4IOCF

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4iocF00
2E35A 1VQ5I 5DM6F 2E36A 2FOWA 2OTJI 1S72I 4UY8I 1YJWI 1VQNI 1YIJI 3CC4I 1HC8A 2NXNB 3CCLI 1MMSA 2ZJRF 3J7YJ 3CC2I 2ZJPF 1VQKI 2OTLI 1VQLI 1YJ9I 1VQ9I 3I56I 2QA4I 2E34A 3CC7I 5GAEJ 3CCUI 3PIOF 4IOAF 1FOWA 3CCRI 3G71I 3PIPF 1YHQI 5GAHJ 3I55I 3DLLF 3CCQI 4IO9F 3CCEI 1QA6A 1VQ7I 1Y39A 2JQ7A 1FOXA 1YITI 1VQ8I 3G6EI 1VQPI 3CD6I 1ACIA 2K3FA 3CJTB 5GADJ 3CF5F 4IOCF 1YJNI 5JVGF 3CMAI 3CCJI 2H8WA 1VQ6I 3CCVI 4V19K 5GAGJ 1VQMI 1FOYA 2QEXI 3CCSI 1VQOI 3G4SI 5DM7F 3CMEI 3J7ZI 3CCMI 2ZJQF 1YI2I 1VQ4I
chains in the Genus database with same CATH superfamily
4PUSA 4B48A 3LNQA 3GFIA 2EH3A 3BR3A 4IJAA 1MJ9A 4NB5A 4RGUA 4FASD 2EBIA 4ZYHA 1HKTA 3ZQHA 1HC8A 4OWRB 3VYRB 1SMTA 1DP7P 2F4MB 2R5YA 3UKGA 1N77A 2EFWA 2FMYA 2FQ4A 3K9TA 4ESFA 3SHFA 2GIZA 2G9WA 3H92A 4BE2A 2IS6A 3EETA 1R58A 2H8RA 3OIOA 1L3LA 4XKVA 1Z9CA 2DMNA 4W97A 2HOTA 3OYDA 3FIWA 1KA8A 3P9IA 2ME0A 2VQHA 1SAUA 1T6SA 2K27A 2F5EA 4XLNF 3V8LA 2HEOA 2CS3A 4CCKA 2VT3A 3AG2H 3RPUD 2X1DA 3WU1B 1MMNA 1OPCA 1R49A 3E97A 1BR2A 3D0SA 2MBFA 4E4HA 2VUMJ 1WJDA 2R7FA 3MN2A 3ZR8X 4GFBA 3K1NA 2DU9A 2GIVA 3LSRA 3OSGA 4IHWA 2B0LA 1R5HA 1TNSA 2LREA 3CDHA 1UHWA 2UXXA 3Q9VA 2DLLA 3S14J 1LFBA 1SC7A 4PFOA 1GLNA 2QSHX 3IKVA 1ZR4A 5M3FJ 3S2DJ 4E7KA 4GXOA 1TQMA 1XB4A 2P8TA 1FP1D 4RLQA 1IN5A 2HXIA 5IYDJ 2Y48A 3BC8A 3MVPA 1YIOA 4E7IA 3QPSA 1HA8A 1W5SA 3FXKA 3F8NA 2JRMA 3I4PA 2KKOA 2XF5A 3L09A 4Y4RA 2M34A 3L7WA 2JSPA 3OYKA 1SEUA 4F92B 2WAQA 4BACA 4FISA 4OIRF 2Y31A 4AYBA 1MSFC 3BTJA 1XSXA 2IGKA 3HB9A 1H9GA 4DOZA 3LSGA 4Q48A 3CUQB 5JR3A 3WODF 3TO7A 4EV0A 4CA0A 3N97A 4JOMA 2KIQA 4IHXA 4RAFA 2UUZA 3G1LA 1ONVA 3IAS2 2LMDA 1YHQI 3KZIC 3LSIA 1R4NB 2FMLA 1I3QJ 3O2PE 4L9VA 5D6FA 1IXRC 2TDXA 1VQPI 1VQ8I 2IA0A 4ASNA 5FLVA 4XSXF 3BCBA 3QP6A 3VDXA 4KYWA 3V42A 2X6WA 2F2EA 1FOKA 2VIXA 4J19A 4HQMA 1ZGWA 1EV7A 5DM6F 3DEEA 3JTHA 5EF6A 2EV6A 1BR1A 3GXOA 4DYRA 4HW0A 4KICA 4EATA 1YS7A 1WQ2A 3JRAA 1SAXA 3KP6A 2V79A 3HKZA 2Y9ZA 3L2VA 2DT5A 2QWWA 3K4JA 1BOBA 2VBYA 4XKWA 4JX4A 5HDGA 3HRMA 3LSKA 4HV6A 5F27A 2LG4A 2O7OA 1FWZA 2HTJA 4RLFA 4GCVA 3G73A 2FU4A 3A2KA 4A3CJ 2HDWA 2PX9A 3HRSA 2ZJRF 2C6YA 2IGOA 2JN6A 5BQTA 3E6MA 2OTLI 4XRSA 4HF2A 1APLC 4KUMA 2PFBA 3PIPF 2KLOA 4ZH4F 4UVAA 3VWBA 2XKOA 1T56A 5B1BH 5GP9A 4IL6C 1J7KA 1YITI 3K6GA 2QENA 3GEZA 1I3AA 4YFXF 3WTTC 1OR7C 4LK1F 3D5RC 1VQMI 1NHAA 1P4WA 2LR8A 3CCYA 2XSJC 4RMNA 1BIAA 2ETHA 4NBQA 3KEYA 4XNFA 5DCMB 1V3FA 2Y30A 2RGVA 4Y3OA 1IUYA 4Z2YA 4C2UA 2WAQN 5HDNA 2HI3A 2LP0A 4EM2A 4CCJA 3VYUB 1MMAA 2CQKA 2MD5A 3SEZA 2WADA 3TO6A 3LAPA 1RC9A 2LY9A 2WBMA 5D8LB 3BQZA 3PJRA 3IH3A 4B3AA 4XK4A 2VE9A 3CDLA 1DGWY 2UV1A 3LFUA 1IC8A 3H9GA 4IPAA 2VXDA 1T0FC 5KNLA 3OYMA 2L4MA 4U88A 2K4BA 2KFDA 4BY1J 4LLNA 4M9XA 5HDKA 4C30A 1Z0XA 3G2BA 5FKOA 1A36A 3H5RA 5FO5A 3ZOBA 4ITVA 1EH8A 1O7FA 1TC3C 1SANA 2DT7B 2KRCA 2O8KA 4N9IA 2K9SA 2CV1A 3KZZA 2F4OB 4M6VA 4TV7A 1A35A 4MTDA 5J1YA 2CW0F 2R5ZB 5TRDA 1R00A 1ZARA 2CRGA 3BZ6A 3BR1A 1F9NA 1TW3A 2P6TA 2BV6A 1FBUA 4M9ZA 1Z7LA 4WK8F 2EB7A 4DYQA 2P4WA 4MQ9F 3PSIA 4LIUA 3TMOA 1FY7A 2GQQA 1IZ1A 2A5YB 1W4MA 5IYBJ 3RPQA 2E36A 1IW7F 2JA8J 2OA4A 3ABMH 2DA4A 4A12A 5LHIA 1XMKA 1UB9A 1KGSA 1W36D 3JREA 4DBQA 3W3CA 3M3YJ 1FIAA 1TZLA 2YR2A 2Z1DA 3DBRB 4LGWA 4I09A 5CVUA 2MW8A 3EYIA 4BJ6C 5GADJ 2EILH 5F0HA 1B8IB 1KZHA 2EWNA 2R0QC 1BOAA 5D5XB 3OYNA 3QYFA 2R7TA 1KQ9A 3FMRA 2L9SA 1ZK8A 3OR2C 2DTRA 2YX7A 4B3XA 4M6XA 3HRTA 5AIQA 4H0EA 1HBXG 5LHHA 1MMSA 2N8GA 1ITYA 4N0BA 4IRHA 3SEQA 2VQCA 2LOOA 4Y52J 2IA1A 2QVOA 3HTUA 2UWMA 3KIOA 1OCCH 4ETSA 2MC3A 2VJ4A 4XR6A 2WA0A 4BBSJ 2BGCA 3K2ZA 2FEZA 3Q3SA 2AHQA 1QHGA 1X1AA 1K6YA 2XAJA 2R93J 1EH7A 3HPGA 1R5GA 4PFPA 4RDUA 5JLWA 1Z91A 4UUSA 1IXSB 2NVXJ 2IJLA 4HA8A 1IN8A 1F1ZA 2O3FA 4IQ4A 4G9YA 3OOPA 1FMVA 3LSTA 1VQKI 2VC1A 1IRFA 5F6FA 3KLNA 2GOXB 3W6VA 1ZTRA 4BS9A 2VE8A 1RI7A 2LH9A 1WJBA 2JA5J 4A0ZA 2D45A 2YS9A 4EGZA 4ZZDA 5LGUA 3G3ZA 3GZ6A 2CW8A 2CH0A 2NS8A 4U7BA 4ZYDA 2CUJA 1HW1A 3ZQFA 5M5YJ 4RS8A 3J7AY 4KIGA 3BJOA 2K3PA 3P9CA 5IYCJ 4BBRJ 1AHDP 1X4OA 2ZXHA 5LBQA 5E1ZB 2HQNA 4A2UA 1OYWA 2EQRA 3FK6A 3CJQB 5E3MA 1FYLA 2VQLA 1W1WE 3ZMVA 2W84A 3DLLF 1JGSA 3A1YA 5EZGA 2JPCA 3X2QH 1LUJB 1U2WA 4A0YA 2CFOA 4K2EA 4HAMA 1NH3A 4C3HJ 2D5VA 2XAFA 3SYTA 3U2RA 4G12A 4Y17A 5IT3A 1ZLKA 3OL3A 1NG7A 4GYGA 2XASA 3DPUA 3ZN0A 5FKNA 2DDBA 3JCUC 1G6NA 2QUFA 3O8GA 2JVGA 3H9JA 4LFUA 2L02A 4AIDA 3DWLE 5EEGA 1SFEA 1YYVA 3H5NA 2E2HJ 3GWZA 2VPLA 2MD0A 3K7AJ 1OQYA 1GXQA 4C3IJ 1LFPA 3GZNB 1J5YA 2DA5A 3DV8A 4IO9F 5JHFA 1N78A 3COAC 1JGGA 4BDYA 4PZJA 4RGXA 3R6SA 4KISA 2LD5A 4WXHA 3OYEA 1ZR2A 4CCMA 1XSVA 4RBOA 3JTGA 4M3FA 2GA1A 1E3PA 4Z6YA 1XS9A 2M4GA 1DQUA 3S17J 3A03A 5J4YA 4YIFA 4D9JA 3TOBA 3ZMSA 3V7CA 3AG3H 4HF0A 5F0CA 3ULQB 5ICEA 2IS2A 5FGMA 2DMUA 3BZKA 5GAEJ 2LRDA 1IF1A 5F1JA 2JK3A 4A3LJ 5FLMJ 2IPQX 2NNYA 5LRSA 1W36C 3FM3A 1S3JA 2Z99A 1I27A 1TP4A 1DDNA 2K3FA 1P2FA 4KIBA 4A3FJ 5GAGJ 4IF4A 1MKMA 3ABTA 4XL9A 2EFOA 1P7JA 2VT2A 2XF6A 4LD5A 3OR1C 3FKIJ 4AVZA 3KP7A 3OWTA 2VBXA 2F48A 2XGDA 1BI2A 2V6CA 2WC2A 5CVJA 3W2AA 5HLTA 3I56I 3FDYA 1QVUA 4E7ZA 1FNNA 4C9YA 3OSFA 4IOAF 2CV2A 2FOKA 3BJ6A 5GAHJ 9ANTA 1RKWA 2E5ZA 3T0YA 3OYFA 4XLFA 3KEQA 2DYSH 4HPQA 4IZZA 2GBYA 4KJZA 2OAZA 5CLSA 3V7RA 1BM9A 1ZKGA 3O3KA 1T08B 4G7OF 2EV5A 4MHGA 1VQ5I 3U9GA 2E7XA 4ZYAA 1SFOJ 2K9NA 4Y13A 1XDSA 2ACJA 3JRGA 2KDZA 1R1VA 1B1BA 2V1NA 1NK3P 3KYCB 2NVTJ 4D1QA 2K86A 2E34A 2WWYA 2OCEA 2FX0A 4V19K 3PSFA 3NRVA 2BBYA 4BAYA 2OPTA 2CU7A 4DYCA 4BKXA 2XGCA 4EM0B 2BW3B 5L3BA 1JT6A 3M8JA 4WX9A 1ON2A 3V8KA 2DOFA 4XOTA 1WVRA 4M3DA 2BY3A 2Q2EA 2VBZA 5HS9A 5ICFA 1KU9A 4N4OB 2K9QA 2RC4A 2JA7J 1WFXA 3B6AA 1H0MA 1TWAJ 1YFHA 2H1LA 2XUBA 2JTVA 5F04A 3MMYB 3ABLH 2HDCA 3KX2A 1RUOA 2G7HA 4L5JA 1VFCA 4I76A 2IT0A 1WI3A 4YG2F 3CMEI 2KISA 1YI2I 1GT0C 4ZYEA 2E2IJ 3TGNA 1W7PD 2EZKA 4FETA 3BROA 1UZCA 2F5CA 3LA3A 1UHSA 1OCZH 1TL8A 2ZSHB 3ESWB 4AIKA 1JI8A 3CESA 1E0EA 3C7JA 3BR6A 4F93B 2YUSA 3S3MA 5D5UB 1IXCA 1N75A 6PAXA 4ESBA 2LBFB 1FBSA 2GXBA 4MLOA 3CO7C 2HPMA 5GPAA 2E71A 3HUGA 2VOPA 1H8AC 2MFZA 3UNGC 4YELA 5K7FA 3JRFA 1LDJA 2PJRA 4KNYA 3J7AO 2PG4A 3E5UA 1OMIA 4NDLA 5TJJA 1QGPA 1ZHFA 1K83J 2HR3A 5B1AH 1MNMC 3RKYA 3WTYC 2QA4I 2MH2A 3HBLA 2FE3A 1FSEA 1TBXA 5K5QA 1LB2A 3H35A 4MO7A 3AFHA 4XLEA 3J81Z 2M30A 4DJAA 2TRTA 3BJAA 1BW6A 1YLFA 1ETKA 3ZMUA 5JVGF 4O3MA 