4IOFD

Crystal structure analysis of fab-bound human insulin degrading enzyme (ide)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
199
Chain Sequence
MTQSPSSLSASVGDRVTITCRAVSSAVAWYQQKPGKAPKLLIYSTSSLYSGVPSRFSGSRSTDFTLTISSLQPEDFATYYCQQSSPSFLITFGQGTKVEIKRTVAAPSVFIFPPSDSQLKSASVVCLLNNFYPREAKVQWKALSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational states and recognition of amyloidogenic peptides of human insulin-degrading enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Insulin-degrading enzyme
total genus 38
structure length 199
sequence length 209
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4iofD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4iofD01
4JJ5B 4TVPE 1P84J 2XNAB 2BHUA 4LNVA 4CMHB 4UT7L 5IQ7L 4L4VD 4OD2B 4Y4HB 5TQ2H 1V7NL 3VXMB 2QADB 4KZDH 1I8KA 1MI5A 2L4OA 1LP9E 1A6TB 4X4XA 1ZSDB 3WNLA 5JORB 1R24A 4FN0A 2ED9A 3AMKA 1CN4A 4DEPB 1FYTB 2A6JB 3QEUA 1P7QA 3VD4A 4DW2H 1YDPA 4JKWA 3EOBA 4KRPB 3PWNA 2AKRA 3RZCD 2CJUL 4RZCB 3VXSE 2DQFA 2DL2A 3QIWA 4JO3H 4YHKL 5DHVA 5DD0L 4KVNL 2XTJC 1CLYH 3UC0H 4MA1B 2AJYH 5FB8B 2ADGA 4P5TD 1DQDH 5D1ZA 3NZHH 4GSDH 5CJQH 4W70A 3DURA 1ZA3B 5FUOL 4LCUA 5IMOA 4CVXB 4PJXF 4ZXBA 4JCLA 4RGOL 1DVFD 4J4PC 2B39A 5ICXB 5DT1H 1FVCA 1F58L 3DX8B 4Q6IC 4ZNEE 4MLIA 2X4PB 5GGRY 4XGZA 2R8SH 1FFPA 1CVSC 2EIDA 4RCAA 3DGCR 3QWOA 4DW2L 1FLRH 3FT2A 1BIIA 1BFOB 3HNVL 3F5WB 3PWPB 1OAXL 4GAGL 3JWOC 3Q5OA 4WHYG 1NDGA 5F8RC 4FQ2L 4XP1H 3CJJA 4AIOA 1EZVX 1UM4L 5EC2B 4R26L 4Y5YC 4GMSH 4FTVA 2FATH 4P59L 1FL5A 2JK5A 2W60B 4JO4H 4Y1AB 3T0XA 3UAJC 5I1JH 1LDPL 5FYJU 3RUGA 1IAII 3I9GH 2HLAA 3KPRB 3CC5A 1MHCB 5H37G 2VLRB 2X05A 2OK0L 1V7ML 1A22B 3LD8C 4TNWF 4HCRH 1J8HB 3Q3GB 4WFFD 4M7KL 2ZUTA 2WQ8A 4LRIA 2C1OA 4O4YL 4QHLA 3HI1A 3L3GA 1QSZA 1KTRL 1PKQE 1WZMA 3ZTNL 1Z9OA 4JQIH 3UTOA 4HFUL 4HKXB 1RVFH 3JUZA 2E6PA 4OCXH 1IAOB 3BIKA 3O6LH 3A6BL 2MQ0A 5BVPH 1RJZB 4MCYB 5E6ID 5ABDE 5C0AE 1JNHB 1UZ6E 4AG4L 2B1AL 1MCFA 2VH5H 2H32H 5I9QB 3VH8B 1U2HA 3NA4A 5D7LD 1MREH 5HHPB 3OSKA 4ELMA 3VXSB 1YEKL 3MGOB 2BNRE 2BP3A 2FGZA 1B9ZA 1NAMB 1JTPA 3EZJB 3ETBF 4UU9A 1OGTA 1MSPA 1YN6B 4OLZH 3N06B 5FO9B 1S9KC 5C07E 1KPUA 1AQKH 4XVSL 4MHHI 3EYFB 2CD0A 3FFCD 5F8QC 4PJDF 4J3TA 4L3AA 4U7SA 5D1XB 4U1LB 2F8XC 2HLFD 4K8RL 2E6JA 1W72A 2NXZB 3W39A 2Q86A 2DM4A 2DLTA 3WN5B 4RQQA 1W8OA 1U8LB 5KW9L 3EJYD 1J8HA 5M94B 3LRHA 3B9DA 1LO4L 3GSNH 4DKFL 3C09B 1XCTB 3HKFA 2Y72A 4LDLB 2XRAL 1EEZA 2ARJA 2EDHA 2IQAA 2BY3A 2OX5A 5IW1B 4LSDA 2F74A 4W4OA 2ITDB 2Q6WA 3X11A 1YY8B 5J6HA 4K2UH 4XMLH 4L8SC 3VGBA 4C56E 3LY6A 2CSPA 1OT2A 4JFFA 4JDTH 2BNUB 5JR1L 1EHNA 2DBLH 4CADA 5C70A 2BXYA 3QDME 3ARWA 3CCHA 1GOGA 1P9MA 2AK1L 4WWID 4PB9L 4P4KD 5I76A 5DEZA 1DLFH 1HQ4A 5IBUG 4UILL 3SGJA 4BELD 3VMPA 1UG9A 1J1OH 1J8HE 1IC7H 3EO9H 3F7RA 4HIEA 4JFHD 4XNZB 4QRQB 3B2UD 3F58H 1ZHLB 1OGTB 4I3RL 3D18A 3O3DB 2CRIA 3KLSA 2ZG3A 4EI5B 4GG6F 4LVHC 2AS5M 3P11L 1LK2A 5EU6D 3T3PF 1CIDA 3RAJL 4Z95L 5IMMA 1LO5A 4N5UA 5E6IB 2BMKA 3JVGC 1CD1B 1DQLH 3VFGH 2DQCL 2VDPH 2QSVA 2V2WB 3K4ZA 4JM2C 1FVCB 3DX8A 4NHUB 3SCMB 4WEBL 1KGCD 2FJGB 1G7LB 4U1GB 5HHOD 1BOGA 2EEDA 5TDNA 5TGBB 3UTTE 3WUWG 1QKZL 3ARUA 3S4SG 1KJMA 4ZFOB 4UNVA 5I19L 3JWDL 3MO1A 2QHRH 4HDIA 4XPFH 5F9JA 3WFDH 4NC2B 1T6VN 1ZGLA 2ADIB 4F3FA 3V7AE 4JO3L 3QCTL 3QUZB 4YHKH 4DTGH 1MCRA 4BQ6A 2FIKA 3EOTL 2DQDH 4CVUA 1WC7A 1YYLH 1TJIH 3LKNB 1FL5B 2JK5B 2W60A 3PNWA 3HE7A 3BZEB 3RX8A 2GSGB 3VFMA 3WMSA 2Q7NA 4LCYB 1I7UA 2X7LA 4WU7B 5F7KC 5T3ZE 4HEME 1I1YA 3QHTC 1DQJB 5TF1H 3QIUC 3O3BA 3IDXH 25C8L 1JTTA 4YBLB 2GKIA 4TUOA 1AJ7H 3I50L 2OP4H 2DI7A 3PWLB 1T66D 3D5OF 1WTLA 1QSFA 2F54E 1GGBL 5E94A 3NN8A 3U2SA 4OGYH 3KVQA 4LCWD 2XY1A 3F58L 5FDWB 1A6VL 1CDIA 5FHAL 3ZSSA 3SCMA 2O5ZL 4R0LC 2ZSVB 1F4XH 5FCUH 1DN2A 1UB5B 3UX9B 2BVPA 4ONHA 1T1WB 1D9KB 4L4TB 3T4AB 1JHKH 4OBRA 2GJZA 1H8NA 3DTXA 3V0VB 1NC4B 3BP4B 3ARBB 4YUEH 2M2DA 3C60A 5FA4A 3V6OC 4K8RD 2YD1A 2E9WA 5CKAA 2VMFA 5ESAA 2B4CH 4G6AD 2SEBB 2N4IA 5DHVH 5ADOL 1S7QB 2XZCL 3HE7B 4G6JH 5B38B 4GRLA 4KK9D 4FQ1H 1P4LB 3O6FC 1QZ1A 3ZSTA 2DL9A 1UXSB 4FZEH 4XX1E 1FRGH 2CUMA 2DWDB 5HJ3B 1ZANL 1MF2H 3G5VA 4FRWA 4X9IA 4TUOB 3H9SB 4X7DC 1RFDH 3GB7A 2H26B 1Z2KA 5MENA 2CLZA 1B3JA 2H45A 2X1XR 1MCOL 1QLEL 1KLFA 2VL4A 1MCEA 1BOYA 3Q1SH 4ETQA 4LEOB 1EEQA 1IGCL 4MNGB 1MOEA 1GCFA 3QXVA 4PRIB 4ALAL 3QISA 4PY8J 5FDYA 1UWGH 1JPST 3P4MA 1Q9OB 3KNBA 5FM5M 5GQBA 4CU7A 2BNUA 1QYGL 3W0WD 3PWJB 3DLQR 3L7FA 3BSZL 5J12C 3QUXD 1T21A 3C6SB 1JPTH 1BM3H 3MV7B 2EXYD 3RY5A 2Y36L 1LNUA 2XA8H 4D9RD 5CD3B 4NSKA 3WS6A 3ZDYE 4GRWF 4ENED 4KRNA 2GT9B 4QKXB 2VTFA 5HD8D 4MXWH 1N5AA 5LG1A 3RX5A 2GJ6B 3DRTA 4RAVA 2W0FB 1T1ZB 4X80H 1BZ7B 4X7CC 1U8JB 4M6NL 3SDCA 3V7AG 4I0KA 3E0GA 1IFHL 2NTFA 2XKNB 3FZUC 5E00B 4HWBL 4BK4A 4PJ9B 3GBNH 2JLLA 1VPOL 4X7TB 2Q20A 3K80A 2APVA 3NFNB 1OCWL 2UZXB 4PJIE 1QLFB 1VA9A 3D39B 4MD0A 1U8IA 2M26A 3V0WL 4GKZA 3TP4A 4HMDA 4OD2A 4Y4HA 3LRSB 5BS0B 3QZWG 2FR4B 1RIVH 4ZO7A 2ERJC 3C5JB 4JAMB 5MEPA 4X7FC 3OZ9H 4KKAD 2I60L 3VFUB 4F9LC 1R3HA 3TBVA 4PRPB 2BRRL 4U1JA 1XF2A 4X8XA 1QLEH 5EO1A 4XC1L 5E2UH 2VZ3A 3QAZC 5GGSA 2H6PB 5IVXB 