4IOCQ

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iocQ00
2MJUA 1SJFA 2QEXS 2CQ4A 3VF0B 2LMIA 2KU7A 4U67Q 2I38A 3CCES 3EGZA 4Z2XA 3B4MA 3SMZA 2D9OA 1Q7YT 2KI2A 3VALA 4LMZA 5GAGU 4M5DB 5IQQA 3UE2A 1FNXH 2DGTA 2DK2A 4EGLA 3EGNA 3ULHA 2QA4S 2CQCA 5LXYA 3VAFA 4W92B 2B0GA 2MY7A 3CMAS 1N8RT 5GAHU 2DGUA 1URNA 5CYJA 2J0QD 5GADU 2ADBA 1YI2S 1VQKS 1FJ7A 1G2EA 3S7RA 1U1KA 3R1HA 4CH1A 4QU6A 2N7CA 4ED5A 1Q82T 2D3OR 2DISA 2F9JA 5DETA 2MQPA 3JB9k 1WWHA 1A9NB 2QFJA 4IO9Q 2MKJA 3H2UB 1U1MA 2KM8C 1KD1T 5H1SV 2MQLA 4P6QA 2KG0A 2MZSA 4WFNQ 4C0OC 1R8PA 2LEBA 3MXHP 1XN9A 2JRSA 2MZJA 3U1MA 2MYFA 1WI6A 4OZ1A 3VAHA 2VOOA 5EN1A 1P1TA 2CQPA 4QQBA 1K8AT 3D2WA 3BO4A 2KRBA 3SDEB 3CCQS 1OWXA 2M9KA 3RW6A 2MPUA 3LQVA 2SXLA 3NS6A 5D78A 4CIOA 2ZJPQ 3Q2TC 2CQGA 2N82B 3VAJA 2RS2A 1FHTA 3S01A 2MQMA 1H2UX 1OPIA 5CA5A 2DNPA 1YWXA 2RVJA 2LXIA 4WF9Q 1U2FA 2OTLS 1DRZA 1R8HA 1M5OC 3CC4S 1UFWA 2G0CA 2F3JA 2DIVA 2MKKA 3S6EA 5LXRA 5LJ3Y 3K0JA 1H2TZ 1JJHA 2AD9A 3HI9A 2BOPA 1X4BA 3CCJS 3ZZYA 1KC8T 4CH0S 2E5IA 2KFYA 4W90B 1HD1A 2HYIB 2VODA 2KXNB 2XB2D 4TU9A 2RRBA 2YTCA 4WFAQ 3CCRS 2CJKA 1SJ4P 1M90T 1FT8A 4A8XA 1M5KC 2YH1A 2L9WA 5BJRA 4WIIA 4J5OA 2MHNA 3PIPQ 3MUMP 2WBRA 1RKJA 2MKSA 4C4WA 1KQSR 5DM7Q 3MUTP 1M5PC 5MLCV 1JJ2R 2DGVA 3IRWP 1YJWS 3IWNC 4WKRA 3I55S 3L3CA 3PIOQ 4BS2A 4TU7A 3CF5Q 2M0GB 2KYXA 2DGSA 3UWTA 4IOCQ 2KXFA 1X5PA 2DB1A 1DHMA 2MJNA 4IUFA 2DGOA 2DGWA 2M52A 1U1QA 1N52B 2U2FA 2XNQA 3I56S 2JVOA 2OSQA 1X4GA 5D77A 1NO8A 1VQLS 1VQ7S 2CQ2A 3CPWR 3G8SA 3CMES 2VOPA 2E44A 2MKHA 2CPHA 2OSRA 4FXWA 3U1LA 4PKDB 3BEGB 1VQ6S 1WEYA 2CQ0A 4YUDA 3TP2A 1WG4A 2LYVA 3THTA 2KG1A 2XS2A 1VQPS 3LPYA 5CXTA 1KOHA 4LJMA 2XNRA 1AUDA 2OJ3A 3CD6S 2LCWA 2LEAA 2D9PA 4QU7A 1VQNS 3Q2SC 2ERRA 2XS7A 1U1NA 2K3KA 2G4BA 3R1LA 3B4DA 2X1AA 3UCUP 1QVGR 1D8ZA 2CQ1A 3ZZZA 2CPDA 3VAKA 1VC6A 2XS5A 2E5GA 1WHXA 2MZTA 2JWNA 1YTYA 1YJ9S 1Q86T 2MSSA 2L08A 1WTBA 2BZ2A 5HL7Q 2ZJRQ 2DNNA 1VBXA 1H2VZ 3G4SS 3J7YU 1X0FA 1JJ4A 2AYGA 2CPXA 2MZQA 3NNHA 1A7GE 2DNZA 2E5JA 2CQHA 2KRRA 4WFBQ 2DHGA 3CXCR 5LSOA 2MXYA 2M88A 1OIAA 4WCEQ 2NLWA 1HD0A 2CPYA 3THPA 1ZZNA 2RUGA 3NNCA 1UP1A 3CUNA 1QVFR 2JX2A 3CCSS 1SJRA 2RT3A 1YITS 2CQ3A 2DO4A 1FJCA 1FJEB 2DHSA 2DHAA 1NU4A 1X4FA 2J76E 4Y0FA 1BY9A 1YIJS 2RNEA 2HGNA 4ZKAA 3G71S 1SJ3P 1X4HA 1SJQA 1HA1A 2MKCA 3CCVS 2LXUA 2DGQA 2MGZB 2LECA 4V19X 1W2BR 1VQMS 3CCUS 4F02A 2RS8A 2KM8B 1JMTA 2N3LA 2DIUA 2M70A 3MI7X 3CTRA 3FEYB 2FY1A 2OIHA 2DH7A 3TYTA 2J0SD 2DHXA 2YKAA 2CPZA 1D9AA 2U1AA 5IM0B 2YWKA 1ZZFA 2MQOA 3US5A 3G8TA 1UAWA 3HHNB 1WHWA 1WEZA 2J8AA 2M7SA 2HGLA 2MSTA 1U1LA 1X4EA 3BO3A 1X5TA 2AYBA 2K8GA 2HZCA 2KHCA 2X1FA 1X5OA 2CPIA 2E5HA 1KOOA 1YJNS 2O3DA 2AYEA 2DNGA 1ZH5A 2PEHA 1U1PA 2EK6A 3S8SA 1U1OA 3H2VE 3G9CA 2X1GA 3P5TL 1CVJA 2DH8A 3P3DA 1U1RA 2VONA 2KN4A 3DXBA 1FO1A 2Q79A 2DGXA 2MMYA 3RW7A 3MOJB 3G96A 1PGZA 5DDRC 1B7FA 1F9FA 2KT5A 5LSLA 4CQ1A 2UP1A 3UCGA 1U6FA 3P49B 2EK1A 3V4MA 1N54B 1OO0B 3SXLA 2DNHA 3G6ES 5IFMA 5GAEU 3NS5A 2DNOA 2RQ4A 4Y00A 4YOEA 1WELA 2CPFA 2MQQA 5JVHQ 1YHQS 2MKIA 1K9MT 4YB1P 3P6YC 3VAGA 1WHVA 5DDOC 4PR6A 2CPEA 1NJIT 2HVZA 2KXHA 2LA6A 2G1DA 4QPTA 5GMKa 4PRFA 1H6KX 1VC0A 2M2BA 3NMRA 2DNQA 2DNKA 2DITA 5ITHA 2YH0A 2DNMA 2V94A 2FPHX 4F26A 3UD4P 2DO0A 4IOAQ 2GO9A 2L41A 2CQIA 1QM9A 1WG5A 1N88A 1WHYA 2DH9A 4FXVA 2LKZA 3CCMS 2A3JA 1UW4A 1VQ8S 5DM6Q 2OTJS 4TLQA 2F9DA 3CC7S 3UD3P 1VQ4S 2LA4A 1VC5A 2NZ4A 1P27B 3N9UC 1X4CA 3CULA 4F25A 2FC8A 5LJ5Y 2M4MA 1VQOS 1X5SA 4UQTA 1S72S 1Q81T 2MQNA 3FEXB 5GVQA 3TO8A 2X1BA 1DBDA 2MZRA 2M8HA 1PO6A 1WI8A 1WG1A 1K73T 2KVIA 2GHPA 1SXLA 5JVGQ 1DZ5A 2MY8A 2FHOB 2CPJA 1FXLA 3MDFA 1M1KT 1X4DA 2DNLA 2LQ5A 2ZJQQ 3DLLQ 2XSFA 2CQDA 1RK8A 2FC9A 4OZ0A 3OW2R 4C7QA 1WF0A 3MURP 4RU2A 5DDQC 2HGMA 2MB0B 1U6BA 3VAMA 1O0PA 3SDEA 3UCZP 2N3OA 4TU8A 3MD3A 1VBZA 3VAIA 2EVZA 2ADCA 3BS9A 3CCLS 3CC2S 1WEXA 1X4AA 2CQBA 2KH9A 2RQCA 1WF2A 2RU3A 1WF1A 1VBYA 3NNAA 1L3KA 5HO4A 2MZ1A 3J7ZT 1IQTA 1VQ5S 2PE8A 2DNYA 1M5VC 4LIRA 3BO2A 3MUVP 2DNRA 2MGZA 2JVRA 4ERDA 3R27A 1S79A 3MD1A 1HL6A 4UY8T 2I2YA 2RRAA 5FJ4A 5IM0A 5DDPC 3EX7B 1VQ9S 2AYMA 2M8DB
chains in the Genus database with same CATH superfamily
3VF0B 3PRVA 1RT4A 4FF4A 1TL3A 1Q7YT 5ETPA 3AQOA 4KHPJ 5IQQA 3MCOA 1FNXH 3D28A 4ZIVA 1BUXA 2XMWA 1OJ4A 3X3UA 3KNGA 3PW5A 5HROA 5IWAF 4UT4A 1YI2S 2Z2YB 2WVDA 3QWPA 2GHVC 3DU6A 4JI5J 3SCJE 4E8UA 3AD9C 3ICLA 4Y2AA 2DISA 5ETRA 1UWBA 3RAMA 3FBFA 3K57A 2KL8A 4FPIA 3BBBA 1NJWA 1R8AA 4OZ1A 3VAHA 4L75A 3OVAA 4KHRA 4QYZJ 3GYGA 2HBRB 2IA6A 1TKTA 3NS6A 4KKOB 4CIOA 4DSIA 1TL4A 4H4KC 1NDPA 2DNPA 5CYQB 1YLXA 1OYEA 5LXRA 3NWGA 1S1VB 2KO1A 1H2TZ 2XLJA 2VFUA 2XEXA 2WCXA 2KFYA 1SJ4P 4DN9A 1FF2A 3DHWC 2NQPA 1M5KC 4J5OA 2MHNA 3FDSA 2C2EA 1RKJA 3BDPA 2WW4A 1TVRA 3A13A 1QE1A 1RT3A 2BYCA 3PW0A 4F36A 2RKIB 4CI0B 2HZVA 3CF5Q 3H59A 4NCBA 2GIFA 3UWTA 3HLUA 3GFYA 5HROB 4KFBB 4J9NA 1BHNA 4ZPTR 2CQ2A 2CPHA 4FXWA 2Z4PA 2H3EB 2B8PA 1AUSL 4FYWB 4GC7A 4CNYA 3C3LA 1VQ6S 3CJSA 3PNIA 4FYXB 3BSCA 1UWBB 2DD8S 4I6YA 2V2QA 4DX7A 1NDLA 4LQ3A 4OYIA 2LQBA 4ZCKA 4M63A 1NB2A 