4IONA

Macrolepiota procera ricin b-like lectin (mpl)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
140
structure length
140
Chain Sequence
STQVSSGQTYKITNVKAGTVIDLSGEDNKSIIGYPYHSGKNQQWTFNWTGKAWTLRSASSGSYLGIEGTPADGTRLVAVNDPFEWHIWRDEANENAFRIFVPFTNYNLDLSGYGDTTPGTPVQLWWTWEGLHQTWTIDRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ricin B-like lectin
publication title Macrolepiota procera ricin B-like lectin (MPL)
rcsb
source organism Macrolepiota procera
molecule tags Sugar binding protein
total genus 36
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4ionA00
1JLYA 3UD9A 4LO7C 4YOLA 2FFVA 1II4A 2FFUA 3V0AA 4G1RA 4ZBVB 1BFFA 5BOWA 4OEGA 3FJDA 4L4HA 3CA1A 1ISXA 2RG9B 2KI4A 3BAOA 1NZKA 4ZGRB 3ZC8A 2AQZA 2QN4A 3P6IA 1AVUA 1TFMB 1PC8B 3FJAA 1DQOA 3OJVA 3FJJA 3BAHA 4JKQA 4AN6A 4DENA 4CJMA 2ZR1B 3VEQA 2FGFA 1T4QA 2Q3NB 2VXTI 3FJHA 1KNMA 2MC2A 2Z49A 3BRGC 1IJTA 4KBBA 3RTJB 3UD8A 4JRAA 5BXSA 3O4AA 4QKRA 1G82A 1S0EA 5FZYA 4EFRA 2GZBA 3NBEA 2DREA 2VLCA 4QKSA 4G6JA 5BP5C 2L5XA 1PWAA 3VT0A 3V0AB 3F1RA 4XFSA 3HALA 3I29B 1Z0HA 3OBTA 1IILA 4QBVA 3AKFA 3JRRA 5I1BA 2AAIB 3BAQA 2WRYA 3VSZA 1Z2VA 2UUSA 3OGGA 3IM5A 4LO2C 2NZ9A 2HWAA 2D44A 1EVTA 3OJ2A 4ZFYB 2DS0A 1NUNA 3EF2A 4D8HA 1S0CA 3Q7YA 3AZVA 3LLPA 3V79C 4USPA 4ZFUB 1V6XA 4F83A 4I4XA 2VUAA 4IZEA 1TWEA 3B9UA 3R4UA 4GOYA 4PC4A 3IIRA 5DZUA 2BEAA 2NM1A 3ZXDA 2ZQNA 3BA5A 3OJMA 4I0YA 4D0ZA 1W3GA 5F8SA 3FJBA 2VU9A 3I2AA 5B2HA 1HWNB 4L4IA 1BFGA 1JT3A 1TIEA 1DQGA 3HOMA 4OEFA 4H04A 3CA0A 1G9BA 4HA2A 2VXRA 4I4OA 4R6UB 3VT1A 3I2XA 3RMXA 3A23A 8I1BA 2Y9GA 5HPZA 5BQUC 5D61A 1VCLA 3S8JA 4G6MA 3N7KA 2VSAA 2D7RA 4OUJA 4ZKTB 1V6UA 4I96A 2HWMA 1RY7A 1AVXB 4J2YA 5JMCA 1N4KA 4DEPA 1V6WA 4LO1C 1DZDA 1ITBA 5FZZA 1S0BA 2F2FC 3MPPG 4GP3A 1R8NA 1K5UA 1L2HA 3WINC 2QYIB 1EYLA 3A21A 1CVSA 4QALA 4TLPA 3T8SA 4GOVA 5JLVA 4FGFA 5FNWA 3BA4A 1S0LA 3QR5A 2NP0A 3N7MA 4I4SA 2FDBM 5E24E 4I4PA 4I7IA 3WO2A 1QQLA 4XFUA 3H6RA 4Z8SB 1DIWA 3CU1B 4I1EA 2P39A 1FV3A 4P0LA 1BLDA 2YUGA 5DVHA 2VSEA 3UJ4A 1HWMB 3CA5A 1M2TB 2D23A 2KI6B 4I37A 4J23B 7I1BA 3HN1A 1S0GA 1DFQA 4J2SA 2F8XC 1PZZA 5EHAA 5DSSB 5EG6C 1SR4A 3ILAA 1G9CA 4OWKA 2LIEA 3Q7XA 1JTCA 1RZOB 4I4RA 3IM7A 3FJ9A 3RTIB 4QD2B 4A7KA 4ZLBB 1JLXA 3CAHA 1IHKA 6I1BA 5G00A 1ONKB 4JAWA 4KEJA 1MC9A 2ZQOA 3P6JA 1AFCA 4IONA 3WMUA 2R9KB 3AH1A 3H6RB 3AJ5A 2E4MA 41BIA 3FGMA 3BX1C 4II0A 1G9AA 1JT4A 3O44A 2HZ9A 3POKA 1D0HA 3O4OA 1XYFA 1A8DA 3CQAA 4KC3A 1FMZA 2K43A 1IRPA 4WBCA 1ISYA 3O5WB 4Z9WB 4IY9A 4AN7B 5GAQA 1RMLA 4H9WA 4EFQA 3FJKA 1XHBA 3MALA 3BA7A 4EKXB 3VSFA 1GGPB 2I1BA 1I1BA 1XG6A 2ERMA 3K1XA 1IOBA 4I4UA 5F8WA 4J2XA 4OWJA 3RMYA 2NTDA 2NVHA 2GO2A 1S0FA 3HSMA 3FJFA 1BA7A 1W3AA 5BXRA 3A07A 2HW9A 2AXMA 4IYBA 1DFCA 2MIBA 1JY0A 4QBCA 1P63A 3NBCA 2D1ZA 3O3QA 3WINA 1BFCA 4IHZA 4HR6C 5DUYA 3LTQA 3FUQA 4Q9GA 4XKIA 5BXPA 3CRIA 4X37A 1YTOA 3N7LA 4F34A 4LO0C 1HCDA 3RSJA 1CE7B 1QQKA 1YYNA 1OQLB 3NBDA 3W9TA 1ILR1 1JT7A 3AKIA 3AKGA 4LO8B 3PMEA 1R8OA 4OW4A 4FVVA 3F62B 2M49A 3AZWA 1AF9A 3SNVA 2X2TA 5D62A 3FJIA 2ET2A 4I1BA 4I6IA 4I4QA 3O49A 1FQ9A 4IQPA 4A7ZA 3AKHA 2K4AB 3Q7WA 3KMVA 9ILBA 3BAUA 4KEIA 4ZOTA 2FO1A 3BRDA 1RG8A 4LO3C 2MLLB 3UD7A 1TTUA 2P23A 2Y9FA 4LO7B 5BP5A 4JPZA 5BXTA 1QXMA 3HBWA 1YBIA 5F90A 2D20A 1BASA 3WO3A 2D22A 2J3PA 3H6SE 4I4VA 2KKIA 5FZUA 2LIQA 3OGFA 4JQ0A 2D7IA 3FJ8A 4XFTA 1WBCA 1Q1UA 3UJ0A 3BRFA 3PUBA 2D43A 4I3NA 4I8MA 4IY8A 31BIA 3VUOA 1J0SA 1HWOB 2X2SA 3FFZA 4LO2A 3P53A 1EV2A 3WO4A 1FGAA 4QO3A 1TOOA 2DRYA 3CRHA 3HMYA 1JT5A 4X38A 1I1EA 4ISQA 3UDAA 3AH2A 4D0TA 2BEBA 3V0BA 1YF8B 4QD2C 2RSTA 2Y9XE 3WA1A 3A22A 4OEEA 2NYYA 3IM6A 1DJSB 1Q03A 1ISWA 4I4YA 4EFPA 4GAIA 3VWCA 3WMVA 1AVAC 4EB2B 3AH4A 3BTAA 2RQ9A 1MD6A 1BFBA 1Z4SA 1HCEA 3O4DA 4ISRA 1PUUB 1V6VA 1FV2A 1WD4A 3ZC9A 1Q04A 3VT2A 1E0OA 2Y9WC 3CA6A 2WBCA 1AVWB 1XZZA 2KLLA 3FUOA 4USOA 3C9ZA 4Q91A 1JQZA 3H6QA 