1EA3A 3PO2J 1U5TA 1QZZA 3HM5A 1ODDA 4QLCU 1EJ9A 3R0AA 4OAZA 2KP6A 4NC7A 4X0GA 5KAFC 2GXAA 2DXIA 4BQQA 3T8RA 4HNVA 3DP7A 1R4MB 3ELKA 4X6AJ 5J8CA 4HG2A 4EJVA 3FXOA 5BOXA 1KU3A 5K7ZA 1B6AA 2DMTA 4LLLA 4LG0A 4BDZA 2HKXA 1HKQA 2CFXA 2LLKA 2W85A 3HDDA 4A5MA 3HOTA 1MMGA 1SD5A 2NVYJ 5D8KB 3VODA 2IS1A 2XRNA 2EZLA 4OIQF 3HKZN 3IUOA 3REOA 3BCAA 3FWEA 4EVIA 2WB1A 3K2AA 3OV8A 4M9SA 2PMZA 2XSDC 2HYGD 1V5GA 5E1WA 1XGMA 2H09A 3GVAA 2XF7A 4KMUX 2DFFA 2QLZA 1YJ9I 2IEKA 1D8JA 1GV2A 3FMQA 4G7HF 5IP7J 1Y1WJ 4YIRX 4LG3A 2HOEA 2JZYA 1XCBA 1GVJA 2M87A 1D1AA 3S32A 5IOZA 4LIVA 3K1PA 3WTSC 2ELJA 1B72B 1IN6A 5HODA 1JUSA 2CUZA 3RCOA 4O5VA 4IOCF 3I71A 3BG7A 4RM3A 3K4MA 1KQ8A 2Y0MA 3U1KA 3D5SC 3VB2A 1ON1A 2ZMEA 4PJ0C 1ZRFA 1X19A 1ENHA 4OU0A 3JR9A 2GLOA 2ZBKA 3TDUC 4YEJA 5KAIC 4P9UA 1O4XA 4GDFA 2VODA 2DCEA 1YRNA 3BR2A 3TEDA 1ZGJA 5LGNA 3I3LA 2R7RA 3F0CA 3WU0A 1E3HA 3CCRI 1ZAOA 1X1PA 2DOEA 1X2NA 1J9IA 2DA6A 4E70A 3S3NA 1XG1A 2TCTA 3WGGA 4L18B 1X1DA 4FQGA 4ESJA 1XDUA 1I1SA 3WE3A 1STZA 3BG9A 1L0OC 4CDGA 4XIDA 4UUSB 4C2TA 1RRJA 4A93J 2A07F 1IRGA 1XGOA 2HQ5A 2M2EA 2OF7A 2EFNA 4D5CA 2HS5A 2G7UA 4HRIA 2L2OA 1WI9A 3QOEA 3ZRGA 5K5OA 2LY2A 4UUVA 1PDNC 2X85A 2KZVA 1T0FA 4A6DA 2A3SA 3DU6A 4HNUA 2ISZA 3M8EA 2JQ7A 2V26A 3LQRA 2R7DA 5LFAA 4OOIA 2CV0A 1LPQA 2FBHA 1YJNI 2R7QA 1SFUA 3WHBA 1HCRA 3LMMA 5DYMA 3HOSA 2CQXA 3TOAA 2OZUA 5IP9J 2W25A 2L7FP 2E1NA 1OCOH 1R36A 4BQOA 1A04A 2A69F 2BVLA 3VYTB 2Z16A 2V4JC 2HKOA 1LE8B 1YOVB 2A6HF 2CG4A 4BEHB 5C4XJ 1T98A 1YW9A 3I4MJ 2W82A 3FF5A 3MKLA 4IXAA 4HEA2 3IAM2 3E1SA 1SVOA 2JPBA 1YTYA 5DUKA 4MEXF 2MH9A 2GA2A 5DM7F 4AM3A 3KZYA 3ECHA 1LNWA 3AG4H 3OY9A 1Z6RA 1RIOH 3LSHA 1JHFA 4BH9A 5E8GA 1VI0A 3FMSA 5E79C 4M3EA 5AIPA 1T38A 1U5TB 4O6JA 4BGDA 2ZJPF 5DCFA 3FISA 1FYKA 4L5EA 5FFXA 2K9MA 1V5FA 1ORKA 2DA2A 4QTRA 1TT0A 1PUFA 1DP3A 4RAZA 2CGPA 4F91B 2I10A 1F36A 3IP4B 1LDKB 3CD6I 3WG7H 3GLXA 4XMYA 2WV1A 2FQ3A 5J4VA 4IHVA 3TKYA 3J80Z 4ZC3A 3P7NA 1TW2A 1X2MA 2IA2A 1J59A 1JT0A 4BUPA 3JRCA 4ENKA 4PK4A 3KLOA 3Q0WA 4CYDA 1QO0D 3OIQA 1CGPA 5J6XA 4BU2A 4MFEA 1KONA 1TTYA 2E2JJ 1RKTA 5CQGA 2EFPA 1W7PB 5FLXK 1LJ9A 1EKEA 3G71I 1CF7B 2E19A 3IL2A 1FEXA 5DV5A 3FXRA 4BXXJ 4HLXA 3QPHA 2AXTC 2DQRA 3E5QA 2L7KA 2K5CA 2X0LA 3CMAI 1U3EM 4S04A 2RQPA 4WXCA 2ZXJA 3MKYB 2IGNA 5F08A 3HL2A 3BZCA 2YU9J 3H5AA 3GFJA 5IP6A 4FX0A 5AONA 2PN6A 4A6EA 1ETVA 3MCZA 2DO7A 2Z3YA 5EJCA 3K1MA 4GRIA 3HOUJ 2DI3A 4KN4X 2L7ZA 1T8IA 3BR5A 3CTAA 1P4AA 2M5WA 5DEQA 2KJBA 3OIPA 3S1RJ 1R71A 1ACIA 1WJ5A 4V2GA 2HYFA 2VASA 1Z1DA 2B7EA 4JK1X 3SZGA 3IRRA 1I6HJ 4ENMA 4G8XA 5FKKA 1W0UA 4U0WA 2HTSA 3PQJA 5HOOA 4Q4ZF 2HDDA 1G3YA 1U8BA 3GTLJ 3FBIB 3GTKJ 3BT9A 3L2CA 2M8GX 2O03A 1OLTA 3L2QA 2M3AA 2LTPA 2QKLB 3G1MA 4X1EA 1OCTC 5C3EJ 3QPLA 1JJ8C 1LEBA 1JUPA 1GV5A 2M0MA 2NNNA 3BWGA 2D1HA 5DCMA 1PVEA 3ZP5A 1OKRA 3FXMA 5CVVA 2CUFA 3E0JB 3OYBA 3QAHA 3QYEA 3BG3A 3HOWJ 1K4SA 1I5ZA 4D7MA 2V9VA 4BYYA 3E6BA 4JX6A 3QU3A 2R7UA 3HGGA 2Q0OA 4FE7A 1K78B 3A0BC 2QGUA 3EUHC 2DOAA 2I5UA 2VKHA 2STWA 3TDZC 3S1NJ 1D5VA 2OCCH 4UB6C 1AOYA 1Y56A 1XGSA 2DFEA 1TLHB 3WTZA 2J5PA 2DBBA 1K78A 1UMQA 3K0LA 2XAUA 3QPTA 5E1XA 2CQNA 3E3VA 1BI1A 3ZQGA 4HX4A 1OFCX 1JHHA 4BE1A 3ROUA 2DPDA 1V5EA 2E35A 4LJZF 4U0YA 2WB1N 4F3QA 2L01A 2JUGA 4EGYA 3F22A 3NEUA 3QQAA 2DYRH 1MBGA 2ZCWA 3FX3A 2A68F 4J00A 2FNPA 3Q5FA 5JLXA 2X48A 1MGTA 2EINH 1TQIA 3HUGB 3RKWA 5A2QZ 2P5LC 1RUNA 1P92A 4V2FA 3MWMA 5LHGA 3GCMA 4PDKA 3CCJI 2YU3A 3M4OJ 2IVMA 1Z05A 4QWQA 2M8EA 4FE4A 4CO8A 4UB8C 1PUFB 2XB0X 1UAAA 3LQQA 2K9LA 2OC6A 5FRNA 1GXPA 4B8XA 1AKHB 3CMYA 2DN0A 2WAFA 1S5LC 3C2HA 2V1UA 3WGHA 3MAJA 3IV5A 4PJLA 1B8IA 1TWHJ 3S2HJ 3I54A 3ABUA 3IC7A 1VQ7I 1Z3YA 2PMUA 3LAJA 2FBKA 1Q1VA 3N4MA 5IT9Z 1AKHA 1MMDA 5BPDA 3LSJA 1T2KA 5IPAA 5GPCA 2YPRA 4B1RA 5E18F 4I6ZA 4DNCA 4ZDPA 3QWLA 2X1CA 1BL0A 1IGNA 3OYLA 3OYAA 4NQWB 1YJWI 1IRZA 2NOGA 2QKMB 3L2WA 3BOQA 3K70D 5LD2C 2X6OA 4LB6B 2VKVA 2GM4A 2M0CA 2L4AA 4XLPF 1WJFA 4CZZA 1Y8QB 3PNYA 4I0AA 1WKMA 2ZNYA 2W1OA 3CJTB 4G6QA 4XONA 1S8NA 2WV0A 4YRVA 5DTDA 5DUIA 1D0ZA 1WJAA 5ED4A 1IV6A 1XCVA 5KVRA 1O3TA 4P9FA 1HQCA 5CQEA 1IRXA 4M6YA 4WCGA 4RM2A 3ONQA 3SXYA 3TW6A 2IGMA 4Q5SF 2ELHA 4AYBN 2HVSA 3HSEA 1J0RA 2QQBA 1ZREA 1OISA 2CUEA 3BDDA 1P6RA 4LK0F 3I55I 3GTOJ 2DDAA 1LE8A 1RZ4A 4IQJA 4HLYA 1XSDA 4G7ZF 3FXLA 2XROA 1FTZA 2E1MB 5C44J 1TQPA 4RAGA 2YSRA 2P5KA 4KA4A 4HDUA 3K4BA 3SFIA 4ENJA 1YS6A 2XB5A 4OMZA 2L9VA 3I59B 1YO5C 2KDOA 1IUFA 2A5WA 3ZQQA 2OTJI 1J75A 2FSWA 1FC3A 2KIMA 1B4AA 1O57A 2EA4A 1IO2A 3H0DA 4A3KJ 1NG6A 3FHZA 3BP8A 2Z2SB 3ISPA 1HKSA 2E1OA 3JSOA 4AUXA 2HQRA 2XAHA 2FNAA 3K4CA 4MFDA 1F4KA 2ZFUA 2BY2A 1X3ZB 1MBHA 5J47A 4XORA 5BNGA 4ZTFA 2OQGA 3H0GJ 4BL0B 1BC8C 1FJLA 1ZG5A 1K7AA 2NS7A 4RB1A 4F52A 5LRRA 4NUBA 3GFLA 2XPWA 4BQNA 3K70C 1LVAA 4OAYA 1HSJA 2VJJA 2VKEA 4N9HA 5EEHA 4UUTA 2NVQJ 3BPVA 3CCEI 4DBRA 1HDDC 4KFCA 2H6BA 4WXDA 1ZLJA 2QSFX 2PJRB 3CF2A 4QIWN 2O8XA 1O3QA 1ERDA 4ZDOA 2MABA 5L3DA 2CQ7A 2DMPA 5E17F 1S7AA 1W5CC 3TW7A 3KPHA 1SD7A 4AU7A 1UFMA 4BY7J 1MH3A 1FIPA 4HSRA 3PM1A 4LOCA 3OYIA 1S6LA 2ZB9A 2AQFA 4AWXB 1EF4A 1SVMA 1D1CA 2CQQA 3M8FA 4CH7A 2NRAC 2HPIA 4ZDLA 3DXJF 2FUG2 3AL0B 1DU6A 4L9TA 3OL4A 3V4GA 3SFZA 2B9SA 2JSCA 4QSHA 2HYJA 5IT9K 4BQAA 2P5VA 4HV5A 4XICA 1ZG3A 4FX4A 3ERED 4M73A 3KP4A 3P9KA 4IHYA 4EJWA 4LB5A 4EJOA 3JSPA 4Y33A 2MLGA 2OD5A 1TWGJ 1EH6A 3QODA 3IH2A 4ZJZA 1H88C 1Y8RB 1XD7A 1ETQA 3L1PA 1V55H 2NYXA 2EIMH 2XC7A 3DTIA 2X4HA 4BJ5C 3NQOA 3TBIA 3CP2A 4II3A 1ETWA 3EUKL 3RIRA 2EIJH 1VQLI 4UNOA 4AD9A 4ABZA 3WE2A 3BTLA 3CJRB 1RR8C 1QZYA 3GF2A 1G8XA 3MEXA 1YW8A 4A3IJ 1LDDA 3GTQJ 2DTZA 1OCRH 1YW7A 3RQIA 1DU0A 2CMPA 2A6TA 1R9TJ 2PQ8A 3G4SI 2L3DA 4A3DJ 2MYSA 4DQ2A 1JJ6C 3U1DA 2QBYB 1SD6A 3BTCA 5D5WB 1R23A 4FTHA 4JBAA 2RN7A 2RNGA 4E6KG 3S15J 5JHUA 3CCUI 2P7VB 2NOJB 1Z77A 4B44A 3S1QJ 2M45A 1PP7U 3F9KA 5EG0A 2W24A 3HJEA 1QQIA 3WTUC 4BNCA 1FPQA 1IN4A 2CWEA 2KQRA 1GUUA 2ISYA 1XGNA 2MG4A 3LSMA 2DK8A 4JYKA 4M72A 5ICCA 2STTA 1PUEE 1VQ4I 2CSOA 2K85A 3DPTA 5E8IA 4AVPA 3K4NA 1HOMA 3KP5A 3GTMJ 2UXNA 3HSRA 5EDNA 4PSXA 4E7HA 3M1EA 2D2WA 3GFMA 4PCQA 5J8FA 3B6CA 3RDIA 4XLAA 1B72A 1S7EA 4PJJA 3J80K 1CQTA 2VONA 2R7WA 2O6GE 4OIPF 3OMYA 2DQLA 3ZQIA 3RKQA 2L54A 1BN5A 4D5FA 3HOZJ 4ANJA 4DGWB 5EGOA 2PI0A 4A3EJ 5HLIA 1KYZA 2Q2EB 1BBYA 1DPRA 3HOXJ 2JWTA 3GW2A 4F55A 3LSPA 1G3TA 2QZ8A 2M4KA 5TISC 2ZFWA 5EGOB 2F5DA 1FMWA 3C2GA 4XM3A 