3IS9A 3OFEA 1DY3A 1DJ0A 5I42A 4BWMA 4RBVA 2AIRB 1TKTB 1QVGR 5CABA 4IRDA 4NLDA 1YBUA 5C42A 5DQIA 4P2XA 1ZA2B 2BX6A 1AB8A 3BQ0A 4TY9A 4NA2A 4OHVA 2PI4A 1X9SA 2OPQA 3R2CJ 1B0PA 4LR8A 5L1LA 2R7QA 2M88A 4ZPBA 1O51A 1VK8A 3U27A 3CCSS 2CQ3A 3ZFVA 1X4FA 3HSJA 1TVRB 3CJTA 1SJQA 2E9TA 4EUVA 1RT3B 4XTTA 1B0TA 5A8KB 2FY1A 2OIHA 3EVOA 2CPZA 3W64A 2D3UA 3RTVA 4N5SA 2WSEC 3NL0A 3HHNB 1GNKA 3M2RA 2YWWA 1RHMB 1X5TA 3MEKA 2KHCA 3NCPA 5I3UA 1GMWA 4P71A 1TV6B 1LXJA 1RU1A 4DL2A 1U1PA 4CLZA 3RRKA 3LPEA 3M8QA 2JLGA 1QAYA 5HK4A 3T41A 1CVJA 1TL7A 5H9EJ 4DU8A 3A12A 3TZYA 3IS9B 5IXUA 3PO4A 3B54A 3NEKA 2BKOA 2ZZNA 3P49B 2EK1A 4Y3CA 1DQAA 4U9RA 2WSCC 4YOEA 1R0AA 1NHUA 2A6MA 2OPQB 1SJ1A 3DMJA 2DITA 2C3UA 2HHUA 2XGQA 3BYRA 3KDNA 2HWIA 3R7SB 2OTJS 2LA4A 1VC5A 2F8EX 1A6LA 1N34J 2ILZA 3H2LA 2ZDPA 2PMZD 2CJAA 2XZDB 4ETXA 2IM0A 3WIVA 4J9OA 5B0EA 2DNLA 2R8HA 3GFZA 3M2RB 1OY6A 4JI7F 3RUBL 4C7QA 4O4RA 2G9OA 1IBLJ 1IJFB 3SDEA 4Q0BA 2ILYA 5CZVA 4CZCA 1ZPVA 4TQSA 3M8QB 3B8HA 1P9YA 4ZVRB 2CQBA 4A8FA 2R2UA 3NNAA 2A2DA 4DR4J 4TQRA 2ZBRA 2YXLA 3BO2A 3JAMU 4UF4A 1X60A 3MR6A 1B70B 3HSGA 1BE4A 1AA1B 1T95A 3UN3A 2HFVA 2QZ8A 3B4MA 3N5FA 1T9TA 4C3KA 4ZVUB 4GRSA 3PJXA 3K58A 2FVCA 1S7HA 4AQYF 1HMVA 3ZZUA 4H4KA 4HACA 1QSLA 2NCKL 3BB5A 3DGVA 1FRKA 3GJRB 3N28A 5KFQA 5GADU 4OYAA 2N7CA 3PZPA 2J7UA 1Q82T 2E9ZA 3C6UA 3I82A 3CD0A 5DRKA 3M2UA 1YJTA 4ELTA 1NJXA 3R5DA 2FVSA 4ZLJA 4AL7A 5LL6d 4YS2A 2E1CA 3DLEA 2VKRA 3SDEB 4Q0BB 3G6YA 4PG5A 3NLCA 3A1YG 2CQGA 2CVIA 2EFVA 2VF3A 1H2UX 1IJEB 2RVJA 3M7VA 1U2FA 4FKXA 1DRZA 2ZUAA 1FKAF 3S6EA 4ZJOA 4ID5B 1GTHA 3LP1B 1SI9A 2P9GA 2RIJA 4B9VA 3ZZYA 4J9QA 5HQMA 1ZA1B 1S0MA 2GZOA 3ZNJ1 4AUKA 4MFBB 2QIFA 1C0TA 4KYZA 2QT7A 1REGX 3IGVA 4DR7F 1HMVB 4HACB 5CZXA 3TJAA 1Q8KA 1KSPA 2M52A 4X64F 4NLOA 3I56S 3K5LA 4LFAF 5KFNA 5KFRA 2HS4A 1FFWB 1RAJA 2OD6A 8ATCB 1PYSB 3H98A 4EFAC 3C6UB 1PCAA 4JI6J 2ZH6A 4M5LA 2QC3A 1HIYA 3LPYA 1Y4ZB 3CDUA 2ZC3A 2OFGX 2GIQA 3QIPA 2HHHJ 3BGUA 2YKQA 3ZTOA 5EWEA 3QSIA 5BXIA 5JJBA 1D8ZA 4OYOA 4I2PA 2JWNA 2B7CB 2B4VA 4ZVSB 1C1BA 4NLTA 1S12A 3GU0A 3PX0A 4QWBA 1JJCB 3GB0A 2AGOA 4DU7A 4WE1A 1XC9A 3CEDA 2XTJP 4LFBJ 1YITS 3D3CJ 1FE0A 4J9SA 3DRRA 5E0OA 3MEGA 4ZKAA 4LRAA 1X4HA 3OPKA 3CCUS 1FXDA 1ZBTA 5C25B 4HI2A 4X4RA 3TYTA 3ONQA 3E2EA 3RJMB 1HBOA 3M32B 3EXYA 2J8AA 3GJQB 1S1XA 3QT7A 1SUQA 2W7PA 3NXZA 2PMWA 1HNZJ 4KY3A 1NSPA 3W3SA 1HQUA 1H73A 2MEWA 2XWXA 3S8SA 1JB0C 2VONA 2ALYB 1CJTA 4N56A 5DLFA 4JI1J 3V6HA 3OFGA 1F9FA 4I2PB 2KFZA 3SXLA 3KK3A 2XLIA 4JI8F 1Z4UA 3RB6A 4ICLA 1IN0A 1NJIT 4QWDA 2C2DA 2FZGB 2L3MA 3NGUA 3N5BA 3KK2B 3W7BA 3Q89A 3JTPA 4WE1B 1YG0A 2L41A 1SC3B 1UWAA 2ASYA 2W1BA 1N56A 3OT9A 2NZ4A 1NRKA 2ASLA 2RQKA 4K4SA 4RUBA 1G4CA 4F3MA 2W2PP 4NRTA 5J1EB 5KAKA 1J5OB 5LOQA 1S1XB 2IAJB 1SUQB 1WUUA 1V3ZA 4ZLLA 2NUHA 3BBFA 4WTYA 2N3OA 4DUTA 2UU9F 1N0UA 3T9NA 3KXDA 4OZ2A 1RTZA 1H0HB 3M8SA 1NXIA 4I7FA 2ZVIA 1HHQA 2H48B 1FTCA 1LW0A 2GVDB 2DNYA 2XY5A 3I0SB 4I2QB 2B8QA 2CJBA 4ZA1A 3QGIA 1SB6A 4ICLB 1WC3A 5IM0A 1S6QB 4ZDNA 2XY6A 2MJUA 4U67Q 1L3TA 5L39A 2V4QA 3VALA 3L7UA 3JYTA 4EGLA 1JLFA 2B0GA 4F50A 1URNA 4ECYA 4Y65A 1NPPA 3OSPA 2DCLA 1VDHA 4DV7F 5J1PA 4PPZA 3DM2B 1SL1A 1LK7A 3M8YA 2R7VA 1H72C 5SUHA 4XPEA 2ZE2B 2C2MB 3OVBA 2MYFA 1SBRA 3SIPB 2HK2A 3MF5A 5LMNF 1CJUB 3KLHA 1RT5A 3KUGA 4Y34A 3A3NB 5LM7E 4CT9A 1LWCB 3GCWP 1JWWA 1LWFB 4NYZA 4QWEA 3ILJA 2J6TA 4KO0B 1LW0B 1KC8T 2ZM6J 5BYRA 2WHOA 2VU5A 3GZ7A 4K50A 3DLBA 4A8XA 4QJVA 2HPUA 3D5MA 3FGVA 1U0HA 1NB7A 4P74A 3MUMP 2W4CA 3MUTP 2LQ8A 4ECQA 3L3CA 1TUVA 4MK9A 3JYTB 1QAIA 2GJ2A 4TU7A 2VUGA 3VV2B 2H5EA 1L3VA 4JI7J 1XWLA 2IMOA 4IOBA 4WK3A 3S1TA 1VQLS 3BH6B 5F8GA 3CPWR 4A8QA 4C0HA 4MMOA 2OSRA 4PKDB 3BEGB 3LANA 4DG1B 5DG9A 3KJQB 1WG4A 2XS2A 2VPZB 2W9CB 1N6QA 2D9PA 2JFKA 1SCJB 3AA8A 4KPCA 2XS7A 3HFVA 1SIZA 5IC6B 1Q0NA 4RNOA 3VAKA 3FSIA 3BN7A 4LRFA 3FZ2A 3MM9A 2EFQA 3KMQA 4C48A 1UA1A 2DRDA 3AT1B 1VBXA 1H2VZ 4C11A 1UFKA 2MZQA 5AJ3J 1UL3A 1N36F 2NZCA 5IOLA 2RDDA 4NEYA 3THPA 3PEJA 4FVMA 4CLKA 3RGIA 1QVFR 4KGZB 2DHSA 4ATNA 1VR6A 1RI7A 2DGQA 3PVXA 2AX0A 4WFZA 2C2ZB 1XTZA 1JLBB 4DPTA 4ZPCA 5D4LA 4CLPA 1UCNA 2HK3A 2GC8A 4RX6A 1X4EA 3T3FA 5IT0A 2UZAA 2CWKA 4NPOA 3W8PA 2FGOA 1HNVB 3AOAA 2VJVA 3CWJA 2BQRA 2C22A 3LUYA 4R8UB 1U2RA 1N6QB 2YWHA 4KGKA 3MM6A 3JXOA 2J7KA 3BR8A 4C8LA 4JI3J 2MMYA 3RW7A 5ETTA 2Y1RI 3NMAA 3JAMY 3MM9B 3Q8RB 4M5KA 3QAUA 2ZVSA 2FJAB 2KXHA 2RUSA 4ZP6A 2YNFA 4C11B 2PMHA 3LAMA 5J2QA 3M9MB 5T7LA 3F73A 4O44B 2Y1LB 2A3JA 1RT1A 5F8LA 5FIIA 4CLTA 5KT5A 4H4MA 4B3RF 1P27B 2FC8A 1U26A 3TX8A 5CCLA 1T05B 1AROP 2FIUA 4NMXA 4JV5J 4ZVGA 3PEHA 2BQ3A 3CCZA 1HHTP 2OMOA 5EDWA 5F41A 3OXGA 4ZVTB 1FRLA 1WSRA 3BDEA 2F1FA 1RISA 2GMHA 3TAPA 4WP9A 2ATLA 1U6BA 3TVZA 3RBXA 1OPZA 4X4UA 4HH1A 2FHJD 3PKYA 1IWGA 3FEZA 3BS9A 4OI1A 1S1UB 3ETOA 2LDIA 1VBYA 1MU2B 3GTYX 4E0DA 2X3GA 2ZHOA 3GV8B 3HO1A 3DRSA 5I4MA 2HHSA 4MKYA 5KT4A 3HD1A 3SCIE 4M94A 4UY8T 3TUPA 4DUZJ 3JTNA 2ZH4A 1SJFA 2VKZG 3WC0A 3CCES 3O1LA 2OP5A 4ECSA 1L3SA 2ZOGA 4DFPA 3TOQA 2WBMA 3UE2A 2RDIA 3DN9A 4W92B 1RT1B 1NK8A 1RWXB 2NYIA 