4IOTA

High-resolution structure of triosephosphate isomerase from e. coli
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
254
structure length
254
Chain Sequence
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Triosephosphate isomerase is a common crystallization contaminant of soluble His-tagged proteins produced in Escherichia coli.
pubmed doi rcsb
molecule tags Isomerase
total genus 94
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4iotA00
4CNPA 3NOEA 1LYXA 3N19B 2R14A 3TMQA 1WV2A 2CLFA 4JX4A 3TXZA 3TR2A 3VFLA 3NQEA 3OG3A 4A21A 2ZZ3A 3NL2A 4HNVA 1R2TA 1QPNA 3W76A 3F4WA 3LXAA 3MW7A 4FF7A 3W75A 1IF2A 2RHGA 2R91A 5J5DA 1GYLA 1P1XA 3PBWA 4S2BA 4AWUA 3GYEA 4JYFA 2A1YA 4RJEA 3P80A 3L5LA 1QR7A 3T44A 3TKFA 3LB0A 3DH7A 5EYWA 4O15A 2YSWA 4JD4A 5CPOA 2WOQA 2E6FA 4GRSA 3W3OA 1T96A 1FCVA 1ICSA 1SO4A 3QFEA 1QPOA 4NQ1A 1SW7A 3NL6A 5G1YA 1B4EA 1KFEA 3QMSA 1C29A 7TIMA 3FOKA 3W7GA 3C56A 1DOSA 1JCNA 2ZRWA 2DJXA 2JK2A 1OFAA 1VHCA 2CLHA 1GVQA 5AHFA 1GG1A 4EF9A 3BGGA 4O8RA 1XBXA 3P5ZA 3VI2A 2W6RA 3NO5A 3LERA 1KFLA 2CZEA 2VEIA 4HN4A 2QEZA 3LOTA 2X1TA 3EWZA 5KMYA 5AHMA 3S1UA 3EXSA 3TUUA 3OA3A 1LRTA 4MFDA 2V81A 1PHQA 1W5MA 3BLIA 3P74A 4JYEA 1HFBA 2FDSA 3GVGA 1VYRA 4K7VA 1Q6LA 1LLWA 1W5OA 4OE7A 1UASA 4GE8A 1YTDA 3W72A 3STGA 5K4XA 4BK9A 4UTTA 3O1NA 1PL9A 1L6SA 2OT1A 3M5ZA 5U4NA 1XDLA 4LRTA 4OT7A 4CCEA 1LBLA 1WXJA 3NVTA 3W85A 3HGOA 1H7NA 5BMWA 3JR2A 3MMTA 1GVRA 4CQ9A 3W83A 5HNRA 4N9BA 4CQAA 4MPQA 2BLEA 3BW2A 3WJSA 4Z08A 4ZVJA 3W1MA 1LRNA 5LGZA 4UMAA 3A24A 1D3GA 1BEUA 4LU0A 5LNUA 3FA5A 5TIMA 3FKKA 4JGDA 2BXVA 4YCOA 5SWUA 2B0MA 3TH6A 4GUHA 2V2CA 1MEWA 1K7XA 4XBKA 5F2IA 3DFSA 2CLEA 3PVFA 4GUIA 4ADUA 1KM4A 4RZ5A 4N9DA 2FLIA 4ADTA 2JGQA 1W3IA 1L6YA 1WQ5A 1AMKA 5FEWA 3W70A 5I3GA 4JY8A 2XFWA 1YTKA 4WXZA 1G4SA 3T4CA 2GJLA 5AFDA 1T99A 1XUUA 3ATYA 1VCVA 3TU9A 3MHFA 2RH9A 4XKYA 4LV4A 1TPWA 2TRSA 4M6PA 2DZVA 3HGSA 4JIPA 3TA6A 3IV3A 2PRLA 4PCFA 4XBSA 3NQ6A 2QCLA 1PVNA 4XTIA 4DPQA 1IXQA 4NJIA 2FIQA 2QCFA 3ZFHA 1T0OA 1NSJA 3SI9A 1F7BA 1QWGA 2UV8G 1XM3A 2NUYA 5A8GA 1TJPA 5C2XA 2A21A 5D2YA 3EKZA 3ZWSA 2ABAA 3NPUA 5KSWA 3N9SA 4ONVA 2CZ5A 2HSAA 1AK5A 2H3BA 2QJIA 3TV8A 