4LMYA 2LFBA 5ICGA 1J09A 2L9RA 1KQ0A 1YX3A 2A61A 1JUMA 3RZOJ 4D0PA 1VTNC 3ZXSA 3SQNA 2HWVA 2Y2ZA 3DKXA 4PJNA 2XDVA 1SMYF 5H6RA 4E7SA 5ILUA 5LLQA 4P55A 3A02A 4BXFA 3PFYA 4KT5C 2RQQA 1QPIA 4A3MJ 3C2BA 3S93A 3CC2I 1BW5A 2PBIA 1GHCA 4RB2C 1JKPC 1WGXA 2X1EA 5DD8A 1ETYA 2X6YA 3D1NI 3WU2C 4B09A 3F3XA 2XIGA 3ZPLA 2ZO4A 3HC7A 2VXZA 1S7OA 2DA7A 4XKBA 4Y15A 2Z5UA 2Z9OA 1XN7A 1FOYA 3ML6A 4UVBA 3L2RA 1ZYRF 1U6GA 4IEJA 1KU7A 4HDVA 2CO5A 3PUFA 4CYCB 2EFQA 3EYYA 4R1HA 1WH7A 3KETA 1U5TC 2V6EA 4UV8A 3CLQA 3DTEA 5FD6A 2JA6J 2HNHA 5H20A 4XN3A 2LKSA 1TNTA 2HZDA 1UG2A 3KFWX 3RYRA 3VFZA 4N4NB 2BXZA 4XRMA 3DTKA 3HSFA 1SVLA 3F8BA 2ZSIB 3DEWA 3CQZJ 1I50J 4Q47A 1OYYA 1RR7A 4PGGA 1MW7A 3L9FA 2BEOA 1IAWA 1MDMA 1XPXA 3ASNH 2IAIA 3VPRA 4HF1A 3OS2A 5FD5A 3F21A 3WG9A 3JAMK 2LVSA 2K7LA 3DU5A 3QYBA 1CF7A 2W00A 2HOAA 2O5RA 3JRIA 1E3OC 1Z6TA 4EM1A 4A3BJ 3AL0C 2BW3A 1U9NA 4G6DA 3CCQI 2DFHA 1Y39A 1A31A 4NHJA 2VJIA 3F8FA 1ZQ3P 1FSHA 3J81K 3I5UA 1K61A 1E2XA 2LF8A 4RGSA 4A3GJ 2PMZN 4AC0A 1RETA 2E60A 1NK2P 4U0VA 1F43A 3GX4X 5HLGA 4NQWA 3OYHA 3GMEA 2DJNA 1HF0A 2IBDA 1QU3A 1XMXA 1JTXA 1MIJA 2NS0A 4RA2A 4W1UA 2QYOA 2HFHA 4JP0A 2V7FA 5F64A 1P4XA 4FCYA 2V1DA 5M5WJ 1MBJA 1K4TA 2Y9YA 2LC2A 3CJNA 4EJTA 2J5OA 2JUCA 3H3ZA 4P96A 3SZTA 5E20A 4L0YB 3DPLC 1W0TA 2DAOA 2LYCA 2AS5F 2ID3A 2HU9A 1Y6IA 2IS4A 3GYHX 1REPC 2FJ1A 1T39A 4B4CA 1SFKA 5B66C 3WGIA 1DPUA 4H4KC 3OYCA 2LNBA 1MBEA 2Q8KA 1HXDA 4G6TB 2WAEA 2MGQA 3ZMDA 5J3LA 2ECBA 1H9TA 2EK5A 1NTCA 3EUHA 2EPFA 4DIQA 3G6EI 4DZJA 2JRTA 3A01A 4IKFA 4EJUA 1J2XA 4EMSA 3B02A 4XRFA 3F8CA 3K4LA 3WTWC 2I8DA 2JVHA 3GLLA 4YFNF 3E5XA 5D4RA 3DBHB 2Y75A 4U7DA 3TO9A 5FROA 5HNFA 4U87A 2JT1A 1X58A 3AG1H 5D4SA 3FM5A 4CICA 3OOUA 3ZQLA 3DF8A 4RAYA 3EUAA 1UG0A 2ZMEC 3PUBA 5J1RA 1VQ9I 4L9NA 1PJRA 2HXOA 1BA5A 1XC5A 1Y0NA 2CW7A 3Q9SA 2H1KA 2V1XA 3VYSB 1OCPA 3V7SA 5L3EA 1HW2A 3W2WA 3IKTA 1WJCA 3B73A 2FXAA 2MSYA 1LFUP 2H8WA 2CJJA 2A6EF 5K1YA 4S05A 3HG9A 2KHMA 2LKPA 3NARA 1VQOI 5FKMA 1BJAA 3T8TA 5CJ9A 4LG0B 3IWZA 4AIHA 4A0XA 3DLAA 2W48A 4XLCA 1Y1VJ 2R7SA 1T95A 2XKPA 4IX7A 2DMQA 1FZPB 2QSGX 3T1BA 2Y0SN 1O3SA 5JI6A 4II2A 3LOCA 3L2UA 5BS6A 1Y0UA 3NWSA 1YX5A 2BY1A 3A4CA 1YE9A 5JVTA 5HVQC 1MJAA 2EJRA 2ZJ2A 1QHHD 2BY0A 2QQAA 1AA7A 3MQ0A 3LA7A 4BHPA 3ABKH 5FJ8J 5CKTA 3CZ6A 3GTJJ 1HW5A 3GTPJ 2V9PA 2QF7A 5D6EA 1LEAA 1FBQA 3K69A 4XLHA 2FF4A 3CO6C 3QU6A 2Z33A 4AIJA 3PIOF 4HSTA 1D8KA 1FOWA 2EIKH 2ME6A 5LGTA 1QA6A 1D1BA 2DT6A 1WRJA 4OIOF 1UELB 2BE5F 2YX4A 2ELKA 2L5QA 3JW4A 3WTVC 2OBPA 2R7ZJ 3PQKA 4MGRA 3RI4A 5J40A 4D7NA 3RPUA 2RV8A 3F72A 3GZ5A 1D3YA 4MEYF 4MIMA 2NVUB 3GTGJ 1FTTA 3JRHA 1W7PA 1MSEC 3S3OA 4I2OA 1XX5A 1ZH5A 2L9NA 3I64A 4WWCA 4ENNA 1QBJA 5ILSA 2BHYA 5F1RA 1FYMA 3N05A 1MH4A 3FBNB 4XSZF 3H36A 3E6DA 3BG5A 2BXYA 3KYDB 3CF5F 1F5TA 3IRQA 1PP8F 1A6QA 3RQ4A 3M07A 2GZWA 1OYIA 3J7ZI 2ZJQF 2VOOA 1P7IA 1UHMA 2R5YB 4MQVA 2FOWA 3E6CC 2LF7A 5L3CA 4FT8A 4R8HA 4BHCA 3W6JB 1USTA 2DK5A 2VBWA 2X6XA 3WHCA 2KL4A 2KIUA 3IWFA 2XGEA 3R4KA 3CUQA 2KRHA 4C3JJ 1YG2A 2COMA 3RKXA 2DFIA 2ESHA 4I0BA 4A5NA 4KMFA 2Y0SA 1IG7A 3LL7A 2BHZA 5KHDA 2W7NA 2OQRA 5ERIA 5KCMA 5L3FA 2MA3A 3ZMTA 2E1MC 5KK1A 2ADUA 4CCNA 2ICWG 1D5YA 1JXSA 3VSLA 1V4RA 2DW4A 2EA2A 3WTXC 2PLYA 1VQ6I 3TL4X 2WTEA 2O61A 3CDIA 1WZ2A 3HZJA 4BEHA 4GGGA 1MZBA 1G59A 1R7JA 5E3LA 5EYRA 2K40A 1I1GA 1S72I 1FT9A 2COBA 1Z67A 2ZC2A 3BG6A 5L3GA 2B63J 2VQGA 3J7YJ 1JKRC 1G3SA 3JRBA 1BJZA 3HGYA 1A6IA 1TWFJ 1UJ8A 5HLHA 3IH4A 3O8HA 3R60A 2H94A 1SD4A 3DEUA 2W4SA 3ECOA 3M7GA 4JX5A 4P1WA 3S2WA 3TQNA 1B9NA 2BOLA 3ZCOA 3DBLB 3K10A 3F6VA 3LA2A 5A2QK 5DD4A 4EEFG 3FHNA 2HOSA 3S16J 4HQEA 2G0EA 4RGRA 1ZRDA 4BHBA 2DODA 1WCMJ 1D0YA 3H3UA 4UV9A 4FHTA 1K6OA 2R4GA 4ZTJA 2VL8A 5LEJA 3MFKA 4IHSA 3CUOA 3DCFA 4KT6A 3HOYJ 5K5RA 3M9AA 4OINF 3ZMZA 3P5JA 2XV4S 4B43A 4UVCA 3BPXA 2CYYA 4WF2A 3FKJA 2Q1ZB 2V9KA 4ON0A 2KJCA 5DS9A 1HLVA 5F0FA 1Q1HA 3EQLF 1B59A 4BXUA 5IY5H 1X1CA 2XPVA 2ZNZA 4S0HB 5ILVA 1KYWA 2LK2A 2XAGA 2ZMEB 3RSNA 2KRFA 4G94A 1QVTA 4F7ZA 1IN7A 5B3SH 1JTYA 4I01A 2E5NA 5EZHA 2R3SA 2MLKA 4CCLA 1K79A 1G4DA 5HS8A 2BZTA 3RJPA 4P5OA 3PNVA 3HHGA 5J1UA 4CXFA 1RESA 2JJ7A 3KP3A 1TT5B 2D1VA 5GTHC 1XTAA 1GDTA 4DW6A 4UHTA 1ZRCA 2XPUA 2PEXA 4KITB 1IV8A 2IXSA 3IHUA 4XRSG 2K02A 3HRUA 2DJIA 2AXLA 4I98B 2P81A 2O9LA 1I39A 2H27A 3K4KA 1Z7UA 1X1BA 1GVDA 1ULYA 1RNLA 2DA1A 4LITA 4Y7NJ 1POGA 2M7AA 3M1CA 5CVRA 4L5IA 1MD0A 3TP0A 1YQAA 4NNJA 5BPIA 3PO3J 1X3WB 4I02A 1LKXA 1WPKA 5K7HA 3V8JA 2XAQA 2P0WA 1JKQC 2XGXA 4PGHA 1MNDA 2OUMA 3BQYA 4NC6A 1FOXA 1G2HA 1D0XA 1JE8A 3U21A 4R79A 3JRDA 5EEAA 3MKZA 3Q0UA 2KIFA 2R7VA 1DGRM 5LEKA 1R6RA 3R61A 5C4JJ 3W6KB 1WSUA 3HEFA 2QQ9A 3G1OA 2E7WA 2LY1A 2HVRA 2VI6A 2EV0A 4BE0A 4HBLA 4MNUA 1ZELA 4YIIA 3FXJA 4I99C 2VB6A 2RREA 3HPHA 2EZHA 5FLXZ 3ASOH 1O3RA 1HSTA 3R0JA 3OS0A 1G3WA 2AQEA 3KCCA 1H89C 3VOEA 3I59A 3EDPA 3HYIA 1B9MA 1BIBA 1XMAA 3TP3A 5FKLA 2VJ5A 3PNTA 2M1BA 3ZQ7A 1WHUA 4A69C 3D5LA 2F4IA 3MZHA 3VSKA 2R7OA 4OMYA 3KP2A 3RYPA 1U8RA 1KU2A 2RDPA 1VQNI 2NXNB 2A05A 3A0HC 4YFKF 2R7XA 1BR4A 3HXLA 4IRIA 3MD2A 1LVKA 3O6BB 4IVNA 1Z21A 3T5XA 5GTIC 1WJEA 1QNTA 1FP2A 1VZ0A 1HDPA 2DPUA 2LSOA 3RTRA 5CYVA 3CCVI 2JMWA 2H6CA 1MNEA 1IDZA 3VEPA 1R22A 4XQFA 4XKCA 1T33A 3OYJA 1C0WA 2E1CA 3KE2A 2QBYA 4HOBA 1WH5A 3AAFA 1R1TA 4HYEA 1S29A 5M3MJ 1X4PA 2L7MP 4PSWA 2IP2A 2NAZA 2Y69H 4IRGA 4A3JJ 1QZEA 2XHKA 2FD5A 3RZDJ 3E7LA 1S9HA 1ZG1A 2VN2A 2WY7Q 1Z3XA 2QQ8A 2JA2A 3AKZA 3C18A 3BR0A 3I0TA 4LLGF 2QEXI 3CCSI 1BI0A 3CCMI 2VC0A 2F6CA 2HVQA 2ZXWH 3JAMZ 3ZGKA 2BYVE 4GYIA 2GWRA 3W2VA 1N25A 3LFKA 5JFRA 1YIJI 1QRYA 3CCLI 3MZYA 5HNHA 1BI3A 3DQVC 3H9QA 3NAUA 2ECCA 4M3GA 1M1EB 3MZ8A 2XVCA 3QP5A 3BY6A 3CC4I 4CGZA 1VF9A 2HQAA 2GOMA 2KPMA 3GBGA 2PJPA 2R92J 2FRHA 1YRNB 3HIFA 1MDMB 2QM3A 3UR3C 2GXGA 5FFZA 4CZCA 4HX7A 1OR7A 3GUDA 1JKOC 2K4JA 3FZVA 3PL8A 2HZTA 3PFIA 1MJBA 5DDGA 2UZKA 3CP8A 4L9JA 5EG0B 3H3VK 4EQQA 2P7CB 4E7LA 1BC7C 1QPMA 2AO9A 5B5EC 1X3UA 1IDYA 4CUGA 2LKXA 2VKDA 1AU7A 2ZKZA 2OZ6A 4C2MJ 5D5VB 1ETOA 5E3NA 1SFXA 2LBFA 1FLIA 4PJMA 4CSWA 5CVIA 3A01B 5H2FC 2P6SA 1USSA 3KEOA 2MC4A 3CUQC 2HGCA 2L0KA 4XN0A 1U0JA 2XRLA 2KZGA 1MBKA 3ZQCA 5TGTA 4CHUA 2RKHA 2GAUA 3EPZA 2ESNA 2EZIA 3I58A 5CPRB 3F8MA 3QRFF 4QPQA 1AWCA 1WWXA 4J01A 3I9V2 4JQFA 4UXNA 3ZN1A 3F23A 4M3BA 3SDGA 2VLAA 3L00A 4HZFA 2W57A 4HNTA 2IW5A 1VNDA 3CLOA 4CYCA 4E7JA 4UY8I 3I4NJ 2KMUA 2FBIA 3FXQA 3H1CA 2OU2A 1TWCJ 3CC7I 2RVCA 4L0ZB 3CMMA 1R1UA 4BJTA 1E17A 4RB3C 3C1DA 1O7LA 2ID6A 4RB0A 3QOPA 1UCRA 2M7BA 3SDBA 2F5VA 3KYLA 1MBFA 1U78A 2KT0A 3HTSB 2FA5A 4KDPA 4NC8A 2F5FA 3FK7A 4XOPA 1ETXA 2VPRA 2BVMA 1U9OA 2LDUA 2X51A 4CCOA 4DZPA 4ZZLA 2OJED 2ZXIA 4MTEA 2R5ZA 1OJLA 1R5ID 3ERMA 2QCOA 2RNJA 3F6OA 3LWFA 1PYVA 2PMHA 5M5XJ 4QPOA 4B47A 4GO1A 3BLYA 4KN7X 1ZN2A 5BMZA 4ZYGA 3S1MJ 3SJMA 4M71A 3SZPA 3OYGA 4HX8A 3DFGA 3OS1A 1FX7A 3C3WA 3FXUA 1DUXC 3MKWB 2M9HA 2IRFG 5HS7A 4KIFA 4XBFA 3NWTA 2WY8Q 3HHHA 2RAEA 3BTIA 3DKYA 5FB2A 5FRMA 1I6XA 2X9DA 1P9QC 3DKWA 5H6QA 3HOVJ 4M74A 5IOYA 4I7HA 2O0YA 2OV7A 3S8PA 4IHTA 1IJWC 1V54H 1ZGAA 1LQ1A 1A5JA 1RPWA 5E3OA 2DA3A 1W5TA 3Q0VA 3GO5A 3I53A