2GX8A 4GKKJ 2XI3A 4ZP8A 5E3RA 1TFWA 2NXUA 4PABA 2Q6CA 5B08A 3J81j 4AE5A 1HR0J 3BKUA 1K47A 1WC1A 2ZOMA 2QV6A 3ZC4A 4GVBA 1ZAXA 2QGFB 3I0RA 4PWDA 4P52A 2OI2A 3RBZA 1K8AT 4MKAA 3OL7A 3TWZA 4N47A 3T1YJ 3Q2TC 3B6BA 1VYAA 3CD5A 1AFJA 2M5YA 3PHTA 4WYLA 2PI5A 3Q8QB 4DBQA 5E33A 3PW4A 3G8QA 5D0EA 3CO0P 3CD7A 3HI9A 3RG6A 1K1SA 1HD1A 2HYIB 3MGJA 4Q44A 3SV4A 4CM0A 4ZMMA 2XWYA 2XYHB 2LFVA 4IR9A 2WVCA 1S1TA 3PW7A 4IO1A 2HS3A 2DXDA 3I5AA 2FZKB 1RCXB 3QFWA 3QO9B 3HHLC 4WKRA 4ECWA 3RAXA 3NGRA 2Q6BA 3NAHA 3KKFA 3CJ8A 4K4ZA 1CSJA 4TY8A 2XNQA 3L4BC 4GKJF 3MMBA 4NLPA 3N6MA 3AXMA 4K59A 1JLAA 5U47A 2FZCB 3G8SA 3ITHA 5AXNA 4L73A 1ZM9A 2UU9J 2X7IA 4NEZA 5F0UA 3LAKA 2JHEA 2Z2ZA 3PX6A 4GVBB 5HMWA 2NYHA 1AUDA 3T5JA 3I0RB 4PWDB 2LCWA 4DL5A 3Q2SC 3OFHA 8AT1B 2POKA 1X31C 2D3ZA 4ED7A 4OYZA 2AT1B 4KV8B 2HAFA 1YTYA 2UUAF 2EW9A 2J6SA 1Q86T 4QIWD 1AYEA 4C2MA 1X0FA 2VQFF 3NNHA 1NSKL 2E5JA 5IT9U 4FF3A 1G2EA 1APSA 3CJ4A 2MXYA 5L1KA 3QIDA 4I1TA 4B08A 1CULA 2B4OA 3UVJB 2CZVC 1FDAA 3MMAA 1FJCA 1FJEB 4C8ZA 2VFTA 4XIUA 1GH8A 2HGNA 3KUHA 3SZ2A 5FDLA 5DQHA 2CKWA 2MQOA 4RW6A 1T3OA 3D1QA 4OV6A 4WZMA 3MMBB 5KFFA 4J9PA 1IVZA 5B0DA 1JLAB 4RNMA 3LP0A 3D3BJ 2OEJA 2EBEA 5CQGA 2AYEA 3UPFA 1XR7A 5C24A 1MWYA 3H8YA 3Q24A 4QIFA 2BE7D 1XMQF 2HFOA 3P3DA 2WVFA 5D0RA 3IWLA 2EI5A 3G96A 3C16B 2UP1A 3UCGA 4X84A 1N54B 2KT3A 3T5LA 4OYPA 3NBPB 3VCDA 2DRAA 3UI3A 4WJBA 2CNKB 1TP7A 3P6YC 5AT1B 4PQUB 4I6WA 4PR6A 2G1DA 3KLFB 2AEJA 2VBZA 1GXLA 5CHCB 4DHVA 2ZWOA 1NDKA 5ITHA 2FPHX 2D7SA 2ZOFA 3MMAB 4DR1F 4UOHA 4ED3A 3HDSA 5DO2A 1SQEA 2MZRA 3HVAA 3H42A 2GHPA 3GLJA 4NCGA 1YRXA 5ETVA 2DCUB 4U7CA 2CPJA 1TK5A 4OI3A 2DRBA 1REVA 4MIAA 2EEYA 1LXNA 1PG5B 4X62J 1RT7B 4PWUA 3OXFA 2DT9A 3LP0B 3E01A 2BE9B 4DPOA 5C24B 3PRBA 1DLOA 4OYXA 4ED1A 1OQ3A 2RQCA 3IFEA 2Q1LA 4WXOA 3LTOA 4OZNA 1ZYQA 1N36J 3EM1A 4Y2MA 1CC8A 2IBOA 3EVMA 1B3TA 1VQ5S 2FTRA 4I64A 1BQMB 1CC7A 4IRCA 2AX1A 1LK5A 4AT1B 5FJ4A 4TNOA 4DS4A 1VQ9S 5KFAA 3EGZA 4D3HA 1T02A 4KQZA 4U6PA 4KE5A 3FMWA 4ZIWA 5D8HB 1S4EA 2Z0GA 3GSIA 1XNQF 1S49A 5KG7A 3BSNA 3OJSA 2BW7A 5G0RA 1F5CA 3R1HA 2HW3A 2ROPA 4NCGB 1WWHA 2W2OP 4PUOB 5H1SV 2KG0A 2GJIA 4XAKA 4LF4F 1NK0A 3OTBA 4UOFA 4QQBA 1RCOB 1OY8A 3LQVA 2ZJPQ 3Q8UA 3HHLA 2RS2A 1FXRA 1VQSA 4ZCIA 2ZWPA 3CC4S 1FERA 3PYDA 2G0CA 4PYDA 3GWCA 3FFIA 3F44A 4KAIA 4RO0A 1HPZA 2LP4A 4UOGA 1HYSA 3I4HX 2CJKA 4K2XA 1HWLA 5JMNA 4B3RJ 4OX9F 1I1GA 1UPPA 1JLEB 2K1RB 2V68A 1JJ2R 4KSEB 2V8GA 4OJGA 4DZ6A 1RAOA 2DGSA 4FBUA 3ZTPA 2LU2A 1TR0A 2DPIA 4YR0A 5D77A 4A8OA 3HVWA 5G0RB 3GJTB 1HBUA 3NWRA 2UXDF 4ES2A 1E6YA 1TMJA 2E7VA 4XDCA 2XHWA 1CG2A 2XNRA 3V6DA 2HFSA 4DR6J 3U1NA 2CA9A 3EGVA 1WHXA 3MM5A 4KBIA 4OZJA 1BQNA 1JLGB 6AT1B 1GXTA 3GP9A 2UVRA 5I3PA 3UN2A 1N5QA 1T3NA 1C0UB 3KG1A 2V4JA 2CPYA 5EX0A 3CUNA 3CJ0A 2JX2A 5D3GA 2Y8WA 4DN0A 1EJ7L 2G13A 4ZVQB 1BY9A 1YIJS 4ECRA 2WB1D 1DTQA 5DGAA 4DUYF 3W2WB 4KC5A 4LF7J 2KM8B 1JMTA 2M70A 4MYUA 5BR8J 1FESA 3UR0A 1C1CA 3WBZA 2QO3A 3MCMA 2GNKA 2NREA 1TKXA 1FRIA 1X7VA 4XPCA 2Z2LA 2ZH3A 1IBKF 2B9XA 5HP1A 5FLXU 1YJUA 4JV1A 2VQEJ 4DZDA 1R0BG 4Y2IA 1FA0A 2V2VA 4HDHA 3JSRA 5HMYA 4C9DA 3HZGA 4PG7A 1S9GB 4NLYA 3K59A 1PGZA 1IR2A 7FD1A 1EQMA 1IBMF 1UVMA 1HNXF 2ZKTA 4MJKA 4B9NA 3QAEA 1K9MT 1Z1ZA 4WWSA 2ZNZA 4F2SA 1BQNB 2ZD1A 2HVZA 2IY5B 1LFPA 2GVZB 1CEZA 2IJFA 1CPZA 4JV0A 2QLJB 3OJUA 5DG7A 2F63A 4MYTA 3TANA 4HT5A 2DH9A 4GKJJ 4WP3A 1WKKA 4F25A 2XG8A 2M4MA 4O3QA 2N4DA 2XO6A 2VASA 3AD7C 4KGXB 1MWZA 2PSZA 2L9NA 1X9MA 4TYAA 1S57A 1T9YA 2IC3A 1M1HA 5F3TA 3A8IA 3L7PA 2VG5A 1TK8A 2HQ3A 1VBZA 2UUAJ 1C4AA 4A8SA 1VGYA 2R7SA 3NOGA 1ZPWX 2Y0BB 2P6TA 5KFMA 1WEXA 1Y0HA 4LVNP 3R97A 4FNIA 2VQFJ 1JNZB 4EI2A 2BM0A 1D9DA 4M1KA 4HKQA 3O6QA 3IR6B 3EPGA 2RE1A 3R5BA 2H65B 1RT2B 3FQLA 2ZD1B 4KT0C 4DR2F 4F2RA 3SMZA 4FNHA 4K8RA 2AQ4A 2PFDA 3T19A 1GMWD 2W7AA 2DK2A 2OPSB 3HJVA 2LVWA 4C97A 2L9DA 1S7IA 5DLGA 2R9LA 1NK9A 4A8KA 2DGUA 1GXUA 5EHHA 3MAQA 1IR1A 4QU6A 2C2RA 3DYAB 2DEIA 1A9NB 3MAAB 2PEBA 1KD1T 2L48A 1NJZA 3V5RA 4WFNQ 2DY9A 3MTJA 3UFCX 2IC3B 3RAQA 1IQZA 1KVKA 3QATA 1P1TA 2VG5B 3DLHA 5A8RA 3DOLA 3G82B 4U95A 2MQMA 4URQU 2UUTA 4OV1A 3TUZC 3HF5A 1R8HA 3A8EA 3Q8YA 3NAIA 5JXSA 2MKKA 3W2VA 1IKYA 4B3TF 5L38A 4C6AA 3W62A 2YWGA 5M2RA 3KHRA 4NLQA 1KVJA 1TZ0A 5IT9Y 2YTCA 5HBMB 2RU9A 2ZITA 3TQEA 1Y5IB 4LSNA 1FT8A 3QFHA 4DR1J 3KTQA 2QX0A 5IC4B 1RTHB 4CTAA 3EWGA 1NKCA 4QWCA 3BGLA 2AGPA 1KS2A 3BQ2A 2HNZA 4TN2A 2AV5A 1NUEA 3QYYA 2V8VA 3IRWP 1HI1A 1P8GA 1S0VA 1QTNB 2M0GB 1WSVA 1X5PA 2AHOB 1U1QA 3BN4A 4YB5A 3PJWA 4OZ5A 3A8JA 2VC1A 3BREA 1S0OA 2B56A 2JC1A 3DNCA 4MK8A 2BRLA 3THTA 1KOHA 4H4OA 3D0GE 3WZ0A 4USMA 3D67A 5C2GA 1VQNS 2K3KA 1ULRA 2IFXA 3WHIA 3DOMB 4F8RA 3TX0A 1I94F 2B9YA 1JNRB 1PBUA 1U2CA 3BBCA 5KFSA 1KKHA 2DNNA 4IQXA 2AYGA 3HVRA 3DRPB 2DNZA 2V2ZA 4MT1A 4WFBQ 3CXCR 4F04B 2NLWA 1HD0A 3ILIA 1XNQJ 3KHGA 1UP1A 2BABA 1KTVA 2KJVA 2XULA 2DO4A 2Q43A 2V6AA 1SV5B 2DHAA 1P1LA 2J76E 3AY0A 2HNZB 1DAXA 2VA3A 3HHEA 1R8CA 2CRLA 4OX6A 1W2BR 5A76A 5LT5A 1RWVB 1ZAWA 2DHXA 3EVWA 2ZDOA 4LF4J 2J7WA 3Q8VA 4L72B 1SQGA 3VQTA 4FS1A 4CCHA 4WP8A 