3GDTA 2AQWA 4LVFA 5ABTA 4C1KA 1CI1A 1U5JA 1F05A 1FXQA 4M5PA 5CGQA 2Z1BA 3OVRA 4JX5A 1YXDA 4JTFA 1G7VA 4EF8A 3EWXA 3IGXA 4RV8A 4MFEA 2NWSA 2VFGA 4YLWA 1O94A 2CZFA 1OFOA 1YPFA 2A6LA 4R7JA 3DFNA 5HR6A 1FWRA 4QJ1A 4O17A 2CLLA 3QPZA 4TMCA 1I8JA 2QJGA 4PEKA 3PM6A 1J5TA 2GOUA 3RLUA 4K38A 2QCMA 4K7YA 2XN1A 3QSTA 1H1YA 4K8HA 1DQXA 4IX0A 4LW7A 1TJRA 5D33A 3W7QA 4B5NA 2C14A 2CU0A 3NGJA 1OHLA 2JBMA 1DQWA 1UB3A 3KOFA 4JDBA 3KVMA 4UTWC 3MO7A 2Y63A 1W5PA 1SSDA 1TRIA 3DAQA 4LY8A 3TAKA 3QH2A 4HNTA 4XKYB 2WSRA 4WY0F 2QF7A 5DN1A 3M47A 4O0ZA 5CKSA 3TFXA 1W5NA 4C1LA 4JEQA 3VE9A 2E5DA 1ZAHA 5D03A 4GUFA 4QNEA 2OZ0A 3MI2A 3DKLA 3LCLA 1TPH1 2OJPA 3I68A 1KW1A 5K3VA 4OV9A 3QEZA 1G7UA 1TTJA 5TBOA 1B3OA 4IX2A 4E2DA 4JXCA 5CZSA 3GDLA 3G1AA 1YLVA 1THFD 2VOMA 2Z6JA 4DO5A 1AW5A 1F73A 5D2TA 3LXBA 3W1NA 1WBHA 3CM4A 4MLJA 2QCNA 1VLIA 2J9XA 5K7JA 3L5AA 4QAIA 1SW3A 3NM1A 4XQ6A 3DFPA 1S5TA 1MO0A 3VE7A 5G2IA 3L21A 3HO8A 3DGRA 3NQ2A 1JQVA 1XDMA 3W23A 3W7JA 3C6CA 1J2WA 5AYZA 3KHJA 2EF9A 5HMSA 2Y89A 1ME8A 2Y7FA 5EA9A 4QIUA 5FEPA 3MBDA 5D04C 1TREA 2QUTA 5I3FA 4ZMGA 1LLZA 3TAOA 1WBJA 1LZOA 3G8RA 2Y70A 4TU1A 4WZHA 4JDYA 4WD0A 2LLEA 1QO5A 1DHPA 4N6EA 3NQMA 3Q94A 4RXFA 3TE9A 3CLMA 1FUYA 2NX3A 1ZAIA 3WJYA 2QCHA 1TV5A 4O1CA 3CEPA 4N4QA 4UTIA 3PS7A 3D0CA 4FXRA 4XWUA 4R34A 3OEXA 4S2CA 5HWNA 2YFOA 3NQCA 1YTEA 5F1VA 1TTIA 3N34A 2DZTA 4LC6A 1TPUA 2Y6ZA 4JYDA 4O4WA 3W88A 3HGRA 5LNVA 2V2DA 4DO4A 1P0KA 4MYXA 5F2LA 1UUMA 2WQPA 1SFLA 1GQNA 3NQ7A 1DV7A 1SQ7A 4GNJA 4UMCA 2NX1A 1VS1A 1ZY9A 5KZDA 1RQHA 4Z0SA 1L9WA 1V7YA 3UYCA 4FIQA 4UTHA 1A5SA 3C52A 2E5CA 3KVLA 4P61A 1Q45A 5G5IA 3KVJA 2NUWA 3FJLA 5CPNA 3UY8A 1GTEA 2DORA 1F74A 1HTIA 5MHBA 4N6FA 3CWOX 1QOQA 1AW2A 2QUVA 3HPXA 2NV2A 3HPZA 1BWKA 3LBMA 1DJNA 3MP3A 3BV4A 3P5YA 3MHUA 1ADOA 3PUOA 1SU5A 3M1ZA 1TTPA 1YDVA 2FQIA 3W1XA 3SGUA 3IGSA 4UFLA 3W86A 3N9RA 2Y7DA 4MKNA 4G1KA 2VEMA 1ZJIA 2YW3A 5I3JA 4LNYA 1VLWA 4ZQOA 5LHEA 1UBSA 1I2RA 1I2QA 5D02A 1N8FA 2WJZA 1ZAJA 4MOZA 1HO1A 1SUXA 1W8SA 4Z1AA 4TO8A 1GVSA 3W1QA 5CPMA 2ZRZA 1KM6A 3W7NA 2YW4A 5EY5A 2ZZ4A 4AXKA 2F7FA 1QOPA 4CNNA 2A7RA 3TDFA 1TTQA 2HS8A 4M19A 4GWEA 4O12A 4I9AA 3DFQA 4AHQA 3Q2DA 4K8EA 5AB3A 3KVKA 