chains in the Genus database with same CATH topology
2E35A 1VQ5I 5DM6F 2E36A 2FOWA 2OTJI 1S72I 4UY8I 1YJWI 1VQNI 1YIJI 3CC4I 1HC8A 2NXNB 3CCLI 1MMSA 2ZJRF 3J7YJ 3CC2I 2ZJPF 1VQKI 2OTLI 1VQLI 1YJ9I 1VQ9I 3I56I 2QA4I 2E34A 3CC7I 5GAEJ 3CCUI 3PIOF 4IOAF 1FOWA 3CCRI 3G71I 3PIPF 1YHQI 5GAHJ 3I55I 3DLLF 3CCQI 4IO9F 3CCEI 1QA6A 1VQ7I 1Y39A 2JQ7A 1FOXA 1YITI 1VQ8I 3G6EI 1VQPI 3CD6I 1ACIA 2K3FA 3CJTB 5GADJ 3CF5F 4IOCF 1YJNI 5JVGF 3CMAI 3CCJI 2H8WA 1VQ6I 3CCVI 4V19K 5GAGJ 1VQMI 1FOYA 2QEXI 3CCSI 1VQOI 3G4SI 5DM7F 3CMEI 3J7ZI 3CCMI 2ZJQF 1YI2I 1VQ4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E35 A;  1VQ5 I;  5DM6 F;  2E36 A;  2FOW A;  2OTJ I;  1S72 I;  4UY8 I;  1YJW I;  1VQN I;  1YIJ I;  3CC4 I;  1HC8 A;  2NXN B;  3CCL I;  1MMS A;  2ZJR F;  3J7Y J;  3CC2 I;  2ZJP F;  1VQK I;  2OTL I;  1VQL I;  1YJ9 I;  1VQ9 I;  3I56 I;  2QA4 I;  2E34 A;  3CC7 I;  5GAE J;  3CCU I;  3PIO F;  4IOA F;  1FOW A;  3CCR I;  3G71 I;  3PIP F;  1YHQ I;  5GAH J;  3I55 I;  3DLL F;  3CCQ I;  4IO9 F;  3CCE I;  1QA6 A;  1VQ7 I;  1Y39 A;  2JQ7 A;  1FOX A;  1YIT I;  1VQ8 I;  3G6E I;  1VQP I;  3CD6 I;  1ACI A;  2K3F A;  3CJT B;  5GAD J;  3CF5 F;  4IOC F;  1YJN I;  5JVG F;  3CMA I;  3CCJ I;  2H8W A;  1VQ6 I;  3CCV I;  4V19 K;  5GAG J;  1VQM I;  1FOY A;  2QEX I;  3CCS I;  1VQO I;  3G4S I;  5DM7 F;  3CME I;  3J7Z I;  3CCM I;  2ZJQ F;  1YI2 I;  1VQ4 I; 
#chains in the Genus database with same CATH topology
 4PUS A;  4B48 A;  3LNQ A;  3GFI A;  2EH3 A;  3BR3 A;  4IJA A;  1MJ9 A;  4NB5 A;  4RGU A;  4FAS D;  2EBI A;  4ZYH A;  1HKT A;  3ZQH A;  1HC8 A;  4OWR B;  3VYR B;  1SMT A;  1DP7 P;  2F4M B;  2R5Y A;  3UKG A;  1N77 A;  2EFW A;  2FMY A;  2FQ4 A;  3K9T A;  4ESF A;  3SHF A;  2GIZ A;  2G9W A;  3H92 A;  4BE2 A;  2IS6 A;  3EET A;  1R58 A;  2H8R A;  3OIO A;  1L3L A;  4XKV A;  1Z9C A;  2DMN A;  4W97 A;  2HOT A;  3OYD A;  3FIW A;  1KA8 A;  3P9I A;  2ME0 A;  2VQH A;  1SAU A;  1T6S A;  2K27 A;  2F5E A;  4XLN F;  3V8L A;  2HEO A;  2CS3 A;  4CCK A;  2VT3 A;  3AG2 H;  3RPU D;  2X1D A;  3WU1 B;  1MMN A;  1OPC A;  1R49 A;  3E97 A;  1BR2 A;  3D0S A;  2MBF A;  4E4H A;  2VUM J;  1WJD A;  2R7F A;  3MN2 A;  3ZR8 X;  4GFB A;  3K1N A;  2DU9 A;  2GIV A;  3LSR A;  3OSG A;  4IHW A;  2B0L A;  1R5H A;  1TNS A;  2LRE A;  3CDH A;  1UHW A;  2UXX A;  3Q9V A;  2DLL A;  3S14 J;  1LFB A;  1SC7 A;  4PFO A;  1GLN A;  2QSH X;  3IKV A;  1ZR4 A;  5M3F J;  3S2D J;  4E7K A;  4GXO A;  1TQM A;  1XB4 A;  2P8T A;  1FP1 D;  4RLQ A;  1IN5 A;  2HXI A;  5IYD J;  2Y48 A;  3BC8 A;  3MVP A;  1YIO A;  4E7I A;  3QPS A;  1HA8 A;  1W5S A;  3FXK A;  3F8N A;  2JRM A;  3I4P A;  2KKO A;  2XF5 A;  3L09 A;  4Y4R A;  2M34 A;  3L7W A;  2JSP A;  3OYK A;  1SEU A;  4F92 B;  2WAQ A;  4BAC A;  4FIS A;  4OIR F;  2Y31 A;  4AYB A;  1MSF C;  3BTJ A;  1XSX A;  2IGK A;  3HB9 A;  1H9G A;  4DOZ A;  3LSG A;  4Q48 A;  3CUQ B;  5JR3 A;  3WOD F;  3TO7 A;  4EV0 A;  4CA0 A;  3N97 A;  4JOM A;  2KIQ A;  4IHX A;  4RAF A;  2UUZ A;  3G1L A;  1ONV A;  3IAS 2;  2LMD A;  1YHQ I;  3KZI C;  3LSI A;  1R4N B;  2FML A;  1I3Q J;  3O2P E;  4L9V A;  5D6F A;  1IXR C;  2TDX A;  1VQP I;  1VQ8 I;  2IA0 A;  4ASN A;  5FLV A;  4XSX F;  3BCB A;  3QP6 A;  3VDX A;  4KYW A;  3V42 A;  2X6W A;  2F2E A;  1FOK A;  2VIX A;  4J19 A;  4HQM A;  1ZGW A;  1EV7 A;  5DM6 F;  3DEE A;  3JTH A;  5EF6 A;  2EV6 A;  1BR1 A;  3GXO A;  4DYR A;  4HW0 A;  4KIC A;  4EAT A;  1YS7 A;  1WQ2 A;  3JRA A;  1SAX A;  3KP6 A;  2V79 A;  3HKZ A;  2Y9Z A;  3L2V A;  2DT5 A;  2QWW A;  3K4J A;  1BOB A;  2VBY A;  4XKW A;  4JX4 A;  5HDG A;  3HRM A;  3LSK A;  4HV6 A;  5F27 A;  2LG4 A;  2O7O A;  1FWZ A;  2HTJ A;  4RLF A;  4GCV A;  3G73 A;  2FU4 A;  3A2K A;  4A3C J;  2HDW A;  2PX9 A;  3HRS A;  2ZJR F;  2C6Y A;  2IGO A;  2JN6 A;  5BQT A;  3E6M A;  2OTL I;  4XRS A;  4HF2 A;  1APL C;  4KUM A;  2PFB A;  3PIP F;  2KLO A;  4ZH4 F;  4UVA A;  3VWB A;  2XKO A;  1T56 A;  5B1B H;  5GP9 A;  4IL6 C;  1J7K A;  1YIT I;  3K6G A;  2QEN A;  3GEZ A;  1I3A A;  4YFX F;  3WTT C;  1OR7 C;  4LK1 F;  3D5R C;  1VQM I;  1NHA A;  1P4W A;  2LR8 A;  3CCY A;  2XSJ C;  4RMN A;  1BIA A;  2ETH A;  4NBQ A;  3KEY A;  4XNF A;  5DCM B;  1V3F A;  2Y30 A;  2RGV A;  4Y3O A;  1IUY A;  4Z2Y A;  4C2U A;  2WAQ N;  5HDN A;  2HI3 A;  2LP0 A;  4EM2 A;  4CCJ A;  3VYU B;  1MMA A;  2CQK A;  2MD5 A;  3SEZ A;  2WAD A;  3TO6 A;  3LAP A;  1RC9 A;  2LY9 A;  2WBM A;  5D8L B;  3BQZ A;  3PJR A;  3IH3 A;  4B3A A;  4XK4 A;  2VE9 A;  3CDL A;  1DGW Y;  2UV1 A;  3LFU A;  1IC8 A;  3H9G A;  4IPA A;  2VXD A;  1T0F C;  5KNL A;  3OYM A;  2L4M A;  4U88 A;  2K4B A;  2KFD A;  4BY1 J;  4LLN A;  4M9X A;  5HDK A;  4C30 A;  1Z0X A;  3G2B A;  5FKO A;  1A36 A;  3H5R A;  5FO5 A;  3ZOB A;  4ITV A;  1EH8 A;  1O7F A;  1TC3 C;  1SAN A;  2DT7 B;  2KRC A;  2O8K A;  4N9I A;  2K9S A;  2CV1 A;  3KZZ A;  2F4O B;  4M6V A;  4TV7 A;  1A35 A;  4MTD A;  5J1Y A;  2CW0 F;  2R5Z B;  5TRD A;  1R00 A;  1ZAR A;  2CRG A;  3BZ6 A;  3BR1 A;  1F9N A;  1TW3 A;  2P6T A;  2BV6 A;  1FBU A;  4M9Z A;  1Z7L A;  4WK8 F;  2EB7 A;  4DYQ A;  2P4W A;  4MQ9 F;  3PSI A;  4LIU A;  3TMO A;  1FY7 A;  2GQQ A;  1IZ1 A;  2A5Y B;  1W4M A;  5IYB J;  3RPQ A;  2E36 A;  1IW7 F;  2JA8 J;  2OA4 A;  3ABM H;  2DA4 A;  4A12 A;  5LHI A;  1XMK A;  1UB9 A;  1KGS A;  1W36 D;  3JRE A;  4DBQ A;  3W3C A;  3M3Y J;  1FIA A;  1TZL A;  2YR2 A;  2Z1D A;  3DBR B;  4LGW A;  4I09 A;  5CVU A;  2MW8 A;  3EYI A;  4BJ6 C;  5GAD J;  2EIL H;  5F0H A;  1B8I B;  1KZH A;  2EWN A;  2R0Q C;  1BOA A;  5D5X B;  3OYN A;  3QYF A;  2R7T A;  1KQ9 A;  3FMR A;  2L9S A;  1ZK8 A;  