2H27 A;  3FXO A;  5EF6 A;  1WJE A;  3QAH A;  5FKN A;  4CO8 A;  2MH9 A;  2ZJ2 A;  3ERM A;  3KZY A;  3NQO A;  1XGO A;  4XIC A;  1NK2 P;  4MQ9 F;  3G1L A;  2M2E A;  1B8I A;  3MZY A;  2EV5 A;  1T98 A;  3HOS A;  2B9S A;  4XRS A;  3M1E A;  3LSI A;  2TRT A;  3OYI A;  2LVS A;  2JWT A;  3KLO A;  1VQM I;  5E8I A;  2O6G E;  4IXA A;  4HNV A;  2E2J J;  2OA4 A;  3W3C A;  3QOP A;  1W0T A;  4BAC A;  2GXB A;  4UUS B;  1Y8R B;  3TED A;  5IY5 H;  4OIP F;  4I7H A;  2XAG A;  1FBS A;  1YJW I;  3LST A;  1U8B A;  3T8T A;  1KU3 A;  1J75 A;  2JK3 A;  3ERE D;  3E97 A;  1X3U A;  4CCL A;  3LSP A;  4AIJ A;  2MAB A;  1XB4 A;  5EEG A;  2KPM A;  5H2F C;  5KHD A;  4A0Y A;  4EGZ A;  2DOF A;  1MNM C;  2DMT A;  1QVU A;  2XHK A;  3BG9 A;  4NC6 A;  5M3M J;  5J1U A;  2L7M P;  4LOC A;  2DOA A;  3WTU C;  3SZP A;  3IKT A;  1VTN C;  1E3O C;  1ZGJ A;  3S8P A;  1XPX A;  1VZ0 A;  4D7N A;  2XGD A;  3BR5 A;  4PSX A;  5DCM A;  5LBQ A;  2M34 A;  2ESN A;  1GUU A;  5TJJ A;  1Q1H A;  2RVC A;  1UHS A;  3P9I A;  2YPR A;  1IN8 A;  2MC4 A;  4OMY A;  4GRI A;  1SMY F;  5DD4 A;  1V5F A;  2K86 A;  4XSZ F;  4AU7 A;  1TLH B;  2H6C A;  3HYI A;  4QPO A;  1HF0 A;  3L7W A;  3B02 A;  1ZTR A;  4JK1 X;  5BPI A;  1U9O A;  3RQ4 A;  1N25 A;  1IW7 F;  1KU2 A;  3KYD B;  4XR6 A;  2E35 A;  5GAE J;  4U88 A;  3KP6 A;  1DP7 P;  4UUT A;  3L1P A;  2Q2E B;  5KVR A;  1FBU A;  3HC7 A;  3S1M J;  1X1P A;  5FLM J;  3FHZ A;  2NS0 A;  4KIG A;  2DYR H;  2Z1D A;  4M6Y A;  5ILU A;  3KYL A;  3J7A Y;  1R5I D;  2XSJ C;  5JHU A;  2BW3 B;  3WU1 B;  1YOV B;  2VT3 A;  1R4N B;  5GPC A;  2HPI A;  2ZFW A;  3SQN A;  3SEQ A;  4ZJZ A;  5HVQ C;  1ETK A;  4I6Z A;  6PAX A;  3GLL A;  2RC4 A;  3M8F A;  1A6I A;  1R58 A;  2QCO A;  1I6H J;  5LHH A;  2IBD A;  1RES A;  2VLA A;  3CUQ B;  2L2O A;  1NK3 P;  3FK7 A;  1EH7 A;  2QQA A;  1UHM A;  4IRI A;  4A5M A;  3EYY A;  4MTE A;  3OSG A;  2ELJ A;  3HTS B;  2CUZ A;  2HR3 A;  4LJZ F;  4XOT A;  4EM1 A;  4HEA 2;  4F52 A;  1FJL A;  1XTA A;  3EUA A;  3WGH A;  3K70 C;  2LP0 A;  2VOO A;  2Z9O A;  3KCC A;  4O3M A;  4RAZ A;  4U7D A;  1LB2 A;  2MSY A;  1NTC A;  3BZK A;  3ZGK A;  4IRH A;  2M87 A;  2M9H A;  3H0G J;  3CTA A;  1EH6 A;  2CYY A;  2VC0 A;  4DQ2 A;  2PJR A;  3DFG A;  2E1C A;  3EUH C;  5GP9 A;  3HRM A;  2VKE