4BI7A 4ZQPA 3P81A 3LXCA 4UFMA 1QNVA 1GJPA 4RZ6A 3LHUA 1C8VA 1RR2A 3CWNA 5FEXA 1TQJA 3M5YA 4IMCA 4EIVA 4LTSA 1H7XA 5TQLA 1G4PA 3BG5A 1OYAA 5D2WA 5EBUA 4H3DA 3LV6A 4FXSA 1VJIA 5EMUA 4OBTA 1Z41A 4GXMA 1H5YA 4S1FA 2A85A 3E02A 2CWNA 1WOBA 5BRBA 4RLIA 3OBKA 3GR8A 3UXAA 1OFQA 1BKSA 2O7QA 5D38A 3I7SA 1K8ZA 3OVPA 1TPFA 5KZMA 2EGZA 3K30A 2H6RA 2ZDRA 2WPBA 2PRMA 3IIVA 3W87A 3BO9A 4BF9A 3W74A 4BI5A 3U6WA 2VFDA 1NFBA 2Y88A 3W73A 4TR9A 1KFBA 1HG3A 4NU7A 3W84A 1SSGA 3MJYA 4O52A 1Z48A 3I65A 4O1BA 3U2OA 2F84A 3MYPA 1W3TA 1KTBA 2YXGA 3C2VA 4XUGA 4YWIA 3LTPA 4UFIA 5HWJA 4IMDA 1FWWA 5AC7A 1SFJA 2CLIA 3W7RA 3NQGA 3GAYA 4Y96A 1KV5A 3FKRA 5L6UA 4IMEA 4O28A 4JIQA 2CFFA 3NQFA 3ZR4A 1IXOA 3P62A 2DZSA 1S3HA 4PODA 3G1XA 3TC6A 3QPYA 5KZEA 3PY2A 4O4VA 1YDOA 1H60A 3HJZA 1I2NA 4FX6M 1JRBA 1PHWA 4RCXA 4DEFA 2KZHA 5DELA 5F4SA 1VPXA 3H55A 3M6YA 3QZEA 1F6PA 3L5MA 5FF7A 3IVSA 4CQ8A 4KFNA 1JCJA 1V5XA 3B8DA 6ALDA 1FWNA 3GNDA 5LSMA 1B57A 3W7DA 1TQXA 1JRCA 2Z6IA 1L2UA 4NX5A 2EAWA 4WOQA 1KFCA 4X3ZA 1KA9F 3CC1A 3W22A 1UUOA 2JGYA 1KTNA 1QCWA 3LCGA 5LNRA 3PSWA 4UFJA 4K6AA 4DBEA 3EXRA 4YCPA 3WFAA 3NL3A 3I6RA 4O50A 1UJPA 2BX7A 1FX6A 4DO6A 3R5EA 1A53A 5T26A 1IXPA 1ZFJA 3RMJA 3C2FA 4UTWA 3F03K 3DKJA 3B4UA 4WY0A 1XL9A 1JUEA 1TV8A 2ZZ7A 1Z42A 1QPQA 3QMTA 1FDZA 1YXCA 3W7KA 5LHFA 3OHIA 1A50A 2HTMA 4FX7A 3DHFA 3W6YA 3MBFA 5DXYA 1F2JA 1KFJA 3THAA 4DF0A 5G4EA 3BARA 3DXIA 3L0NA 5K2ZA 3M0ZA 2WKJA 4NXKA 2A5HA 1W37A 2BSLA 3NQAA 4A2RA 3TJLA 3CPRA 4E2BA 3G0SA 1SO6A 3PB0A 4NJGA 2E6AA 3LTSA 4O11A 5LGXA 5A5WA 4KFOA 3WJXA 5C5YA 1ZNNA 2RKXA 3W1RA 1KLYA 3M41A 3O6DA 4E0CA 3B03A 4NNBA 1VGAA 4OHQA 4QSHA 5F2GA 3W7PA 1OYCA 2A0NA 3LHTA 3LTYA 3IRDA 1WA3A 3LRKA 3PBVA 3KRSA 1OX6A 2C15A 3EWWA 3N14A 3TSBA 3BW3A 3PR2A 3MP5A 2J9YA 2ISWA 1UCWA 3CEUA 3HGJA 4UNLA 3HMJG 5BW6A 3H54A 1NEYA 1EWDA 1G67A 2E6YA 1LROA 3N73A 4UTJA 1JQXA 3LHYA 5HQEA 8TIMA 2FB3A 1CX9A 1O95A 3W2JA 3W1AA 1H61A 1VC4A 4UUIA 3MI6A 2FPTA 2YZRA 1X8FA 3GB6A 2ZFAA 4WJEA 3LCFA 2W0UA 1LDCA 1FDJA 3TROA 1DORA 3ABOA 1EWEA 3W71A 1OFRA 1OF6A 3E9AA 3WK0A 1Z44A 2C18A 4M6VA 3T40A 1XFBA 3ZWTA 4O10A 1TPEA 3RNDA 1VQTA 3GKFA 3P8IA 1LORA 4DF2A 2V30A 4WY0B 2OCZA 3SZ8A 1KM0A 