4IFVB 2MQ8A 2F4VJ 3NP5A 2EFNA 4LFCF 2O3DA 1WKLA 2P6SA 5L8RC 2J0XA 2B9EA 2X1GA 3P5TL 1T9XA 2RB7A 1O5JA 4EYIB 5IS2A 2GHWA 2DGXA 1HQEA 2HQGA 2LEPA 4C8OA 1ZS6A 4P7VA 1N5TA 3V4MA 4RNNA 4JYAF 4LRBA 5GAEI 4ZPAA 2MKIA 4LBIA 4QPTA 1WOPA 5KFBA 4USIA 5A0YA 2XHCA 4C3MA 4UY85 2FGCA 1HLWA 2OPRB 4DPYA 1RP5A 1TQLA 4YHHF 1F9HA 2VHGA 1RWOB 1S6PA 3HKZD 1VQ4S 4LF6F 3N9UC 4YMEA 3IGNA 1C2PA 3ZZPA 5J1NA 1DBDA 4O0IA 1WI8A 3D68A 3PRDA 2QLBB 4DEZA 4LF1A 2RMLA 4DPUA 2LQ5A 3OR2B 4BBYA 3DLLQ 2B6AA 2P9EA 2VBYA 1IKWB 1SC4B 4KGMA 2C2NA 2MB0B 1GTEA 2CADA 2A18A 1PC5A 2WSFC 3ET6A 2XMMA 6FDRA 2X51A 2G2YA 4A47A 1Q5VA 2XSJA 3ENAA 1MWQA 1ZETA 1GX6A 5HJXA 4ZVHA 4DL0C 3MEEA 5H9FK 1LWEA 3E8OA 3HT0A 2H54B 3QLHB 3K5OA 1H7XA 1FRJA 4ITSA 1KWMA 1HWKA 4DL4A 3N6NA 2VG7A 3M9NB 1U7LA 3RBEA 2R8KA 3M2VA 4DUYJ 2D9OA 4M5DB 3UO0A 2DGTA 4QPXA 2NR0A 3VAFA 4HH0A 2R2SA 5KG5A 1MROA 1NK7A 4W98A 4RNHA 5L1IA 1H3DA 2RF2B 1AW0A 2YNIA 5M2UA 2HQIA 4ED5A 1IBKJ 1OSCA 5B0GA 2HHXA 2MKJA 4CYUB 2GQ2A 3MXHP 1XN9A 2YVSA 5T14A 3VGSA 1IBMJ 5D78A 4WYWA 1HNXJ 3MPYA 4DR4F 5CA5A 1X8DA 2XSJB 3V81B 1ICEB 4V1Ak 1LKZA 2YBVA 2VDHA 3AB4B 4DQRA 3ILLA 3MEEB 2CWXA 2OUGA 4J9LA 4V19J 2BJ1A 1LWEB 4CH0S 3G87A 3VQSA 4NLWA 3D66A 2XB2D 4TU9A 2KZZA 3SSSA 3RB3A 3AAWB 2L9WA 3LWLA 1FKOB 3RRGA 1IKVA 4O4GB 2VG7B 1E6VB 3L95X 2KZMA 3C66A 3SCLE 3IWNC 2MLYA 1JX4A 2W9BB 2HURA 2CFXA 1PYTA 5L9XA 4IOCQ 2B43A 1MROB 2VD3A 1NO8A 1VQYA 3DXSX 3QRRA 4O3PA 1CJKA 1NNDA 2MKYA 4NZ7A 4IG0A 4N8NA 3CDWA 3M1VB 5FLXY 5M2PA 3D0HE 4JBCA 2EPIA 3DFEA 2V9KA 4PXCA 1M0SA 2AF6A 4IDKA 2E1PA 4EYHB 5B09A 4MIBA 3ZTQA 5KFDA 1KBRA 1X0PA 3GFHA 1F0XA 2J8SA 1WTBA 4DR2J 3ETMA 4J90A 3VGUA 2FJBB 5J2MB 2C28A 1ZZNA 2QE5A 1R8BA 3TRGA 2V5HG 1FCAA 1IKVB 1NU4A 4DOZA 4ILRA 1SJ3P 3FBBA 1YK9A 4JI4J 1KNZA 2RS8A 2N3LA 2YKAA 1UW9A 2CNLB 1ZZFA 1V5VA 4Q7AA 4E98A 2ZH9A 5HVFA 2VC0A 3K2YA 1WHWA 3KJVA 3LO3A 1B64A 4JI6F 5CYQA 1T11A 1YJ7A 1ITPA 3DDNA 3O8WA 1CJKB 5E41A 1U0SA 2CPIA 2QYGA 4K5RA 2HHHF 3EDRB 2J5AA 4ELVA 3UD5A 2Y9HA 3K5NA 4AXJA 1TL1A 4M95A 3EYZA 1FWKA 4DFKA 2VB6A 4DQQA 3MOJB 2F8HA 4U8VA 1HNIA 3H0PA 4KH1B 2XMKA 1YHQS 3MECA 2RKIA 1LV5A 5AXMA 4YB1P 3VAGA 5A8WA 3ISND 2WK4A 3HKWA 4IKAA 4KFBA 4LFBF 3ILOA 2YH0A 2DNMA 5D0GA 2BMBA 3UD4P 3PX4A 3EJMA 4ED2A 1WG5A 2F5GA 1HFEL 4XO0A 2QLXA 3VHQA 1CQMA 3EDQB 5KG0A 2JOQA 1T9VA 3GPAA 3KWMA 4PZVA 1QTMA 4NWBA 3TO8A 2X1BA 1UJ4A 1U4BA 2XGPA 1RB0A 3W8GA 2CJXB 1HNZF 1EETB 2E9RX 3KJVB 2W8LA 3GG1A 2OHDA 4OZ0A 1VFJA 2CDRB 4RU2A 1I94J 3VAIA 4JI1F 3LWMA 3V6KA 1TL1B 3TZZA 3K5MA 1I3OB 3CC2S 3HSDA 2QRRA 2A10A 2VL1A 1KFSA 5HO4A 1IQTA 3IMQJ 2PE8A 1HNIB 2GFFA 1NMEB 4O3OA 3DGPB 3MECB 3MD1A 4IH7A 5A8KA 3WX4A 2QMWA 5A8WB 2ZH5A 1BXNA 4X66F 2CQ4A 3R5JB 2KU7A 4QZVB 2B51A 2BEFA 4DR3F 4K4UA 1FX2A 1TV6A 4Q45A 3AB2B 3IA0A 4NI2B 2EG2A 1RYSA 2I6WA 1S10A 5GAHI 2Q3PA 1HWJA 2WVBA 4LFCJ 1FJ7A 4DI6A 1GEHA 3Q23A 3HFKA 4J37A 2FJWA 1QSYA 4FBTA 4S0MA 4RU9A 4XDDA 3BPDA 3SFGA 2XMAA 4CNZA 1VCTA 1NHKL 4DQSA 3IAS9 1HWIA 3OBIA 4YR2A 4Q8FA 2UXBJ 4JYAJ 5F3ZA 4GVLA 1OPIA 4P10A 1YWXA 4B9MA 3WX8A 1UJ5A 3K0JA 3HM9A 2BOPA 2E1AA 3HJFA 3D1HA 2CZ4A 1RSCA 4W90B 4YQWA 1ELOA 5KFPA 4YHHJ 2HS0A 5EUHA 3O44A 3DCAA 4LF6J 2IJNA 5KFOA 1Y7PA 4BCAA 4F4WA 1KQSR 2OO4A 3PIOQ 3GONA 3FCHA 1FFSB 1CBKA 3PR5B 2JSXA 4EMDA 3C2PA 3IRXB 3DC2A 3TAQA 4LR9A 1A0OB 2YX7A 2M3DA 3IAM9 3KNAA 2Y8YA 4M5IA 4DR5F 1R0CB 3TP2A 4HDGA 2RILA 1S48A 5KFIA 4A4JA 4J9MA 4EZ9A 1JLCA 2IRYA 3PDNA 3L09A 2BA9A 2D41A 4OJ3A 4CH7A 2YPYA 1KN6A 1OY9A 2PT0A 3JS9A 3PFOA 2CPDA 4YN3B 5E3CA 3H4BA 1RWWB 1YJ9S 2UV8G 2ZM6F 4OZLA 2L08A 5HL7Q 4RJVA 1KQFB 3G4SS 1RUSA 1SH3A 5K14B 4EO8A 4WCEQ 1SC6A 3HXMA 4J9KA 1VRUA 2DYAA 3EXCX 3NKYA 3AH6A 2R7UA 1W25A 2JEIA 3G71S 2UVWA 3CCTA 4DDFA 1UPMB 3VWSA 3GR1A 3E3XA 3FBEA 3RBDA 1YZ7A 1VIXA 4CLSA 2VJUA 4RZRA 5ETNA 3JTOA 3DHXA 3W66A 3P4UB 2EWHA 5BYSA 1Z2LA 1KOOA 2FLOA 4ID5A 1R6YA 3LP1A 1F2GA 4KTQA 3D6MB 1T0TV 1R27B 5DGBA 1JLCB 2JJ4D 3MEDA 2KN4A 1FO1A 2WW8A 2EG1A 2O67A 2GGPB 4MFBA 1TL5A 3I87A 3QT5A 3PTWA 4J9UE 5A6PA 5GAEU 5AJ3F 2MQQA 5JVHQ 2CXEA 1UFLA 1PC4A 4QR2A 5C5JA 3GG0A 1PAEX 2N7YA 1VC0A 3UW1A 2DNKA 3M6UA 2ZH7A 3I9V9 3MMCB 5DG8A 2DO0A 3TEGA 2HFNA 1VRUB 4NLSA 4QWAA 2Y0SD 3F41A 2IBKA 3D6HB 1XIQA 3MCSA 3DLGB 1X4CA 5F9NA 4RUCA 1S4FA 1S72S 2MQNA 1RWPB 2HVIA 1WOSA 5KFKA 1IKXA 1K73T 1MN9A 2W7OA 1DTTB 3D0IE 1M1KT 2YX1A 4OYBA 3MWBA 1RT6A 3OLAA 1XMOF 2KYZA 2XSFA 4P75A 3FBCA 2EC0A 4DX6A 5B0FA 1JLQA 2ALZA 4TU8A 4JI3F 4K5SA 5H9EK 1Q95G 1V6HA 5K20B 3PY8A 3LGHA 4Y2KA 3MEDB 5KFTA 5BYQA 3ENVA 5K5MA 1NDCA 1U6ZA 1I6JA 3MUVP 3MM8B 1FD8A 5C25A 2K3IA 1MLAA 3OV7A 3IG1A 1P6TA 2R4FA 3M32A 3B78A 4ZS6A 4Z2XA 4HHHA 5DQGA 3GIKA 5GAGI 1LFWA 4JV5F 2OLWA 3Q0AA 5CYJA 3CW2C 1GFWB 2FVPA 2ADBA 4OMFG 1VQKS 5KFYA 1IKXB 2UVVA 3MR2A 1PJ6A 1SH2A 2ZEJA 4D3GA 4EBDA 1RT6B 2MQLA 2MZSA 4CO4A 4C0OC 2LEBA 2MZJA 3KHHA 1VRQC 1J27A 1JLQB 3ISNC 4MKVA 4YB7A 4OJ1A 6FD1A 4CO1A 3KK2A 4ANCA 3A3PB 2I5JB 2LXIA 1BC6A 2OTLS 2GW8A 1U24A 3K5PA 1HBMA 1D0EA 3C19A 2IPOB 4YP3A 1X4BA 1WC5A 2E5IA 3IN5A 4DUZF 5RUBA 2CG4A 4G1PA 2Z8QA 1SH0A 1ROFA 5E7OB 