A;  2JVH A;  5LGU A;  3ABU A;  4XLA A;  5KAI C;  4GGG A;  5EEA A;  1I1S A;  2LTP A;  2XAH A;  3LSR A;  2IS1 A;  3QP5 A;  1Z6R A;  1KQ9 A;  1FPQ A;  4KIC A;  4EM2 A;  2XB0 X;  4JBA A;  1HLV A;  4XQF A;  4B09 A;  1TZL A;  1MDM B;  2E7W A;  2H1K A;  3CD6 I;  1LVK A;  1DP3 A;  2X1E A;  1QGP A;  1FC3 A;  2OQG A;  5L3D A;  5LEK A;  2W24 A;  3PUF A;  3GTM J;  2KZG A;  3FMS A;  4YRV A;  3CCU I;  4LLG F;  1QNT A;  5HLI A;  4ASN A;  1BI1 A;  2LR8 A;  2XGE A;  1OR7 A;  4IF4 A;  1YX5 A;  2HEO A;  4X0G A;  4LK0 F;  4ESF A;  3EUH A;  1NG6 A;  1PP8 F;  1XD7 A;  5DUK A;  3K10 A;  2EWN A;  2R5Z B;  2X6Y A;  1FX7 A;  3FIW A;  2O9L A;  3FXQ A;  1WJF A;  3I53 A;  2F5F A;  3ZQI A;  3LFK A;  1F5T A;  1P4X A;  3WOD F;  3GW2 A;  5AIP A;  3QRF F;  3HBL A;  2VC1 A;  4NDL A;  1KZH A;  1V5G A;  2STT A;  1IZ1 A;  2HDD A;  1V54 H;  3JRH A;  1F36 A;  1XC5 A;  4ZH4 F;  3Q9S A;  5JR3 A;  1R71 A;  3TO6 A;  2M30 A;  3FDY A;  5D6E A;  3OYB A;  4PFO A;  1HDD C;  3JRB A;  5EJC A;  2R3S A;  1YYV A;  1Z7U A;  1S6L A;  2E7X A;  2YUS A;  3Q9V A;  4HBL A;  4EJO A;  1MBE A;  3RKY A;  1Z77 A;  1JJ8 C;  2GBY A;  4UV8 A;  3MN2 A;  1TC3 C;  2Y2Z A;  3HB9 A;  4G6T B;  2AS5 F;  3QPT A;  1TW2 A;  2M45 A;  2VN2 A;  5J4V A;  2ZNZ A;  3QPL A;  1JT6 A;  3CQZ J;  1DPR A;  2KZV A;  1X3W B;  2ME6 A;  1H0M A;  1TTY A;  2GIV A;  2PX9 A;  2XPU A;  3F23 A;  2KQR A;  3KP4 A;  4DYC A;  5K1Y A;  4UB8 C;  4OIN F;  1D0X A;  2WTE A;  1YIJ I;  3OYN A;  3CO6 C;  2P6T A;  2IGM A;  3TKY A;  5DV5 A;  1KON A;  5IOZ A;  5DCM B;  2QKL B;  3TQN A;  2A6E F;  3O8G A;  5BNG A;  2W4S A;  2F4O B;  1SFK A;  4KIB A;  3VSK A;  2NVT J;  4BU2 A;  1K79 A;  2RQP A;  2O8K A;  1FYL A;  1GV5 A;  3IH3 A;  2H6B A;  2XKO A;  3H9Q A;  3IUO A;  1MBH A;  4BS9 A;  4LIT A;  3RKW A;  1NH3 A;  4HSR A;  4QPQ A;  5A2Q K;  1GXQ A;  2O0Y A;  2BZT A;  1IRX A;  1FYK A;  4FX4 A;  4EJT A;  5FGM A;  5IYC J;  1K61 A;  2L7Z A;  3F8M A;  3V8L A;  2Z5U A;  2A6T A;  2L02 A;  3HUG A;  4ESB A;  2QWW A;  5DYM A;  3MKL A;  4Q47 A;  4R8H A;  3TP0 A;  3CF5 F;  2VPR A;  2OTL I;  4N0B A;  1G4D A;  1W5S A;  1WJB A;  3C2B A;  2LY9 A;  2M1B A;  3GTL J;  1TWH J;  3GLX A;  2N8G A;  5L3E A;  4CYC B;  4CCO A;  2VIX A;  1W1W E;  1SVM A;  2QLZ A;  3FIS A;  3K1N A;  