4YMZA 5F2MA 3DHDA 3GK0A 4AMAA 3PWAA 3LCHA 4ZL1A 4ZZ9A 1IGSA 3DU0A 4WQ6A 4P2VA 1OX5A 3SW6A 5DLCA 3MI3A 2X1UA 1EEPA 4I7UA 1X1OA 3OIXA 4AHPA 4CCDA 1KV8A 3UZJA 4BWLA 5GVJA 4EVZA 2B7OA 3NQDA 4O1AA 2BTMA 1EX5A 1OABA 1VR6A 2QCGA 3R12A 4UTUA 4IMGA 4CNOA 4O1DA 3TW7A 1I45A 4MZ1A 2GQ8A 2VELA 4CLMA 2YFNA 2G95A 3N3MA 1F6KA 3G3MA 4FNQA 2VEKA 3LV5A 3RF9A 2RDWA 3ABRA 3LGEA 3VKJA 1NF0A 1JCYA 2B4GA 4Y9AA 4LT9A 3PBYA 4HNNA 1A5AA 3CQ0A 1KBJA 3NZRA 1RQBA 4N02A 4RX0A 1LOQA 4UTLA 3N2XA 4FNUA 2Y61A 3O63A 2QCDA 4KWWA 1D9EA 1NAL1 2FPYA 3L68A 4MLRA 4JY9A 4LUIA 2NXIA 1PCWA 1D3HA 1R46A 4GUGA 2ZQ0A 1OVDA 4JTGA 1SZFA 3PBUA 3IIXA 3I7RA 5G1TA 1H51A 1H7WA 3AO0A 3L2IA 4O19A 3T78A 1O5KA 3M5VA 5K9XA 5KINA 2NUXA 3SECA 2CLKA 1AL7A 5C6MA 2QKFA 2NXHA 4GUJA 3BG3A 2DJLA 3A5VA 2P0OA 3QQ1A 3SIZA 3T7VA 2C1HA 5BMXA 4PTNA 4NXSA 4TMBA 3GXTA 3W9ZA 1R30A 1C9DA 1JUBA 2WNQA 3VCRA 4FO4A 4JTJA 1FCQA 1TRDA 1DL3A 3G1SA 4BFAA 3UWZA 1YPIA 4HIBA 2NZLA 2OX1A 2JKPA 3MP4A 4RK8A 4QISA 3NZ1A 3HBLA 4HNUA 5LNWA 3HQ1A 3M9YA 4U4MA 1XXXA 1FY6A 3E0IA 4O54A 1WX0A 2I14A 1LCOA 4W9TA 1WAUA 4UCGA 3G3DA 4I7WA 1AG1O 3TSDA 3YPIA 1R2RA 2G5WA 2J88A 3T55A 1Q6QA 2XN2A 3LLFA 3DFTA 2A4AA 5J5RA 1HUVA 2E68A 4Z1BA 5AC6A 2QUUA 3EX1A 1OF8A 3CB8A 4KFPA 4H6KA 1OFEA 2CLMA 3BLFA 4AF0A 5I3IA 4JR5A 4FX8A 5G4WA 1MEHA 2DZUA 2ZA3A 3WK1A 3STFA 2V0TA 3W7OA 1M7OA 2PRHA 3JS3A 4AVFA 1E51A 1OYBA 2I9EA 2VFIA 1ZALA 1EUNA 5AHIA 3GIYA 3B04A 3UZ5A 4MY1A 2RFGA 2BWGA 4RKAA 2ZYFA 2ZTKA 3KXQA 3W7IA 2QCDB 3KX6A 5FF0A 2CZDA 5DCEA 1P4CA 1O5XA 3NM3A 4IGHA 3NR0A 3O06A 3STCA 1LTDA 4UIOA 4UR7A 2A6NA 2XN0A 1SO5A 3G1VA 4UR8A 1QAPA 4HPJA 3KRZA 3DI1A 4I7VA 3W7EA 3MUXA 4DXVA 4O57A 5EPDA 3W2MA 1RPXA 1TO3A 1FXPA 2P1FA 4BWLC 4KWVA 4Y8FA 2ISSA 4NUWA 3PUEA 4LS1A 4UFKA 5K9DA 4GFSA 3GR7A 3M43A 3PG9A 3USBA 3L65A 3TC7A 2TSYA 2TMDA 2QDHA 4AWTA 4D2JA 1W54A 1N55A 4O53A 5HR7A 3TW6A 3NNTA 4Q33A 1GOXA 3LCXA 2HS6A 2JKEA 3MWAA 4LWWA 1P0NA 2H90A 1KM1A 1WOAA 3L9CA 4O16A 3HG5A 2WO5A 3HG4A 3DBPA 1VYPX 2CLOA 1M7PA 3S9YA 1LM1A 3P67A 3LM7A 3FYOA 1N7KA 1XUZA 4FNRA 3EWBX 1TB3A 4FIRA 3S5YA 1G4EA 1MSSA 4ZQMA 2VEPA 2YX0A 2Y7EA 4AF0B 2FTPA 1Q3NA 2QJHA 3ELFA 3QW3A 5FESA 3CHVA 5DCBA 1VH7A 3LRLA 