3OR2 C;  2DTR A;  2YX7 A;  4B3X A;  4M6X A;  3HRT A;  5AIQ A;  4H0E A;  1HBX G;  5LHH A;  1MMS A;  2N8G A;  1ITY A;  4N0B A;  4IRH A;  3SEQ A;  2VQC A;  2LOO A;  4Y52 J;  2IA1 A;  2QVO A;  3HTU A;  2UWM A;  3KIO A;  1OCC H;  4ETS A;  2MC3 A;  2VJ4 A;  4XR6 A;  2WA0 A;  4BBS J;  2BGC A;  3K2Z A;  2FEZ A;  3Q3S A;  2AHQ A;  1QHG A;  1X1A A;  1K6Y A;  2XAJ A;  2R93 J;  1EH7 A;  3HPG A;  1R5G A;  4PFP A;  4RDU A;  5JLW A;  1Z91 A;  4UUS A;  1IXS B;  2NVX J;  2IJL A;  4HA8 A;  1IN8 A;  1F1Z A;  2O3F A;  4IQ4 A;  4G9Y A;  3OOP A;  1FMV A;  3LST A;  1VQK I;  2VC1 A;  1IRF A;  5F6F A;  3KLN A;  2GOX B;  3W6V A;  1ZTR A;  4BS9 A;  2VE8 A;  1RI7 A;  2LH9 A;  1WJB A;  2JA5 J;  4A0Z A;  2D45 A;  2YS9 A;  4EGZ A;  4ZZD A;  5LGU A;  3G3Z A;  3GZ6 A;  2CW8 A;  2CH0 A;  2NS8 A;  4U7B A;  4ZYD A;  2CUJ A;  1HW1 A;  3ZQF A;  5M5Y J;  4RS8 A;  3J7A Y;  4KIG A;  3BJO A;  2K3P A;  3P9C A;  5IYC J;  4BBR J;  1AHD P;  1X4O A;  2ZXH A;  5LBQ A;  5E1Z B;  2HQN A;  4A2U A;  1OYW A;  2EQR A;  3FK6 A;  3CJQ B;  5E3M A;  1FYL A;  2VQL A;  1W1W E;  3ZMV A;  2W84 A;  3DLL F;  1JGS A;  3A1Y A;  5EZG A;  2JPC A;  3X2Q H;  1LUJ B;  1U2W A;  4A0Y A;  2CFO A;  4K2E A;  4HAM A;  1NH3 A;  4C3H J;  2D5V A;  2XAF A;  3SYT A;  3U2R A;  4G12 A;  4Y17 A;  5IT3 A;  1ZLK A;  3OL3 A;  1NG7 A;  4GYG A;  2XAS A;  3DPU A;  3ZN0 A;  5FKN A;  2DDB A;  3JCU C;  1G6N A;  2QUF A;  3O8G A;  2JVG A;  3H9J A;  4LFU A;  2L02 A;  4AID A;  3DWL E;  5EEG A;  1SFE A;  1YYV A;  3H5N A;  2E2H J;  3GWZ A;  2VPL A;  2MD0 A;  3K7A J;  1OQY A;  1GXQ A;  4C3I J;  1LFP A;  3GZN B;  1J5Y A;  2DA5 A;  3DV8 A;  4IO9 F;  5JHF A;  1N78 A;  3COA C;  1JGG A;  4BDY A;  4PZJ A;  4RGX A;  3R6S A;  4KIS A;  2LD5 A;  4WXH A;  3OYE A;  1ZR2 A;  4CCM A;  1XSV A;  4RBO A;  3JTG A;  4M3F A;  2GA1 A;  1E3P A;  4Z6Y A;  1XS9 A;  2M4G A;  1DQU A;  3S17 J;  3A03 A;  5J4Y A;  4YIF A;  4D9J A;  3TOB A;  3ZMS A;  3V7C A;  3AG3 H;  4HF0 A;  5F0C A;  3ULQ B;  5ICE A;  2IS2 A;  5FGM A;  2DMU A;  3BZK A;  5GAE J;  2LRD A;  1IF1 A;  5F1J A;  2JK3 A;  4A3L J;  5FLM J;  2IPQ X;  2NNY A;  5LRS A;  1W36 C;  3FM3 A;  1S3J A;  2Z99 A;  1I27 A;  1TP4 A;  1DDN A;  2K3F A;  1P2F A;  4KIB A;  4A3F J;  5GAG J;  4IF4 A;  1MKM A;  3ABT A;  4XL9 A;  2EFO A;  1P7J A;  2VT2 A;  2XF6 A;  4LD5 A;  3OR1 C;  3FKI J;  4AVZ A;  3KP7 A;  3OWT A;  2VBX A;  2F48 A;  2XGD A;  1BI2 A;  2V6C A;  2WC2 A;  5CVJ A;  3W2A A;  5HLT A;  3I56 I;  3FDY A;  1QVU A;  4E7Z A;  1FNN A;  4C9Y A;  3OSF A;  4IOA F;  2CV2 A;  2FOK A;  3BJ6 A;  5GAH J;  9ANT A;  1RKW A;  2E5Z A;  3T0Y A;  3OYF A;  4XLF A;  3KEQ A;  2DYS H;  4HPQ A;  4IZZ A;  2GBY A;  4KJZ A;  2OAZ A;  5CLS A;  3V7R A;  1BM9 A;  1ZKG A;  3O3K A;  1T08 B;  4G7O F;  2EV5 A;  4MHG A;  1VQ5 I;  3U9G A;  2E7X A;  4ZYA A;  1SFO J;  2K9N A;  4Y13 A;  1XDS A;  2ACJ A;  3JRG A;  2KDZ A;  1R1V A;  1B1B A;  2V1N A;  1NK3 P;  3KYC B;  2NVT J;  4D1Q A;  2K86 A;  2E34 A;  2WWY A;  2OCE A;  2FX0 A;  4V19 K;  3PSF A;  3NRV A;  2BBY A;  4BAY A;  2OPT A;  2CU7 A;  4DYC A;  4BKX A;  2XGC A;  4EM0 B;  2BW3 B;  5L3B A;  1JT6 A;  3M8J A;  4WX9 A;  1ON2 A;  3V8K A;  2DOF A;  4XOT A;  1WVR A;  4M3D A;  2BY3 A;  2Q2E A;  2VBZ A;  5HS9 A;  5ICF A;  1KU9 A;  4N4O B;  2K9Q A;  2RC4 A;  2JA7 J;  1WFX A;  3B6A A;  1H0M A;  1TWA J;  1YFH A;  2H1L A;  2XUB A;  2JTV A;  5F04 A;  3MMY B;  3ABL H;  2HDC A;  3KX2 A;  1RUO A;  2G7H A;  4L5J A;  1VFC A;  4I76 A;  2IT0 A;  1WI3 A;  4YG2 F;  3CME I;  2KIS A;  1YI2 I;  1GT0 C;  4ZYE A;  2E2I J;  3TGN A;  1W7P D;  2EZK A;  4FET A;  3BRO A;  1UZC A;  2F5C A;  3LA3 A;  1UHS A;  1OCZ H;  1TL8 A;  2ZSH B;  3ESW B;  4AIK A;  1JI8 A;  3CES A;  1E0E A;  3C7J A;  3BR6 A;  4F93 B;  2YUS A;  3S3M A;  5D5U B;  1IXC A;  1N75 A;  6PAX A;  4ESB A;  2LBF B;  1FBS A;  2GXB A;  4MLO A;  3CO7 C;  2HPM A;  5GPA A;  2E71 A;  3HUG A;  2VOP A;  1H8A C;  2MFZ A;  3UNG C;  4YEL A;  5K7F A;  3JRF A;  1LDJ A;  2PJR A;  4KNY A;  3J7A O;  2PG4 A;  3E5U A;  1OMI A;  4NDL A;  5TJJ A;  1QGP A;  1ZHF A;  1K83 J;  2HR3 A;  5B1A H;  1MNM C;  3RKY A;  3WTY C;  2QA4 I;  2MH2 A;  3HBL A;  2FE3 A;  1FSE A;  1TBX A;  5K5Q A;  1LB2 A;  3H35 A;  4MO7 A;  3AFH A;  4XLE A;  3J81 Z;  2M30 A;  4DJA A;  2TRT A;  3BJA A;  1BW6 A;  1YLF A;  1ETK A;  3ZMU A;  5JVG F;  4O3M A;  1EA3 A;  3PO2 J;  1U5T A;  1QZZ A;  3HM5 A;  1ODD A;  4QLC U;  1EJ9 A;  3R0A A;  4OAZ A;  2KP6 A;  4NC7 A;  4X0G A;  5KAF C;  2GXA A;  2DXI A;  4BQQ A;  3T8R A;  4HNV A;  3DP7 A;  1R4M B;  3ELK A;  4X6A J;  5J8C A;  4HG2 A;  4EJV A;  3FXO A;  5BOX A;  1KU3 A;  5K7Z A;  1B6A A;  2DMT A;  4LLL A;  4LG0 A;  4BDZ A;  2HKX A;  1HKQ A;  2CFX A;  2LLK A;  2W85 A;  3HDD A;  4A5M A;  3HOT A;  1MMG A;  1SD5 A;  2NVY J;  5D8K B;  3VOD A;  2IS1 A;  2XRN A;  2EZL A;  4OIQ F;  3HKZ N;  3IUO A;  3REO A;  3BCA A;  3FWE A;  4EVI A;  2WB1 A;  3K2A A;  3OV8 A;  4M9S A;  2PMZ A;  2XSD C;  2HYG D;  1V5G A;  5E1W A;  1XGM A;  2H09 A;  3GVA A;  2XF7 A;  4KMU X;  2DFF A;  2QLZ A;  1YJ9 I;  2IEK A;  1D8J A;  1GV2 A;  3FMQ A;  4G7H F;  5IP7 J;  1Y1W J;  4YIR X;  4LG3 A;  2HOE A;  2JZY A;  1XCB A;  1GVJ A;  2M87 A;  1D1A A;  3S32 A;  5IOZ A;  4LIV A;  3K1P A;  3WTS C;  2ELJ A;  1B72 B;  1IN6 A;  5HOD A;  1JUS A;  2CUZ A;  3RCO A;  4O5V A;  4IOC F;  3I71 A;  3BG7 A;  4RM3 A;  3K4M A;  1KQ8 A;  2Y0M A;  3U1K A;  3D5S C;  3VB2 A;  1ON1 A;  2ZME A;  4PJ0 C;  1ZRF A;  1X19 A;  1ENH A;  4OU0 A;  3JR9 A;  2GLO A;  2ZBK A;  3TDU C;  4YEJ A;  5KAI C;  4P9U A;  1O4X A;  4GDF A;  2VOD A;  2DCE A;  1YRN A;  3BR2 A;  3TED A;  1ZGJ A;  5LGN A;  3I3L A;  2R7R A;  3F0C A;  3WU0 A;  1E3H A;  3CCR I;  1ZAO A;  1X1P A;  2DOE A;  1X2N A;  1J9I A;  2DA6 A;  4E70 A;  3S3N A;  1XG1 A;  2TCT A;  3WGG A;  4L18 B;  1X1D A;  4FQG A;  4ESJ A;  1XDU A;  1I1S A;  3WE3 A;  1STZ A;  3BG9 A;  1L0O C;  4CDG A;  4XID A;  4UUS B;  4C2T A;  1RRJ A;  4A93 J;  2A07 F;  1IRG A;  1XGO A;  2HQ5 A;  2M2E A;  2OF7 A;  2EFN A;  4D5C A;  2HS5 A;  2G7U A;  4HRI A;  2L2O A;  1WI9 A;  3QOE A;  3ZRG A;  5K5O A;  2LY2 A;  4UUV A;  1PDN C;  2X85 A;  2KZV A;  1T0F A;  4A6D A;  2A3S A;  3DU6 A;  4HNU A;  2ISZ A;  3M8E A;  2JQ7 A;  2V26 A;  3LQR A;  2R7D A;  5LFA A;  4OOI A;  2CV0 A;  1LPQ A;  2FBH A;  1YJN