4CXF A;  2DCE A;  2WV1 A;  2K9S A;  3FXR A;  5H6Q A;  4HNU A;  3G4S I;  5IP7 J;  4M3F A;  4OWR B;  3R4K A;  3OL4 A;  1DU6 A;  2GA1 A;  2HKO A;  1XN7 A;  3JRF A;  3FHN A;  3F9K A;  3HOZ J;  1LQ1 A;  1TWC J;  3A0H C;  4KT5 C;  2CU7 A;  3A03 A;  1FSE A;  4CYD A;  3OYH A;  1TW3 A;  2X0L A;  4XN0 A;  4C2T A;  1JGS A;  1BL0 A;  1O7F A;  1SFX A;  2QA4 I;  1F9N A;  3HOY J;  5M3F J;  2HS5 A;  1AA7 A;  5B1A H;  2R7Z J;  1BC7 C;  5EG0 A;  2VPL A;  2AXT C;  3EYI A;  1BI0 A;  4G6D A;  4DYQ A;  1QZE A;  1OPC A;  2DT5 A;  2PQ8 A;  4LIV A;  4A3L J;  2EBI A;  1GLN A;  2LBF B;  2NS7 A;  1SAN A;  3CUO A;  1WJ5 A;  1EJ9 A;  1X2N A;  4D0P A;  3IAS 2;  2BXZ A;  2CGP A;  1M1E B;  2QYO A;  1P2F A;  1ZYR F;  3IV5 A;  3TP3 A;  1ETO A;  2LOO A;  4IKF A;  2CW7 A;  2L9R A;  3LA3 A;  3QPS A;  4PJN A;  1U5T C;  1RKW A;  1Z9C A;  4ZYD A;  5E1X A;  2NVY J;  4P9F A;  3LSM A;  3GFL A;  3TO7 A;  2XAS A;  1W7P A;  1E3H A;  1OJL A;  1O3S A;  2WBM A;  5KCM A;  4F3Q A;  2AO9 A;  3S2W A;  3DPU A;  2MH2 A;  4D9J A;  2ZXI A;  2IA0 A;  9ANT A;  5TGT A;  4BY1 J;  4NC7 A;  4EQQ A;  2R7D A;  1R49 A;  2P5K A;  1S5L C;  2PEX A;  2ZB9 A;  2BV6 A;  2Y48 A;  1ITY A;  4A3D J;  2F4I A;  1IDY A;  3T5X A;  1MZB A;  4YII A;  2CQQ A;  2DBB A;  1U5T A;  3DTE A;  3WHB A;  1Y56 A;  1H8A C;  4IQ4 A;  5K7Z A;  1OCP A;  2Z2S B;  4EEF G;  4P9U A;  4ZYE A;  3O2P E;  2VBZ A; 
#chains in the Genus database with same CATH homology
 4IO9 F;  2ZJQ F;  1YJN I;  3CC4 I;  3CF5 F;  4IOA F;  2OTL I;  3CD6 I;  3CME I;  1VQN I;  3CCQ I;  2E34 A;  4UY8 I;  1VQL I;  3CCR I;  3CCU I;  5DM7 F;  3CJT B;  4IOC F;  3CC7 I;  2FOW A;  5GAG J;  3G4S I;  1VQ4 I;  5DM6 F;  1YHQ I;  2OTJ I;  2ZJP F;  3CCM I;  5JVG F;  1VQK I;  3PIP F;  3I56 I;  1VQ5 I;  1S72 I;  2E35 A;  5GAE J;  1ACI A;  1YIT I;  2QA4 I;  3CCV I;  3J7Z I;  1VQP I;  2NXN B;  2K3F A;  1HC8 A;  3I55 I;  2ZJR F;  1VQ6 I;  2QEX I;  3DLL F;  5GAH J;  4V19 K;  5GAD J;  2E36 A;  1FOX A;  1Y39 A;  1YI2 I;  3J7Y J;  1VQ7 I;  2JQ7 A;  1YIJ I;  1FOY A;  3PIO F;  3CCJ I;  1VQ9 I;  3CCL I;  1QA6 A;  1FOW A;  3CCS I;  3CMA I;  1VQM I;  3CCE I;  3G6E I;  3G71 I;  1VQO I;  2H8W A;  3CC2 I;  1YJW I;  1MMS A;  1YJ9 I;  1VQ8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...