2GJNA 1SO3A 3ATZA 3O16A 1JVNA 4XTDA 3UWQA 4A3UA 2VFFA 3B0PA 3UPBA 1VCGA 4GBUA 1FQ0A 2ALDA 4H4IA 4MZYA 2VKZG 3FEMA 3M16A 3NQVA 4ZQNA 3W7HA 3E96A 3EWYA 3H53A 5C54A 4RZ4A 1B4KA 3SGZA 2Z0IA 5HULA 2Q3RA 3TCEA 4LRSA 4K36A 3P60A 2A7NA 3IEBA 1KTCA 5FEZA 4IQLA 3V75A 1VHNA 2GQAA 4QITA 1G6CA 1TPC1 3U8GA 4LS2A 3HF3A 4MZ8A 1A5CA 2ZCGA 1KBIA 4DBDA 4FB7A 5LNSA 1F5ZA 2HMCA 4LVDA 5BOOA 1I4NA 3P82A 1OFBA 1PIIA 4A2SA 3M44A 3ABSA 3OVQA 3W2KA 4JTUA 4ZQRA 4X9SA 2EPHA 1TPB1 4IPJA 1ZCOA 1OG0A 3M7WA 2E09A 3W1TA 2ZRXA 5H91A 1LBMA 1VZWA 4IUOA 2C16A 3O8AA 1M6JA 5L9FA 2WNNA 2B7QA 1XBVA 2Y7GA 4ZQCA 5G2HA 1SR9A 1TV7A 2VXNA 4R53A 1EPXA 2H3DA 1FWSA 2ZRVA 3UWUA 1RD5A 4LVGA 2DZXA 3C2RA 2G96A 3UWVA 2Q8ZA 1XKYA 4LS0A 4YL2A 1ONRA 3QJAA 1ZENA 1QDSA 3QF0A 3W07A 1OX4A 4IWWA 1ALDA 3FIGA 1SZNA 4MVAA 5EL1A 2RDUA 1QO2A 3W1LA 1P5BA 3CT7A 2E77A 4JTTA 3TIMA 3RFAA 3UY7A 4AB4A 3NA8A 5BNKA 3GDKA 3LRMA 4JTIA 1G69A 1TCDA 2ZZ6A 2DP3A 4FHAA 3Q58A 3BG9A 2NLIA 4EWND 3EX2A 1LRQA 2Q3OA 3F1QA 1JR1A 3BLEA 2BZNA 2GQ9A 4HSOA 2H8XA 3S0CA 2YR1A 3GKAA 1FWTA 4ICNA 2V82A 1YADA 4IOTA 4JX6A 1XCFA 4MY8A 5HWMA 1O4UA 1RQEA 2O7SA 2ZA2A 3LLDA 5CG7A 2J9ZA 2CW6A 3B06A 1YYAA 1L6WA 4L4MA 1H7OA 2JKAA 4M7TA 2E5BA 3IIPA 5FI8A 4U28A 2C3ZA 3MYOA 4LUJA 2I1OA 3S42A 3SY5A 4O18A 1GWJA 1H7RA 3QYQA 3HOJA 1BTMA 4IMFA 4JTKA 4LOCA 3SJ3A 3UXDA 4OQVA 1X7FA 1JUKA 1VYSX 3G1DA 4MIMA 1J4EA 2V5LA 5F4XA 3G1FA 5CZJA 1KM3A 4UNKA 5HUOA 3TSMA 3NG3A 3CTLA 1LBFA 3LCWA 4A22A 4KKXA 2YYTA 1K7FA 2X2GA 1TSIA 4WUIA 2FFCA 3UWYA 3R89A 1X1ZA 1EP1A 1S5WA 2Z2UA 4AH7A 3UQNA 3EB2A 1ZHAA 3LI1A 2EHHA 2NV1A 3LBCA 3S1WA 2GVGA 3KFTA 4UTMA 3GAKA 4HKPA 2QDGA 1SW0A 2FJKA 1DKWA 1OX4B 4CCCA 2J24A 2WSQA 4Y6GA 3CU2A 2D73A 4PA8A 3PF3A 3EKLA 1K8YA 3Q37A 4JN6A 1XBZA 1NVMA 3IIZA 1ME9A 2P10A 4N4PA 1OFDA 1SPQA 4OU1A 1EIXA 4POCA 3FFSA 4OGZA 1PV8A 4HT3A 3QC3A 3BGJA 1TIMA 2ISVA 1OK4A 3LCIA 3KAOA 1QMLA 1Y0EA 5D05A 1ML1A 4ML9A 1TPDA 1GVOA 3S5ZA 5IBXC 5CSSA 3O6CA 1JCLA 3S8HA 1BWLA 1LOSA 4LVBA 5E1QA 4FNPA 1ICQA 3LX9A 2V8ZA 2VENA 4NJHA 2PC4A 5HJLA 1SZEA 3EWUA 4DF1A 3M5XA 3UPWA 2OT0A 3NQ8A 2OMAA 3P61A 4LVAA 2E1DA 4YXGA 1O60A 3P84A 3LHVA 1MZHA 1HL2A 3L66A 5DCDA 3RU6A 3DI0A 3EX4A 5KTLA 