2DRZA 4X3AA 4P6AA 1TP0A 3OBRA 3PG0A 5BVPI 5BQUA 4DCKC 1HIBA 1HKNA 4OWLA 1TWMA 3NJ5A 1EPWA 4LO0A 2Q9XA 1SR4C 1ISZA 1AXMA 4EEEB 4GP0A 3FJCA 1SZ6B 4JKXB 3E8LC 4LO1A 3V0BB 4P0JA 3QYDA 2F2FA 1BARA 2XOAA 2Z48A 4JP0A 3BAGA 4G9MA 4I2SA 3AJ6A 3BADA 3BAVA 3JUTA 1F31A 5EC5A 1M16A 3D7WB 3FJEA 3NBNA 1YXWA 3BB2A 3O4BA 1BLAA 2E4MC 4KEKA 2ESUA 3PHZA 4J2KA 4ZA3B 1WD3A 2BFHA 4HJJA 1IRAX 4LO3A 1DLLA 1UPSA 3ZX7A 1T9FA 2KH2A 3IAGC 1K5VA 3N0KA 3N7JA 3S8KA 1ABRB 4Q9PA 1G9DA 3O4CA 4IZXA 4A7YA 1W3FA 21BIA 1DZCA 1FWUA 5D63A 3TC2A 1IT0A 4QC4A 1FN0A 3CA4A 4ZFWB 1FMMS 4G9NA 1PUMB 3ZXGA 1HWPB 5FNXA 2K8RA 4ENDA 4X39A 1FWVA 2IHOA 4P0KA 4GAFA 1WBAA 2IWTB 2D24A 5F8YA 1S0DA 2AFGA 3R4SA 3CRGA 3CA3A 1ISVA
chains in the Genus database with same CATH superfamily
1JLYA 3UD9A 4LO7C 4YOLA 2FFVA 1II4A 2FFUA 3V0AA 4G1RA 4ZBVB 1BFFA 5BOWA 4OEGA 3FJDA 4L4HA 3CA1A 1ISXA 2RG9B 2KI4A 3BAOA 1NZKA 4ZGRB 3ZC8A 2AQZA 2QN4A 3P6IA 1AVUA 1TFMB 1PC8B 3FJAA 1DQOA 3OJVA 3FJJA 3BAHA 4JKQA 4AN6A 4DENA 4CJMA 2ZR1B 4MZFB 3VEQA 2FGFA 1T4QA 2Q3NB 2VXTI 3FJHA 1KNMA 2MC2A 2Z49A 3BRGC 1IJTA 4KBBA 3RTJB 3UD8A 4JRAA 5BXSA 3O4AA 4QKRA 1G82A 1S0EA 5FZYA 4EFRA 2GZBA 3NBEA 2DREA 2VLCA 4QKSA 4G6JA 5BP5C 2L5XA 1PWAA 3VT0A 3V0AB 3F1RA 4XFSA 3HALA 3I29B 1Z0HA 3OBTA 1IILA 4QBVA 3AKFA 3JRRA 5I1BA 2AAIB 3BAQA 2WRYA 3VSZA 1Z2VA 2UUSA 3OGGA 3IM5A 4LO2C 2NZ9A 2HWAA 2D44A 1EVTA 3OJ2A 4ZFYB 2DS0A 1NUNA 3EF2A 4D8HA 1S0CA 3Q7YA 3AZVA 3LLPA 3V79C 4USPA 4ZFUB 1V6XA 4F83A 4I4XA 2VUAA 4IZEA 1TWEA 3B9UA 3R4UA 4GOYA 4PC4A 3IIRA 5DZUA 2BEAA 2NM1A 3ZXDA 2ZQNA 3BA5A 3OJMA 4I0YA 4D0ZA 1W3GA 5F8SA 3FJBA 2VU9A 3I2AA 5B2HA 1HWNB 4L4IA 1BFGA 1JT3A 1TIEA 1DQGA 3HOMA 4OEFA 4H04A 3CA0A 1G9BA 4HA2A 2VXRA 4I4OA 4R6UB 3VT1A 3I2XA 3RMXA 3A23A 8I1BA 2Y9GA 5HPZA 5BQUC 5D61A 1VCLA 3S8JA 4G6MA 3N7KA 2VSAA 2D7RA 4OUJA 4ZKTB 1V6UA 4I96A 2HWMA 1RY7A 1AVXB 4J2YA 5JMCA 1N4KA 4DEPA 1V6WA 4LO1C 1DZDA 1ITBA 5FZZA 1S0BA 2F2FC 3MPPG 4GP3A 1R8NA 1K5UA 1L2HA 3WINC 2QYIB 1EYLA 3A21A 1CVSA 4QALA 4TLPA 3T8SA 4GOVA 5JLVA 4FGFA 5FNWA 3BA4A 1S0LA 3QR5A 2NP0A 3N7MA 4I4SA 2FDBM 5E24E 4I4PA 4I7IA 3WO2A 1QQLA 4XFUA 3H6RA 4Z8SB 1DIWA 3CU1B 4I1EA 2P39A 1FV3A 4P0LA 1BLDA 2YUGA 5DVHA 2VSEA 3UJ4A 1HWMB 3CA5A 1M2TB 2D23A 2KI6B 4I37A 4J23B 7I1BA 3HN1A 1S0GA 1DFQA 4J2SA 2F8XC 1PZZA 5EHAA 5DSSB 5EG6C 1SR4A 3ILAA 1G9CA 4OWKA 2LIEA 4UY4A 3Q7XA 1JTCA 1RZOB 4I4RA 3IM7A 3FJ9A 3RTIB 4QD2B 4A7KA 4ZLBB 1JLXA 3CAHA 1IHKA 6I1BA 5G00A 1ONKB 4JAWA 4KEJA 1MC9A 2ZQOA 3P6JA 1AFCA 4IONA 3WMUA 2R9KB 3AH1A 3H6RB 3AJ5A 2E4MA 41BIA 3FGMA 3BX1C 4II0A 1G9AA 1JT4A 3O44A 2HZ9A 3POKA 1D0HA 3O4OA 1XYFA 1A8DA 3CQAA 4KC3A 1FMZA 2K43A 1IRPA 4WBCA 1ISYA 3O5WB 4Z9WB 4IY9A 4AN7B 5GAQA 1RMLA 4H9WA 4EFQA 3FJKA 1XHBA 3MALA 3BA7A 4EKXB 3VSFA 1GGPB 2I1BA 1I1BA 1XG6A 2ERMA 3K1XA 1IOBA 4I4UA 5F8WA 4J2XA 4OWJA 3RMYA 2NTDA 2NVHA 2GO2A 1S0FA 3HSMA 3FJFA 1BA7A 1W3AA 5BXRA 3A07A 2HW9A 2AXMA 4IYBA 1DFCA 2MIBA 1JY0A 4QBCA 1P63A 3NBCA 2D1ZA 3O3QA 3WINA 1BFCA 4IHZA 4HR6C 5DUYA 4MZHA 3LTQA 4H75A 3FUQA 4Q9GA 4XKIA 5BXPA 3CRIA 4X37A 1YTOA 3N7LA 4F34A 4LO0C 1HCDA 3RSJA 1CE7B 1QQKA 1YYNA 1OQLB 3NBDA 3W9TA 1ILR1 1JT7A 3AKIA 3AKGA 4LO8B 3PMEA 1R8OA 4OW4A 4FVVA 3F62B 2M49A 2NS2A 3AZWA 1AF9A 3SNVA 2X2TA 5D62A 3FJIA 2ET2A 4I1BA 4I6IA 4I4QA 3O49A 1FQ9A 4IQPA 4A7ZA 3AKHA 2K4AB 3Q7WA 3KMVA 9ILBA 3BAUA 4KEIA 4ZOTA 2FO1A 3BRDA 1RG8A 4LO3C 2MLLB 3UD7A 1TTUA 2P23A 2Y9FA 4LO7B 5BP5A 4JPZA 5BXTA 1QXMA 3HBWA 1YBIA 5F90A 2D20A 1BASA 3WO3A 2D22A 2J3PA 3H6SE 4I4VA 2KKIA 5FZUA 2LIQA 3OGFA 4JQ0A 2D7IA 3FJ8A 4XFTA 1WBCA 1Q1UA 3UJ0A 3BRFA 3PUBA 2D43A 4I3NA 4I8MA 4IY8A 31BIA 3VUOA 1J0SA 1HWOB 2X2SA 3FFZA 4LO2A 3P53A 1EV2A 3WO4A 1FGAA 4QO3A 1TOOA 2DRYA 3CRHA 3HMYA 1JT5A 4X38A 1I1EA 4ISQA 3UDAA 3AH2A 4D0TA 2BEBA 3V0BA 1YF8B 4QD2C 2RSTA 2Y9XE 3WA1A 3A22A 4OEEA 2NYYA 3IM6A 1DJSB 1Q03A 1ISWA 4I4YA 4EFPA 4GAIA 3VWCA 3WMVA 