3H3KA 3G08A 3CD4A 5L2KB 3S36H 1RMFL 5ISZB 5A43C 4KJQC 4F9LA 1TQCB 3QUYD 4XPGH 4KVCL 2OTWB 3DV4B 2JIXA 1CBVH 4KMQA 5T1KD 4F7TA 2J6EL 4J7RA 2EH8H 2NX5A 4WI3A 2HT4D 5KN5B 1ZA3A 5DEGB 3DMMB 3BP6A 5C0AB 4Y2DA 5E94B 1CFNA 5HHQB 3K8MA 3BKML 2DB8A 4XZUA 2XT1B 2EYSB 5FECA 3WNKA 4MAYB 4Y5XC 1KXQE 1YMMB 1K5NB 1RSFA 3JWDH 4NWUH 3C5ZB 2AJ3B 4NQDA 4HLZH 4D3CH 3DUHA 3ZDZE 4IOIA 5E8PB 5FK9B 1NJ9B 4GAJL 3D69B 2MNUA 2P8MA 1KF9B 3MLZL 3RWCB 4HXBH 4X7SL 5HYSA 1P7KB 4XGZB 1TJHH 1LVEA 1XF3A 3NBNA 1UJTA 1HN1A 5DS8B 5FO7A 3V2AR 5F1NB 2IALA 5EG6C 3VXOA 5DGRA 2ARJQ 4MQSB 4S1QH 4R3SB 4LAQH 5J4MA 2Y4SA 3CGTA 3PGFL 2NR6D 1QRNB 1I9JH 4OKDA 1XF5B 5FYJE 1I1FA 2NQCA 1MUJB 1FZMA 5DK3A 2N7AA 1F4XL 5FCUL 4JFDE 1ROWA 1G7JB 2XN9B 4LPCA 3LDBC 5D7LE 3WJJA 4LSRH 1C5BH 3MROA 3GDBA 3TT1H 3GI9L 5CZVH 1BMGA 4CU8A 4RGMC 3I75B 4OQ1A 3JXAA 2W9DL 4OKVA 3HAEA 2B5IB 4KAQL 3OKYA 1FVEA 3V95A 1P5UA 2GUOA 1TENA 2H41A 4O9HL 3BPNC 3ULSB 4YE4L 1K4CA 2Q3ZA 3FQTB 3FFCE 1ZWIB 4JN2A 5IM7B 1T4KA 3H0TA 1FG2A 1LO4H 4YDIH 4JRYA 2FL5B 2XN9D 1UVQB 2QSCH 4YHNB 5EOCL 4OIAA 4LAQL 3BRGC 1N7MH 1BWWA 3ULVD 2XG4A 1MRFL 3MYZA 4Y16C 1PYWB 2WLZA 3WL9A 4U6YA 4YPGB 1XGQA 3S96B 1TQBC 2BSTB 5BV7L 1P7QD 1T7ZA 4XBEL 2VDMH 5F9AC 4P23D 3TN0B 5CZXD 1CFSA 5GGVL 4Q9RH 3LEYH 1N3NB 1IEBB 5BO1L 1O0VA 2NTSP 1U8LA 4JCMA 1J1OL 1IBGL 2PTTB 4DGIH 3UO1H 2R0ZL 4JFQB 2R23A 3MRJB 3L6FB 4DGYH 4X4MA 3RGVD 4F7PB 1J0KA 3X11B 3LKPA 1YQ2A 2X70B 2D2OA 4C57C 3EDKA 5MEPB 5HDLA 3GBML 4XNXL 2WWMD 5T1MA 4GT7A 4NN5B 4EDWL 5JLZB 4XWGL 4CADB 4ISVB 1VEOA 4OFVA 4JY6A 4TSCL 4OZGE 3TPUA 1AGDA 5C3TA 5HHXL 3MRDA 4XPBL 2FO4B 4UILH 5TE4L 5DMJB 3FCTB 2ITCB 2NZ9D 1A6UL 3D3VE 4WFFE 4AEHH 3KPMA 4OFDA 1MRCL 3M8OH 2JJTC 3DX9A 5LBSL 4KDVA 1EBAA 3ILPA 2SEBA 2CIKA 5C09D 1PG7H 3DMMA 1OAYH 1MJ8L 2C3VA 1G7MA 4MJIE 2QJDA 1EGJH 1O7SA 5B8CC 6FABH 3VG9B 3REVA 4XCYA 3O3EA 4X7EC 4OAWB 1CICA 1TVHB 3GO1H 4GKNB 4Q9RL 5I1GH 4N8CH 3VW3L 1KJ3L 1T3FB 5C0JA 4H8WL 1ZLWK 1JMZA 3WFZA 1DBAH 4GLRI 3QQ4A 3K8LA 4PREA 4QHKJ 3HFMH 1NQBA 5IB1B 1MCQA 2XFXB 1IM9D 4PS4L 3C6LB 4UOW1 4PJHB 1ZE3C 3E6HA 1HZHL 3QUZA 2WM0A 3MRCA 3WV0A 1Q9WB 3KJ4C 2PNDA 4M5YL 2GJJA 1W72L 3ULUF 4LDOB 5E7BA 1YNLL 3FN9A 5E4EB 5CUSH 3X17A 1QQDA 3WIIL 1PDKA 1JHKL 1XCQB 3HZMB 5ITBH 4ZSOA 1I1YB 1TZGH 3B3IA 1IL1B 5ADPL 2YD4A 2D0FA 1PKQA 4ODTL 3QQ9D 2BHZA 4UTBH 3M17B 5AWNH 3C87A 1CL7L 4PJCF 3ORJA 3VDCA 2Q76B 1C1EL 5DJYB 4PJFF 5HPOA 3ILQC 3VG0H 4GG8A 5F9OH 1BWMA 3MZGB 4KKBC 5IEHA 3FFCA 2R4SL 1R5IA 5SWZB 5JW4Q 5DFVD 4M1GL 2NY4D 3O3EB 5B3NA 2UZIH 5F7DB 3SBWA 1S9XA 3H3PH 1A5FL 3G6DH 1T66C 1FP5A 1MCSA 3SE3A 1SJEB 2MWCA 1UCBH 3EIFA 4OZGB 2P7TA 3BVNB 4Z7VF 2E5EA 5IT2L 1RUPH 2GJZB 4OJFH 4PP1C 4ZTPH 4M4RA 3ARYA 5HDQH 5IJVB 4IOFC 1T03H 3MRRB 5KSVB 1HH6A 1R5WA 3MRFB 4AH2B 4JM4L 4M48L 1PLGH 3G6JA 5HYSG 4F7MA 1MJUL 2IANA 2XWTB 1J11A 1F42A 3G04B 3SE4C 4K3EL 1MFBL 3CDGB 4V1DE 3MCG1 5DC4B 1PBYA 4WIQA 1KGCE 5D7SH 3SDDA 4D9LL 1VFUA 5JNYA 1BIHA 4G5ZL 4BQ8A 3NFSL 1MHCA 3ELAT 2UZIL 3LOWA 4WWKD 1NH6A 4XXCC 3QNXB 4WW1A 3VXME 2JJVA 1YY9C 2ICWI 4UDTB 3TYGL 1E4JA 3NH7L 1QRND 1NFDE 4KGLA 2YKLH 4P2CG 4U6HB 3TJEL 1PQZA 3ARVA 1FYTE 2I07A 1LWRA 5E6YA 4QTHA 1UZ8A 2WMPA 2BMKB 3B4NA 3ARRA 3WNNA 1S7RA 5GSRA 2X1PA 1JNLL 2G2RA 5ACLA 3IKKA 1OTTD 4YGVB 2FGWL 1K5NA 1JRHH 1I8IA 2EXWD 3Q6GL 3RP1A 4F7CA 2A0LD 5T3ZD 1T7XA 2NY6B 3DI2B 5FUOH 3RWFB 5GRXG 5HHPA 2X4NB 4U1IA 3U0TB 3VWKB 5D7JB 4YWGL 3A6CH 3KYMB 4GRWB 1CXIA 4UDUB 3FB5A 4DUVA 4IRJB 3BPNB 5IJVA 4NKIH 3G5XA 5CHNB 1BQLL 5DVOA 3V79C 3UPRB 4J1UA 5C0CB 1UWXK 1Q94B 1QLRB 3B43A 5DHYA 4MAYC 1Q9LA 4H20H 3KWWB 5E5UB 2A74A 1OP3H 3NPSC 2NX5D 25C8H 4FS0A 4JFDB 1I75A 5A3ID 2ENYA 3LVEA 3EYUH 4AT6B 5JW5A 1KFAL 3PQYE 2HTKC 1CXHA 4OZFB 4MD4B 4MA8L 2VDNH 5C0JB 3ES6A 3UYOD 4OCRL 1EERB 4EEEA 2OR8A 3LN4B 5HI5D 1IC4L 4OM0L 4GBXA 3HMXL 4OM1H 2E7BA 1D6EA 4FQIL 4YXLL 4FQLL 4HUWB 1FC1A 3WN5A 2CRZA 1Y0LA 5IHUL 2I24N 1DSFH 5TDOB 2VLKB 4HCRA 3ULUC 3DRQB 4D0DA 1Q1JH 2VSCA 3QIUD 5GIRA 1BFSA 1A7NH 2HTLC 4U2YA 4J2XA 1J9CT 1T1YA 3GMOA 3K2MC 2AJSH 2XKSA 1TETL 4M4PA 5GGTH 4KZEH 5JDJA 5C07B 4XP9H 2YWYA 3BE1L 1KN4L 3TNMA 1B4RA 1W0YT 5CINH 3CIQA 4ZFZA 1ND0A 1VKXA 3C60D 1IGIH 3RKDC 5FEBA 1T5WA 1HEZB 4ODBD 3N1PC 1RV6X 3QI9C 2PXYC 3B8YA 4JREC 1SYVB 3RWEB 2FD6H 1A7RH 3JWDC 5K9QG 4NO0D 1JGEA 4UUJA 4RMVA 4CN6A 4NZDA 1TZHA 4OB5L 4PJ7A 4N8VG 2H3NB 1I9JL 2VLLB 2VUOA 2XZCH 5T3XD 3VG9C 3LQMA 5C2BL 1M05B 5J56B 4HXAL 2V7NB 4NQVB 4O58L 5DURB 5FYLH 4BZ2L 3V52L 4HUVB 3MA7A 4I18A 3NVQA 2GK0A 3B9KD 4Y5VC 1AY1H 3KJ6H 3I2CL 5TPWL 2LU7A 4AEFA 1JYWA 3VGAB 2DLFL 1L7TH 1LP9B 1UT9A 2BOCA 5CJXA 3TO4B 2VZVA 5KJRH 2HMID 3IFNH 3DGGA 4U49A 5EU5B 4MNQA 3O4LE 4H8WC 4NCDA 1OARL 3VXMA 2AXJA 1BD2A 2HH0L 3RY6C 1FE8L 4N68A 3KAAA 3H7LA 4FXGB 4ZNEA 1CR9H 2HVKB 4HAGA 5E1AB 4PJIB 3B83A 5CILL 3IFLH 3GJFA 5E08H 4HS3A 1PQZB 4GOSA 4MDIB 3SY0A 1DN0B 4V1DD 5B38G 1U3JA 3T1WA 1KN4H 4KK5C 3HZVB 3QDGB 5ANMB 1MPAH 1P4IH 2CR6A 5E24E 1NCCL 4ENEC 1CICB 1TZHB 3WXVH 5F21B 1X5YA 5DTFB 1YYLL 4GKZB 1BFOA 3VWKA 3OAUL 1FYTD 3QCTH 4DTGL 3AGVA 4XC1H 4MJIB 2GUOB 5KVEH 1A7BA 2BC4B 1X4ZA 1WQVT 1ZHKA 4RRPA 3D39E 5DO2D 1B6DA 