5K8MA 2JZ5A 1XMBA 2AJ1A 4TKTA 3IG1B 5J1EA 3PIPQ 1Y5NB 2I9SA 1J5OA 2BRKA 2IAJA 3QNWB 4GKKF 3D7SB 1YJWS 1HWUA 4IYQA 3W60A 4ZCLA 4OQJA 2KXFA 1DHMA 5F8JA 2P8IA 1HR0F 3SQGB 2GS8A 3R9LA 5KFGA 5KFZA 2VOPA 4M5JA 2HLTA 4DLGA 2XM3A 1RTJA 1NH7A 2V8PA 3ZZOA 4QIGA 2DR5A 2GVDA 4Z37A 2XMJA 3I0SA 4I2QA 3T1YF 1KFDA 2LEAA 1Q53A 4YDDB 4OX8A 2AP6A 2UUBJ 3TAMB 1S6QA 3NCRA 4DV6J 3M8RA 4NXNF 2BBEA 4ZPDA 1EB0A 2RAQA 3P45B 3VVUA 3KYLA 1RXOB 1VC6A 1FD2A 2ROEA 5CH7B 3FSYA 3QSYB 2DKOB 1HBMB 5GMDA 4X66J 1CS4A 1JXVA 2CPXA 1W26A 5G4DA 3GYNA 4Y2CA 4DR3J 2KRRA 2YKOA 3CDEA 4KH0B 3PXGa 2RUGA 2I1RA 3DM2A 1R7IA 3I31A 1L3UA 4Z7YA 5AE3A 1F9EB 2ZE2A 3M8PA 4B3OA 2BJ8A 2MKCA 1HA1A 3PFEA 2MGZB 3FCVA 4RWXA 2J0SD 3HHLD 2HG4A 1CJUA 1EAYC 3C46A 5ETSA 2ZFHA 1XNRJ 2HRUA 2K8GA 3M6VA 2HZCA 1LWCA 2QN6B 1RTJB 4KR0B 4WU2A 4U7UK 4HVZA 2LLZA 1LWFA 3CO9A 3BGRA 4I4BA 4KO0A 1YKWA 1U1OA 4O3NA 1LW2B 1VMBA 1NPKA 1S5ZA 1U25A 4OI0A 4NXMJ 3W5ZA 5THWA 2YNGB 1DURA 4HHJA 3LH2S 1NBEB 5DDRC 3KOAA 5IFMA 4ECXA 2BJ9A 3PYFA 2NUUG 2CPEA 4B3MJ 3KLEB 3OSNA 2LA6A 2BW2A 1CS4B 4GMKA 1H6KX 2F40A 5F8MA 2W8KA 2QL5B 2FY8A 4F26A 4IOAQ 1JKHB 4G65A 4DXLA 2LKZA 3CCMS 4DG1A 1R6VA 3VZIA 4TLQA 3N01A 3UD3P 4BWJA 3M8PB 4B3OB 2W9CA 3AJ1A 1Q81T 1V3SA 3RZAA 4DR5J 5GVQA 2OKQA 5B0AA 1T8EA 3KK1B 1RYRA 1SXLA 2FHOB 3I6PA 1H74A 1RAIB 4CLWA 3PW2A 5KG3A 1D9FA 2BXJA 2DXEA 1NEEA 3N4WA 1S9FA 4R0EA 3UCZP 2NSCA 3H90A 2LQ9A 1R89A 3BGRB 1JK9B 1LWXA 5KG1A 1T03B 5HLFA 1YJVA 1WF2A 1NK4A 5IV4A 1R31A 5KOXA 3HVTA 5L1JA 3J80U 4I0WA 3AJ2A 4ZPVR 3JSMB 2ZBIA 2JVRA 2G0IA 1VRTB 1JLBA 2YNHB 4PXBA 3H25A 1G1XA 4IH5A 1FRHA 1QD1A 2BVZA 4DV0F 3THVA 2LMIA 3VTIA 2I38A 2KI2A 4ECZA 1TK0A 1HNVA 1XEZA 3M30B 2XY7A 2V8DA 3HCXA 1Q8LA 4R8UA 1WACA 5GAHU 3HULA 1KHVA 4JI2J 1SKWA 2E7WA 5J2NB 1MN7A 4FS2A 4BHQA 2JNJA 4X62F 2A0FB 4USHA 1U1MA 1CJVB 3CIZA 1K0TA 4C98A 4ZLPA 4P6QA 2DBBA 3QJPA 1SC1B 2V50A 3BKFA 4ENOA 4LIWA 3CCQS 1G7CB 4L76A 4M5GA 2EKNA 1YSJA 3S01A 3J81U 2WOMA 3CIMA 4DSFA 1TMMA 2HNDA 5HLFB 3OL9A 4CLYA 4O44A 1FRMA 4I56A 3HVTB 3CCJS 3R6GB 2GMLA 2ZNYA 3GIRA 3KLGB 4EK2A 1T05A 2NXNA 3V4IB 4G6VB 1D3WA 4K4XA 3SQOP 3UDEA 1HW9A 1F5AA 1RU2A 1UEVA 2WBRA 4K7QA 4NE9C 2C3MA 2XBPA 4UW2A 1M5PC 4ZCMA 2ZBPA 1RAEB 3I55S 1XMOJ 4DV4J 3U02A 4ALZA 4IUFA 4DV1J 3LF0A 2U2FA 3H4DA 3VVTA 2XMTA 2YKNB 2RRNA 2EC2A 2APOA 1S1UA 2O1PA 1U02A 4R5PA 3CMES 4M5HA 3DLKB 2AU0A 3A8KA 1BGXT 2KT2A 3A4TA 4RLEA 2VG6B 1MU2A 1DQ8A 4ER8A 4DSEA 3LW5C 1WD6A 2BE2A 1VLYA 3CD6S 2K7KA 3Q8SB 2JC0A 2ERRA 4L3KA 3J7Z5 4O3SA 3B4DA 4X4PA 2X1AA 1T7PA 2WOMB 2E5GA 2HNDB 1D1UA 5KOWA 2D1CA 2FVQA 2ZJRQ 1UVLA 3CSKA 3DOKB 3J7YI 3V6JA 1CQNA 4QIEA 4F0MA 3GFXA 5ETQA 2EFPA 4PG8A 3SEOA 4AL6A 2PC6A 1OIAA 4CO0A 3NNCA 3OXLA 4F0HA 2OELA 3QT8A 3POTA 2HNYA 2VICA 4DL3A 4QCLA 2HQFA 2Q66A 2G0JA 3R5AA 2A6OA 5C7PA 3OQ2A 2LXUA 4ZPWR 1H38A 3HP6A 2ZH8A 4IQMA 3US5A 1UTAA 5D6GA 3J7AN 4FF2A 4OI2A 2ZBCA 2XMUA 4MAKA 2PO4A 1RT4B 2MSTA 3QQCD 3CJ2A 1TL3B 2A1BA 4R5PB 3OL8A 1KEKA 1NM2A 1YJNS 4DR6F 1ZH5A 2PEHA 2NPIA 1BLUA 4BC9A 2BE2B 3IXQA 1EKRA 3BSOA 2YKMA 1FVQA 5E3AA 2QMXA 3DXBA 2HAIA 1B7FA 1GT8A 4I6AA 2LQJA 4DCJB 1PYOB 4X4QA 3NS5A 4LF8J 2RQ4A 3QO9A 2IA0A 3M9OB 3Q83A 2UXCF 5F8HA 2BJEA 3SYZA 1QAJA 2FLPA 4DV5J 1RWKB 2CIMA 2GO9A 4C8YA 1QM9A 3PO5A 2BUNA 3DDIA 3POTB 1UW4A 2HNYB 4LF7F 1C4CA 3FRZA 2COLA 5BR8F 1VK3A 3R5CA 1PSDA 2NSBA 2NPFA 5JVGQ 5KFEA 1WKJA 4CLFA 3FNNA 2IVYA 4YDXA 4KV8A 2AKWB 3D4JA 4QW9A 4OI4A 1QE1B 1XJWB 1FE4A 1HI0P 1UVKA 4NXNJ 3IM8A 2VQEF 1EZZB 2KHDA 1UETA 2HVEA 4WXWA 4ED0A 4NX9A 3G6XA 1N33J 3UNGC 2JEGA 1GX5A 2AJQA 5KT3A 1SKUB 4KJIA 2PA3A 2YKMB 1EKSA 3G86A 4HL9A 2RU3A 1VLOA 3VGVA 4EZ6A 1TELA 3CCWA 2P5VA 3UVJA 1QUPA 1Y10A 3MR5A 3FSXA 4ERDA 3QRPA 1Q1KA 3TA1A 1NJYA 3ZTSA 2AEMA 5DDPC 5I42B 1M5HA 1UZHA 4FXDA 2AYMA 2HRTA 4QOTA 5C42B 4LMZA 5GAGU 2IM1A 3TUIC 3CMAS 4HTIA 4PYAA 3LOUA 1AZSA 1VHIA 4CH1A 2EBGA 3OR1A 3I9ZA 2C42A 2AEFA 3JB9k 5F9LA 3C16A 2QFJA 2PD1A 2I0XA 1NCLA 4KB7A 2VDIA 2KM8C 3VZHA 3TR5A 3ZZ0A 3NBPA 5MAOA 3FQKA 3FZBA 2DHHA 5HANA 4ELUA 3BO4A 4PXDA 4PQUA 1OWXA 1XQIA 1H7WA 3CE8A 3KLFA 2JH3A 1QDUB 4UOCA 5E3PA 4Y6IA 3GIMA 3T6JA 1M5OC 1Q78A 1UFWA 3R7BB 5I3UB 1RAAB 1JJHA 4A46A 3AOBA 3OUYA 2VODA 4Q5VA 1N5SA 4WFAQ 1TL7B 3N0VA 2ASDA 4PPDA 1RWNB 1K0VA 4GC6A 1OYDA 5C2CA 2OD4A 2V67A 3DRXA 2HHPA 3BYPA 1Y9OA 5HJYA 4ZVFA 1RT7A 4C8MA 1R0AB 3NGSA 3K7RA 5D4PA 2DB1A 4WBFA 2OSQA 3DMJB 1IM4A 4R0JA 4I67A 4AFFA 1VQ7S 3SBMA 1AZSB 2AJFE 3OR1B 3U1LA 2KB2A 1D09B 4ANEA 4BDPA 1AFIA 2FD2A 5KG6A 1BQMA 4OHZA 4ZN3A 2OMLA 3T1HJ 1MMNA 1F2HA 2QSWA 4IH6A 4TYBA 4LF9J 2KDOA 4DV0J 1RHQB 4AD6A 2V8HA 1HBNA 2FJEB 4O0NA 1RE1B 5KT2A 2JEFA 3KFWX 5AE1A 3SI8A 2E5LF 3BH7B 4NA3A 2IDLA 2OEKA 3OUYB 1WOOA 4NYOA 2CQHA 1BD6A 2DHGA 3CJQA 2J9DE 3CT9A 3TNVA 2ZH1A 4LREA 4LUBA 4P72A 4J7CA 4PUOA 5ADZA 2VH7A 5K8NA 2J6UA 3G2XA 1YDLA 3PG9A 3UDVA 5HVGA 4OLPA 2B4PA 4AXIA 4UZBA 3G8TA 1UAWA 1PILA 1WEZA 4WTOB 3MHYA 4N41A 3ENWA 1FVSA 5F8IA 3CVKA 2RHQB 4CM2A 3HT3A 3H2VE 2AZ3A 1RQ0A 2YX4A 3PYGA 3M2UB 3J80Y 1JLEA 2O66A 1OO0B 2DJWA 2K1RA 4CLUA 2W9AA 2QLFB 2Z57B 