I;  2R7Q A;  1SFU A;  3WHB A;  1HCR A;  3LMM A;  5DYM A;  3HOS A;  2CQX A;  3TOA A;  2OZU A;  5IP9 J;  2W25 A;  2L7F P;  2E1N A;  1OCO H;  1R36 A;  4BQO A;  1A04 A;  2A69 F;  2BVL A;  3VYT B;  2Z16 A;  2V4J C;  2HKO A;  1LE8 B;  1YOV B;  2A6H F;  2CG4 A;  4BEH B;  5C4X J;  1T98 A;  1YW9 A;  3I4M J;  2W82 A;  3FF5 A;  3MKL A;  4IXA A;  4HEA 2;  3IAM 2;  3E1S A;  1SVO A;  2JPB A;  1YTY A;  5DUK A;  4MEX F;  2MH9 A;  2GA2 A;  5DM7 F;  4AM3 A;  3KZY A;  3ECH A;  1LNW A;  3AG4 H;  3OY9 A;  1Z6R A;  1RIO H;  3LSH A;  1JHF A;  4BH9 A;  5E8G A;  1VI0 A;  3FMS A;  5E79 C;  4M3E A;  5AIP A;  1T38 A;  1U5T B;  4O6J A;  4BGD A;  2ZJP F;  5DCF A;  3FIS A;  1FYK A;  4L5E A;  5FFX A;  2K9M A;  1V5F A;  1ORK A;  2DA2 A;  4QTR A;  1TT0 A;  1PUF A;  1DP3 A;  4RAZ A;  2CGP A;  4F91 B;  2I10 A;  1F36 A;  3IP4 B;  1LDK B;  3CD6 I;  3WG7 H;  3GLX A;  4XMY A;  2WV1 A;  2FQ3 A;  5J4V A;  4IHV A;  3TKY A;  3J80 Z;  4ZC3 A;  3P7N A;  1TW2 A;  1X2M A;  2IA2 A;  1J59 A;  1JT0 A;  4BUP A;  3JRC A;  4ENK A;  4PK4 A;  3KLO A;  3Q0W A;  4CYD A;  1QO0 D;  3OIQ A;  1CGP A;  5J6X A;  4BU2 A;  4MFE A;  1KON A;  1TTY A;  2E2J J;  1RKT A;  5CQG A;  2EFP A;  1W7P B;  5FLX K;  1LJ9 A;  1EKE A;  3G71 I;  1CF7 B;  2E19 A;  3IL2 A;  1FEX A;  5DV5 A;  3FXR A;  4BXX J;  4HLX A;  3QPH A;  2AXT C;  2DQR A;  3E5Q A;  2L7K A;  2K5C A;  2X0L A;  3CMA I;  1U3E M;  4S04 A;  2RQP A;  4WXC A;  2ZXJ A;  3MKY B;  2IGN A;  5F08 A;  3HL2 A;  3BZC A;  2YU9 J;  3H5A A;  3GFJ A;  5IP6 A;  4FX0 A;  5AON A;  2PN6 A;  4A6E A;  1ETV A;  3MCZ A;  2DO7 A;  2Z3Y A;  5EJC A;  3K1M A;  4GRI A;  3HOU J;  2DI3 A;  4KN4 X;  2L7Z A;  1T8I A;  3BR5 A;  3CTA A;  1P4A A;  2M5W A;  5DEQ A;  2KJB A;  3OIP A;  3S1R J;  1R71 A;  1ACI A;  1WJ5 A;  4V2G A;  2HYF A;  2VAS A;  1Z1D A;  2B7E A;  4JK1 X;  3SZG A;  3IRR A;  1I6H J;  4ENM A;  4G8X A;  5FKK A;  1W0U A;  4U0W A;  2HTS A;  3PQJ A;  5HOO A;  4Q4Z F;  2HDD A;  1G3Y A;  1U8B A;  3GTL J;  3FBI B;  3GTK J;  3BT9 A;  3L2C A;  2M8G X;  2O03 A;  1OLT A;  3L2Q A;  2M3A A;  2LTP A;  2QKL B;  3G1M A;  4X1E A;  1OCT C;  5C3E J;  3QPL A;  1JJ8 C;  1LEB A;  1JUP A;  1GV5 A;  2M0M A;  2NNN A;  3BWG A;  2D1H A;  5DCM A;  1PVE A;  3ZP5 A;  1OKR A;  3FXM A;  5CVV A;  2CUF A;  3E0J B;  3OYB A;  3QAH A;  3QYE A;  3BG3 A;  3HOW J;  1K4S A;  1I5Z A;  4D7M A;  2V9V A;  4BYY A;  3E6B A;  4JX6 A;  3QU3 A;  2R7U A;  3HGG A;  2Q0O A;  4FE7 A;  1K78 B;  3A0B C;  2QGU A;  3EUH C;  2DOA A;  2I5U A;  2VKH A;  2STW A;  3TDZ C;  3S1N J;  1D5V A;  2OCC H;  4UB6 C;  1AOY A;  1Y56 A;  1XGS A;  2DFE A;  1TLH B;  3WTZ A;  2J5P A;  2DBB A;  1K78 A;  1UMQ A;  3K0L A;  2XAU A;  3QPT A;  5E1X A;  2CQN A;  3E3V A;  1BI1 A;  3ZQG A;  4HX4 A;  1OFC X;  1JHH A;  4BE1 A;  3ROU A;  2DPD A;  1V5E A;  2E35 A;  4LJZ F;  4U0Y A;  2WB1 N;  4F3Q A;  2L01 A;  2JUG A;  4EGY A;  3F22 A;  3NEU A;  3QQA A;  2DYR H;  1MBG A;  2ZCW A;  3FX3 A;  2A68 F;  4J00 A;  2FNP A;  3Q5F A;  5JLX A;  2X48 A;  1MGT A;  2EIN H;  1TQI A;  3HUG B;  3RKW A;  5A2Q Z;  2P5L C;  1RUN A;  1P92 A;  4V2F A;  3MWM A;  5LHG A;  3GCM A;  4PDK A;  3CCJ I;  2YU3 A;  3M4O J;  2IVM A;  1Z05 A;  4QWQ A;  2M8E A;  4FE4 A;  4CO8 A;  4UB8 C;  1PUF B;  2XB0 X;  1UAA A;  3LQQ A;  2K9L A;  2OC6 A;  5FRN A;  1GXP A;  4B8X A;  1AKH B;  3CMY A;  2DN0 A;  2WAF A;  1S5L C;  3C2H A;  2V1U A;  3WGH A;  3MAJ A;  3IV5 A;  4PJL A;  1B8I A;  1TWH J;  3S2H J;  3I54 A;  3ABU A;  3IC7 A;  1VQ7 I;  1Z3Y A;  2PMU A;  3LAJ A;  2FBK A;  1Q1V A;  3N4M A;  5IT9 Z;  1AKH A;  1MMD A;  5BPD A;  3LSJ A;  1T2K A;  5IPA A;  5GPC A;  2YPR A;  4B1R A;  5E18 F;  4I6Z A;  4DNC A;  4ZDP A;  3QWL A;  2X1C A;  1BL0 A;  1IGN A;  3OYL A;  3OYA A;  4NQW B;  1YJW I;  1IRZ A;  2NOG A;  2QKM B;  3L2W A;  3BOQ A;  3K70 D;  5LD2 C;  2X6O A;  4LB6 B;  2VKV A;  2GM4 A;  2M0C A;  2L4A A;  4XLP F;  1WJF A;  4CZZ A;  1Y8Q B;  3PNY A;  4I0A A;  1WKM A;  2ZNY A;  2W1O A;  3CJT B;  4G6Q A;  4XON A;  1S8N A;  2WV0 A;  4YRV A;  5DTD A;  5DUI A;  1D0Z A;  1WJA A;  5ED4 A;  1IV6 A;  1XCV A;  5KVR A;  1O3T A;  4P9F A;  1HQC A;  5CQE A;  1IRX A;  4M6Y A;  4WCG A;  4RM2 A;  3ONQ A;  3SXY A;  3TW6 A;  2IGM A;  4Q5S F;  2ELH A;  4AYB N;  2HVS A;  3HSE A;  1J0R A;  2QQB A;  1ZRE A;  1OIS A;  2CUE A;  3BDD A;  1P6R A;  4LK0 F;  3I55 I;  3GTO J;  2DDA A;  1LE8 A;  1RZ4 A;  4IQJ A;  4HLY A;  1XSD A;  4G7Z F;  3FXL A;  2XRO A;  1FTZ A;  2E1M B;  5C44 J;  1TQP A;  4RAG A;  2YSR A;  2P5K A;  4KA4 A;  4HDU A;  3K4B A;  3SFI A;  4ENJ A;  1YS6 A;  2XB5 A;  4OMZ A;  2L9V A;  3I59 B;  1YO5 C;  2KDO A;  1IUF A;  2A5W A;  3ZQQ A;  2OTJ I;  1J75 A;  2FSW A;  1FC3 A;  2KIM A;  1B4A A;  1O57 A;  2EA4 A;  1IO2 A;  3H0D A;  4A3K J;  1NG6 A;  3FHZ A;  3BP8 A;  2Z2S B;  3ISP A;  1HKS A;  2E1O A;  3JSO A;  4AUX A;  2HQR A;  2XAH A;  2FNA A;  3K4C A;  4MFD A;  1F4K A;  2ZFU A;  2BY2 A;  1X3Z B;  1MBH A;  5J47 A;  4XOR A;  5BNG A;  4ZTF A;  2OQG A;  3H0G J;  4BL0 B;  1BC8 C;  1FJL A;  1ZG5 A;  1K7A A;  2NS7 A;  4RB1 A;  4F52 A;  5LRR A;  4NUB A;  3GFL A;  2XPW A;  4BQN A;  3K70 C;  1LVA A;  4OAY A;  1HSJ A;  2VJJ A;  2VKE A;  4N9H A;  5EEH A;  4UUT A;  2NVQ J;  3BPV A;  3CCE I;  4DBR A;  1HDD C;  4KFC A;  2H6B A;  4WXD A;  1ZLJ A;  2QSF X;  2PJR B;  3CF2 A;  4QIW N;  2O8X A;  1O3Q A;  1ERD A;  4ZDO A;  2MAB A;  5L3D A;  2CQ7 A;  2DMP A;  5E17 F;  1S7A A;  1W5C C;  3TW7 A;  3KPH A;  1SD7 A;  4AU7 A;  1UFM A;  4BY7 J;  1MH3 A;  1FIP A;  4HSR A;  3PM1 A;  4LOC A;  3OYI A;  1S6L A;  2ZB9 A;  2AQF A;  4AWX B;  1EF4 A;  1SVM A;  1D1C A;  2CQQ A;  3M8F A;  4CH7 A;  2NRA C;  2HPI A;  4ZDL A;  3DXJ F;  2FUG 2;  3AL0 B;  1DU6 A;  4L9T A;  3OL4 A;  3V4G A;  3SFZ A;  2B9S A;  2JSC A;  4QSH A;  2HYJ A;  5IT9 K;  4BQA A;  2P5V A;  4HV5 A;  4XIC A;  1ZG3 A;  4FX4 A;  3ERE D;  4M73 A;  3KP4 A;  3P9K A;  4IHY A;  4EJW A;  4LB5 A;  4EJO A;  3JSP A;  4Y33 A;  2MLG A;  2OD5 A;  1TWG J;  1EH6 A;  3QOD A;  3IH2 A;  4ZJZ A;  1H88 C;  1Y8R B;  1XD7 A;  1ETQ A;  3L1P A;  1V55 H;  2NYX A;  2EIM H;  2XC7 A;  3DTI A;  2X4H A;  4BJ5 C;  3NQO A;  3TBI A;  3CP2 A;  4II3 A;  1ETW A;  3EUK L;  3RIR A;  2EIJ H;  1VQL I;  4UNO A;  4AD9 A;  4ABZ A;  3WE2 A;  3BTL A;  3CJR B;  1RR8 C;  1QZY A;  3GF2 A;  1G8X A;  3MEX A;  