2I5YL 3O0RL 2CLVB 5F88B 2I60H 3MUY1 2Z8VC 4LCIH 2F5AL 3FN3A 3BPOC 1UVQA 4CRPA 4ZUSA 4HWEL 1I9RL 4MD5A 1M7DA 1EO8L 4Y16D 3Q2CA 5T5NG 2EEBA 3IFPA 4U33A 3VFPB 4XNQA 1RZ8B 4K23L 1ZT1A 2FSEB 1S7UB 3RL1A 4CNIA 2K1MA 5HYEA 2NY2D 4LFHG 1PSKH 3CVHL 5IVZB 3LKOA 3EFDH 2YA1A 1X5IA 1J1XL 4KUCD 4AIZB 3O41B 1D5MA 1RAMA 2O5ZH 4Z7WB 1DEEA 2VLJD 1CLOH 3QB7C 3WS6C 4FQJL 5BVJB 4M00A 2QKIA 3HNSL 5DRXA 1S7WB 2BY0A 4P2QA 4LFHD 2Q8AL 4PJXB 3QUZD 2OSLB 2NPLX 4R4BB 4Z7NF 2VZUA 4M7JH 4H8WH 1N59B 4PRIE 4URTB 1AD0B 2NY0B 2BSSB 2NY6D 3MCLL 5F7NC 3QDHA 2F19H 4R7NA 1KEGL 5HHOB 4AM0B 5ERWA 3U7AA 5DD3H 1FHGA 2WP3T 4X6DF 1WZLA 2Y5TA 1F11A 4P9ML 1DQDL 4U6TA 3GI9H 1WBYA 1YMMD 4HBCL 1B2WH 2H1PH 1KN2H 3K1KC 1E4WH 3ARGD 4XVJH 3IFPB 2C4XA 1T2JA 4HWBA 4OAWA 4YUEL 3IGAB 4LPVA 3HC3H 4JFFE 2GCYB 5EBLB 1TJGL 4LQFH 3TJHD 2D03H 5E9DA 1SQ2N 3TV3L 1Z9MA 1GGCH 3CMGA 1NL0H 2F74B 4HUVA 3MJGX 4R90L 4O02H 1P9MC 3O2WL 2N7BA 3ZE2E 1JTOA 2ARWA 2P5EB 3RWDB 1Q9WA 3QRGL 1D5ZB 4NGHL 4KHTH 2NCMA 4KAQH 4MJ5A 4HX1A 4Z77A 2IQAB 4OM0H 1LE5B 5DJ6B 2D9CA 3BUTA 1N6QL 3SKMA 2HWZH 1T0MA 4IRJD 2AERT 5CINL 4Z18A 4TTGA 5TF1L 4PFEA 1CF8L 4S0SD 3O11A 1A6AB 1HHJB 1CGVA 1QBLL 4NKDA 4F2MB 2EECA 2C3XA 3PQYB 3SGKC 1JZ2A 1A7NL 4X6CF 5IB3B 5I71C 1NMAL 3N1QC 1M71A 1BGXH 1TCRA 1MEXH 3QQ9C 2MHAA 1KIPB 1UCBL 4WJ5B 5E2VL 4ZUTB 1GIGH 2YD9A 1RY7B 1QEWB 2VWEE 5J7CC 1JV5A 1NCAL 1WITA 4U05A 4I0PB 5J11B 4LF3B 1H15B 2R9HC 2UWEB 1WZKA 3O81A 5IEHB 1J5OL 4QWWD 2FLBT 4QRTA 4IJ3B 3TBSA 3R0NA 5T33L 1T7VA 5T5NF 1QTYT 4I5BA 1ZXQA 4S1SH 2FEEL 3IAGC 2GYSA 4N9OB 1HQRA 2D9QB 3LRGA 4GAYB 4P23B 1PW3A 4Z77B 5J89A 2W0KA 3OHXA 3D6GA 3S98A 3LEVL 4KJWC 5I8EA 1OB1A 3VFNA 3EJYC 4O02L 1NGPL 4JFZL 1NMBH 4ELMF 2GITB 4POYA 1H5BA 3EKCA 3EDEA 4P0DA 1OTSC 5MHSD 1S7UA 3UJIL 5IEKB 1G6VK 4JPIB 5HDBF 1GSMA 4X0KA 4OD1H 4R96A 3HC0B 3LQAL 1NGWB 1VFBB 1BPVA 2CR3A 3U9PH 4JFED 3U2SB 3FT3A 4OKVB 1M7IB 4OLVL 3IFLL 2Y06L 4JHBA 2FH6A 1LHZA 2IMNA 4UDTA 3UTSE 1XIWC 3EYUL 4FP8H 5BMFH 4GAJH 5J1SC 5J1TC 4YFDB 1HKLH 4KTEH 3GKWH 5E5RB 3BKCH 4QF1A 3ZO0A 3KLDA 2OTUA 3QDJE 4DKFH 1IARB 4C83A 4HIXH 3S5LG 2QQLH 4C54A 3PQYD 4G7YH 4ZPVA 4UNTA 4LEXH 4PJHA 5E7FA 4Y4KC 2VXVH 4D8PB 5CUSL 2XXMB 1GRWA 2ENSA 3S5LA 3R06A 1UWGL 1MFCL 1D9KA 1NSNL 4FTVB 5CGYD 3TEUA 1CFBA 3CFDA 4C59B 1ZT7B 3UYRH 4HWBH 5C0DB 3QEHA 2VLRE 4OFIA 4UIKH 1CL7H 4X6DA 5F93C 5A2FA 4HPOH 3PJSA 3DXAB 4MAYD 3O3DA 4R0LB 4U1KA 2R39A 2D31B 1NLDL 2IH1B 4LBEB 3ROOB 3WIFA 2APBA 2E7MA 3SOBH 3QG6A 1TDQA 1XGQB 3VMOA 3LEVH 1LK2B 2LAAA 4CMHC 4ZAKA 4QRRD 5IT2H 5MENB 1NGWA 3JTTB 4GS7C 4UOJA 4XRCA 2CDGB 5HGHA 4ZQKA 4HK0A 4QXUL 4YGAB 4ZYKA 4XAKE 1KV3A 4JFQA 4JFFD 2PYFA 2R4SH 1PLGL 4LLUA 3ZYZA 1SJEA 3ZE2F 5I75C 4KDWA 3TESA 3MO1B 3NPSB 1I7RB 5IQ9A 1IQDB 4O4YH 3KS0H 3RTQD 3S3PA 3VXMD 3R8QA 2ADIA 1RIUL 4XXDB 4HBCH 4P99A 1GHFL 3GGWA 5T1MB 3K2UH 1IGYB 1X5AA 3IDNA 1T7YA 3IJYA 3RVTC 1FNFA 2OL3B 4P9MH 1QA9A 3U46A 1NCWH 5T3XE 4PUBH 15C8H 3JWOH 1GC1L 2IEPA 2BRRH 3VXSA 1Q0XH 2CUHA 2ZZUT 3EYSH 1OPGH 1Q38A 3U7WL 2OL3H 1NCBH 1FV1A 4UQ2A 1LEIB 3VXRD 3H9HB 1HH9B 5I2IA 4N0UE 4OFYA 4MXVF 1OP9A 4BH8B 1CFVL 4M43L 2FBOJ 2GFBA 4WO4D 4JQIL 1I3RB 2AEQH 4LF3A 2BRQA 1NFDA 2EE9A 5FYJL 3GM8A 2KQNA 5JW4N 3DHMA 1UZ6F 3DUUB 2GIYA 4K8RC 4TOYL 1NGQH 4XPAH 1LGVA 3L1OH 2NY1C 8FABA 3BZDA 5KVDL 1KCRH 2IBZX 4X6CA 3A67L 4UT9H 5C1MB 5E8DL 4OLYH 2B0SL 1HQRB 1ZKAA 4ZTOL 5H35A 5FHAH 5BOPA 1VEMA 5GRVL 2VDLL 5IW1A 2FO1A 5IQ9B 1MCPH 4KGJA 1FGNH 3MLWL 5MI0C 5IVXE 4KROB 5D7IE 2VITA 1U9KA 2YK1L 3BO8B 5J9PB 5DD0H 4G42A 1LO3L 5C08B 2OL3A 3ESUF 2E27L 5DF0A 3KGRA 2FZ3A 2V5MA 4M5ZL 4O2CA 3HC0A 2CUIA 1NCAH 1FFNA 4XAWL 4KQ4L 1RIUH 1CXEA 4GFTB 3BQUA 3RU8L 4GKSB 2VLRA 3QUXC 4X6BA 4PGEB 5HSFA 4LNRB 5EORL 4ZUVA 4A6YH 3KLAA 2OTPA 3LCYA 3SCMD 2BNQA 5EA0L 4MB5A 2A6DB 4Q6YA 3ZDXF 2BCKB 2ZG1A 4P2QD 2NXYC 4KVNH 2R4RL 4JLRB 4OT1L 4KK5D 4MSWB 3ROLA 1OAYL 5L2KD 3VRIB 4RWYL 2V17H 2K3TA 3W82A 5MEOB 4YHIA 4HFWA 1Z6JT 3LZFL 5HI3C 4MNHB 1YPZF 2D0GA 3BUYA 2W59A 4D8PA 4XCNA 1C16B 1LDSA 4RDQF 4X4YB 1S9VB 4PGJA 1NC4D 3CX5J 4YXKH 4L8CB 2NNAB 4IOIB 5E8PA 5H35B 5JHDE 4D0DB 4XXCA 2W9LA 1JZ5A 5EOCJ 1U6AL 4K7PX 4LCCC 1M1SA 1KLUA 4GW4A 2D4DA 4FQLH 4K7FA 4HPYL 1ZLUK 2AV7B 3H42L 3IJSB 3DO3A 5AZEH 1ZLUH 1MIML 3RPIA 3BZ4A 4OD1L 1M6OB 1MCPL 1R3KA 3U6RA 4WUKL 1U92A 1MCKA 4Q9BA 1HDMA 1IBGH 3O11B 1ETZA 3MODL 1JNJA 5I17A 3UYPA 4PRID 4YK4C 1TJIL 1FFNB 3MOAL 4H26A 2IGFL 2DJSA 4MXQC 4GUPB 5JPNA 4PG2A 5CP3A 1DUYA 5HI4D 1AFVL 2BVQB 1BJMA 2HYMA 1NUNB 1QLFA 3D39A 2FB4H 5IW6B 1HWHB 4KDTA 3MV9A 3W0WA 3ULSA 5EORH 5I19H 3OBAA 1J87A 5E5MB 2VLLA 1R3LA 3IETB 1IGTB 5I8CA 3QEGH 4IMKC 3U9PL 1RK1A 2FD6L 4LKXB 3DTXB 1BAFL 1UXWB 3QUMA 1UB6A 4JY5H 1UH3A 4IRJA 4XB8A 3FFDB 5HHNB 4PY7A 4YDVB 1UM5L 1J05B 1P4BH 4ODWB 5D2LE 1KJVA 3B5TA 4OCXL 1R3JA 2AK4E 2DLHA 1NANH 3LDBB 1WGOA 3GMNB 5H37H 4A6YA 2AJVH 4FQQB 4RMTA 2AV1B 5I8EB 3TCLA 3L3JA 5AAWA 3V0VA 3S8WA 5E1HB 1K3IA 4O2EA 1FFOA 3U4EA 3KPPB 4C58B 3D3VB 3DV4A 3QA3B 5ENWB 4AZ8A 3K81A 4HKJA 2L7UA 5KVGL 4FNLL 3WLWC 1X5JA 3AY4A 4HPOL 4J8RA 1KXTB 3RZCA 2FBJH 3EO1B 3V4UL 3E2HC 1KCLA 1AD9B 4UV7L 3TM6A 3MRHB 3MGTA 1SJXA 4U0RB 