3DLEB 3SCKE 2Y1JA 1WHVA 1HBNB 3OVSA 4U7UD 2R7TA 3DI6A 1YRUA 1J5EJ 1AXQA 1KLNA 4XK8C 1T9UA 4OIXA 1TFYA 3M8WA 2FJXA 3TA0A 4NLUA 1OSDA 1TAQA 2VPXB 3FUYA 1GK8A 2F4VF 2W24A 5IWAJ 3U7JA 3HSZA 3FKBA 2J9DA 2YQ0A 1C0TB 2CQDA 4RL1A 1RLCL 4NL5A 3C6TA 1WF0A 1JLGA 4OZ3A 4USVA 3UR3C 5ETKA 4Q8EA 1WORA 1YBTA 1B0VA 3J81Y 1NAQA 1C0UA 4OJHA 3FRYA 1V9OA 2GMJA 1JXEA 1ZTWA 2Z2MA 3KJFB 2OGUA 5DS7A 4KGVB 1S6OA 3GE9A 1RDRA 1HKAA 2WB4A 1T9WA 2I8EA 3W2WA 3QIPB 3I96A 3NRBA 1S59A 1URRA 4DSLA 2I2YA 4JV2A 4JUZA 3MPUB 4P2SA 5IZHA 1UEUA 4RW7A 2E7XA 1QUVA 4ZP7A 3DI6B 1FRXA 2ZHBA 2R8IA 1EX8A 1FEEA 2XC9A 4CP5A 4IFYA 3EGNA 3W1YC 1C1BB 2QA4S 2XQCA 3NS7B 4X4VA 1TU0B 4YR3A 2Z30B 3W61A 3KLVA 3H40A 2NXCA 1S9GA 5DETA 4ZVEA 2XLKA 3KMSA 4LVOP 7FDRA 4IO9Q 2IVMA 1FK9A 1RTDA 3Q22A 1PIEA 3DRRB 3MEGB 1R8PA 3MZIA 2ATCB 2D69A 3C6TB 1JQGA 4P2FA 5EN1A 2CQPA 3WDOA 4B9UA 2MLXA 2VV5A 2MPUA 2FUG9 1HBOB 2GVZA 4USJC 4FN5A 1OQ6A 4OI6A 4IG3A 3OL6A 2UXCJ 5LJ3Y 1KLMA 1FDNA 4PG6A 1HQUB 3KUEA 3GSDA 4JI0F 2KXNB 1RHUB 4B3SF 1M90T 1VJWA 2WTFA 4PXEA 1CJTB 2HIQA 3QPIA 2HMIA 2JLFA 4RW7B 3KK3B 3VGTA 3MCNA 1R43A 2IRXA 4IFYB 5HI7A 5KT6A 2FLLA 2MJNA 3QGGA 3LGNA 3ZZRA 4O23A 3H5SA 2WVEA 2BANA 1S99A 3KG0A 4LF2A 2ZUGA 1S9EA 1SIWB 3BKTA 3NOCA 1G6BA 1EP4A 5KFHA 4Z7CA 1FK9B 1VQPS 1RTDB 4Y28C 4MIWA 3OHBA 3ADAC 3AQPA 3MAHA 1F60B 3RYLA 4UQGA 4ECTA 3FK4A 1RT2A 4L6V3 3UCUP 4N77A 4DL6A 2W4DA 1XK8A 4LRDA 5E5NA 4IG3B 2OPSA 3QBCA 4ILMA 1KLMB 3MR7A 1NSQA 3J7YU 2YKPA 4DX5A 1A7GE 2AWZA 3OTEA 4CDIA 1XR5A 3DYAA 4I7FB 1U45A 3R8YA 2QA2A 2HMIB 3MAAA 4ECUA 5AXKA 4B17A 2IJRA 2LECA 1I5OB 4JP8A 1XBWA 2ACYA 2DIUA 5IM0B 3F0NA 1RABB 3IR5B 2VFRA 3G82A 2M7SA 2E1RA 4P9SA 2BANB 3BO3A 4HYKA 2WAQD 1UVJA 3QMQA 1S9EB 4ES3A 2HHTA 3ENQA 1JLFB 1NH8A 1EP4B 1TUWA 3PJ9A 1UVIA 2HRYA 3LP2A 5HBMA 2DH8A 2C3YA 2FJVA 3HZEA 3D1OA 1MSWD 4BC7A 3WC2A 3BV8A 1RTHA 4NLRA 1RTIA 2NXJA 1QLNA 1U6FA 5D4OA 4P2MA 3EICA 5DDOC 4M5MA 2GJFA 4X2BA 4PRFA 4N7TA 3KLHB 4O3RA 2YQ3A 3TJ8A 4C3LA 3BQ1A 2OH2A 1RT5B 4CWBA 3AOCA 2W2MP 2CQIA 2IIHA 3NG8A 3M6WA 4FXVA 2MTLA 2ZZTA 3RB4A 3EMTA 1VQ8S 4JI4F 2QL9B 5KFXA 2ZH2A 2CAJA 1JIHA 4AQYJ 1HQ2A 1X5SA 3QWUA 4ZVOB 2KJWA 2M8HA 3GV7B 2B4UA 2KVIA 4ZK7M 1U0HB 3IWXA 2GIRA 3MDFA 3DOMA 4MK7A 3NCQA 2ASJA 2FYXA 2BKPA 1YZ6A 4B9TA 1SL0A 4QR1A 2R7WA 1F6TA 2AGQA 2Z56B 2W4PA 3VAMA 4FYDA 3DRPA 1FDBA 3GMGA 3LP2B 1W2IA 1YRTA 3K17A 4I69A 2E5LJ 5HSPA 2GQCA 1RTIB 2MZ1A 2WZ1A 3JSYA 1SV5A 1TKZA 4DPWA 4FVCA 1UA0A 2ZC4A 1IXKA 2QA1A 1EARA 5ETOA 1S0NA 2XMVA 2YQ1A 3DKDA 1YVFA 2R3VA 3EX7B 3TARA 5CCMA 4IFVA 4RUHA 1SL2A 4CO5A 1VISA 3IBCB 3R2DJ 1RADB 2HHQA 4DV3F 4LBPA 4DR7J 1RACB 5B7WA 3LGMA 2E66A 4TXSA 2R7RA 3I4PA 3IR7B 4X64J 2MQPA 4LFAJ 2E29A 3H2UB 3SFUA 1QAXA 2MHEA 4OHWA 4PAAA 3N6LA 1TTHB 1WI6A 4UZCA 2QL7B 3IM9A 3TVYA 3D2WA 3O3LA 4RW8A 3QZ8A 2SXLA 1WTFA 2PFFB 3OTDA 3SSQA 3HK2A 3MPWA 3OHAA 4JOUA 2DIVA 2OPRA 2FHKA 4YB6A 4YFUA 1TKZB 2NS1B 2C2OB 1K1QA 4KIAA 4LR7A 3D6FB 4DF8A 2H9ZA 3MM6B 1N32F 2HWHA 3KDOA 4RPFA 2YH1A 2IM3A 3W9HA 4DX8H 5F8NA 2QLWA 1RAHB 4LF5F 3H5UA 2MKSA 3OR2A 2XCAA 4EO6A 2IRUA 5EWFA 2R2TA 2A2CA 1IKWA 3EZOA 4F4AA 2HKEA 4DV2F 2KYXA 4N76A 2Z58B 3M05A 2YNFB 1RGVA 2JVOA 2PN6A 2OFHX 3RR7A 4F3OA 3TVKA 1P9QC 1UVNA 1TAUA 2CJYB 2MKHA 5J2QB 2QG9B 3BM7A 4FP9A 1RKIA 5ETLA 5T7LB 2RDJA 2AMCB 2KG1A 2VBXA 4ECVA 1FTRA 1FWLA 4WKYA 4H4MB 4OX7A 3QLHA 5T41A 2UXBF 3AD8C 4RR5A 4QU7A 1U8SA 3M8ZA 3FMBA 1NZAA 3R1LA 4RW8B 2N4CA 4ZHRA 3NGTA 2XCPA 2IDEA 4DQIA 1UMJA 4PQAA 4EBEA 4M5DA 4P73A 2MSSA 1GAOA 2BOAA 4L3NA 1FI4A 4JI8J 3HPOA 2RF2A 5LSOA 2J9CA 2HQDA 3IC1A 2HBYB 3UDLA 4KHMA 4JB8B 1KR4A 2ZBQA 2UUCF 4CYUA 3MPVA 3O2IA 2EFGA 3D9BA 3DRSB 3CCVS 1VQMS 2PIIA 3MI7X 2DH7A 1D9AA 2AZ1A 1K44A 3W63A 1ACMB 2AYBA 4C8NA 3V81A 2XZWA 1U09A 1VIOA 2E5HA 4DLEA 1KDNA 2GA7A 2K06A 4HR2A 1Y5LB 2F65A 5HAOA 1YBAA 2IVFB 1FKOA 2X3DA 4JI0J 2JLEA 2KT5A 4O4GA 1WNEA 4CQ1A 4B3SJ 4ZHRB 2AJ0A 1E6VA 4EBCA 2EKYA 4OLOA 2HWTA 2G2OA 3R3TA 1YQHA 3H5XA 4U96A 2WRMA 1WELA 4WIQA 1GQEA 2W9BA 4K4YA 4J9RA 1KQGB 4LSZB 1RAGB 2DNQA 3BGFA 2V94A 3GIIA 1GMVA 3UN5A 4K0KF 3M1VA 3HFZB 2H4YB 4FKYA 5HMZA 2UVUA 1FWPA 2KVQE 1VQOS 4UQTA 2EFOA 4F4ZA 3EPIA 1S77D 4HI1A 1WG1A 4NLXA 2LU1A 1DZ5A 3QRQA 3E51A 1FXLA 1S1TB 1X4DA 3GYXB 4DV7J 5CD4H 5KG4A 4LQ9A 3ZZTA 1RWUA 4ES1A 1IWAA 2K2PA 1O0PA 3M6XA 2VA2A 4EEYA 3H5YA 4PWWA 4TY8B 1FEHA 4L74A 3R7NB 5J2MA 3OFFA 2HHWA 3ITHB 2R42A 5LMNJ 2J9EA 4PG4A 1WDTA 3Q86A 1ZOTA 5EWGA 5AXLA 2CNNB 2DNRA 1VBKA 5IQ6A 4AYBD 1RBLA 3EZUA 2HLUA 2GV1A 4ZOSA 1Q4RA 9ATCB 1H98A 2J0WA 3K8VA 2K7JA 1MMLA 3WQPA 1RJJA 1L5UA 7AT1B 5KG2A 3ULHA 2CQCA 5LXYA 2MY7A 1N8RT 2JDJA 4C8KA 1DQ9A 1FFGB 1WDDA 3V2UC 4C0BA 2D3OR 1CULB 2FJDB 1RA6A 1DARA 3AJDA 2YWEA 5AE2A 1KVIA 4DF4A 2CZ9A 1PJ5A 5FDLB 1F3VA 1IR0A 1BWVA 4GO7X 4F0KA 4F4XA 1AT1B 2KRBA 3RW6A 4RW6B 1U47A 1GMUA 4OHYA 2N82B 3VAJA 1FHTA 5GMEA 1NK6A 2VZ9A 1WJ9A 5IT4A 1ZTTA 3L7OA 1FX4A 4FF1A 1ZM3A 4X4OA 1YX2A 4DWIA 1VOMA 1QY7A 5LMUF 2HVDA 4NYPA 1Y00A 3MM7A 3QGHA 4A48A 2ZZMA 4YY3F 1LNQA 4RWWA 2RRBA 1WC4A 2LDYA 3KHLA 4RW4A 4Q2MA 4PEOA 4FDFA 4EWTA 4WIIA 