5HINA 2W79A 5DXXA 4GC4A 3E12A 3AJXA 3QRHA 1AW1A 4UXDA 3SR7A 3R13A 4RXGA 1FCUA 3LI0A 1EA0A 2X30A 1IIGA 1OFPA 4QM1A 3TMLA 3NAVA 2B7PA 4MJMA 2X1SA 3RLVA 1JCXA 1W5QA 1R2SA 1U83A 4FEZA 3S5OA 3HIJA 1IIHA 1TMHA 4PH6A 4Y90A 3TQKA 4J9JA 4N9CA 1X6UA 1RZMA 2PE4A 3PC0A 2FB2A 1JCMP 1I2PA 1ME7A 4PC8A 2C19A 1K7EA 4IXHA 2QAPA 3MHGA 2V9DA 2VC6A 3DFOA 4NZJA 5IM51 1AL8A 3W7LA 2X16A 3TK7A 4NVTA 3TNOA 3IGUA 4Q32A 2QAFA 5AYYA 1VRDA 3B05A 1TPVA 4JICA 2EKCA 4QNWA 4NX0A 2VFHA 2ZTJA 5CZ0A 5LKYA 2TPSA 3C2OA 4ORIA 5D09A 1W0MA 4UTKA 4UFHA 1G4TA 1DJQA 5CPLA 3PULA 3QMRA 5FF2A 3G1YA 4WX2A 3S1VA 3TQVA 5K9CA 1H1ZA 4ORMA 2YPIA 3GX9A 4NJJA 2H8ZA 4Q4KA 5F1UA 3GZ3A 3EX3A 5AHEA 3O05A 2YGYA 5C55A 2ZZ5A 4LV9A 2Q8LA 4Z0JA 4Z1DA 4Z1CA 5D32A 3G8EA 3W1UA 4XZ9A 1TYGA 3GDRA 1FDYA 3LHZA 4NNAA 4K37A 4UTTC 5D2XA 3G24A 4JTSA 1XC4A 5I3KA 2C13A 2AGKA 1DVJA 2ATMA 3ANYA 3ZS4A 1K8XA 4NNCA 3IIOA 1PE1A 2C6QA 1M5WA 2J27A 3QW4B 3DENA 3C0JA 3LHWA 3O15A 3SFKA 5K4ZA 1Q6RA 4WXYA 3A9IA 4NJKA 2DZWA 2GVJA 3FS2A 2QCEA 5DY3A 2ZA1A 2R94A 1EP3A 4AHOA 4WOZA 4UC5A 1YXYA 4BI6A 3NPWA 4L4LA 1GT8A 3G18A 1XBYA 3SSJA 2G97A 3GNNA 4AWSA 3S6DA 4UMBA 3A23A 4K39A 2GUUA 4PL2A 2YYUA 3W2NA 5DBUA 5AHLA 3BVJA 4DPPA 3TQ0A 3W2UA 1QFEA 3P8JA 1PS9A 1IXNA 4FNTA 3TJXA 3WK3A 1KM2A 1KFKA 4N9EA 5CZTA 3PB2A 2ZRUA 3R2GA 5FF4A 4E38A 4HSNA 5E0KA 1K03A 2QR6A 3I7QA 1EUAA 3FJ6A 3KRUA 3HG2A 3L0KA 2C0AA 3FLUA 3IVUA 3HB9A 4O0KA 3C8FA 1H62A 5D30A 5AOUA 3F4NA 3O6YX 2X1RA 4TX9A 4BR1A 1W3NA 1KLZA 3EXTA 3GDMA 2R8WA 3GXNA 1GZGA 2GPTA 3CIXA 3HPSA 4JTHA 3G0UA 1JJKA 1GPWA 3TFCA 1EP2A 1RV8A 2Y85A 4MYAA 4X2RA 1B9BA 3UD6A 5AHNA 4IPIA 4AAJA 4JS3A 1GEQA 3PG8A 2WSYA 2ZBTA 3GLCA 4TIMA 3WJZA 1H63A 5D37A 4GJ1A 5LZLA 3JRKA 3NPXA 3NYZA 3QQ0A 4LC8A 5I3HA 2GVLA 2IQTA 1GTHA 1JULA 2TYSA 4IXXA 2VFEA 5H2ZA 3PSVA 4EOUA 1HO4A 2DZPA 3UNDA 4JNMA 3BPWA 1GG0A 1W56A 3W1PA 5DBTA 5FF3A 1CW2A 5F4WA 4OV4A 4OWGA 4AEOA 1H7PA 1EB3A 3C4UA 5G2WA 1W1ZA 3BK0A 1FCBA 6TIMA 3HG3A 1PCKA 2PURA 1WYIA 4NT0A 4MUZA 5EKYA 2B7NA 3B0VC 5U7SA 1LOLA 4NZFA 4R33A 1W31A 3O07A 2Y62A 3A5FA 3B0UX 4HHPA 1YDNA 2NX9A 1MXSA 2NWRA 3C3NA 4QQ3A 5AYXA 5HUPA 3BW4A 5D2VA 3IVTA 1R47A 3NPVA 4RR4A 3STEA 4JTLA 3FYPA 1S5VA 2WNZA 