4G5ZH 4UT7H 5IQ7H 1PG7L 5FECB 2VL5A 4QT5B 1B6UA 2V5RA 3HPJA 4EQ3A 4FXLA 5DVKA 4Y89A 5FYKH 3QZWB 3MNZB 3AY4C 4UV4H 4X7SH 1FAIH 3D85D 4QF1B 3KPNA 5FUCC 4PJIF 4EI5C 1XGYL 2BZDA 1FN4A 4D3CL 15C8L 5HVGB 4IM8A 1FYTA 2A6JA 2DI8A 3FFDA 4RFNB 4K23H 2PXYA 1WC7B 2Z35A 1X5HA 4MXVE 1FLTX 2NY3D 1KJVB 2DS4A 2IH3A 5GIRB 4JG1H 3MV11 1JN6A 5FUZH 1L6ZA 3NCFB 2I5YH 3O0RH 5DMKA 5DZNA 4LVNB 5FO8B 4AEEA 4M5YH 5ETUB 4WU5A 5CIPH 5CWSA 3GMLB 4UUJB 3ILPB 2X10A 3BT2L 4N0YH 1EVUA 4ONGL 4L3EB 3T2OA 5DQDH 4K71B 2DOCA 4UQ3A 5D72H 4DZ8A 2IWGA 4ZUWA 5IHUH 3TBSB 3L5XH 3I3DA 4MHHG 2WP3O 4GKNA 5DJ0B 3MREA 5DR5H 3FONB 5TFSL 4XP9L 1EUUA 3UZVB 1YPZA 3OTTA 1BHGA 4PRPA 1IEHA 1N7ML 3H9YA 1L0XA 2HFGH 3OR7A 1V5JA 2VISB 4P4KB 3WFEH 1QQDB 1ZTXH 4LAJH 4Z7VB 3TA3C 4L8BA 5HYJA 5GGSY 1QFWI 1XR9A 3E6HB 3F7VB 2DTMH 4Q6IB 2Q8BL 2LE9A 5ISZA 1YNKH 4P46B 1F90L 1KYOJ 4DQOL 5HDQL 2J4WH 5JMRA 5E1AA 4KK6D 3CLEL 3OKOB 5DSCA 1A6ZB 4PPTA 5INCB 5EO1B 1ZOXA 1FZKA 4FQXA 4HUUB 5EN2A 3QDJD 1MFEH 4NN7C 2W07A 1S7XB 1MWAL 2DQTL 3I2CH 3VXTB 4ACPA 2MFNA 3V4VL 3V52H 3GSRA 5HBBA 4M8VA 4RGNB 3WDIA 4MQTB 1KJ2B 4UAOC 4HWZB 1EX0A 5EIIB 3L3IA 3EYQC 4UINH 5FOBA 3WFBH 1CD1A 3SJVA 4JFPA 2CKBH 1XIWD 1OQXA 1IVLA 3WUWB 1DBKL 4P5MB 2YD3A 4I4WA 1FO0L 3LN5B 3QAZB 4DGIL 4O5LH 3AB0C 5ALBH 3CSGA 1U8QB 3C6SA 4BK5A 2PYEA 4CVWA 3ARDA 3MRMB 1A4KB 3S36L 5SWZD 3VFTB 4ZFFB 4ZUSB 5K9OA 5I6XC 5L2JA 1D5BB 4I9WE 2R1XB 3CDCA 3NCJH 32C2B 3GMQB 2PW2B 3DXAA 5CILH 1N6QH 4PJCE 1HSBA 3UTQB 2PR4L 4G7VH 2KPNA 4UBDD 4HIIA 1SBSL 1FZKB 5IF0A 1UENA 1EFXB 3RGVA 4G9DB 2HH0H 4NO5A 4R3SA 2AXGA 3FQUA 3RBGA 3ULUE 1F6AA 4XB7A 3VJ6A 3B5HA 4APQA 4JKMA 4ZUTA 1FRGL 3EFFA 3RUGE 2BK8A 2XWJA 2OXGA 4M62H 5E6ZA 3MOAH 1WBXB 3GO1L 4RDQG 5I73B 4JLRA 3PF2A 2F15A 5J0BA 2AJYL 3CFKB 2Y6SC 5BXFB 4IIQC 4FXKB 1DBJL 1WT5A 4GAFB 5ILTH 5JZ7D 4MA8H 1AI1L 1NCCH 1C5DB 4ZD3L 4MCZB 3NZHL 5CJQL 4F7CB 3WL9B 5TH2A 1GC1H 1KELL 4S1RL 4X5LA 1JGVL 4I77H 3NIDF 3KYNA 1T4KB 1MAJA 5T1KB 1VEPA 3KS0J 1MCHA 1MAMH 4U3HA 3VGGA 2VKWA 3FB5B 5L2JB 2A6KA 1BVKA 4HUNB 1CK0H 4R7NB 1KENL 4ZS7H 5JW5B 3BP5A 1RZIB 1WWBX 3DWTA 5EC2A 2B20A 3WYRA 3OGCB 5CP3H 2IPKB 4HHAA 4PJEB 2ZKHH 4JKPH 3WHE0 1OAKL 3BIAX 3U30B 4YFLI 3GIZL 1ULVA 5IF0B 2P42B 5GS3A 4P49A 4D0BB 4PJEF 4X99A 3X14B 1SBSH 3PDOA 5CEYB 3ULUL 3MLPA 5F71A 2PW1B 5DWUH 1YECL 3F7YB 5AYUH 3RNQA 1XH3B 4KJPC 4K94L 1XGTB 1FJ1A 1ODAA 3LV3A 2UYLB 3GNMH 5I66B 3S37L 1A2YB 2CDEA 3QDMA 3LKPB 2AEPL 3GSNA 2OR9H 5HGBB 1DEDA 4OB5H 4UV4L 4X8JA 4F8QA 4ZTPL 1DBBH 1XF3B 5D93B 4MNQE 3OKOA 2Z31A 4J3UA 4F7MB 2V9TA 3PNWB 3R06B 4KK9C 3O2DA 1AHWB 3K3QA 3EOBB 5CGMA 5E8EA 1TIUA 1OTTC 2DKMA 2J5LC 4OLUH 3UTZA 3HPLB 4LEXL 3TC9A 2CLRA 5EA0H 4NRZB 4JM4H 1XF5A 4M48H 4X6DE 4ODHH 3HE6B 4NQEE 2HJFA 4I18C 2NW3A 1A3LH 1FGVL 4AQOA 4L3CA 3EOYG 4LKCA 1S5IH 3RZCB 4L1DA 3HZYB 4YDKH 4JZOA 4ZAKD 2I9TB 5D8JL 2VO5A 1NEZA 4OQTH 4BQ9A 3MTRA 3FO2B 2NXYD 1UB5A 1A3QA 1JV5B 1U8QA 1EFQA 1LEGB 3FRPG 1AR2A 2D7QA 4Q9QL 4KKCC 4B50A 4MA7H 3WS3B 5JTWA 2P46B 3D2UD 3FO0H 1QFUH 5D7JA 5FIEA 4MWFA 5E56A 2WIIA 4N0FA 4PUBL 5J6HB 4HIJB 2DN7A 1VERA 3QIWC 5KSBA 1WFUA 3P4NA 4OI8A 1AXTL 4D9QD 4ODHL 3ARGB 1A14H 1OAUL 1ZEAL 2Y5EA 1PKQB 2NXYB 1JYNA 4X9GA 5TDPA 3PHSA 1O5DT 1BQLH 3BKYL 4MDIA 4YR6A 3SY0B 2VABB 3A6CL 5SWZE 4U4BA 4KRLB 4DGVL 5DMYA 4I9WD 1DUYB 3HTLX 5KSAD 2LVCA 4R8WL 5CD5C 4F7EB 3B3IB 1Y18B 5F3HB 2HVKA 1SMOA 3C8HA 2PTTA 4XC3L 1CLCA 1IKNC 3RVUC 4HJJL 4MXQD 3HI1B 2EDOA 1BJ8A 2WSKA 4Z0BL 3RVTD 3AXLA 1B0WA 4FFVC 3GJEA 2RB8A 3BP7A 3UC0L 2XWBA 3L9RA 3TO4D 3VXUD 1XF1A 3EJJX 1QR4A 5CMAB 1HILA 1X5FA 3C60C 1CS6A 2KZ1B 2HJLB 3EHBC 1ZANH 4P2YA 4KHXH 4XBPA 3EOTH 4DN3H 2K9UA 1LE9B 1NLBH 4LSRL 2NY0D 4NWTL 2VQ1A 2YPVL 5F7LB 2XNAA 1FORL 4Z7UA 4XPTL 4YC2B 3PGDB 4ZO6A 4OM1L 2GT9A 4BSWB 3ZT6A 2EIZB 5D96B 4WDIA 2FATL 4NO3B 1U58B 3SEPA 3I02A 2NY3B 5T5FL 3MLSL 4ZDHA 2AGJH 2YRZA 3UJJL 5JXAL 4O9HH 1KIQB 1ZA6B 1RZ8A 4P46A 1W0WA 4RGMB 4U1KB 3NOIA 3DRTB 1II4E 3PL6C 1I1CA 4RFEA 3QIBC 4K9EL 5IIEB 4P5KA 2YPKA 3STZB 1E0OB 3C2AH 3ARZA 1TZIA 4D0BA 4J4PD 3DXAE 4HXAH 4L8SB 2YN5A 3BQUB 4LSTL 3FOLB 3IDJB 4CBPA 1L9NA 4NBXB 4JJHA 3KLAB 5D2LA 3RRQA 2CK2A 5JPMB 5D1ZB 1IAKA 3GMPA 1CFQB 4PIRF 2ITDA 3RWFA 3GJEB 3KPNB 1FH5H 1RJYA 5JOFA 2VE6A 2R69H 1CGXA 4O58H 2VDOH 3UPAA 4JVWA 4UB0H 1JWMB 2VDRL 3T09A 4R90H 4LQ1A 5TFSH 4EI5D 5E9DE 1KJ2H 1FIEA 3MLYL 1AE6L 3O6KL 2BNQE 2P8PA 3QJFA 5KVFH 2YPLA 4L29B 3KHOA 1IGYA 3ARBA 3DV6B 2QADC 5HI3D 5KW9H 3PABA 5T3XL 4YZFF 1FCGA 3BPCA 3VI4E 2PTUA 4WUUD 1YEEL 2EYRB 2L0DA 1FV1B 3BRDA 4L8SA 1NEZB 1S9YA 3BEVA 1S8DA 4R97C 3B9KA 2CK0H 3MRQA 3V6OE 1AO7B 2VDKL 1J1PL 1HH9A 5I2IB 4B53A 4NQSA 5KSAB 1GAFH 4EN3B 4CW1A 4MGXA 2ICEA 1NDMB 3MRBB 2BVEA 3GSUB 1MI5D 1BX2A 2PYED 3A6OA 4KZDL 2EEAA 3ARDD 4OGZA 1VDGA 2HG5A 5K9QI 4XMPH 3WXWL 3VFVA 1OWWA 3N9GH 3MRRA 2LVEA 3MMEA 4FXKA 4LLWB 2X5PA 3TN0C 5KSVA 1ZGLB 4I8DA 4F9PA 3MLUL 1IC5H 3G6JE 1EUTA 3SGEH 1W0VB 3KPRE 4TN9A 5T33H 5F88A 4WENB 3IS0X 1LEKB 4KMTL 4CMMA 1YDPB 4E5XB 4K94C 3KR3H 1LNUB 2GSGA 2OL3L 3GEWB 4HQQL 5FHBL 1RUAL 2FECI 3LB6D 3MBEC 1UQSB 3MRGA 1J1XH 3QNZB 5FKPA 5I73C 5FM4A 1SEBA 2DQCH 3NCYS 3I6GA 3RL1B 4CNIB 