1YW8 A;  4A3I J;  1LDD A;  3GTQ J;  2DTZ A;  1OCR H;  1YW7 A;  3RQI A;  1DU0 A;  2CMP A;  2A6T A;  1R9T J;  2PQ8 A;  3G4S I;  2L3D A;  4A3D J;  2MYS A;  4DQ2 A;  1JJ6 C;  3U1D A;  2QBY B;  1SD6 A;  3BTC A;  5D5W B;  1R23 A;  4FTH A;  4JBA A;  2RN7 A;  2RNG A;  4E6K G;  3S15 J;  5JHU A;  3CCU I;  2P7V B;  2NOJ B;  1Z77 A;  4B44 A;  3S1Q J;  2M45 A;  1PP7 U;  3F9K A;  5EG0 A;  2W24 A;  3HJE A;  1QQI A;  3WTU C;  4BNC A;  1FPQ A;  1IN4 A;  2CWE A;  2KQR A;  1GUU A;  2ISY A;  1XGN A;  2MG4 A;  3LSM A;  2DK8 A;  4JYK A;  4M72 A;  5ICC A;  2STT A;  1PUE E;  1VQ4 I;  2CSO A;  2K85 A;  3DPT A;  5E8I A;  4AVP A;  3K4N A;  1HOM A;  3KP5 A;  3GTM J;  2UXN A;  3HSR A;  5EDN A;  4PSX A;  4E7H A;  3M1E A;  2D2W A;  3GFM A;  4PCQ A;  5J8F A;  3B6C A;  3RDI A;  4XLA A;  1B72 A;  1S7E A;  4PJJ A;  3J80 K;  1CQT A;  2VON A;  2R7W A;  2O6G E;  4OIP F;  3OMY A;  2DQL A;  3ZQI A;  3RKQ A;  2L54 A;  1BN5 A;  4D5F A;  3HOZ J;  4ANJ A;  4DGW B;  5EGO A;  2PI0 A;  4A3E J;  5HLI A;  1KYZ A;  2Q2E B;  1BBY A;  1DPR A;  3HOX J;  2JWT A;  3GW2 A;  4F55 A;  3LSP A;  1G3T A;  2QZ8 A;  2M4K A;  5TIS C;  2ZFW A;  5EGO B;  2F5D A;  1FMW A;  3C2G A;  4XM3 A;  4LMY A;  2LFB A;  5ICG A;  1J09 A;  2L9R A;  1KQ0 A;  1YX3 A;  2A61 A;  1JUM A;  3RZO J;  4D0P A;  1VTN C;  3ZXS A;  3SQN A;  2HWV A;  2Y2Z A;  3DKX A;  4PJN A;  2XDV A;  1SMY F;  5H6R A;  4E7S A;  5ILU A;  5LLQ A;  4P55 A;  3A02 A;  4BXF A;  3PFY A;  4KT5 C;  2RQQ A;  1QPI A;  4A3M J;  3C2B A;  3S93 A;  3CC2 I;  1BW5 A;  2PBI A;  1GHC A;  4RB2 C;  1JKP C;  1WGX A;  2X1E A;  5DD8 A;  1ETY A;  2X6Y A;  3D1N I;  3WU2 C;  4B09 A;  3F3X A;  2XIG A;  3ZPL A;  2ZO4 A;  3HC7 A;  2VXZ A;  1S7O A;  2DA7 A;  4XKB A;  4Y15 A;  2Z5U A;  2Z9O A;  1XN7 A;  1FOY A;  3ML6 A;  4UVB A;  3L2R A;  1ZYR F;  1U6G A;  4IEJ A;  1KU7 A;  4HDV A;  2CO5 A;  3PUF A;  4CYC B;  2EFQ A;  3EYY A;  4R1H A;  1WH7 A;  3KET A;  1U5T C;  2V6E A;  4UV8 A;  3CLQ A;  3DTE A;  5FD6 A;  2JA6 J;  2HNH A;  5H20 A;  4XN3 A;  2LKS A;  1TNT A;  2HZD A;  1UG2 A;  3KFW X;  3RYR A;  3VFZ A;  4N4N B;  2BXZ A;  4XRM A;  3DTK A;  3HSF A;  1SVL A;  3F8B A;  2ZSI B;  3DEW A;  3CQZ J;  1I50 J;  4Q47 A;  1OYY A;  1RR7 A;  4PGG A;  1MW7 A;  3L9F A;  2BEO A;  1IAW A;  1MDM A;  1XPX A;  3ASN H;  2IAI A;  3VPR A;  4HF1 A;  3OS2 A;  5FD5 A;  3F21 A;  3WG9 A;  3JAM K;  2LVS A;  2K7L A;  3DU5 A;  3QYB A;  1CF7 A;  2W00 A;  2HOA A;  2O5R A;  3JRI A;  1E3O C;  1Z6T A;  4EM1 A;  4A3B J;  3AL0 C;  2BW3 A;  1U9N A;  4G6D A;  3CCQ I;  2DFH A;  1Y39 A;  1A31 A;  4NHJ A;  2VJI A;  3F8F A;  1ZQ3 P;  1FSH A;  3J81 K;  3I5U A;  1K61 A;  1E2X A;  2LF8 A;  4RGS A;  4A3G J;  2PMZ N;  4AC0 A;  1RET A;  2E60 A;  1NK2 P;  4U0V A;  1F43 A;  3GX4 X;  5HLG A;  4NQW A;  3OYH A;  3GME A;  2DJN A;  1HF0 A;  2IBD A;  1QU3 A;  1XMX A;  1JTX A;  1MIJ A;  2NS0 A;  4RA2 A;  4W1U A;  2QYO A;  2HFH A;  4JP0 A;  2V7F A;  5F64 A;  1P4X A;  4FCY A;  2V1D A;  5M5W J;  1MBJ A;  1K4T A;  2Y9Y A;  2LC2 A;  3CJN A;  4EJT A;  2J5O A;  2JUC A;  3H3Z A;  4P96 A;  3SZT A;  5E20 A;  4L0Y B;  3DPL C;  1W0T A;  2DAO A;  2LYC A;  2AS5 F;  2ID3 A;  2HU9 A;  1Y6I A;  2IS4 A;  3GYH X;  1REP C;  2FJ1 A;  1T39 A;  4B4C A;  1SFK A;  5B66 C;  3WGI A;  1DPU A;  4H4K C;  3OYC A;  2LNB A;  1MBE A;  2Q8K A;  1HXD A;  4G6T B;  2WAE A;  2MGQ A;  3ZMD A;  5J3L A;  2ECB A;  1H9T A;  2EK5 A;  1NTC A;  3EUH A;  2EPF A;  4DIQ A;  3G6E I;  4DZJ A;  2JRT A;  3A01 A;  4IKF A;  4EJU A;  1J2X A;  4EMS A;  3B02 A;  4XRF A;  3F8C A;  3K4L A;  3WTW C;  2I8D A;  2JVH A;  3GLL A;  4YFN F;  3E5X A;  5D4R A;  3DBH B;  2Y75 A;  4U7D A;  3TO9 A;  5FRO A;  5HNF A;  4U87 A;  2JT1 A;  1X58 A;  3AG1 H;  5D4S A;  3FM5 A;  4CIC A;  3OOU A;  3ZQL A;  3DF8 A;  4RAY A;  3EUA A;  1UG0 A;  2ZME C;  3PUB A;  5J1R A;  1VQ9 I;  4L9N A;  1PJR A;  2HXO A;  1BA5 A;  1XC5 A;  1Y0N A;  2CW7 A;  3Q9S A;  2H1K A;  2V1X A;  3VYS B;  1OCP A;  3V7S A;  5L3E A;  1HW2 A;  3W2W A;  3IKT A;  1WJC A;  3B73 A;  2FXA A;  2MSY A;  1LFU P;  2H8W A;  2CJJ A;  2A6E F;  5K1Y A;  4S05 A;  3HG9 A;  2KHM A;  2LKP A;  3NAR A;  1VQO I;  5FKM A;  1BJA A;  3T8T A;  5CJ9 A;  4LG0 B;  3IWZ A;  4AIH A;  4A0X A;  3DLA A;  2W48 A;  4XLC A;  1Y1V J;  2R7S A;  1T95 A;  2XKP A;  4IX7 A;  2DMQ A;  1FZP B;  2QSG X;  3T1B A;  2Y0S N;  1O3S A;  5JI6 A;  4II2 A;  3LOC A;  3L2U A;  5BS6 A;  1Y0U A;  3NWS A;  1YX5 A;  2BY1 A;  3A4C A;  1YE9 A;  5JVT A;  5HVQ C;  1MJA A;  2EJR A;  2ZJ2 A;  1QHH D;  2BY0 A;  2QQA A;  1AA7 A;  3MQ0 A;  3LA7 A;  4BHP A;  3ABK H;  5FJ8 J;  5CKT A;  3CZ6 A;  3GTJ J;  1HW5 A;  3GTP J;  2V9P A;  2QF7 A;  5D6E A;  1LEA A;  1FBQ A;  3K69 A;  4XLH A;  2FF4 A;  3CO6 C;  3QU6 A;  2Z33 A;  4AIJ A;  3PIO F;  4HST A;  1D8K A;  1FOW A;  2EIK H;  2ME6 A;  5LGT A;  1QA6 A;  1D1B A;  2DT6 A;  1WRJ A;  4OIO F;  1UEL B;  2BE5 F;  2YX4 A;  2ELK A;  2L5Q A;  3JW4 A;  3WTV C;  2OBP A;  2R7Z J;  3PQK A;  4MGR A;  3RI4 A;  5J40 A;  4D7N A;  3RPU A;  2RV8 A;  3F72 A;  3GZ5 A;  1D3Y A;  4MEY F;  4MIM A;  2NVU B;  3GTG J;  1FTT A;  3JRH A;  1W7P A;  1MSE C;  3S3O A;  4I2O A;  1XX5 A;  1ZH5 A;  2L9N A;  3I64 A;  4WWC A;  4ENN A;  1QBJ A;  5ILS A;  2BHY A;  5F1R A;  1FYM A;  3N05 A;  1MH4 A;  3FBN B;  4XSZ F;  3H36 A;  3E6D A;  3BG5 A;  2BXY A;  3KYD B;  3CF5 F;  1F5T A;  3IRQ A;  1PP8 F;  1A6Q A;  3RQ4 A;  3M07 A;  2GZW A;  1OYI A;  3J7Z I;  2ZJQ F;  2VOO A;  1P7I A;  1UHM A;  2R5Y B;  4MQV A;  2FOW A;  3E6C C;  2LF7 A;  5L3C A;  4FT8 A;  4R8H A;  4BHC A;  3W6J B;  1UST A;  2DK5 A;  2VBW A;  2X6X A;  3WHC A;  2KL4 A;  2KIU A;  3IWF A;  2XGE A;  3R4K A;  3CUQ A;  2KRH A;  4C3J J;  1YG2 A;  2COM A;  3RKX A;  2DFI A;  2ESH A;  4I0B A;  4A5N A;  4KMF A;  2Y0S A;  1IG7 A;  3LL7 A;  2BHZ A;  5KHD A;  2W7N A;  2OQR A;  5ERI A;  5KCM A;  5L3F A;  2MA3 A;  3ZMT A;  2E1M C;  5KK1 A;  2ADU A;  4CCN A;  2ICW G;  1D5Y A;  1JXS A;  3VSL A;  1V4R A;  2DW4 A;  2EA2 A;  3WTX C;  2PLY A;  1VQ6 I;  3TL4 X;  2WTE A;  2O61 A;  3CDI A;  1WZ2 A;  3HZJ A;  4BEH A;  4GGG A;  1MZB A;  1G59 A;  1R7J A;  5E3L A;  5EYR A;  2K40 A;  1I1G A;  1S72 I;  1FT9 A;  2COB A;  1Z67 A;  2ZC2 A;  3BG6 A;  5L3G A;  2B63 J;  2VQG A;  3J7Y J;  1JKR C;  1G3S A;  3JRB A;  1BJZ A;  3HGY A;  1A6I A;  1TWF