3PAJA 3G0XA 3INPA 2RDTA 2V5BA 4DELA 1ICPA 2WV8A 5E93A 3EX6A 4MY9A 2A2IA 1WDWA 4HPXA 3V1PA 2A7PA 4PFMA 4ADSA 4O13A 3ABQA 5DY2A 4DQWA 1H50A 5CSRA 1KM5A 1MEIA 4FNSA 2YDAA 1OK6A 1VCFA 3CIWA 2ABBA 4ALDA 2PCQA 2NXGA 1DBTA 4M6QA 3P7YA 3G1HA 1SZGA 2DU2A 5AC8A 1OJXA 3E49A 3TX9A 3L67A 3UWWA 2ATSA 1Q6OA 2YCEA 3DZ1A 4IJBA 1A5BA 1RVGA 1F76A 3NL5A 4PL1A 1GYNA 1NF7A 3WJWA 1K3UA 4MJZA 1K02A 2ZRYA 3VNDA 1I2OA 2ZZ1A 1T8XA 5KITA 3W7CA 3W2LA 4M7SA 4JTEA 5AN7A 1QPRA 3PUDA 1LP6A 2QCCA 2V2HA 2AAMA 3LDVA 3NDOA 3NXFA 5IBXA 3WK2A 3C61A 3THQA 1FBAA 3QM3A 3R8RA 3N2MA 3NEVA 2FPVA 4X22A 3A22A 3EEGA 3G22A 2E6DA 3S5NA 3QSRA 1XI3A 3RK8A 3GXPA 4N2YA 3L0GA 2J6XA 4O14A 3S1XA 1GVFA 3C2EA 3TXVA 3W7MA 2ZZ2A 4A29A 3A21A
chains in the Genus database with same CATH superfamily
3UVIA 4XK2A 2DVUA 1WV2A 1TE1A 3VFLA 3P6LA 4A21A 3UJ2A 2ZZ3A 4X0VA 4HNVA 4QR6A 1ECQA 3W76A 3CV7A 5HQLA 1G5AA 1XWYA 4TOQA 3PBWA 4S2BA 3GYEA 5DT5A 2A1YA 4I5XA 1QR7A 2ANUA 4LF1A 3PZQA 3MB9A 5EYWA 3N4EA 1MQPA 2YSWA 2WOQA 2E6FA 4R9OA 5BWAA 7A3HA 1JCTA 1IE7C 3QFEA 4L6HA 1XYCA 3BLLA 3GO2A 4NQ1A 1G0CA 2DH3A 5G1YA 1B4EA 4H19A 2VL4A 3PZVA 1SZRA 3ALFA 2PDXA 3GTHA 3W7GA 1DOSA 1S1PA 2JK2A 3E0FA 3N2TA 1WUFA 1GG1A 7REQB 3P5ZA 3LERA 3ZJKA 1BVNP 5CJMA 4HN4A 3CZ8A 5KMYA 5AHMA 3TUUA 1Z69A 1LRTA 4MFDA 1WKFA 4FXFA 5EBAA 1MDRA 3ENLA 3GVGA 4UOJA 1WB0A 1Q6LA 3VA8A 1CLKA 4OE7A 2PB1A 1ZLPA 3KLLA 1VBUA 3STGA 4ZFMA 1XD0A 4X2PA 2OT1A 1XDLA 4OT7A 3ZVIA 3QVQA 1WXJA 4FF5A 3CIVA 1BXBA 1TA3A 5BMWA 3EPMA 3MMTA 3HFYA 4CQAA 3BW2A 4J3TA 3A24A 1D3GA 1UR2A 3AUJA 4XSLA 2EBNA 1EF3A 5SWUA 2V2CA 4HHMA 5F2IA 2P5NA 2CLEA 1KM4A 4DXKA 4RZ5A 1NIUA 2E9LA 3ARYA 5LXXA 4RDZA 4FP1A 1AMKA 5BOFA 1GEHA 1K70A 3W70A 2ODOA 1PX4A 4RNIA 2XFWA 1Z6KA 2QDEA 4WXZA 4GYPA 1T99A 1XUUA 3S6OA 3WEOA 3AXIA 4JTCA 4UQCA 3TU9A 1HF6A 4GO8A 3T2OA 4B5TA 4LV4A 4ZE5A 1CGWA 3HGSA 4ZOAA 5AVNA 1C92A 3IV3A 2PRLA 2CITA 3F5JA 3TA6A 4XBSA 4CGTA 3K4AA 1GOQA 4XTIA 1CCWB 4NJIA 4DZ5A 2FIQA 2TODA 2YLAA 1CB2A 5E70A 1T40A 4WKAA 5A6BD 4LAUA 4EPEC 1J0HA 1XM3A 1I0DA 1TJPA 3ZWSA 1YPXA 1O5RA 3KBVA 3NPUA 5KSWA 5CC7A 3N9SA 3BAIA 3RPTA 3GQYA 3RU8X 3GXIA 4IH3A 2CLPA 5EFFA 2VVNA 4UB9A 4HU3A 5C9UA 2OGYA 4LSBA 