2PO6D 5IJKC 1PZUB 2ATPA 5E4IA 5FO9A 2NY6C 5IBTL 1MJJA 3QUKB 4AL8H 4Y4KB 5D9SB 1I9RH 2I07B 5L0QB 1F4YL 2NTFB 2XKNA 5E00A 5L8KB 2B2XH 1P5VA 3DIFA 3MBEA 3VXNB 4OTXH 2WBWB 1WISA 3WSQL 1NCBL 1YC7A 4ODUB 3LQAH 1XF4B 3X14A 5CMAA 3HI6L 3GRWL 4QHMA 3SGKA 3VG0L 2VYRE 3MLVH 3HNTL 3TPKA 1V3MA 2QSCL 3QEQB 4KROC 1E27B 3ARGC 1OP5H 2MCG1 5CJOH 5ACMA 4EZMA 3BZFA 5K9OB 1J18A 1WWWX 2VOTA 3H3BC 3VXQB 3C5JA 3VXUE 2KUTA 5DJAB 5A40E 3FTGA 5HHME 5C0EA 4G8GA 3HG1D 1CQKA 2UWEF 1N2RB 1S7VB 3MCLH 1T03L 5F6IC 3MUGB 3QP3A 4N1HB 5F89A 3V6BR 1TZIB 1D5BA 1S7SA 4LHUB 2VNCA 3IDGA 5KBNC 4R9HA 4DUWA 1SJVA 3PDDA 5D7SL 1MRFH 4XCFH 3EDDA 1OAZL 4UOW0 4F8TA 5HJ3A 1JWSA 4PJIA 3MRJA 5CWSB 3PWUB 4GRWH 4X0KB 4M9PA 2NW3B 2XWJB 3HG1B 3RDTA 2V2XB 3SGDI 3GB7B 1H5BC 3KPLB 2NX5B 5KN5A 5E2WH 1VFBA 4FQCL 3UXFA 2GTZA 1OAKH 5EU3B 4JPWH 3IRZA 1RJYB 2DYPD 4PP2A 3P4OB 4JZJC 4ONGH 1WZ1L 3Q6FA 3MSPA 4OZHE 1Y0LB 4U3CA 3U36A 3QDJB 1I7ZB 1OLLA 4QHMB 5K9KA 4RMRA 2VLKA 2NXZC 3ZHDA 2H32A 3V6FA 4DOHB 4NO0B 3C2SA 2Y6SD 1MAML 3VH8A 1AXIB 2R4RH 2WUBH 3P73A 3O6FA 4NQEB 1NJ9A 3P0VH 4OD3L 4S1QL 3S97C 3KHQA 4Z7UF 5C0DA 1JNLH 1Z0NA 5FGCB 4HUXB 4L8BB 3IRPX 2ZKHL 4JKPL 1I3GL 4WI5A 1REIA 2GJ6A 1U3HD 4NGHH 3CK0L 1QSVA 4MZ2A 4CN1A 2MSPA 4JB9H 3D9AH 4ELMB 1A7QH 1KYOK 5I9QC 5E9DD 4U1LA 3MLZH 5DFVC 1BVZA 2X9YA 1PZ5A 4B5EA 3PWNB 4X99B 5SV4A 1D9KC 3E3QC 3OV6A 4YXLH 4YHYB 1HYRC 4FFYL 3C2AL 4KJWD 1QBLH 4Z7QF 4EN3A 2X6MA 1FZOA 4ZAKB 4PJXA 1S7TB 5DT1L 3VXTA 2CMRL 3S88L 3I6LE 2VDNL 1HZHH 1OVZA 4U7MA 1G0YR 4HWZA 1HINH 3D2UA 5D7JD 1OW0A 2NY7H 1FGNL 4S0TD 4M7LT 2BSSA 5LGJA 1Z5LB 1GC1C 1R3HB 1KB5B 4XPAL 3LN5A 2PXYB 3QZWA 4PJAE 4WNQB 5FYJH 2ZOKA 3LV3B 4L9DA 5I16A 1ZWIA 5IM7A 1QHOA 3IDUA 2EC8A 1HE7A 1XMWA 1NGZB 2PYEE 2R29H 5HHVH 3FL7A 4P48A 1RHHB 1AP2A 3GZKA 2L7JA 3RU8H 5T1LA 4K7PH 1JHLH 3BOVA 2HRPL 2A83A 4JFFB 1CICC 4P9HL 5L6YH 5JXEC 1MFDL 4DKDC 2AAVA 5D7KE 4NC1E 5DD1L 4ODXA 5I1IL 3SO3B 2APXA 3VE0A 1Q9LB 4JRXB 4OD3H 3VFSB 4Y4HC 1JNNL 4OI7A 4HT1H 1KB5L 1NC2A 4PBVC 4RNRB 5GS1A 3WJLA 1F5WA 5J1AA 4WFGD 1UC6A 5FF6A 1T83A 5JXEA 5B39A 2A0LC 3MREB 4QYOA 4BH8A 4Y8DC 1B90A 2PTVA 3NABH 2EXYC 5I1JL 4WW2B 1KELH 4JJ5A 1MFAL 5GHWH 5C0BD 3SDYH 1XGPA 5GGVH 2R29L 4LVOC 3UPCA 4HUKB 3GIVA 5JDSB 3T0BA 3S88H 3ARFD 5SV3A 2YBRA 1I8LC 1ZSDA 4PRHE 3WLBA 2XTJB 3VU2A 3FONA 4OUUB 2G60H 5TJWK 3DOSA 3C6LD 4U1GC 2PF6A 2ZNWA 3MUZ1 4JFHE 4ZUUB 1URLA 4XVSH 1KLGA 1GGIL 2RFXB 4N1EA 5EDXA 4DWHA 1JJUA 2YN3A 1AGEA 4HKBB 4JO1L 1KG0B 1RJLB 3BN9C 3NH7H 1ZT1B 1CXKA 3FQXB 2X4OB 3LPFA 4I13B 5HHMD 1J0IA 1MCBA 4JFEB 2E7HA 5D72L 4TNVF 1FIGH 2VZSA 1P1ZB 5C0ND 2MPAH 4KKLC 2E8YA 4WHYH 3WEXB 1H3PL 3EO0B 5JQ6L 5F9WB 4NYLB 2YD8A 3KPSE 3HN3A 5GSVB 3WSQH 1FO0A 4HD9A 2GSIA 2HTLD 3T3MF 4GBXD 4QXUH 2GJ6E 2EYTB 5GRUL 3IFOB 4R4ND 1MHPL 5EFIA 4QRTB 1AO7D 3VFNB 2GK0B 4CKVX 2ZNXA 2AV7A 3GUTA 4XBPB 3BWAB 5IK3B 1U92B 4JRXE 4H25A 4NN6C 3F5WA 5AD0A 3DGGB 4JDVA 1OGAD 4I2XB 3VA6A 2D7PA 1XFPA 5D5MB 2XIDA 4HG4K 3VD3A 1ZLSL 3PL6D 1KULA 5JR1H 1VFAA 1JUFA 1NMBL 5DC0A 1UJ3A 2IANE 5E95B 1WFNA 5IIEA 4S2SA 4U2ZA 2CO7B 1TLKA 3DYOA 3T8XB 3EDFA 2R2EB 4X9BA 2AJZA 5I15L 1KCSH 3EDJA 3L3GB 3T1FB 1I3UA 1CFQA 3H9SE 1DN0A 1IGTA 5I8CB 4PJGB 2A73B 4OZIA 5BRZB 2E7LC 3STBA 1HHGA 1ONQB 5D2NE 4PY7B 5ESQA 1G7QA 4FTVE 5HGDB 5JLZA 3WFDL 1EHLL 5ECJE 3MV7A 4KK8C 3PIQB 1I85A 1O7VA 5B8CB 1RK1B 3WS3A 1T0MB 4XAKD 2PCPB 5IROA 5JHDA 1JGDB 4KDTC 3BHBA 1YEIH 2P5ED 1CG9B 3VFWA 1ORQB 3PXJA 1JWMA 3U1SL 5HTSA 4A6YL 1I8MB 1X7QA 4MAUH 3HS0B 3GM0A 5EUKA 1CDHA 1S7VA 1FDLL 2W0PA 4YHMH 3DVIA 3ZTJH 1MLCB 3GSXA 1A7RL 4LGPB 1EEUA 5F1NA 1I3GH 2YSSB 3LKQB 1AGBB 1NBYA 1FCCA 5IFJB 4KRMB 2VABA 3FRUA 5FHBH 2NY7L 4K55A 1Q9KB 3RWGB 1G9NL 5D7KD 3O6LL 4GXVH 3VRJB 3QIWD 1NDMA 4YLQT 4JO4L 1RVFL 5E8OB 3HR6A 3CH8A 1UKSA 5MEOA 3BPOB 5HHXH 4P4RB 3QRGH 1U8OB 2DLEA 5KG9B 5KVMC 4PGDA 1UZ8B 5DQ9A 2ZPKL 5ACZB 4MJ6A 5J8OA 1C5CL 5FYKU 3U9UA 1C16A 1S9VA 4X8JB 3UBXB 3X12A 5IUSA 1BQSA 4K3JH 4XP4L 4YO0B 5EBMA 4WY7H 3TV3H 3RIAK 3IU3A 2AXFA 1Y6NR 1OD7A 3IYLW 1FC2D 1FG2B 3HMWL 5CBAB 2IPTH 4LSQH 1DUZA 3O2DL 2IGFH 4PYGA 2QQKL 2HFEA 3LS4H 4PJGF 1J7VR 2W92A 4HBQA 2R1YA 3ULUH 4NIKB 1G9MH 2Z31B 5ETUA 3QXUA 5T5FH 3TO4C 4S1RH 3GKZA 3WDJA 5C0FB 5CJ5A 5J6GB 5JUEH 1T20B 3BJLA 2NZIA 5C92A 5D7IF 3L5IA 1P6FA 4HPYH 5K59F 2X44D 4KJYB 4DVRH 4MYWB 4ERSL 1C08A 5IW6A 3DX6B 2CJUH 3QUZC 4Z7UE 3WIHH 1YEGH 5C0RH 1OF2A 1MVFA 4Y16B 4TVPL 1AQDA 4H1LA 1JNNH 3L5JA 2ICCA 5FK9A 4DVBA 3UCRA 1KJMB 4ZFOA 1X9QA 1QP1A 5I1EH 2IQ9L 3OGOE 4NPYB 5HHNA 3GUTB 4ONOA 5D1QD 3QDGE 4KROD 3S5LB 4OCMC 4WUUE 4BFEA 2VQUA 3BDBA 3CZJA 5DS8A 4HWUA 2DMBA 1LD9B 3DVNB 1DSFL 3VXPB 1BJ1J 2WIIB 1IT9H 4U1NA 4ELKA 5D5MA 3V5DA 1MNUH 3I9GL 1KBGL 2B8OT 4O2EB 3QBTB 4Y4FB 5TF0A 3AROA 3B2VH 5T1LB 1SEQH 3MLTB 3EUUA 2IFFH 2P5WD 4TQEL 1P7QB 5JIHA 3UTTA 1E6JL 3C5SA 5CZKA 1FZMB 4PB0H 4NBZB 5A16B 2NYYC 4ODXB 3G6DL 1QBML 2A6DA 3WKMH 5FGRA 2F5AH 1RULL 3G6AA 3PP4L 5GZND 4M1GH 4OZ4A 1SM3H 3DROB 1MWAA 5EU7C 2QQKH 3ZMRA 3ROLB 2ESVB 4WEBH 2HKFH 5IB2A 5JIPA 3W5NA 3F7PC 4MXWL 4JHZA 3RWEA 5JHLH 5K33A 4ZTOH 5ESQB 5EUOF 1XGRA 1K8IA 1TFHA 3U82B 1A14L 2LAGB 4M1DL 2VC2H 