1AVAC 4EB2B 3AH4A 3BTAA 2RQ9A 1MD6A 1BFBA 1Z4SA 1HCEA 3O4DA 4ISRA 1PUUB 1V6VA 1FV2A 1WD4A 3ZC9A 1Q04A 3VT2A 1E0OA 2Y9WC 3CA6A 2WBCA 1AVWB 1XZZA 2KLLA 3FUOA 4USOA 3C9ZA 4Q91A 1JQZA 3H6QA 2DRZA 4X3AA 4P6AA 1TP0A 3OBRA 3PG0A 5BVPI 5BQUA 4DCKC 1HIBA 1HKNA 4OWLA 1TWMA 3NJ5A 1EPWA 4LO0A 2Q9XA 1SR4C 4MZGB 1ISZA 1AXMA 4EEEB 4GP0A 3FJCA 1SZ6B 4JKXB 3E8LC 4LO1A 3V0BB 4P0JA 3QYDA 2F2FA 1BARA 2XOAA 2Z48A 4JP0A 3BAGA 4G9MA 4I2SA 3AJ6A 3BADA 3BAVA 3JUTA 1F31A 5EC5A 1M16A 3D7WB 3FJEA 3NBNA 1YXWA 3BB2A 3O4BA 1BLAA 2E4MC 4KEKA 2ESUA 3PHZA 4J2KA 4ZA3B 1WD3A 2BFHA 4HJJA 1IRAX 4LO3A 1DLLA 1UPSA 3ZX7A 1T9FA 2KH2A 3IAGC 1K5VA 3N0KA 3N7JA 3S8KA 1ABRB 4Q9PA 1G9DA 3O4CA 4IZXA 4A7YA 1W3FA 21BIA 1DZCA 1FWUA 5D63A 3TC2A 1IT0A 4QC4A 1FN0A 3CA4A 4ZFWB 1FMMS 4G9NA 1PUMB 3ZXGA 1HWPB 5FNXA 2K8RA 4ENDA 4X39A 1FWVA 2IHOA 4P0KA 4GAFA 1WBAA 2IWTB 2D24A 5F8YA 1S0DA 2AFGA 3R4SA 3CRGA 3CA3A 1ISVA
chains in the Genus database with same CATH topology
1JLYA 3UD9A 4LO7C 4YOLA 2FFVA 1II4A 2FFUA 3V0AA 4G1RA 4ZBVB 1BFFA 5BOWA 4OEGA 3FJDA 4L4HA 3CA1A 1ISXA 2RG9B 2KI4A 3BAOA 1NZKA 4ZGRB 3ZC8A 2AQZA 2QN4A 3P6IA 1AVUA 1TFMB 1PC8B 3FJAA 1DQOA 3OJVA 3FJJA 3BAHA 4JKQA 4AN6A 4DENA 4CJMA 2ZR1B 4MZFB 3VEQA 2FGFA 1T4QA 2Q3NB 2VXTI 3FJHA 1KNMA 2MC2A 2Z49A 3BRGC 1IJTA 4KBBA 3RTJB 3UD8A 4JRAA 5BXSA 3O4AA 4QKRA 1G82A 1S0EA 5FZYA 4EFRA 2GZBA 3NBEA 2DREA 2VLCA 4QKSA 4G6JA 5BP5C 2L5XA 1PWAA 3VT0A 3V0AB 3F1RA 4XFSA 3HALA 3I29B 1Z0HA 3OBTA 1IILA 4QBVA 3AKFA 3JRRA 5I1BA 2AAIB 3BAQA 2WRYA 3VSZA 1Z2VA 2UUSA 3OGGA 3IM5A 4LO2C 2NZ9A 2HWAA 2D44A 1EVTA 3OJ2A 4ZFYB 2DS0A 1NUNA 3EF2A 4D8HA 1S0CA 3Q7YA 3AZVA 3LLPA 3V79C 4USPA 4ZFUB 1V6XA 4F83A 4I4XA 2VUAA 4IZEA 1TWEA 3B9UA 3R4UA 4GOYA 4PC4A 3IIRA 5DZUA 2BEAA 2NM1A 3ZXDA 2ZQNA 3BA5A 3OJMA 4I0YA 4D0ZA 1W3GA 5F8SA 3FJBA 2VU9A 3I2AA 5B2HA 1HWNB 4L4IA 1BFGA 1JT3A 1TIEA 1DQGA 3HOMA 4OEFA 4H04A 3CA0A 1G9BA 4HA2A 2VXRA 4I4OA 4R6UB 3VT1A 3I2XA 3RMXA 3A23A 8I1BA 2Y9GA 5HPZA 5BQUC 5D61A 1VCLA 3S8JA 4G6MA 3N7KA 2VSAA 2D7RA 4OUJA 4ZKTB 1V6UA 4I96A 2HWMA 1RY7A 1AVXB 4J2YA 5JMCA 1N4KA 4DEPA 1V6WA 4LO1C 1DZDA 1ITBA 5FZZA 1S0BA 2F2FC 3MPPG 4GP3A 1R8NA 1K5UA 1L2HA 3WINC 2QYIB 1EYLA 3A21A 1CVSA 4QALA 4TLPA 3T8SA 4GOVA 5JLVA 4FGFA 5FNWA 3BA4A 1S0LA 3QR5A 2NP0A 3N7MA 4I4SA 2FDBM 5E24E 4I4PA 4I7IA 3WO2A 1QQLA 4XFUA 3H6RA 4Z8SB 1DIWA 3CU1B 4I1EA 2P39A 1FV3A 4P0LA 1BLDA 2YUGA 5DVHA 2VSEA 3UJ4A 1HWMB 3CA5A 1M2TB 2D23A 2KI6B 4I37A 4J23B 7I1BA 3HN1A 1S0GA 1DFQA 4J2SA 2F8XC 1PZZA 5EHAA 5DSSB 5EG6C 1SR4A 3ILAA 1G9CA 4OWKA 2LIEA 4UY4A 3Q7XA 1JTCA 1RZOB 4I4RA 3IM7A 3FJ9A 3RTIB 4QD2B 4A7KA 4ZLBB 1JLXA 3CAHA 1IHKA 6I1BA 5G00A 1ONKB 4JAWA 4KEJA 1MC9A 2ZQOA 3P6JA 1AFCA 4IONA 3WMUA 2R9KB 3AH1A 3H6RB 3AJ5A 2E4MA 41BIA 3FGMA 3BX1C 4II0A 1G9AA 1JT4A 3O44A 2HZ9A 3POKA 1D0HA 3O4OA 1XYFA 1A8DA 3CQAA 4KC3A 1FMZA 2K43A 1IRPA 4WBCA 1ISYA 3O5WB 4Z9WB 4IY9A 4AN7B 5GAQA 1RMLA 4H9WA 4EFQA 3FJKA 1XHBA 3MALA 3BA7A 4EKXB 3VSFA 1GGPB 2I1BA 1I1BA 1XG6A 2ERMA 3K1XA 1IOBA 4I4UA 5F8WA 4J2XA 4OWJA 3RMYA 2NTDA 2NVHA 2GO2A 1S0FA 3HSMA 3FJFA 1BA7A 1W3AA 5BXRA 3A07A 2HW9A 2AXMA 4IYBA 1DFCA 2MIBA 1JY0A 4QBCA 1P63A 3NBCA 2D1ZA 3O3QA 3WINA 1BFCA 4IHZA 4HR6C 5DUYA 4MZHA 3LTQA 4H75A 3FUQA 4Q9GA 4XKIA 5BXPA 3CRIA 4X37A 1YTOA 3N7LA 4F34A 4LO0C 1HCDA 3RSJA 1CE7B 1QQKA 1YYNA 1OQLB 3NBDA 3W9TA 1ILR1 1JT7A 3AKIA 3AKGA 4LO8B 3PMEA 1R8OA 4OW4A 4FVVA 3F62B 2M49A 2NS2A 3AZWA 1AF9A 3SNVA 2X2TA 5D62A 3FJIA 2ET2A 4I1BA 4I6IA 4I4QA 3O49A 1FQ9A 4IQPA 4A7ZA 3AKHA 2K4AB 3Q7WA 3KMVA 9ILBA 3BAUA 4KEIA 4ZOTA 2FO1A 3BRDA 1RG8A 4LO3C 2MLLB 3UD7A 1TTUA 2P23A 2Y9FA 4LO7B 5BP5A 4JPZA 5BXTA 1QXMA 3HBWA 1YBIA 5F90A 2D20A 1BASA 3WO3A 2D22A 2J3PA 3H6SE 4I4VA 2KKIA 5FZUA 2LIQA 3OGFA 4JQ0A 2D7IA 3FJ8A 4XFTA 1WBCA 1Q1UA 3UJ0A 3BRFA 3PUBA 2D43A 4I3NA 4I8MA 4IY8A 31BIA 3VUOA 1J0SA 1HWOB 2X2SA 3FFZA 4LO2A 3P53A 1EV2A 3WO4A 