J;  1UJ8 A;  5HLH A;  3IH4 A;  3O8H A;  3R60 A;  2H94 A;  1SD4 A;  3DEU A;  2W4S A;  3ECO A;  3M7G A;  4JX5 A;  4P1W A;  3S2W A;  3TQN A;  1B9N A;  2BOL A;  3ZCO A;  3DBL B;  3K10 A;  3F6V A;  3LA2 A;  5A2Q K;  5DD4 A;  4EEF G;  3FHN A;  2HOS A;  3S16 J;  4HQE A;  2G0E A;  4RGR A;  1ZRD A;  4BHB A;  2DOD A;  1WCM J;  1D0Y A;  3H3U A;  4UV9 A;  4FHT A;  1K6O A;  2R4G A;  4ZTJ A;  2VL8 A;  5LEJ A;  3MFK A;  4IHS A;  3CUO A;  3DCF A;  4KT6 A;  3HOY J;  5K5R A;  3M9A A;  4OIN F;  3ZMZ A;  3P5J A;  2XV4 S;  4B43 A;  4UVC A;  3BPX A;  2CYY A;  4WF2 A;  3FKJ A;  2Q1Z B;  2V9K A;  4ON0 A;  2KJC A;  5DS9 A;  1HLV A;  5F0F A;  1Q1H A;  3EQL F;  1B59 A;  4BXU A;  5IY5 H;  1X1C A;  2XPV A;  2ZNZ A;  4S0H B;  5ILV A;  1KYW A;  2LK2 A;  2XAG A;  2ZME B;  3RSN A;  2KRF A;  4G94 A;  1QVT A;  4F7Z A;  1IN7 A;  5B3S H;  1JTY A;  4I01 A;  2E5N A;  5EZH A;  2R3S A;  2MLK A;  4CCL A;  1K79 A;  1G4D A;  5HS8 A;  2BZT A;  3RJP A;  4P5O A;  3PNV A;  3HHG A;  5J1U A;  4CXF A;  1RES A;  2JJ7 A;  3KP3 A;  1TT5 B;  2D1V A;  5GTH C;  1XTA A;  1GDT A;  4DW6 A;  4UHT A;  1ZRC A;  2XPU A;  2PEX A;  4KIT B;  1IV8 A;  2IXS A;  3IHU A;  4XRS G;  2K02 A;  3HRU A;  2DJI A;  2AXL A;  4I98 B;  2P81 A;  2O9L A;  1I39 A;  2H27 A;  3K4K A;  1Z7U A;  1X1B A;  1GVD A;  1ULY A;  1RNL A;  2DA1 A;  4LIT A;  4Y7N J;  1POG A;  2M7A A;  3M1C A;  5CVR A;  4L5I A;  1MD0 A;  3TP0 A;  1YQA A;  4NNJ A;  5BPI A;  3PO3 J;  1X3W B;  4I02 A;  1LKX A;  1WPK A;  5K7H A;  3V8J A;  2XAQ A;  2P0W A;  1JKQ C;  2XGX A;  4PGH A;  1MND A;  2OUM A;  3BQY A;  4NC6 A;  1FOX A;  1G2H A;  1D0X A;  1JE8 A;  3U21 A;  4R79 A;  3JRD A;  5EEA A;  3MKZ A;  3Q0U A;  2KIF A;  2R7V A;  1DGR M;  5LEK A;  1R6R A;  3R61 A;  5C4J J;  3W6K B;  1WSU A;  3HEF A;  2QQ9 A;  3G1O A;  2E7W A;  2LY1 A;  2HVR A;  2VI6 A;  2EV0 A;  4BE0 A;  4HBL A;  4MNU A;  1ZEL A;  4YII A;  3FXJ A;  4I99 C;  2VB6 A;  2RRE A;  3HPH A;  2EZH A;  5FLX Z;  3ASO H;  1O3R A;  1HST A;  3R0J A;  3OS0 A;  1G3W A;  2AQE A;  3KCC A;  1H89 C;  3VOE A;  3I59 A;  3EDP A;  3HYI A;  1B9M A;  1BIB A;  1XMA A;  3TP3 A;  5FKL A;  2VJ5 A;  3PNT A;  2M1B A;  3ZQ7 A;  1WHU A;  4A69 C;  3D5L A;  2F4I A;  3MZH A;  3VSK A;  2R7O A;  4OMY A;  3KP2 A;  3RYP A;  1U8R A;  1KU2 A;  2RDP A;  1VQN I;  2NXN B;  2A05 A;  3A0H C;  4YFK F;  2R7X A;  1BR4 A;  3HXL A;  4IRI A;  3MD2 A;  1LVK A;  3O6B B;  4IVN A;  1Z21 A;  3T5X A;  5GTI C;  1WJE A;  1QNT A;  1FP2 A;  1VZ0 A;  1HDP A;  2DPU A;  2LSO A;  3RTR A;  5CYV A;  3CCV I;  2JMW A;  2H6C A;  1MNE A;  1IDZ A;  3VEP A;  1R22 A;  4XQF A;  4XKC A;  1T33 A;  3OYJ A;  1C0W A;  2E1C A;  3KE2 A;  2QBY A;  4HOB A;  1WH5 A;  3AAF A;  1R1T A;  4HYE A;  1S29 A;  5M3M J;  1X4P A;  2L7M P;  4PSW A;  2IP2 A;  2NAZ A;  2Y69 H;  4IRG A;  4A3J J;  1QZE A;  2XHK A;  2FD5 A;  3RZD J;  3E7L A;  1S9H A;  1ZG1 A;  2VN2 A;  2WY7 Q;  1Z3X A;  2QQ8 A;  2JA2 A;  3AKZ A;  3C18 A;  3BR0 A;  3I0T A;  4LLG F;  2QEX I;  3CCS I;  1BI0 A;  3CCM I;  2VC0 A;  2F6C A;  2HVQ A;  2ZXW H;  3JAM Z;  3ZGK A;  2BYV E;  4GYI A;  2GWR A;  3W2V A;  1N25 A;  3LFK A;  5JFR A;  1YIJ I;  1QRY A;  3CCL I;  3MZY A;  5HNH A;  1BI3 A;  3DQV C;  3H9Q A;  3NAU A;  2ECC A;  4M3G A;  1M1E B;  3MZ8 A;  2XVC A;  3QP5 A;  3BY6 A;  3CC4 I;  4CGZ A;  1VF9 A;  2HQA A;  2GOM A;  2KPM A;  3GBG A;  2PJP A;  2R92 J;  2FRH A;  1YRN B;  3HIF A;  1MDM B;  2QM3 A;  3UR3 C;  2GXG A;  5FFZ A;  4CZC A;  4HX7 A;  1OR7 A;  3GUD A;  1JKO C;  2K4J A;  3FZV A;  3PL8 A;  2HZT A;  3PFI A;  1MJB A;  5DDG A;  2UZK A;  3CP8 A;  4L9J A;  5EG0 B;  3H3V K;  4EQQ A;  2P7C B;  4E7L A;  1BC7 C;  1QPM A;  2AO9 A;  5B5E C;  1X3U A;  1IDY A;  4CUG A;  2LKX A;  2VKD A;  1AU7 A;  2ZKZ A;  2OZ6 A;  4C2M J;  5D5V B;  1ETO A;  5E3N A;  1SFX A;  2LBF A;  1FLI A;  4PJM A;  4CSW A;  5CVI A;  3A01 B;  5H2F C;  2P6S A;  1USS A;  3KEO A;  2MC4 A;  3CUQ C;  2HGC A;  2L0K A;  4XN0 A;  1U0J A;  2XRL A;  2KZG A;  1MBK A;  3ZQC A;  5TGT A;  4CHU A;  2RKH A;  2GAU A;  3EPZ A;  2ESN A;  2EZI A;  3I58 A;  5CPR B;  3F8M A;  3QRF F;  4QPQ A;  1AWC A;  1WWX A;  4J01 A;  3I9V 2;  4JQF A;  4UXN A;  3ZN1 A;  3F23 A;  4M3B A;  3SDG A;  2VLA A;  3L00 A;  4HZF A;  2W57 A;  4HNT A;  2IW5 A;  1VND A;  3CLO A;  4CYC A;  4E7J A;  4UY8 I;  3I4N J;  2KMU A;  2FBI A;  3FXQ A;  3H1C A;  2OU2 A;  1TWC J;  3CC7 I;  2RVC A;  4L0Z B;  3CMM A;  1R1U A;  4BJT A;  1E17 A;  4RB3 C;  3C1D A;  1O7L A;  2ID6 A;  4RB0 A;  3QOP A;  1UCR A;  2M7B A;  3SDB A;  2F5V A;  3KYL A;  1MBF A;  1U78 A;  2KT0 A;  3HTS B;  2FA5 A;  4KDP A;  4NC8 A;  2F5F A;  3FK7 A;  4XOP A;  1ETX A;  2VPR A;  2BVM A;  1U9O A;  2LDU A;  2X51 A;  4CCO A;  4DZP A;  4ZZL A;  2OJE D;  2ZXI A;  4MTE A;  2R5Z A;  1OJL A;  1R5I D;  3ERM A;  2QCO A;  2RNJ A;  3F6O A;  3LWF A;  1PYV A;  2PMH A;  5M5X J;  4QPO A;  4B47 A;  4GO1 A;  3BLY A;  4KN7 X;  1ZN2 A;  5BMZ A;  4ZYG A;  3S1M J;  3SJM A;  4M71 A;  3SZP A;  3OYG A;  4HX8 A;  3DFG A;  3OS1 A;  1FX7 A;  3C3W A;  3FXU A;  1DUX C;  3MKW B;  2M9H A;  2IRF G;  5HS7 A;  4KIF A;  4XBF A;  3NWT A;  2WY8 Q;  3HHH A;  2RAE A;  3BTI A;  3DKY A;  5FB2 A;  5FRM A;  1I6X A;  2X9D A;  1P9Q C;  3DKW A;  5H6Q A;  3HOV J;  4M74 A;  5IOY A;  4I7H A;  2O0Y A;  2OV7 A;  3S8P A;  4IHT A;  1IJW C;  1V54 H;  1ZGA A;  1LQ1 A;  1A5J A;  1RPW A;  5E3O A;  2DA3 A;  1W5T A;  3Q0V A;  3GO5 A;  3I53 A; 
#chains in the Genus database with same CATH homology
 2E35 A;  1VQ5 I;  5DM6 F;  2E36 A;  2FOW A;  2OTJ I;  1S72 I;  4UY8 I;  1YJW I;  1VQN I;  1YIJ I;  3CC4 I;  1HC8 A;  2NXN B;  3CCL I;  1MMS A;  2ZJR F;  3J7Y J;  3CC2 I;  2ZJP F;  1VQK I;  2OTL I;  1VQL I;  1YJ9 I;  1VQ9 I;  3I56 I;  2QA4 I;  2E34 A;  3CC7 I;  5GAE J;  3CCU I;  3PIO F;  4IOA F;  1FOW A;  3CCR I;  3G71 I;  3PIP F;  1YHQ I;  5GAH J;  3I55 I;  3DLL F;  3CCQ I;  4IO9 F;  3CCE I;  1QA6 A;  1VQ7 I;  1Y39 A;  2JQ7 A;  1FOX A;  1YIT I;  1VQ8 I;  3G6E I;  1VQP I;  3CD6 I;  1ACI A;  2K3F A;  3CJT B;  5GAD J;  3CF5 F;  4IOC F;  1YJN I;  5JVG F;  3CMA I;  3CCJ I;  2H8W A;  1VQ6 I;  3CCV I;  4V19 K;  5GAG J;  1VQM I;  1FOY A;  2QEX I;  3CCS I;  1VQO I;  3G4S I;  5DM7 F;  3CME I;  3J7Z I;  3CCM I;  2ZJQ F;  1YI2 I;  1VQ4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...