1RHKB 1IM6A 1FNMA 1EETA 2BJ7A 5EX3A 2B7BB 1XERA 1D8YA 3DLJA 5CYMA 5MLCV 4IRKA 2DXFA 2B5JA 2IMWP 4BS2A 1N0VC 1JXLA 3AXKA 2DGWA 2PA8D 1KQKA 3T6BA 2QYCA 4DJBA 4MH8A 2MDAA 4NMLA 2WONA 3OD2A 2R7OA 3W5YA 1MMDA 2CG8A 2CQ0A 1XR6A 2G1HA 1OS5A 4ETZA 3DGPA 3CDAA 2UUWA 2C3PA 2G4BA 3H7HB 2B3TB 2W2NP 2AJ4A 3NGKA 1REVB 1RBAA 1TUGB 3K89A 1TKDA 3EZ5A 2MZTA 3SSRA 2BZ2A 3E01B 3MM7B 4NI2A 4QW8A 4LRCA 3KLIA 3D6TB 2HFUA 2H4WB 1DLOB 4ZN1A 3OTCA 4RW4B 4DV3J 2H1YA 2RT3A 4DFMA 3HX9A 4OHXA 1I51B 2RNEA 3OTOF 1T94A 3W65A 4V19X 5CYMB 4DL7A 2DR8A 4RKUC 4F02A 2B5JB 1RAFB 2U1AA 2YWKA 2LXFA 1EIYB 4QBUA 2NXEA 2VFSA 3CGIA 1FJGF 1HHSA 3FVYA 5I3QA 5KTQA 3PR4A 2WONB 3T1AA 5HQ8A 5KFUA 4MKBA 2GQQA 2DNGA 2UUBF 4DV6F 2FHMA 4KPYA 3G9CA 5KFCA 2Y1IA 5FD1A 1U1RA 2VBWA 3BGOP 1BMQB 2KFNA 2Q79A 3C14A 1BWEA 1N48A 1UEKA 1SKSA 4NZ0A 2QJ3A 1N32J 2Y3YA 3BF4A 4Y00A 5E3QA 2VIHA 2CPFA 3NY0A 4USKA 3CDBA 2QA4G 4LF5J 1Q8BA 3MTKA 5GMKa 2P2CB 3HHLB 3NMRA 5EGYA 2ZKUA 3IRXA 2HSEB 2XYGB 3KLIB 4NASA 2RHSB 3RR8A 1KTQA 4DV2J 4K4WA 1ZAVA 1ZM4A 4J9VA 2HIYA 1N88A 2VFVA 3FFIB 1U49A 1EQ0A 3A3OB 1HPZB 4FPRA 1HYSB 4ED4A 1LQ9A 1QSSA 2QMUB 1Q16B 1XNRF 2H51B 2DR9A 1PO6A 2EXUA 2RJZA 4TVAB 2OPPA 2R8GA 5A2QU 3P8BB 4I68A 1RHJB 2JFDA 4M8LA 4UUWA 3MOZA 1RK8A 3W9JA 2HGMA 3IBWA 1CLFA 4NXMF 2YY3A 4LSLA 5DJBA 1S6UA 5K14A 4AL5A 2EVZA 4NA1A 3CCLS 4K2JA 4A8YA 3F56A 1S76D 2KH9A 4ZLNA 1HBUB 3C14B 4G3IA 1L3KA 4NLVA 2V34A 1E6YB 1WC0A 4B3MF 3TZXA 4WFXA 3V6DB 4K4VA 1KONA 4ID8A 1J2VA 2UUCJ 4HTJA 2FVRA 3W9IA 3CJ5A 1IUJA 3JQJA 4OFZA 2QEXS 1HNWF 4FYYB 3MPDA 3PM9A 2R7XA 4USWA 3AFGA 4NLGA 3MM5B 1O8BA 4CRJA 5CD4A 2DVIA 2ZHAA 4K4TA 3PYEA 5D0HA 4QYZK 3B82A 2V4JB 3VR1A 3S7RA 1U1KA 2OPPB 2GGPA 3H20A 5D3GB 2OAUA 3FC9A 2CJ9A 1NSAA 8RUCA 1DTQB 3U1MA 1HW8A 1IBCB 2HBZB 4CT8A 4LSLB 3DU5A 2BV3A 4URSA 3P96A 4X4TA 3T5HA 3GIJA 1C1CB 3MMCA 2HQCA 1NLKL 2GAHC 3C15A 1UJ6A 2F3JA 1TKXB 3DRYA 4ILLA 1LEOA 5IV3A 5HVHA 4X65F 5HP1B 2MLZA 3DLGA 1M1GA 3KJNB 2HVHA 4K0KJ 3MMJA 4DCPB 3CCRS 1V3RA 3ELHA 1DTTA 1B4SA 5BJRA 2AJ2A 1NHVA 2DTJA 2AW0A 5DM7Q 3QJLA 1VI7A 1V5IB 1R3NA 4F7VA 3CJ3A 3HHKA 4JI2F 1VHFA 2W2QP 3BSAA 3PHEA 4RW9A 4A8MP 2DGOA 4ED8A 4B9SA 1X4GA 1KRPA 2DEJA 3P5BP 4HT7A 5B0BA 3TJ9A 1WEYA 9RUBA 1U8WA 1NKEA 2QFIA 1U48A 2QSFA 4ED6A 2BM1A 3MM8A 2OJ3A 1FNOA 1U1NA 2H5IB 5JUMA 2C1EB 1XMQJ 5K8OA 3TQ1A 4ZJQA 1Q7LB 2CQ1A 3ZZZA 3OLBA 2V63A 2CUYA 1BQXA 1HI8A 2RH3A 2HHVA 3C15B 1OMSA 3RRHA 4IR1A 2CYYA 2W01A 4DS5A 1JJ4A 4OYMA 3IO1A 1S97A 2FHJA 2H5JB 1UKUA 1MW7A 1Y11A 3N79A 2F8MA 3D54A 5HMXA 2R2RA 2F4FA 5D15A 4Y0FA 3QJJA 4DV4F 3RB0A 4DV1F 4QR0A 3J7A1 4X4NA 4DSJA 3I5BA 3AA9A 3ZNUA 4MTPA 2BJDA 2HEKA 4OL8A 4RW9B 4E2FB 4KHPF 3PCOB 5E2QA 2HGLA 2I5JA 3HD2A 2JL9A 2BQUA 5B0CA 2X1FA 1X5OA 1F3FA 4JI5F 2FDNA 5LMUJ 4OYWA 3CB4A 5HN0A 5HATA 4YY3J 4GO5X 4W4MA 2FQQB 3L9ZA 5DZ6A 4A8WA 2DY1A 2P9CA 3GV5B 5KFWA 4CLLA 1NZ8A 2DNHA 4FYVB 2DR6A 5H9FJ 1DFDA 2GO8A 2HFZA 4RBTA 5A8RB 3DOLB 3QT6A 4F4KA 2V9WA 3SQGA 3BPSP 1PBAA 3FJ2A 1WHYA 1S1WA 3W2VB 1IKYB 2JEJA 4DFJA 5DM6Q 3W5XA 4Q43A 3QZ7A 2F9DA 3CC7S 3AODA 4DQPA 3CULA 2CDQA 5LJ5Y 4USUA 1WC6A 1NKBA 3LA0A 4LSNB 4NRUA 3TAMA 2MY8A 4CTAB 1LOUA 5DZ7A 4DSKA 3O5TB 2YPZA 1UZDA 4F3QA 2R8JA 3RU0A 3MURP 5DDQC 3ZO7A 1FKPA 4HEA9 2HZAA 4U8YA 2BACA 3MD3A 4WU3A 2ADCA 1O6XA 1X4AA 3EE3A 4NCAA 1Z2ZA 1Y3KA 4QYRA 4LF8F 4F4YA 2GCFA 4DMZA 4ANDA 3UQSA 1M5VC 4LIRA 4H4OB 1NK5A 4B02A 2D3O1 2MGZA 3R27A 3BJYA 3CMQA 1ZM2A 5KFLA 1YGYA 3TZWA 4DV5F 2RRAA 3OTOJ 2M8DB 2CVEA 2RSQA 3JQMA 3JQKA 3DDKA 5CAAA 1HARA 2V2KA 4OX9J 2PGCA 1S1WB 1FJGJ 2W25A 2O5DA 4R25A 1Q5YA 2OEMA 2C2KB 1LW2A 2J0QD 3GR0A 5LSRA 4ZVPB 1X9WA 5GADI 2C3OA 3G6VA 2YNGA 2F9JA 2FB0A 3T5KA 3GILA 2F7VA 5HQLA 2HBQB 2ABYA 3BZQA 3KG4A 2UXDJ 1N33F 2JRSA 2VOOA 4WFYA 3TEHB 1FKPB 2M9KA 3R5GA 3KLEA 3SV3A 4LBHA 4DCOB 2BKNA 3TUJC 2UV8A 4YEAA 2BDPA 4WF9Q 4N8OA 1JKHA 1N5YA 4RNFA 5KT7A 2B9WA 2AD9A 4F67A 4WK1A 3ZXWA 4J91A 2ACMA 3TI0A 3KK1A 4B9LA 5ETMA 1HQEB 1MG7A 3CJKA 4G1IA 5L46A 4TLRA 2CNOB 4C4WA 4HLBA 1KP6A 4H54A 2DGVA 3HHDA 3BR9A 4CO3A 1RWMB 1SVDA 4KRWA 1N52B 1T03A 4NOHA 1B7YB 2XYPB 5A0YB 4DPXA 2E44A 4WZQA 1N34F 4G1QA 3T9ZA 4YUDA 2IYGA 2LYVA 4X4SA 1S6PB 5CXTA 3JSMA 4LJMA 4LT6A 1VRTA 2YNHA 3CNQP 3Q8PB 2KTQA 2ROGA 2V0NA 3GQCA 5A6WA 3PV8A 4ZJLA 4RBUA 1IBLF 1Q79A 3GCXP 2RQMA 2XS5A 1PAUB 5K8PA 2B6AB 3HMJG 3I5CA 1N5YB 2YWFA 1HNWJ 3M30A 1VS3A 3MR3A 3ET6B 2V4RA 5F0WA 3UNYA 3PKMA 3IBFB 3EUNA 2CJQA 4P7TA 4ZP9A 2GAGC 5J2NA 1RBOB 3R6LB 3QGPA 1SJRA 3NGDA 5L9NA 1W7WA 4HHUA 1CJVA 3CJKB 5KFVA 1RA7A 1N5VA 2D74B 3MFIA 2RD5C 3WIUA 1RZMA 1RHRB 2VPYB 3CTRA 3FEYB 5J2PA 4FZVA 5KFJA 1NPRA 1PJ7A 3JSBA 5A2QY 1Y3JA 3M2VB 3IP0A 1U1LA 1SKRA 1SPBP 1G3OA 3ZTRA 4EU0A 2XO7A 3CJRA 2V69A 2IM2A 4UUXA 4G1QB 3M4XA 3LALA 2EK6A 3EGWB 3KLGA 3T1HF 1RLDA 2VPWB 3V4IA 1F1BB 2BR0A 2YNIB 1FDDA 4X65J 3UDCA 4LF9F 1Q8IA 2BJ3A 5LSLA 3G6ES 2DNOA 4USTA 1SQFA 4CO2A 1B99A 2DPJA 2M2BA 2YKNA 3X1LB 2E1MC 2IHR1 2O01C 1YJRA 3DLKA 2VG6A 5SZTA 1EHWA 3PACA 2FLNA 1KHWA 4ZITA 4BLGA 2DR7A 4NZ6A 3FEXB 5J2PB 4URGA 1VJQA 3AHPA 1F5BA 2ZJQQ 3TA2A 2G2ZA 1N4LA 2FC9A 3OW2R 1M5SA 1PKUA 3C8YA 1QJHA 4QIVA 2IYIA 4KKOA 3DOKA 3TW0A 2XZTB 3MFHA 3ISZA 1WF1A 2QTWA 4M5NA 4IG0B 1S1VA 3J7ZT 3I32A 4PCQA 5K9FA 2PDAA 1MNEA 4WPAA 4B3TJ 2XI2A 1S79A 3K8WA 4IDKB 4UTGA 1J5EF 4Q2LA 1HL6A 5D4NA 3GJSB 3FCWA 2KKHA 4RUAA