1FGAA 4QO3A 1TOOA 2DRYA 3CRHA 3HMYA 1JT5A 4X38A 1I1EA 4ISQA 3UDAA 3AH2A 4D0TA 2BEBA 3V0BA 1YF8B 4QD2C 2RSTA 2Y9XE 3WA1A 3A22A 4OEEA 2NYYA 3IM6A 1DJSB 1Q03A 1ISWA 4I4YA 4EFPA 4GAIA 3VWCA 3WMVA 1AVAC 4EB2B 3AH4A 3BTAA 2RQ9A 1MD6A 1BFBA 1Z4SA 1HCEA 3O4DA 4ISRA 1PUUB 1V6VA 1FV2A 1WD4A 3ZC9A 1Q04A 3VT2A 1E0OA 2Y9WC 3CA6A 2WBCA 1AVWB 1XZZA 2KLLA 3FUOA 4USOA 3C9ZA 4Q91A 1JQZA 3H6QA 2DRZA 4X3AA 4P6AA 1TP0A 3OBRA 3PG0A 5BVPI 5BQUA 4DCKC 1HIBA 1HKNA 4OWLA 1TWMA 3NJ5A 1EPWA 4LO0A 2Q9XA 1SR4C 4MZGB 1ISZA 1AXMA 4EEEB 4GP0A 3FJCA 1SZ6B 4JKXB 3E8LC 4LO1A 3V0BB 4P0JA 3QYDA 2F2FA 1BARA 2XOAA 2Z48A 4JP0A 3BAGA 4G9MA 4I2SA 3AJ6A 3BADA 3BAVA 3JUTA 1F31A 5EC5A 1M16A 3D7WB 3FJEA 3NBNA 1YXWA 3BB2A 3O4BA 1BLAA 2E4MC 4KEKA 2ESUA 3PHZA 4J2KA 4ZA3B 1WD3A 2BFHA 4HJJA 1IRAX 4LO3A 1DLLA 1UPSA 3ZX7A 1T9FA 2KH2A 3IAGC 1K5VA 3N0KA 3N7JA 3S8KA 1ABRB 4Q9PA 1G9DA 3O4CA 4IZXA 4A7YA 1W3FA 21BIA 1DZCA 1FWUA 5D63A 3TC2A 1IT0A 4QC4A 1FN0A 3CA4A 4ZFWB 1FMMS 4G9NA 1PUMB 3ZXGA 1HWPB 5FNXA 2K8RA 4ENDA 4X39A 1FWVA 2IHOA 4P0KA 4GAFA 1WBAA 2IWTB 2D24A 5F8YA 1S0DA 2AFGA 3R4SA 3CRGA 3CA3A 1ISVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JLY A;  3UD9 A;  4LO7 C;  4YOL A;  2FFV A;  1II4 A;  2FFU A;  3V0A A;  4G1R A;  4ZBV B;  1BFF A;  5BOW A;  4OEG A;  3FJD A;  4L4H A;  3CA1 A;  1ISX A;  2RG9 B;  2KI4 A;  3BAO A;  1NZK A;  4ZGR B;  3ZC8 A;  2AQZ A;  2QN4 A;  3P6I A;  1AVU A;  1TFM B;  1PC8 B;  3FJA A;  1DQO A;  3OJV A;  3FJJ A;  3BAH A;  4JKQ A;  4AN6 A;  4DEN A;  4CJM A;  2ZR1 B;  3VEQ A;  2FGF A;  1T4Q A;  2Q3N B;  2VXT I;  3FJH A;  1KNM A;  2MC2 A;  2Z49 A;  3BRG C;  1IJT A;  4KBB A;  3RTJ B;  3UD8 A;  4JRA A;  5BXS A;  3O4A A;  4QKR A;  1G82 A;  1S0E A;  5FZY A;  4EFR A;  2GZB A;  3NBE A;  2DRE A;  2VLC A;  4QKS A;  4G6J A;  5BP5 C;  2L5X A;  1PWA A;  3VT0 A;  3V0A B;  3F1R A;  4XFS A;  3HAL A;  3I29 B;  1Z0H A;  3OBT A;  1IIL A;  4QBV A;  3AKF A;  3JRR A;  5I1B A;  2AAI B;  3BAQ A;  2WRY A;  3VSZ A;  1Z2V A;  2UUS A;  3OGG A;  3IM5 A;  4LO2 C;  2NZ9 A;  2HWA A;  2D44 A;  1EVT A;  3OJ2 A;  4ZFY B;  2DS0 A;  1NUN A;  3EF2 A;  4D8H A;  1S0C A;  3Q7Y A;  3AZV A;  3LLP A;  3V79 C;  4USP A;  4ZFU B;  1V6X A;  4F83 A;  4I4X A;  2VUA A;  4IZE A;  1TWE A;  3B9U A;  3R4U A;  4GOY A;  4PC4 A;  3IIR A;  5DZU A;  2BEA A;  2NM1 A;  3ZXD A;  2ZQN A;  3BA5 A;  3OJM A;  4I0Y A;  4D0Z A;  1W3G A;  5F8S A;  3FJB A;  2VU9 A;  3I2A A;  5B2H A;  1HWN B;  4L4I A;  1BFG A;  1JT3 A;  1TIE A;  1DQG A;  3HOM A;  4OEF A;  4H04 A;  3CA0 A;  1G9B A;  4HA2 A;  2VXR A;  4I4O A;  4R6U B;  3VT1 A;  3I2X A;  3RMX A;  3A23 A;  8I1B A;  2Y9G A;  5HPZ A;  5BQU C;  5D61 A;  1VCL A;  3S8J A;  4G6M A;  3N7K A;  2VSA A;  2D7R A;  4OUJ A;  4ZKT B;  1V6U A;  4I96 A;  2HWM A;  1RY7 A;  1AVX B;  4J2Y A;  5JMC A;  1N4K A;  4DEP A;  1V6W A;  4LO1 C;  1DZD A;  1ITB A;  5FZZ A;  1S0B A;  2F2F C;  3MPP G;  4GP3 A;  1R8N A;  1K5U A;  1L2H A;  3WIN C;  2QYI B;  1EYL A;  3A21 A;  1CVS A;  4QAL A;  4TLP A;  3T8S A;  4GOV A;  5JLV A;  4FGF A;  5FNW A;  3BA4 A;  1S0L A;  3QR5 A;  2NP0 A;  3N7M A;  4I4S A;  2FDB M;  5E24 E;  4I4P A;  4I7I A;  3WO2 A;  1QQL A;  4XFU A;  3H6R A;  4Z8S B;  1DIW A;  3CU1 B;  4I1E A;  2P39 A;  1FV3 A;  4P0L A;  1BLD A;  2YUG A;  5DVH A;  2VSE A;  3UJ4 A;  1HWM B;  3CA5 A;  1M2T B;  2D23 A;  2KI6 B;  4I37 A;  4J23 B;  7I1B A;  3HN1 A;  1S0G A;  1DFQ A;  4J2S A;  2F8X C;  1PZZ A;  5EHA A;  5DSS B;  5EG6 C;  1SR4 A;  3ILA A;  1G9C A;  4OWK A;  2LIE A;  3Q7X A;  1JTC A;  1RZO B;  4I4R A;  3IM7 A;  3FJ9 A;  3RTI B;  4QD2 B;  4A7K A;  4ZLB B;  1JLX A;  3CAH A;  1IHK A;  6I1B A;  5G00 A;  1ONK B;  4JAW A;  4KEJ A;  1MC9 A;  2ZQO A;  3P6J A;  1AFC A;  4ION A;  3WMU A;  2R9K B;  3AH1 A;  3H6R B;  3AJ5 A;  2E4M A;  41BI A;  3FGM A;  3BX1 C;  4II0 A;  1G9A A;  1JT4 A;  3O44 A;  