2NNAA 2C7UB 2ZUYA 3H9SD 3P4OA 3PWPA 3O4OB 1RHFA 2B1HL 1F3RB 1KBGH 2PCPA 1RZ7H 3OR6B 2CK0L 1F00I 1HKLL 4LU5H 3BUYB 2YZ8A 3FB7B 2EDNA 1M6OA 5BZWA 4XNXH 5F7YC 4I48A 3W9EA 1Q94A 3GMMB 1HDMB 1G6RH 2AQ1A 4DKEL 2GEEA 4P23A 3MPCA 1KN2L 4DOHE 5ICZB 2QQLL 4K8RH 12E8L 1JFQH 1GGTA 1YQVH 3M45A 4LRIC 1CVRA 3I02B 3QQNA 4G9DA 2J6EH 5C71A 1HCVA 3OKLB 5FA4B 4KFZC 1EJ6A 1F6AB 4JPKL 5LWYH 1KEGH 4K7PL 2EO1A 5K93A 3DO7B 3KLHD 3MV8B 2GFBB 5AG8A 4PRHB 3KJ4B 1A6WL 1CLZH 1JF5A 4PRDB 1BEYL 3RHWF 4UIKL 3TWCH 3ZLQC 4GQ9H 2D7TL 3KPRA 3KDMB 1EAPA 5E4EC 3S35X 2R2HA 3CFJA 4ODSH 4PGCA 1XF4A 4IS6B 3LB6C 4LPXA 3NGBB 1RJZA 4KY1H 1JZ4A 3RGVC 3W0WB 4MJ5B 4D2NA 5E2TH 1H3XA 3PV6A 2EKSA 1RZFL 1LILA 1WVZA 4LEOA 1Q0XL 1T1YB 5JOFB 3HI6H 3MFFB 3MV9E 2NLJB 2P4AB 3BIKB 3GSOB 4NRXB 5LBSH 3MYJB 1EBPA 1OTSD 3KNBB 5C08A 3QEUB 3FB7A 3DMMD 5K59E 1MY7A 4MVBC 4TTDC 4XVUD 4IIQA 1T1ZA 4M43H 4IRZL 5IB3A 2CIKB 1K8DA 4JDVB 4S1DC 2H9GA 1VSCA 3VXOB 4RA0C 3O9WA 3K1DA 3PWVB 4TVPD 1W72B 2IAMB 3HE7D 3V4VH 4RISH 3G9AB 4H88H 1INEL 1S8DB 1FH5L 2B5IC 1JFQL 5GRZA 3QHFH 2C4FT 5D7IA 1YEJH 5LQBL 2ADGB 4PJ7B 5JA9A 3J7HA 1G84A 4PRPD 5AWNL 3GSUA 2W1NA 1Q1JL 4G43A 1HKFA 3NACH 1AD9A 2XA8L 1B0GB 1MEXL 2VAAA 5DRNB 3KDMA 5AEAA 1AO7A 1HCFX 4XRCB 1HIML 5I74B 1NGPH 4NKMA 1K4CB 4JO2L 5E2WL 3D0LA 1C12B 2FWOB 5LVEA 1FNGA 1J0HA 3T3PE 5IJKA 3ARFC 1MCDA 4N90D 3AFLA 1XCQA 2BSRB 1EO7A 4XTRC 5B3JF 1ZGLP 3KPSD 4NRXA 1F4HA 2DD8H 3FQXA 5DUBA 4GAGH 1OAXH 3BISA 1J0ZA 4CN4A 5DMGD 1KPVB 3GMLA 4JM2A 4E5XA 3V4UH 4QHKI 4OCSH 3G6AB 4OZHA 1F11B 2GJ6D 3S96A 2FNBA 2AJXH 3VGAC 2QTEA 3EW3B 1AO7E 4JFZH 5IB2B 1GZPB 4V1DB 3DIFB 4KXZH 4JB9L 4LPUA 1CGTA 5D6DC 2VKXA 3MJ8B 1KSRA 4NJ9H 4YHLH 4MJ4A 2P5WE 1NPUA 2YC1A 3PHQA 1G7LA 3GRWA 5C9KA 1TTUA 5ILTL 1JK8A 5GGUB 3WEXA 4G43B 5BVPL 3UBXI 5E2UL 4JEGB 5EU6A 4HH9B 3QCUL 4YDVA 4J6RH 4OZFH 5D6DA 2IAND 4BFGA 4QXTB 3HLAB 2P5EA 3KR3L 3RWHA 1KB5A 4NQDB 3S34H 2CLVA 2EDFA 2FGWH 4EIZC 2QSQA 1KENH 5I71B 4WEUD 4AL8L 4ORGB 1A1MA 2C5DC 2GHWB 1BVKB 3ESVF 2ITCA 1RUQL 1AH1A 4NJAH 5DDHA 3CPLB 3CNKA 1U6AH 5D7JC 1G7HB 2DICA 2Q8BH 5IG7A 3EYFA 1HYSD 5E0QA 3AM8A 3LMJL 4NOBA 1U3YA 1U95A 2YR3A 1I7UB 2XG5A 4OCNC 3NFPB 3T0ED 2P48B 3QPXH 1Y18A 4JFPB 3RJQB 2AK4B 2P5EE 3F62A 3QNYB 3HFML 4P2QB 3EGSA 3QUMH 4Z7NE 3TNNB 5CP7A 3MNZA 5HDOA 5E2VH 1QO3B 4FA8A 3QG7H 5K9JH 4N8CL 4HXBL 1KEML 5GPRA 5BZDB 1FAKT 3Q6FB 4PJDB 4GG6A 3MA7B 5DK0A 1C7SA 2O61A 2EXWC 4E41A 4LCIL 3WBDA 2Z35B 3HNTH 5EBWB 1ZA6A 4NWUL 3DNKA 4U6YB 3CDYA 3LPGA 1A7OL 35C8H 3P73B 5KVEL 4K3HA 1JE6A 1VACA 2VXTH 4Y1AA 5FGCE 4BKLA 1CTNA 5E8NB 4EN3C 4DAGH 2DBLL 2C1PB 4MS8D 4KC3B 1F2XK 1ED3A 1AGEB 4HKBA 2YMXL 2IC2A 5D2NA 1HSBB 3UTQA 4PRNA 5KVFL 3WCYA 4W68A 1TJHL 1C5BL 3OAZH 1A3RL 4WV1B 1OM3H 1NAKH 3O3UN 4NCC1 4HF5L 3RTQB 2X4QB 5I8KL 5DJ8A 3GJFB 1JVKA 4JFDA 3RGVB 2NY2B 5KVDH 1R6VA 2Z91B 3P9WB 3QDMD 4U3XA 5KG9A 1IFHH 2CH8A 1IAOA 1T04B 4IMLB 1FNSL 3TBYA 1FNLA 2P45B 3KYOB 2AW2A 2J1KA 4M61B 4EI6B 4JZNA 3DRQA 5FGBC 2XV6B 1TTGA 2A38A 5LAXB 3ZKSD 4FQJH 5ICYB 3H3PL 4JN1H 1TPXB 4J23A 4POZC 2HN7B 1F3DH 1N64L 2J88H 1QFWM 1VADA 3V5KA 1FAIL 1KCRL 2NX5E 1JRHI 3CVIH 2WUCH 4NP4H 5BV7H 4ISVA 1MCCA 3GKWL 1OM3L 2YOCA 1KTDB 4O2CB 1EXUB 3TGXA 2F19L 4LQFL 3FO0L 1YEDB 5ICZA 4LCYA 3GMOB 2F53E 4BKLB 4BSVA 2X4SA 4OT1H 2ZJSH 2CIIB 3LHPH 4Z5RA 3QIWB 2JKXA 2ZCHH 3MJ9H 1I3VA 1I9IH 2LU4A 3K46A 3RVXC 1EK3A 3DARA 3TNMB 4JG1L 3X3GH 3PDOB 1A1NB 5CEYA 4Y88A 4AMKH 3UTSA 1IILE 1K2DB 5C0AD 4M62L 5HYIA 3BGMA 2ICES 2V2TA 5F70A 4MB3A 1A0QH 1VGKA 2UZYB 4NWTH 4LP5A 1N26A 4WFHD 2FECL 5FDWA 3AS1A 3KXFE 1S9YB 3BEVB 3NPZB 2BNRD 3PWPD 1E6OL 4JM2F 4NPYA 3WLBB 2HRLA 3TYGH 5HGHB 4GJTB 5IESL 3I3BA 2HT2D 1XGTA 2PYEB 3INUL 2VDQH 3OF6D 3ZYJA 5I66A 4TSAL 5D1QC 1DVFB 5GZOC 1PVHA 5JDSA 1S3KH 1BF2A 4PJ8C 2ICWA 1OWRM 3GSQA 3HPLA 3QYCA 3SQOH 3I6GB 1MVUA 1TVDA 4RFEB 2V5SA 2WINA 5C9JA 1JBJA 1P7HL 3QJHA 3HCVA 1JWUA 1EXUA 4P5TA 4JR9H 1P2CB 3KWWA 2J4WL 4F9PC 3ULVL 5L88H 4JPWL 3HUJE 4LSSL 1T0PB 2DTML 4H20L 2ATKB 3LKQA 1SEBB 1FL6B 2DQHL 2CDFB 5F6HJ 4QHNB 3VXUA 4EVNA 4KV5E 3M17A 2B4CL 3PL6B 2EDLA 4RGOH 1IC7L 4XVTL 1FDLH 1JGUL 5GSVA 1CT8A 4XCFL 1JMXA 3L5WB 4E41E 4LPYA 2AJ3A 1QR1A 3ZE1E 2DLGA 5F7WC 1VFOA 2GK2A 1F4WH 5KANG 5D93C 3DJ9A 2QADD 3D69A 3BIBX 4PRBA 3T0EE 5MEQB 4QGTA 2LU3A 1RUQH 4MCZA 2AP2A 3BE1H 5I1GL 5IBLD 2W9DH 2B4CC 1E6OH 1HOCA 1W2KT 4PV9B 3FN0L 2AJSL 4ZOCA 1U36A 5D1ZC 2AXHA 1UJ3C 3R0MA 1BVLA 2FWOA 4KQ4H 3G5YA 4ZXBC 4JRWA 3SDDB 3T0DA 1EA9C 4ALAH 2BSRA 4BH7B 2R2BA 5CIPB 3MR9A 1YNTA 3G6JB 5I30H 4HHAB 3SGDH 5LGHH 1OCWH 4S2SB 2DWEB 4ZFOL 5F9WC 2VRAA 2MPAL 4GXUN 2Q87A 1CE1L 2VLJA 1EAJA 3BZEA 4WW2F 1I7TB 3UJIH 4BZ2H 3BKYH 1CZ8H 5DD6A 1D5IL 2XWBB 1B2WL 2H1PL 2MKWA 1T04A 3W2DH 4LSVL 2R15A 5E03A 1A7QL 5IB4A 3GSVB 1RUKL 1N0XH 1LE9A 1CT8B 2HT3C 1RZKL 2HN7A 3ZKND 3RHWK 2PO6C 2FEDD 4PR5B 1JYVA 4OZIB 3MFFA 4RWYH 3UO1L 1JI1A 2Z8RA 1NFIA 4NHCH 4ZDHB 5BW7A 1MJUH 2XQBL 4JHWL 1H8OA 1I8MA 4PB0L 3HZKA 3CCHB 3RZCC 4RSVA 1SEQL 4ZD3H 1EJOH 4HJ0C 4HF5H 3CFIC 3MV01 4C4KT 2XPGA 4G8EA 2P8LA 4NFBA 1IZJA 2CIIA 1KPRA 4Z5RB 1A3RH 3CZFB 5INDB 4WGWB 5DJZA 4YDJA 32C2A 2HWZL 2ZCLL 5DRWB 