chains in the Genus database with same CATH topology
3M32A 3B78A 4ZS6A 3VF0B 5CCMA 1RT4A 3EGZA 4Z2XA 4IFVA 4D3HA 4RUHA 1SL2A 5DQGA 1T02A 3GIKA 4FF4A 4CO5A 4KQZA 4U6PA 1TL3A 1Q7YT 3AQOA 4KE5A 3FMWA 5D8HB 5IQQA 1FNXH 5GAGI 2HHQA 2Z0GA 1LFWA 3D28A 1XNQF 4JV5F 2XMWA 1S49A 5KG7A 4DV3F 3X3UA 3KNGA 2OLWA 3PW5A 3Q0AA 3BSNA 5HROA 5IWAF 3OJSA 5CYJA 5B7WA 3LGMA 2E66A 2FVPA 1YI2S 2ADBA 4TXSA 4OMFG 3QWPA 5G0RA 2GHVC 3DU6A 3I4PA 3IR7B 2R7RA 1VQKS 3SCJE 1F5CA 3R1HA 2HW3A 2ROPA 5KFYA 1IKXB 4E8UA 3ICLA 2UVVA 3MR2A 4Y2AA 2DISA 4NCGB 2MQPA 1SH2A 1UWBA 1WWHA 2E29A 3RAMA 4D3GA 3K57A 4PUOB 3H2UB 3SFUA 4EBDA 5H1SV 1RT6B 2MQLA 2KG0A 2MZSA 4CO4A 1QAXA 2MHEA 1NJWA 2GJIA 4C0OC 4XAKA 4OHWA 2LEBA 1R8AA 1NK0A 3OTBA 4LF4F 2MZJA 3N6LA 1WI6A 4OZ1A 3VAHA 4QQBA 3KHHA 3OVAA 4KHRA 3TVYA 3D2WA 1JLQB 4QYZJ 3ISNC 4YB7A 4OJ1A 3O3LA 3LQVA 4RW8A 2IA6A 3QZ8A 2SXLA 1TKTA 1WTFA 3NS6A 4KKOB 6FD1A 4CIOA 2ZJPQ 2PFFB 3HHLA 3OTDA 4CO1A 3SSQA 1TL4A 4H4KC 2RS2A 3KK2A 4DSIA 3HK2A 3MPWA 2I5JB 2DNPA 3OHAA 2LXIA 5CYQB 1FXRA 1BC6A 1VQSA 4ZCIA 2OTLS 2GW8A 4JOUA 1U24A 3K5PA 3CC4S 1FERA 2G0CA 1HBMA 2DIVA 2OPRA 5LXRA 3GWCA 3NWGA 1D0EA 3FFIA 3F44A 2FHKA 4KAIA 1S1VB 2KO1A 1HPZA 1H2TZ 2XLJA 4YP3A 2VFUA 2XEXA 4YB6A 1X4BA 4YFUA 1HYSA 1TKZB 2WCXA 2NS1B 2E5IA 3IN5A 4DUZF 2KFYA 1K1QA 2CG4A 3I4HX 4KIAA 2CJKA 4K2XA 1HWLA 4G1PA 2Z8QA 1SJ4P 1SH0A 1ROFA 4DF8A 4DN9A 2H9ZA 5E7OB 3MM6B 5K8MA 1N32F 2HWHA 1FF2A 2JZ5A 3DHWC 2NQPA 1XMBA 2YH1A 1M5KC 2IM3A 2AJ1A 4J5OA 4TKTA 4OX9F 2MHNA 3FDSA 3IG1B 2QLWA 4DX8H 5J1EA 5F8NA 3PIPQ 2C2EA 1I1GA 1Y5NB 2I9SA 1J5OA 1RKJA 4LF5F 3H5UA 1JLEB 3BDPA 2MKSA 3OR2A 2XCAA 1TVRA 4EO6A 2BRKA 2IAJA 2K1RB 2IRUA 5EWFA 2R2TA 1QE1A 1RT3A 4GKKF 2BYCA 2A2CA 3PW0A 1IKWA 4KSEB 1JJ2R 1YJWS 1HWUA 2RKIB 4IYQA 2V8GA 4OJGA 4CI0B 3CF5Q 4DV2F 2KYXA 3H59A 4NCBA 4N76A 2DGSA 4ZCLA 3M05A 4FBUA 3UWTA 3HLUA 2KXFA 4OQJA 1DHMA 5F8JA 2LU2A 1TR0A 2YNFB 1RGVA 1HR0F 3GFYA 3SQGB 4KFBB 2JVOA 5HROB 2PN6A 4J9NA 2DPIA 4YR0A 2OFHX 5D77A 4ZPTR 3RR7A 4A8OA 4F3OA 5KFGA 3TVKA 1P9QC 2CQ2A 3HVWA 5G0RB 5KFZA 1UVNA 2VOPA 1TAUA 2HLTA 2MKHA 2CPHA 1HBUA 4FXWA 2Z4PA 4DLGA 5J2QB 3BM7A 1RTJA 4FP9A 4GC7A 1RKIA 4CNYA 3C3LA 2UXDF 5T7LB 1VQ6S 1NH7A 3PNIA 3ZZOA 3BSCA 1UWBB 2DD8S 2RDJA 2KG1A 2VBXA 4QIGA 4I6YA 4ECVA 4ES2A 2DR5A 1FTRA 1E6YA 4WKYA 4Z37A 4H4MB 2XMJA 4XDCA 2XHWA 1CG2A 4OX7A 2XNRA 3V6DA 3I0SA 3QLHA 4I2QA 5T41A 4LQ3A 3T1YF 1KFDA 2UXBF 2LEAA 1Q53A 2LQBA 4YDDB 4ZCKA 4QU7A 4M63A 4OX8A 3U1NA 1U8SA 2AP6A 3FMBA 3IS9A 1NZAA 3TAMB 1S6QA 3NCRA 3OFEA 1DJ0A 3R1LA 5I42A 4BWMA 4RBVA 4RW8B 2N4CA 3M8RA 2BBEA 4NXNF 4ZPDA 1TKTB 4ZHRA 1QVGR 3KYLA 4IRDA 2XCPA 1VC6A 4NLDA 4DQIA 5C42A 1WHXA 5DQIA 1UMJA 1FD2A 2ROEA 4PQAA 5CH7B 3FSYA 4EBEA 3MM5A 4M5DA 4KBIA 2MSSA 1HBMB 4OZJA 1GAOA 4L3NA 3BQ0A 1BQNA 1JLGB 4TY9A 4NA2A 4OHVA 1GXTA 2PI4A 2CPXA 1X9SA 2UVRA 5I3PA 2OPQA 3HPOA 5G4DA 1B0PA 3GYNA 4Y2CA 5L1LA 1N5QA 2KRRA 1C0UB 2RF2A 2YKOA 2R7QA 3KG1A 2M88A 2V4JA 5LSOA 1T3NA 2CPYA 2J9CA 3CDEA 4ZPBA 5EX0A 1O51A 3IC1A 3PXGa 2RUGA 1VK8A 3U27A 3CUNA 2I1RA 3UDLA 4KHMA 3DM2A 1R7IA 3CJ0A 2JX2A 3CCSS 5D3GA 1KR4A 4DN0A 2CQ3A 3I31A 2UUCF 1L3UA 3ZFVA 3MPVA 5AE3A 1X4FA 2G13A 3O2IA 2ZE2A 2EFGA 1BY9A 3M8PA 1YIJS 4B3OA 1TVRB 4ECRA 2WB1D 3DRSB 1SJQA 1HA1A 1DTQA 2MKCA 3PFEA 4EUVA 2MGZB 3CCVS 2E9TA 5DGAA 1RT3B 1VQMS 4DUYF 1B0TA 3W2WB 4KC5A 2KM8B 1JMTA 5A8KB 2M70A 2PIIA 3MI7X 4RWXA 4MYUA 2FY1A 2DH7A 2OIHA 3HHLD 2J0SD 2CPZA 1D9AA 2HG4A 2D3UA 3RTVA 4N5SA 2WSEC 3C46A 3NL0A 3HHNB 1GNKA 3M2RA 1FESA 2ZFHA 3UR0A 1C1CA 2HRUA 1X5TA 4C8NA 2AYBA 3WBZA 2K8GA 2QO3A 3V81A 2XZWA 3M6VA 2HZCA 3MEKA 1LWCA 2KHCA 2GNKA 1U09A 2NREA 3NCPA 1TKXA 1VIOA 1FRIA 1RTJB 4KR0B 1X7VA 4WU2A 4U7UK 4HVZA 4XPCA 2E5HA 2LLZA 1LWFA 2Z2LA 5I3UA 3CO9A 1TV6B 4DLEA 2ZH3A 1IBKF 1LXJA 3BGRA 2B9XA 4DL2A 4I4BA 4KO0A 5HP1A 1U1PA 2GA7A 1YJUA 3RRKA 4JV1A 2JLGA 3M8QA 4O3NA 1U1OA 1LW2B 1QAYA 1VMBA 1CVJA 1Y5LB 1U25A 4OI0A 5H9EJ 4Y2IA 1FA0A 4HDHA 5HMYA 3JSRA 5THWA 4C9DA 3HZGA 1YBAA 4PG7A 2YNGB 1S9GB 3IS9B 2IVFB 1FKOA 1DURA 4HHJA 4NLYA 5IXUA 3K59A 3LH2S 3PO4A 1PGZA 5DDRC 3KOAA 7FD1A 2JLEA 2KT5A 4O4GA 1WNEA 2ZZNA 4CQ1A 4ZHRB 2AJ0A 3P49B 1E6VA 4EBCA 2EK1A 1IBMF 2EKYA 4OLOA 4Y3CA 2HWTA 3R3TA 5IFMA 1YQHA 1UVMA 4ECXA 1DQAA 4U9RA 2WSCC 3H5XA 4YOEA 1HNXF 2WRMA 1WELA 2ZKTA 1GQEA 4MJKA 4B9NA 3QAEA 2W9BA 2NUUG 1R0AA 1K9MT 1Z1ZA 1NHUA 2ZNZA 4F2SA 2CPEA 4K4YA 1BQNB 4J9RA 2ZD1A 1KQGB 2HVZA 3OSNA 3KLEB 2LA6A 2BW2A 1LFPA 4GMKA 1H6KX 2F40A 2DNQA 5F8MA 2IJFA 1SJ1A 2OPQB 3DMJA 1CEZA 2DITA 4JV0A 1CPZA 3BGFA 2V94A 2C3UA 3OJUA 2HHUA 2W8KA 2XGQA 3GIIA 5DG7A 4F26A 4IOAQ 1JKHB 4MYTA 3TANA 4K0KF 4HT5A 2DH9A 2LKZA 2HWIA 3CCMS 4DG1A 3M1VA 3VZIA 2OTJS 4TLQA 3N01A 5HMZA 2UVUA 3UD3P 2LA4A 1VC5A 4BWJA 2F8EX 1A6LA 4F25A 3M8PB 4B3OB 2XG8A 2W9CA 3AJ1A 2M4MA 1VQOS 4UQTA 1Q81T