2HZ9 A;  3POK A;  1D0H A;  3O4O A;  1XYF A;  1A8D A;  3CQA A;  4KC3 A;  1FMZ A;  2K43 A;  1IRP A;  4WBC A;  1ISY A;  3O5W B;  4Z9W B;  4IY9 A;  4AN7 B;  5GAQ A;  1RML A;  4H9W A;  4EFQ A;  3FJK A;  1XHB A;  3MAL A;  3BA7 A;  4EKX B;  3VSF A;  1GGP B;  2I1B A;  1I1B A;  1XG6 A;  2ERM A;  3K1X A;  1IOB A;  4I4U A;  5F8W A;  4J2X A;  4OWJ A;  3RMY A;  2NTD A;  2NVH A;  2GO2 A;  1S0F A;  3HSM A;  3FJF A;  1BA7 A;  1W3A A;  5BXR A;  3A07 A;  2HW9 A;  2AXM A;  4IYB A;  1DFC A;  2MIB A;  1JY0 A;  4QBC A;  1P63 A;  3NBC A;  2D1Z A;  3O3Q A;  3WIN A;  1BFC A;  4IHZ A;  4HR6 C;  5DUY A;  3LTQ A;  3FUQ A;  4Q9G A;  4XKI A;  5BXP A;  3CRI A;  4X37 A;  1YTO A;  3N7L A;  4F34 A;  4LO0 C;  1HCD A;  3RSJ A;  1CE7 B;  1QQK A;  1YYN A;  1OQL B;  3NBD A;  3W9T A;  1ILR 1;  1JT7 A;  3AKI A;  3AKG A;  4LO8 B;  3PME A;  1R8O A;  4OW4 A;  4FVV A;  3F62 B;  2M49 A;  3AZW A;  1AF9 A;  3SNV A;  2X2T A;  5D62 A;  3FJI A;  2ET2 A;  4I1B A;  4I6I A;  4I4Q A;  3O49 A;  1FQ9 A;  4IQP A;  4A7Z A;  3AKH A;  2K4A B;  3Q7W A;  3KMV A;  9ILB A;  3BAU A;  4KEI A;  4ZOT A;  2FO1 A;  3BRD A;  1RG8 A;  4LO3 C;  2MLL B;  3UD7 A;  1TTU A;  2P23 A;  2Y9F A;  4LO7 B;  5BP5 A;  4JPZ A;  5BXT A;  1QXM A;  3HBW A;  1YBI A;  5F90 A;  2D20 A;  1BAS A;  3WO3 A;  2D22 A;  2J3P A;  3H6S E;  4I4V A;  2KKI A;  5FZU A;  2LIQ A;  3OGF A;  4JQ0 A;  2D7I A;  3FJ8 A;  4XFT A;  1WBC A;  1Q1U A;  3UJ0 A;  3BRF A;  3PUB A;  2D43 A;  4I3N A;  4I8M A;  4IY8 A;  31BI A;  3VUO A;  1J0S A;  1HWO B;  2X2S A;  3FFZ A;  4LO2 A;  3P53 A;  1EV2 A;  3WO4 A;  1FGA A;  4QO3 A;  1TOO A;  2DRY A;  3CRH A;  3HMY A;  1JT5 A;  4X38 A;  1I1E A;  4ISQ A;  3UDA A;  3AH2 A;  4D0T A;  2BEB A;  3V0B A;  1YF8 B;  4QD2 C;  2RST A;  2Y9X E;  3WA1 A;  3A22 A;  4OEE A;  2NYY A;  3IM6 A;  1DJS B;  1Q03 A;  1ISW A;  4I4Y A;  4EFP A;  4GAI A;  3VWC A;  3WMV A;  1AVA C;  4EB2 B;  3AH4 A;  3BTA A;  2RQ9 A;  1MD6 A;  1BFB A;  1Z4S A;  1HCE A;  3O4D A;  4ISR A;  1PUU B;  1V6V A;  1FV2 A;  1WD4 A;  3ZC9 A;  1Q04 A;  3VT2 A;  1E0O A;  2Y9W C;  3CA6 A;  2WBC A;  1AVW B;  1XZZ A;  2KLL A;  3FUO A;  4USO A;  3C9Z A;  4Q91 A;  1JQZ A;  3H6Q A;  2DRZ A;  4X3A A;  4P6A A;  1TP0 A;  3OBR A;  3PG0 A;  5BVP I;  5BQU A;  4DCK C;  1HIB A;  1HKN A;  4OWL A;  1TWM A;  3NJ5 A;  1EPW A;  4LO0 A;  2Q9X A;  1SR4 C;  1ISZ A;  1AXM A;  4EEE B;  4GP0 A;  3FJC A;  1SZ6 B;  4JKX B;  3E8L C;  4LO1 A;  3V0B B;  4P0J A;  3QYD A;  2F2F A;  1BAR A;  2XOA A;  2Z48 A;  4JP0 A;  3BAG A;  4G9M A;  4I2S A;  3AJ6 A;  3BAD A;  3BAV A;  3JUT A;  1F31 A;  5EC5 A;  1M16 A;  3D7W B;  3FJE A;  3NBN A;  1YXW A;  3BB2 A;  3O4B A;  1BLA A;  2E4M C;  4KEK A;  2ESU A;  3PHZ A;  4J2K A;  4ZA3 B;  1WD3 A;  2BFH A;  4HJJ A;  1IRA X;  4LO3 A;  1DLL A;  1UPS A;  3ZX7 A;  1T9F A;  2KH2 A;  3IAG C;  1K5V A;  3N0K A;  3N7J A;  3S8K A;  1ABR B;  4Q9P A;  1G9D A;  3O4C A;  4IZX A;  4A7Y A;  1W3F A;  21BI A;  1DZC A;  1FWU A;  5D63 A;  3TC2 A;  1IT0 A;  4QC4 A;  1FN0 A;  3CA4 A;  4ZFW B;  1FMM S;  4G9N A;  1PUM B;  3ZXG A;  1HWP B;  5FNX A;  2K8R A;  4END A;  4X39 A;  1FWV A;  2IHO A;  4P0K A;  4GAF A;  1WBA A;  2IWT B;  2D24 A;  5F8Y A;  1S0D A;  2AFG A;  3R4S A;  3CRG A;  3CA3 A;  1ISV A; 
#chains in the Genus database with same CATH topology