43C9A 1SY6A 5BW7C 4AIXA 5I1CH 4UIMA 5DHYB 5B21A 5HGAB 3F12A 2YSSA 4PJGE 5B38A 3O9WB 3PE9A 4HS8H 2AQ2A 1RMFH 2VAAB 5DRNA 1B0RB 3FHQA 3SO5A 1UH2A 4HMCA 2W9EH 4MD4A 5JW4M 3PGCA 1BOGB 5TDNB 2X41A 1AQKL 3IJHA 3P77A 1JPSH 4P2OB 2QV2A 4K3DH 2BX5A 4ZG1A 3WFCL 1ADQL 5L8LB 2A77L 4JFOA 4G3YL 4NQCD 5T3ZH 3CFEB 3QULB 4L3EE 3ZE1F 4ETQB 3FCTA 4HMEA 5EZJA 2PETA 1A47A 5TE7H 3U30C 4M93B 4PJDA 4BM7A 5B22A 5GZNC 3L95A 1Q9OA 4OLWH 2ZWLT 4MQ7A 4TSBH 5C07D 5ADOH 2EICA 5GS1C 3LKNA 3UAJD 2VDOL 3U79A 4JN1L 4PJ7F 1P4BL 1U93B 5TQ2L 2VR4A 2AKRB 1OAZH 3LIZH 1NC2B 3FHAA 1OLZA 4HSQA 5DMGC 2FJHB 5DJZB 3ARQA 2EDYA 3WFBL 5GJTL 3O3BB 2Z92A 3OX8B 3SDDD 1OL0A 1WFTA 2AEIT 4NJAL 4NKDB 2NY5C 3W0WE 3SKJL 3U7WH 5E8DH 1VHPA 3PWLA 3QG6B 1DDHA 5D71H 4KMLB 3JZ7A 3HC4H 2OZ4A 4I3RH 3PXHA 1TCMA 5GGUA 1XGPB 4NQCB 3MLXL 4YH6A 2EDDA 1C1EH 4QNPF 1D5MB 1A3LL 5LGKA 4O5LL 1XGYH 4MZ3A 4XP6L 2JCCF 2B7DT 5BVJA 2NY5L 1CFVH 1XH3A 2AEWA 3KPQA 2J3SA 4OUUA 4JN2B 3A0OA 5F3BA 4TVSa 4R26H 4WW2A 1R0AH 1G9ML 4HGWA 5EOTB 3WJLC 5JQ6H 1BVLB 4N8PA 1WEJL 5IB1A 2XFXA 1T83C 5F96H 5D8JH 3WHE1 1A2YA 2CDEB 3BQUC 3JVGA 4BFBD 5EZJB 2YBRB 4E42B 2BOBB 4XMPL 3WXWH 3GGWB 4PRPE 1IM9A 4PLOB 2ZCKL 4NUGH 4DK6A 3FMGL 4U6VL 2YKLL 3AS3A 2RBLA 4NQDE 4HZLA 1AHWA 2JCCB 4WTZA 3V5DB 5TE7L 3V4PH 1WAAF 2N56A 1IEAB 4I2XE 4LCWA 4Z0BH 4WI2A 2VZ1A 3UJTH 1LO0L 4KJPD 4D9LH 3MC0A 4YC2C 4DGYL 3LIZL 3DX7B 2WAHA 5HHOE 5FM8A 3VWJD 3G5VB 3JSSA 2QSTA 3L6FA 1K4DB 4XWOD 1IAKB 2V2TB 1IGFH 4LSUH 4WHTB 3BVNA 3T0EC 3ULVE 5BO1H 2LABA 4ZO9A 1AHWC 4OF3A 4DGVH 4ZS6C 1DE4A 5IOPB 2WNGA 4RISL 4OIIL 4LLMB 3G5ZB 4RGND 2NMSA 3T3ME 3F7QA 5EO0B 4NM8H 4TSCH 1BZ9A 1MCWW 5J06A 4ZS7L 4PJFA 5C86A 3C5ZA 4JREB 3OKKA 3CFDB 4IRSC 2VUYA 2AV1A 3FO9A 2P8MB 4BUGA 1A6VH 1CXFA 4MD5B 4HDIB 1EGJL 3HE6D 4EUPG 1YEHL 5F7EL 2J12B 4APQC 4G6JL 4O51B 4R0LA 3SKOB 2ZUQB 4FG6C 4OCRH 1J0JA 3ROOA 1QNZH 2IALB 1NCWL 4QTIH 5D70H 5HPMB 5EU4A 1ZHNB 3O3AB 3NCEB 4LHUA 1KC5H 1IZKA 1WT5C 4TRPH 4PJCA 3HAEG 5FF6B 5MENE 4NFDA 1TCRB 1V05A 2FSEA 3CLEH 4XNUH 2ADFH 2ICWJ 4IS6A 5IHZB 2BJML 3BPLB 3UZQA 3MRBA 4S1SL 5JO5A 3RTQA 3CFCH 1G7JA 1EEZB 2ARJB 4NO0A 4FZ8L 4C55A 1S5HA 3L3IB 3TIEB 43CAB 4HZAA 2XY2A 1TQCC 1U8KA 1JIBA 4XP1L 5BJTB 3LS4L 4QCIB 5LXGL 1YQVL 3QUXB 2P5WB 3TBVB 3QO1A 4M61A 1QSFE 1RIHH 2NY1B 1BQHB 2EKSB 4BA8A 5HGGS 5EUKB 4L9LA 1SYSB 5HYFA 3ARDB 3MRMA 3IXAA 3PGDA 1A6WH 5KSAC 1AKJD 4JY5L 5HI4C 1DR9A 1GZQA 2MKLC 3BHBB 5H94A 3NZ8A 2KDGA 4XHJD 3OL2A 3IJSA 1OT1A 3CSPA 4G8IB 3RIFF 1MFNA 4GBXC 2CXGA 5KOMC 5IFAL 1W0WB 4GW5A 5MI0B 4OF7A 1E28B 1ZS8A 2AJUL 1MRDL 1EZVY 3MNWB 3BD3A 1P69B 3MA9L 3EBAA 3WFCH 3BP6B 5I17B 2DTSA 5B3JE 5HPMA 4P3DB 3NCJL 1AGBA 5IFJA 1NGYA 1LP9F 2J5LB 4GLRH 4UTAL 4OLUL 1DLFL 2EC9T 5JW3L 5C8JB 4HIXL 5DK2A 5FKAB 4PBWD 4X4ZA 3JBG7 5EC1B 2FYYA 2P7TB 3EGSB 4OCYL 3Q0HA 2W65B 4YO0A 5EBMB 1NFDB 3HB3C 3ME0A 3NAAH 2CGRL 5C0RL 1WJ3A 3MLUH 5DHXB 3QT2A 2YUXA 3LN9A 3BGAA 3CFCL 1SVCP 4BZYA 1OSPH 3DETC 4XP5L 1B4JL 5IHLB 1G7PB 6CGTA 5C0BE 3QIBD 1ACZA 4LRNH 1N5YL 3MGAA 3AAZB 3VCLA 3VWJB 4U0RC 3HC3L 1IGJB 4E41D 5DJ6A 2RJMA 4LL9A 1H3VA 4G8EB 5GS1B 3NZ8B 4WI7A 2JJWA 4KK8D 2MCPL 3DX7A 3FOMA 5GS0H 5I1KL 5GS0D 2YD5A 5DYOA 5KOVC 1MH5B 1XGUA 4N9GA 1IT9L 2DF3A 1T20A 1ZLVH 4DN3L 1T5WB 1QR1B 4NQDD 4XNMB 2X4RA 1M71B 3UTPD 3T04D 5CJOL 1KTLA 1JL8A 2A73A 4LLYA 3TA3A 4UT6L 4D0CB 5IFHL 3MRHA 1KB5H 3ZKXB 4JGJA 4XPGL 4F58H 4EOWH 1TJGH 1YN7A 3HRZA 3GMRA 3T0VA 4ESKA 3U4BL 4OGAC 1EVTC 3JWOL 4HV8A 5BS0A 2FR4A 3GSNB 1JZ8A 5TE6L 3MMEB 4LLWA 3FQNB 1BGXL 1PYWA 4AENB 1IKNA 4OSUH 2X4OA 4W81A 2P24B 3AAZA 3KXFD 3DVNA 4L4VA 4WVRA 5EU4B 5HDBE 4HKZA 1C7TA 3LH2L 2A6IA 2ZCKH 1TVBA 3E8UL 4UINL 2R1WA 5HVHC 1NGQL 1MCOH 4EQ2A 1Q9KA 5DMKB 4UQ2B 2BVOB 4HG4J 1E4XI 2Z92B 4WU5B 2Q8AH 3E1F1 2HJFB 2XYCA 1MJJB 3QUKA 2DQTH 2Z8SA 1VGKB 4OBSA 5C0AA 4JRYD 4FZEL 3P11H 2MCPH 4HUWA 4JZOB 1E4XH 2IAMD 1UXWA 3QUMB 5JHDD 1DQQB 1AXTH 5F7DA 3UBXA 1BM3L 3X12B 4Y5YA 1HH6B 1R5WB 1J05A 4I1NB 5TH2B 2ZOKB 1GGIH 3CMOH 3F65A 3ARSA 1BF8A 3D87B 1QSEA 4Q9QH 2CKBL 2D0HA 5D70L 4X98A 5H94B 2XQYK 4X6DB 5HYJE 3GSWB 2YXFA 2DQGL 4U1HB 3VWKD 3UZEA 1FSKC 3GSQB 1P7KA 2BOBA 1T6WA 5GGQL 2FIKB 4G42B 1PGRB 4J3XA 2HT4C 1TETH 2WINB 4ZMAT 3CUPB 3L3DB 2CRMA 4FQQA 3FKUS 4NC0B 2HVJB 4G6FD 3SJVE 3D1MC 5DMIL 1FNEB 3C8KA 1YEGL 3KPPA 1WCQA 1V3JA 4P4KC 5D2NB 1F13A 2DQFB 4QO1A 2DQDL 2VXUL 2E27H 3BAEL 5DEFA 4OFKA 3FRPA 3TIDB 3D85A 1L7TL 1CU4H 1P84K 3U0PB 1Q0YH 4JFXA 1FNHA 4LK4A 1JGUH 5CBEB 5GRJH 3WO4B 4XC3H 3BKJH 1JGDA 3OB0K 4NNXA 2DJ4A 3P9LA 1T7WA 3TBYB 1BZ9B 2J8UE 1CDGA 3H42H 3V6ZA 5T1DH 4OCSL 1T5XA 3WHXA 3PUCA 2H6PA 5IVXA 1U93A 4KI5F 3ZKMD 2EDTA 1KIUA 2X4NA 2YEZA 2O5YH 4LASH 4RX4A 5I76B 5EUOA 3TBTA 4BSWA 4GRMA 3SDAD 3WO3B 4E0RA 4HIEB 5EPMA 5C6TL 2ZG2A 1L0YA 2HKHH 3FT4A 1NANI 3HS0A 4YDLC 5ESAB 2JB6B 1P1ZA 1ETZB 3RQ3A 1EEYB 2CKNA 4L4VE 3EOAB 3IDIB 3LKRA 3OJMB 1FL3A 3BDYH 3RUGB 4F37F 2DI9A 5L6YL 4D0CA 1K9TA 5HYQB 2GTWB 3MACL 2LTQC 1S9XB 2NXZD 1K8IB 2P47B 5EZIL 2BSED 3K2UL 3PG2A 2FX7H 1FZOB 3MV8E 5KS9A 5L7XL 4F57H 5C3LD 5GS2D 1NMAH 4XMKL 1UKTA 2F5BH 5EU6E 3VDAA 4F15B 5EFIB 2BDNH 1LE5A 1YNLH 5F97E 4N0FB 1YJDL 2F54A 