 1JLY A;  3UD9 A;  4LO7 C;  4YOL A;  2FFV A;  1II4 A;  2FFU A;  3V0A A;  4G1R A;  4ZBV B;  1BFF A;  5BOW A;  4OEG A;  3FJD A;  4L4H A;  3CA1 A;  1ISX A;  2RG9 B;  2KI4 A;  3BAO A;  1NZK A;  4ZGR B;  3ZC8 A;  2AQZ A;  2QN4 A;  3P6I A;  1AVU A;  1TFM B;  1PC8 B;  3FJA A;  1DQO A;  3OJV A;  3FJJ A;  3BAH A;  4JKQ A;  4AN6 A;  4DEN A;  4CJM A;  2ZR1 B;  4MZF B;  3VEQ A;  2FGF A;  1T4Q A;  2Q3N B;  2VXT I;  3FJH A;  1KNM A;  2MC2 A;  2Z49 A;  3BRG C;  1IJT A;  4KBB A;  3RTJ B;  3UD8 A;  4JRA A;  5BXS A;  3O4A A;  4QKR A;  1G82 A;  1S0E A;  5FZY A;  4EFR A;  2GZB A;  3NBE A;  2DRE A;  2VLC A;  4QKS A;  4G6J A;  5BP5 C;  2L5X A;  1PWA A;  3VT0 A;  3V0A B;  3F1R A;  4XFS A;  3HAL A;  3I29 B;  1Z0H A;  3OBT A;  1IIL A;  4QBV A;  3AKF A;  3JRR A;  5I1B A;  2AAI B;  3BAQ A;  2WRY A;  3VSZ A;  1Z2V A;  2UUS A;  3OGG A;  3IM5 A;  4LO2 C;  2NZ9 A;  2HWA A;  2D44 A;  1EVT A;  3OJ2 A;  4ZFY B;  2DS0 A;  1NUN A;  3EF2 A;  4D8H A;  1S0C A;  3Q7Y A;  3AZV A;  3LLP A;  3V79 C;  4USP A;  4ZFU B;  1V6X A;  4F83 A;  4I4X A;  2VUA A;  4IZE A;  1TWE A;  3B9U A;  3R4U A;  4GOY A;  4PC4 A;  3IIR A;  5DZU A;  2BEA A;  2NM1 A;  3ZXD A;  2ZQN A;  3BA5 A;  3OJM A;  4I0Y A;  4D0Z A;  1W3G A;  5F8S A;  3FJB A;  2VU9 A;  3I2A A;  5B2H A;  1HWN B;  4L4I A;  1BFG A;  1JT3 A;  1TIE A;  1DQG A;  3HOM A;  4OEF A;  4H04 A;  3CA0 A;  1G9B A;  4HA2 A;  2VXR A;  4I4O A;  4R6U B;  3VT1 A;  3I2X A;  3RMX A;  3A23 A;  8I1B A;  2Y9G A;  5HPZ A;  5BQU C;  5D61 A;  1VCL A;  3S8J A;  4G6M A;  3N7K A;  2VSA A;  2D7R A;  4OUJ A;  4ZKT B;  1V6U A;  4I96 A;  2HWM A;  1RY7 A;  1AVX B;  4J2Y A;  5JMC A;  1N4K A;  4DEP A;  1V6W A;  4LO1 C;  1DZD A;  1ITB A;  5FZZ A;  1S0B A;  2F2F C;  3MPP G;  4GP3 A;  1R8N A;  1K5U A;  1L2H A;  3WIN C;  2QYI B;  1EYL A;  3A21 A;  1CVS A;  4QAL A;  4TLP A;  3T8S A;  4GOV A;  5JLV A;  4FGF A;  5FNW A;  3BA4 A;  1S0L A;  3QR5 A;  2NP0 A;  3N7M A;  4I4S A;  2FDB M;  5E24 E;  4I4P A;  4I7I A;  3WO2 A;  1QQL A;  4XFU A;  3H6R A;  4Z8S B;  1DIW A;  3CU1 B;  4I1E A;  2P39 A;  1FV3 A;  4P0L A;  1BLD A;  2YUG A;  5DVH A;  2VSE A;  3UJ4 A;  1HWM B;  3CA5 A;  1M2T B;  2D23 A;  2KI6 B;  4I37 A;  4J23 B;  7I1B A;  3HN1 A;  1S0G A;  1DFQ A;  4J2S A;  2F8X C;  1PZZ A;  5EHA A;  5DSS B;  5EG6 C;  1SR4 A;  3ILA A;  1G9C A;  4OWK A;  2LIE A;  4UY4 A;  3Q7X A;  1JTC A;  1RZO B;  4I4R A;  3IM7 A;  3FJ9 A;  3RTI B;  4QD2 B;  4A7K A;  4ZLB B;  1JLX A;  3CAH A;  1IHK A;  6I1B A;  5G00 A;  1ONK B;  4JAW A;  4KEJ A;  1MC9 A;  2ZQO A;  3P6J A;  1AFC A;  4ION A;  3WMU A;  2R9K B;  3AH1 A;  3H6R B;  3AJ5 A;  2E4M A;  41BI A;  3FGM A;  3BX1 C;  4II0 A;  1G9A A;  1JT4 A;  3O44 A;  2HZ9 A;  3POK A;  1D0H A;  3O4O A;  1XYF A;  1A8D A;  3CQA A;  4KC3 A;  1FMZ A;  2K43 A;  1IRP A;  4WBC A;  1ISY A;  3O5W B;  4Z9W B;  4IY9 A;  4AN7 B;  5GAQ A;  1RML A;  4H9W A;  4EFQ A;  3FJK A;  1XHB A;  3MAL A;  3BA7 A;  4EKX B;  3VSF A;  1GGP B;  2I1B A;  1I1B A;  1XG6 A;  2ERM A;  3K1X A;  1IOB A;  4I4U A;  5F8W A;  4J2X A;  4OWJ A;  3RMY A;  2NTD A;  2NVH A;  2GO2 A;  1S0F A;  3HSM A;  3FJF A;  1BA7 A;  1W3A A;  5BXR A;  3A07 A;  2HW9 A;  2AXM A;  4IYB A;  1DFC A;  2MIB A;  1JY0 A;  4QBC A;  1P63 A;  3NBC A;  2D1Z A;  3O3Q A;  3WIN A;  1BFC A;  4IHZ A;  4HR6 C;  5DUY A;  4MZH A;  3LTQ A;  4H75 A;  3FUQ A;  4Q9G A;  4XKI A;  5BXP A;  3CRI A;  4X37 A;  1YTO A;  3N7L A;  4F34 A;  4LO0 C;  1HCD A;  3RSJ A;  1CE7 B;  1QQK A;  1YYN A;  1OQL B;  3NBD A;  3W9T A;  1ILR 1;  1JT7 A;  3AKI A;  3AKG A;  4LO8 B;  3PME A;  1R8O A;  4OW4 A;  4FVV A;  3F62 B;  2M49 A;  2NS2 A;  3AZW A;  1AF9 A;  3SNV A;  2X2T A;  5D62 A;  3FJI A;  2ET2 A;  4I1B A;  4I6I A;  4I4Q A;  3O49 A;  1FQ9 A;  4IQP A;  4A7Z A;  3AKH A;  2K4A B;  3Q7W A;  3KMV A;  9ILB A;  3BAU A;  4KEI A;  4ZOT A;  2FO1 A;  3BRD A;  1RG8 A;  4LO3 C;  2MLL B;  3UD7 A;  1TTU A;  2P23 A;  2Y9F A;  4LO7 B;  5BP5 A;  4JPZ A;  5BXT A;  1QXM A;  3HBW A;  1YBI A;  5F90 A;  2D20 A;  1BAS A;  3WO3 A;  2D22 A;  2J3P A;  3H6S E;  4I4V A;  2KKI A;  5FZU A;  2LIQ A;  3OGF A;  4JQ0 A;  2D7I A;  3FJ8 A;  4XFT A;  1WBC A;  1Q1U A;  3UJ0 A;  3BRF A;  3PUB A;  2D43 A;  4I3N A;  4I8M A;  4IY8 A;  31BI A;  3VUO A;  1J0S A;  1HWO B;  2X2S A;  3FFZ A;  4LO2 A;  3P53 A;  1EV2 A;  3WO4 A;  1FGA A;  4QO3 A;  1TOO A;  2DRY A;  3CRH A;  3HMY A;  1JT5 A;  4X38 A;  