2ZUSA 5HYJB 4KKBD 1IC4H 1JGLL 1U8KB 3MCKB 5I1LA 4NQXB 4HC1H 2P5WA 3OG4B 4HUMB 2EC9U 1INDL 3QFDA 2YRPA 1CIUA 3QCVH 1S9WA 4JQVC 4F2MA 2HLFC 3IXTA 4C56A 3B5GA 3E2HB 4GRMB 4GKSA 1ADQA 3O6MH 1ZT4A 1NAMA 4G8IA 5I74C 3MV8A 5KS9E 1N5AB 4JO1H 4PV8A 4FQCH 1RZJH 3PABB 2O5YL 4TOYH 3EO9L 3FO1B 4JRXA 5HGAA 3VFSA 5E2TL 4EKXA 4NKQB 1QSFB 2EDBA 1EAPB 3I75A 1CFTB 3RIAF 3HR5B 4QRRA 4OGXH 4JDZA 3S6CA 3RI5F 5F1SA 1U8NA 4LVEA 4MQXD 5IMKA 4PG9B 4HC1L 4M6NH 4S1DD 1HOCB 1BJ1H 3L5WA 3OJ2C 3WIFB 4L4TA 3T4AA 3PP3K 5IV2B 2FL5A 1WV7T 3N1MC 4WV1C 2Q6WB 2NLJA 3RBSA 4YHPB 1RU9L 5GGVY 3VFVB 3NA9H 2PW2A 3CPLA 2FX7L 4KU1A 1FBIH 1VGEL 5HHOA 3RWHB 4NQXA 4PJDE 1F8TH 3LS5H 2C3WA 4NM4L 4YIQB 2VXSL 4M7JL 1IRAY 4Z7OE 3GJFK 1P4LA 4HULB 5EOQH 5DFTA 3QHFL 1JN6B 4APQD 4YHOH 3DROA 5EZOH 2V17L 1HINL 1AGFA 3CSYA 3SQOL 3MR9B 2YA0A 1CWVA 4FFWC 3C5SB 3OAZK 5A16A 1ZLSH 5I1AB 4KHXL 4IRZH 1EO5A 4DK3A 2DYPB 1SY6H 1EFXA 4MMXC 2OJZL 5HVHB 4Y4KA 3O4LD 2XZQH 2VDML 1U8OA 2X4RB 1CFNB 2R0LL 5HHQA 4WTXA 5C0CE 3VXNA 4DZ8B 3P40A 5I1HL 1T89A 3TJEH 1U8NB 4P46C 4OF6A 3QIBA 1ZTXL 4N8VA 4QOKB 3BGFB 3QI9B 3KYNB 1YEKH 5F3BB 4OCYH 2AVGA 2OTUB 4GW1B 2DAVA 5EZOL 4B7IA 4XNYL 2YPLB 4L29A 1QFWL 3CZFA 4L4JA 4PD4K 4F80A 4M6MH 5GISL 2J2ZA 1XR9B 3BP5B 4KTDL 2VSDA 2FJFA 4JM2B 1D7FA 1NLBL 5E08L 4EXPX 5F7MC 2P24A 3ULUD 3VW3H 1SY6L 4QRPA 3NABL 3VFMB 3MRNB 5FGSA 4FQXB 3QXTA 2DJUA 3TH3T 4FQIH 3D3VA 3P0YL 1H0DA 1ORSA 3SPVA 4MAUL 3CFJB 4PRNB 5GRWA 4FQ1L 4RQQB 2IH1A 1S7XA 4LBEA 5EC1A 5F44A 3QNXA 3BQUD 4WW1B 3RIFK 4PTTA 4ODVH 3S37X 3SE9L 2ICEB 1M05A 2KBGA 5DD5H 2ZUUA 1NGYB 3LHPL 3BW9B 3IU4H 3JTTA 3MBXL 2D7NA 4I18B 4LCUB 5IMOB 4IOFD 1B0RA 3TFKD 3DSFL 2G60L 5BS0D 4J3OC 4HH9A 1B88A 1ITBB 3PGCB 4YHLL 1YEFL 1CQYA 1HILB 4PJXE 1UM4H 5K9KB 1WZ1H 1KJ3H 4WI4A 1F2QA 1I8IB 4JFOB 4ODTH 4U1JB 4OV5A 3AC0A 5MEND 5ITFB 4KUZL 3DETD 3ARPA 5I75B 1TZGL 1BD2B 3OPZH 3QQ3A 4UB0L 5SWSE 4NDMA 4XWOC 3IAQA 2I27N 2R69L 1WAAE 1L0QA 3B9KC 5T1DL 5I1KH 4I3SH 4Y0GA 3WN5C 1ORQA 2JJSC 2YUWA 1ZHLA 5TE6H 4AM0A 1IGJA 4R96B 4WCYH 1CGWA 1YZZA 4P3WA 4TUKH 2CXKA 5DEGA 3QFJE 1A9BA 4LIQH 5KANI 4OQTL 1H3UA 4DCQA 1U8MA 1DANT 3VD7A 1UWEL 3TN0A 4NYLA 4AT6A 2AXGB 3DUSA 8FABB 2F5BL 1Q72L 5CCKL 1DBMH 1U41A 2IBZY 2OS7A 5DJ0A 2CPCA 2O5XH 2VJXA 4EDWH 1DDHB 4MS8C 2R0WH 4XNMA 2E7CA 4Q97A 3SDXF 3T0WA 2H26A 3CU1A 4MNQD 3RNKA 3BW9A 2YPLE 5F1KC 1QSED 3OR7B 2VXTL 1BD2D 2PUQT 4HS6A 3UYRL 1H3GA 4R4FH 3TZVA 4X6CB 5ELIA 3RVVD 3RUGF 1GGYA 1YJDH 1D5ZA 4BZ1H 1MFBH 1N2RA 3GBMH 4PJEE 4U1SB 5FYKL 2XOTA 3CAFA 3HCVB 4R6UA 4KRPC 4G7YL 1Z0MA 5E8NA 4HV8B 3FZUD 3D0VB 4YR6B 4JO2H 5HHMB 4AK1A 2YEZB 1AY1L 4YEEA 3QXWA 4RZCA 4NDMB 3MGOA 4XPBH 5TE4H 3T0EA 1YJDC 1FPTL 2M8XA 4E9LA 2F53A 2XKUA 5JOEA 3KPTA 3X3FH 3BDXA 1G1CA 3MJ8A 5SX5K 2ADJA 4OCLC 5DJ8B 3BH9B 3GSNL 1OARH 2IPKA 3AXLB 5DWUL 3SDCB 4PJBF 3G9VA 1GVIA 1F4AA 3C5ZC 4LDEB 3HAEB 1V7NH 4PTUA 1S7RB 5GSRB 5BV7B 1C08B 1MJ7L 5C8JA 2JIXD 4Q7DA 2VLRD 3RWIB 1OF2B 1RULH 1XEDA 3BN3B 4RMUA 4M6OL 1DQTA 1NEUA 5IHBA 1DE4B 5IOPA 4GW1A 4Y1AD 2NW2B 1Q8MA 2X4TA 5GHWL 4Z9KB 3SDAA 4Y5YB 3OKNA 3VH8G 3MRLB 1EGJA 3R1GL 2DQJH 2NY4B 5CIPA 3RKDD 1T1XA 2XRAH 4J6RL 4YPGA 4J4PA 4U31A 4M3JA 5IEKA 4Q0XL 1MQKL 4YHZH 1BBJB 2VDRH 3WNMA 4QHUA 2PXYD 1NC4A 4KQ3H 3MRPB 3NCMA 1J88A 1H3PH 1KB9K 2C3HA 2E7LA 3H9HA 3HMXH 4X4ME 3TO2A 2R2BB 4OV6F 4S11A 5D7IB 3IS1X 5EBLA 4ONFH 3MRKA 1NMCB 2J7LA 3O45B 3RWJA 1S7TA 5IB4B 1X5GA 3BH9A 1I9EA 4GRLB 3NIGE 4Z6AT 1JHTB 2RQ8A 4YQXL 2CLZB 2WV3A 3X13A 3O8XD 1OSZA 1U42A 4NNPL 1LO5B 5E6IA 3X3FL 2WLYA 4PRIA 3X3GL 4ODUA 1NGXB 2G5BB 3GHEH 4HLJA 5EWIL 3UEZA 2C1OB 2QHRL 4Z78A 1MJ7H 5E5MA 4LGSB 2EH7H 3GMRB 3V7MA 1R3JB 3HNSH 3TJHC 3WD5L 1HSAB 4UV7H 1PKOA 4K3DL 4J12A 3FQWA 1CLOL 4LKXA 3ARBD 5BQ7A 4IEFB 3L3JB 3B9EA 4R7DB 5BS0E 1MHHB 1SMAA 3A67H 4MJIA 1INEH 4Y8AA 3UTSD 5FA3B 1YC8A 3MV8D 4JRYE 3ZKMC 1HXMB 2V9QA 5JMOC 3U4AA 5IBUB 3GMNA 4A6YB 1EEYA 4ZPTB 1R3IL 4M3KB 2FX9L 4HIHB 5IBLC 5C09B 5SWSD 3SHSA 1AXSB 1KIRB 3IU4L 1G6RB 1G7IB 4K9EC 4ZSOE 5EPMB 3EAKA 5D1ZD 3TBWB 2ZP0T 2Q3AA 3C09C 1TNNA 2JELL 1CDUA 4ZXBD 1BZ7A 4JVUA 1Y6KR 4OLEA 3SKUD 4X9HA 3NFSH 3DI3B 3U7YH 4XCCL 1CD9B 3T4YB 5DQDL 1V8HA 2DMKA 5DUPL 3MCKA 3HLAA 3VRLF 1AIFA 1M4KA 4P2OA 1HHGB 3SJVD 3V5HB 1KCSL 1PY4A 4PLJD 1MNUL 1ZLVK 1EMTL 3D0VA 2ED8A 3P9MA 5F1IB 5B8CA 2AJXL 4QWWC 1QSEE 4PP1D 5DDHB 2DQEH 4PLKC 2XZAL 5CKGA 3CXHK 3MODH 4XI5C 2YHGA 5L2KE 4JGMA 2R0KH 2HT3D 2NY2C 4P2OC 1YUHA 2X89A 5E70A 4DFHA 2VH5L 2FEDC 3UP1A 3KYAA 3MBED 1K2DA 4I3SL 2MQCA 2OM5A 1DTUA 4H26B 1RUML 3MRIA 1MWAB 1G0XA 4LSPH 5D6CA 2C3GA 4Y4FD 5I30L 4KI5C 3FT3B 3O4LA 1FE8H 4CUCA 3HZYA 3TCLB 2YD2A 3CLFH 1MI5E 1WFOA 3EYSL 3QNYA 4BQBA 3G6JF 1MFAH 4H1LG 2JIXB 2OXHA 3I3EA 4PV8B 3FO2A 4HJ0D 3GNML 2E9IA 1QO3A 4PTTB 3H7BB 4FQPA 3AUVA 1YY9D 1EHXA 1WF5A 1MJ8H 5E9DB 4A2MA 5JPMA 4LKCB 2P1YA 5D1QB 3KPRD 1IQWL 3K0WA 4BUHA 1GHFH 4R2GD 3SDXA 2CO6B 2WBJD 5DK0B 4Z7VA 2ZUXA 1CICD 1G9NH 4LLAA 4HIJA 5DJDB 3OMZA 1A4JA 1UACH 1J8KA 5FYJD 3VXRE 4FQXC 4CAGA 2N1KA 4XCEA 3HZKB 4MJ2A 4RMSA 1YPZB 3W9DA 2YZ1A 4R4FL 1PEZA 2APFA 4NKOA 1JWUB 3OKMA 3VI4F 1FGVH 2PO6B 2FO4A 5CLWA 4YDJB 1SJHB 3F7VA