1I1E A;  4ISQ A;  3UDA A;  3AH2 A;  4D0T A;  2BEB A;  3V0B A;  1YF8 B;  4QD2 C;  2RST A;  2Y9X E;  3WA1 A;  3A22 A;  4OEE A;  2NYY A;  3IM6 A;  1DJS B;  1Q03 A;  1ISW A;  4I4Y A;  4EFP A;  4GAI A;  3VWC A;  3WMV A;  1AVA C;  4EB2 B;  3AH4 A;  3BTA A;  2RQ9 A;  1MD6 A;  1BFB A;  1Z4S A;  1HCE A;  3O4D A;  4ISR A;  1PUU B;  1V6V A;  1FV2 A;  1WD4 A;  3ZC9 A;  1Q04 A;  3VT2 A;  1E0O A;  2Y9W C;  3CA6 A;  2WBC A;  1AVW B;  1XZZ A;  2KLL A;  3FUO A;  4USO A;  3C9Z A;  4Q91 A;  1JQZ A;  3H6Q A;  2DRZ A;  4X3A A;  4P6A A;  1TP0 A;  3OBR A;  3PG0 A;  5BVP I;  5BQU A;  4DCK C;  1HIB A;  1HKN A;  4OWL A;  1TWM A;  3NJ5 A;  1EPW A;  4LO0 A;  2Q9X A;  1SR4 C;  4MZG B;  1ISZ A;  1AXM A;  4EEE B;  4GP0 A;  3FJC A;  1SZ6 B;  4JKX B;  3E8L C;  4LO1 A;  3V0B B;  4P0J A;  3QYD A;  2F2F A;  1BAR A;  2XOA A;  2Z48 A;  4JP0 A;  3BAG A;  4G9M A;  4I2S A;  3AJ6 A;  3BAD A;  3BAV A;  3JUT A;  1F31 A;  5EC5 A;  1M16 A;  3D7W B;  3FJE A;  3NBN A;  1YXW A;  3BB2 A;  3O4B A;  1BLA A;  2E4M C;  4KEK A;  2ESU A;  3PHZ A;  4J2K A;  4ZA3 B;  1WD3 A;  2BFH A;  4HJJ A;  1IRA X;  4LO3 A;  1DLL A;  1UPS A;  3ZX7 A;  1T9F A;  2KH2 A;  3IAG C;  1K5V A;  3N0K A;  3N7J A;  3S8K A;  1ABR B;  4Q9P A;  1G9D A;  3O4C A;  4IZX A;  4A7Y A;  1W3F A;  21BI A;  1DZC A;  1FWU A;  5D63 A;  3TC2 A;  1IT0 A;  4QC4 A;  1FN0 A;  3CA4 A;  4ZFW B;  1FMM S;  4G9N A;  1PUM B;  3ZXG A;  1HWP B;  5FNX A;  2K8R A;  4END A;  4X39 A;  1FWV A;  2IHO A;  4P0K A;  4GAF A;  1WBA A;  2IWT B;  2D24 A;  5F8Y A;  1S0D A;  2AFG A;  3R4S A;  3CRG A;  3CA3 A;  1ISV A; 
#chains in the Genus database with same CATH homology
 1JLY A;  3UD9 A;  4LO7 C;  4YOL A;  2FFV A;  1II4 A;  2FFU A;  3V0A A;  4G1R A;  4ZBV B;  1BFF A;  5BOW A;  4OEG A;  3FJD A;  4L4H A;  3CA1 A;  1ISX A;  2RG9 B;  2KI4 A;  3BAO A;  1NZK A;  4ZGR B;  3ZC8 A;  2AQZ A;  2QN4 A;  3P6I A;  1AVU A;  1TFM B;  1PC8 B;  3FJA A;  1DQO A;  3OJV A;  3FJJ A;  3BAH A;  4JKQ A;  4AN6 A;  4DEN A;  4CJM A;  2ZR1 B;  4MZF B;  3VEQ A;  2FGF A;  1T4Q A;  2Q3N B;  2VXT I;  3FJH A;  1KNM A;  2MC2 A;  2Z49 A;  3BRG C;  1IJT A;  4KBB A;  3RTJ B;  3UD8 A;  4JRA A;  5BXS A;  3O4A A;  4QKR A;  1G82 A;  1S0E A;  5FZY A;  4EFR A;  2GZB A;  3NBE A;  2DRE A;  2VLC A;  4QKS A;  4G6J A;  5BP5 C;  2L5X A;  1PWA A;  3VT0 A;  3V0A B;  3F1R A;  4XFS A;  3HAL A;  3I29 B;  1Z0H A;  3OBT A;  1IIL A;  4QBV A;  3AKF A;  3JRR A;  5I1B A;  2AAI B;  3BAQ A;  2WRY A;  3VSZ A;  1Z2V A;  2UUS A;  3OGG A;  3IM5 A;  4LO2 C;  2NZ9 A;  2HWA A;  2D44 A;  1EVT A;  3OJ2 A;  4ZFY B;  2DS0 A;  1NUN A;  3EF2 A;  4D8H A;  1S0C A;  3Q7Y A;  3AZV A;  3LLP A;  3V79 C;  4USP A;  4ZFU B;  1V6X A;  4F83 A;  4I4X A;  2VUA A;  4IZE A;  1TWE A;  3B9U A;  3R4U A;  4GOY A;  4PC4 A;  3IIR A;  5DZU A;  2BEA A;  2NM1 A;  3ZXD A;  2ZQN A;  3BA5 A;  3OJM A;  4I0Y A;  4D0Z A;  1W3G A;  5F8S A;  3FJB A;  2VU9 A;  3I2A A;  5B2H A;  1HWN B;  4L4I A;  1BFG A;  1JT3 A;  1TIE A;  1DQG A;  3HOM A;  4OEF A;  4H04 A;  3CA0 A;  1G9B A;  4HA2 A;  2VXR A;  4I4O A;  4R6U B;  3VT1 A;  3I2X A;  3RMX A;  3A23 A;  8I1B A;  2Y9G A;  5HPZ A;  5BQU C;  5D61 A;  1VCL A;  3S8J A;  4G6M A;  3N7K A;  2VSA A;  2D7R A;  4OUJ A;  4ZKT B;  1V6U A;  4I96 A;  2HWM A;  1RY7 A;  1AVX B;  4J2Y A;  5JMC A;  1N4K A;  4DEP A;  1V6W A;  4LO1 C;  1DZD A;  1ITB A;  5FZZ A;  1S0B A;  2F2F C;  3MPP G;  4GP3 A;  1R8N A;  1K5U A;  1L2H A;  3WIN C;  2QYI B;  1EYL A;  3A21 A;  1CVS A;  4QAL A;  4TLP A;  3T8S A;  4GOV A;  5JLV A;  4FGF A;  5FNW A;  3BA4 A;  1S0L A;  3QR5 A;  2NP0 A;  3N7M A;  4I4S A;  2FDB M;  5E24 E;  4I4P A;  4I7I A;  3WO2 A;  1QQL A;  4XFU A;  3H6R A;  4Z8S B;  1DIW A;  3CU1 B;  4I1E A;  2P39 A;  1FV3 A;  4P0L A;  1BLD A;  2YUG A;  5DVH A;  2VSE A;  3UJ4 A;  1HWM B;  3CA5 A;  1M2T B;  2D23 A;  2KI6 B;  4I37 A;  4J23 B;  7I1B A;  3HN1 A;  1S0G A;  1DFQ A;  4J2S A;  2F8X C;  1PZZ A;  5EHA A;  5DSS B;  5EG6 C;  1SR4 A;  3ILA A;  1G9C A;  4OWK A;  2LIE A;  4UY4 A;  3Q7X A;  1JTC A;  1RZO B;  4I4R A;  3IM7 A;  3FJ9 A;  3RTI B;  4QD2 B;  4A7K A;  4ZLB B;  1JLX A;  3CAH A;  1IHK A;  6I1B A;  5G00 A;  1ONK B;  4JAW A;  4KEJ A;  1MC9 A;  2ZQO A;  3P6J A;  1AFC A;  4ION A;  3WMU A;  2R9K B;  3AH1 A;  3H6R B;  3AJ5 A;  2E4M A;  41BI A;  3FGM A;  3BX1 C;  4II0 A;  1G9A A;  1JT4 A;  3O44 A;  2HZ9 A;  3POK A;  1D0H A;  3O4O A;  1XYF A;  1A8D A;  3CQA A;  4KC3 A;  1FMZ A;  2K43 A;  1IRP A;  4WBC A;  1ISY A;  3O5W B;  4Z9W B;  4IY9 A;  4AN7 B;  5GAQ A;  1RML A;  4H9W A;  4EFQ A;  3FJK A;  1XHB A;  3MAL A;  3BA7 A;  4EKX B;  3VSF A;  1GGP B;  2I1B A;  1I1B A;  1XG6 A;  2ERM A;  3K1X A;  1IOB A;  4I4U A;  5F8W A;  4J2X A;  4OWJ A;  3RMY A;  2NTD A;  2NVH A;  2GO2 A;  1S0F A;  3HSM A;  3FJF A;  1BA7 A;  1W3A A;  5BXR A;  3A07 A;  2HW9 A;  2AXM A;  4IYB A;  1DFC A;  2MIB A;  1JY0 A;  4QBC A;  1P63 A;  3NBC A;  2D1Z A;  3O3Q A;  3WIN A;  1BFC A;  4IHZ A;  4HR6 C;  5DUY A;  4MZH A;  3LTQ A;  4H75 A;  3FUQ A;  4Q9G A;  4XKI A;  5BXP A;  3CRI A;  4X37 A;  1YTO A;  3N7L A;  4F34 A;  4LO0 C;  1HCD A;  3RSJ A;  1CE7 B;  1QQK A;  1YYN A;  1OQL B;  3NBD A;  3W9T A;  1ILR 1;  1JT7 A;  3AKI A;  3AKG A;  4LO8 B;  3PME A;  1R8O A;  4OW4 A;  4FVV A;  3F62 B;  2M49 A;  2NS2 A;  3AZW A;  1AF9 A;  3SNV A;  2X2T A;  5D62 A;  3FJI A;  2ET2 A;  4I1B A;  4I6I A;  4I4Q A;  3O49 A;  1FQ9 A;  4IQP A;  4A7Z A;  3AKH A;  2K4A B;  3Q7W A;  3KMV A;  9ILB A;  3BAU A;  4KEI A;  4ZOT A;  2FO1 A;  3BRD A;  1RG8 A;  4LO3 C;  2MLL B;  3UD7 A;  1TTU A;  2P23 A;  2Y9F A;  4LO7 B;  5BP5 A;  4JPZ A;  5BXT A;  1QXM A;  3HBW A;  1YBI A;  5F90 A;  2D20 A;  1BAS A;  3WO3 A;  2D22 A;  2J3P A;  3H6S E;  4I4V A;  2KKI A;  5FZU A;  2LIQ A;  3OGF A;  4JQ0 A;  2D7I A;  3FJ8 A;  4XFT A;  1WBC A;  1Q1U A;  3UJ0 A;  3BRF A;  3PUB A;  2D43 A;  4I3N A;  4I8M A;  4IY8 A;  31BI A;  3VUO A;  1J0S A;  1HWO B;  2X2S A;  3FFZ A;  4LO2 A;  3P53 A;  1EV2 A;  3WO4 A;  1FGA A;  4QO3 A;  1TOO A;  2DRY A;  3CRH A;  3HMY A;  1JT5 A;  4X38 A;  1I1E A;  4ISQ A;  3UDA A;  3AH2 A;  4D0T A;  2BEB A;  3V0B A;  1YF8 B;  4QD2 C;  2RST A;  2Y9X E;  3WA1 A;  3A22 A;  4OEE A;  2NYY A;  3IM6 A;  1DJS B;  1Q03 A;  1ISW A;  4I4Y A;  4EFP A;  4GAI A;  3VWC A;  3WMV A;  1AVA C;  4EB2 B;  3AH4 A;  3BTA A;  2RQ9 A;  1MD6 A;  1BFB A;  1Z4S A;  1HCE A;  3O4D A;  4ISR A;  1PUU B;  1V6V A;  1FV2 A;  1WD4 A;  3ZC9 A;  1Q04 A;  3VT2 A;  1E0O A;  2Y9W C;  3CA6 A;  2WBC A;  1AVW B;  1XZZ A;  2KLL A;  3FUO A;  4USO A;  3C9Z A;  4Q91 A;  1JQZ A;  3H6Q A;  2DRZ A;  4X3A A;  4P6A A;  1TP0 A;  3OBR A;  3PG0 A;  5BVP I;  5BQU A;  4DCK C;  1HIB A;  1HKN A;  4OWL A;  1TWM A;  3NJ5 A;  1EPW A;  4LO0 A;  2Q9X A;  1SR4 C;  4MZG B;  1ISZ A;  1AXM A;  4EEE B;  4GP0 A;  3FJC A;  1SZ6 B;  4JKX B;  3E8L C;  4LO1 A;  3V0B B;  4P0J A;  3QYD A;  2F2F A;  1BAR A;  2XOA A;  2Z48 A;  4JP0 A;  3BAG A;  4G9M A;  4I2S A;  3AJ6 A;  3BAD A;  3BAV A;  3JUT A;  1F31 A;  5EC5 A;  1M16 A;  3D7W B;  3FJE A;  3NBN A;  1YXW A;  3BB2 A;  3O4B A;  1BLA A;  2E4M C;  4KEK A;  2ESU A;  3PHZ A;  4J2K A;  4ZA3 B;  1WD3 A;  2BFH A;  4HJJ A;  1IRA X;  4LO3 A;  1DLL A;  1UPS A;  3ZX7 A;  1T9F A;  2KH2 A;  3IAG C;  1K5V A;  3N0K A;  3N7J A;  3S8K A;  1ABR B;  4Q9P A;  1G9D A;  3O4C A;  4IZX A;  4A7Y A;  1W3F A;  21BI A;  1DZC A;  1FWU A;  5D63 A;  3TC2 A;  1IT0 A;  4QC4 A;  1FN0 A;  3CA4 A;  4ZFW B;  1FMM S;  4G9N A;  1PUM B;  3ZXG A;  1HWP B;  5FNX A;  2K8R A;  4END A;  4X39 A;  1FWV A;  2IHO A;  4P0K A;  4GAF A;  1WBA A;  2IWT B;  2D24 A;  5F8Y A;  1S0D A;  2AFG A;  3R4S A;  3CRG A;  3CA3 A;  1ISV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...