4A35A 2PD9A 1RJRA 1TA3B 2OO6A 1W1TA 4JX5A 3S9ZA 2Q71A 1N82A 9XIAA 2VWSA 2WANA 4EF8A 5I23A 3BL3A 4RV8A 3AIEA 4XZNX 2CZFA 2A6LA 4H9YA 3DFNA 3LD5A 2ALRA 2CLLA 3QPZA 4FZIA 2YDQA 2W67A 1E9ZB 2D3NA 2XN1A 4UZSA 1DQXA 4GCXA 4WEVX 1KRCC 1X39A 1HT6A 3NGJA 2W9MA 2CBJA 2FZ8A 1DQWA 1Z8AA 5KETA 4UTWC 1CTNA 4EXQA 1NP2A 1UOZA 4GXWA 4R88A 1GJUA 1GOIA 4GC3A 1WDPA 3M47A 4O0ZA 4F9DA 2YOCA 2IPJA 3E0VA 3RPDA 1OCBA 3RCMA 2JEQA 5D03A 2X2YA 4NI3A 2OZ0A 3MI2A 1KQZA 2DH2A 1R86A 4US5A 3QEZA 1TTJA 4PMDA 3E38A 4JXCA 5CZSA 1XLIA 3G1AA 1YLVA 1THFD 2CBIA 2VOMA 1KWGA 4D8LA 3VGBA 4LCRA 3S2CA 4HOZA 1WBHA 3CM4A 4MLJA 1GK8A 3DESA 3K8MA 3CQHA 2J9XA 2OODA 2VZVA 3GTIA 3W01A 2HWGA 3NM1A 5BYWA 1R9XA 3VE7A 3N2BA 2R24A 3VC5A 3HO8A 3NQ2A 1JQVA 1NDYA 5FACA 3W23A 4W89A 5A2AA 5AYZA 3CH0A 2EF9A 2DUZA 1RBAA 1HJWA 1VJSA 4H00A 5FEPA 2DIEA 1XGDA 3DC8A 1UD4A 5CPTA 3G8RA 3R0KA 4ZOBA 4KS0A 2VX4A 2LLEA 1DHPA 1XJBA 4W5UA 3CMGA 3NGFA 4LQ1A 1FUYA 3QHNA 2XVLA 4HK6A 3A64A 2XVPA 1YQ2A 2D22A 3NQCA 5F1VA 3SAZA 1HNYA 2Y6ZA 3LGDA 3EOSA 4O4WA 1KNWA 4DO4A 1P0KA 4B3LA 5F2LA 1UUMA 1DV7A 4UMCA 3LM3A 3AXKA 2NX1A 1ZY9A 4BY3A 1QVBA 3ZT6A 4JCMA 3UYCA 3NCOA 3L4WA 4FIQA 1J6PA 3S6TA 3KVLA 2WC4A 4DBUA 2DORA 1F74A 1M9HA 1OGSA 2ZKMX 3EMQA 3JW7A 5FD0A 3PHAA 4J1OA 3HPXA 2NV2A 4A8NA 3LBMA 5CCZA 1XLMA 1C8YA 1ZSXA 3MP3A 3BV4A 4JFTA 3TP4A 3MHUA 2I7GA 1TTPA 4K68A 3V4BA 5ABHA 3MTWA 3SGUA 2WWCA 5DT7A 4MKNA 1JDAA 3TN5A 3N04A 2GSHA 3MPGA 1VLWA 2OQLA 3BAYA 1UBSA 5BU9A 4XD4A 3PPCA 1HO1A 2OWCA 1SUXA 5GNYA 1W8SA 3MJMA 4ROPA 4AD5A 3BLDA 1GKPA 2ZRZA 1KM6A 5EY5A 4AXKA 2F7FA 2J7FA 4DYJA 1RBLA 3QV6A 3WNNA 1Q7MA 4I9AA 3Q2DA 3KVKA 4D6JA 3ITCA 4PFHA 4AX7A 1YKWA 1KBBA 3WYZA 3BE7A 3CWNA 2YZ5A 5FEXA 1TQJA 5CSYA 4IMCA 4EIVA 1C9WA 1H7XA 5TQLA 4MWAA 4XX6A 4BQ2A 1OYAA 1RAKA 1AQFA 1JFXA 4TVCA 5EBUA 3TVAA 1R3RA 2X0SA 4OBTA 1Z41A 2R6OA 1O12A 3O0FA 2QNEA 5BRBA 1UP2A 4RLIA 4RV3A 4DJFD 3R1ZA 4C6IA 3W00A 2J8GA 2O7QA 1V6WA 2V6AA 3I7SA 1UA7A 4IIEA 3OVPA 4YYCA 4PCTA 5KZMA 3K30A 3BSMA 2WPBA 3TYAA 1IZCA 4IM4A 3W74A 1C90A 3SRFA 4WGXA 3EKGA 2VI0A 4IGNA 3WLKX 1QI4A 1MW1A 1SSGA 4DM1A 1Z48A 3QGVA 4HMDA 4O1BA 4J3ZA 4DUWA 3U2OA 2DIKA 3OBAA 4XUGA 4MADA 3W7RA 1EQPA 3AMDA 3R94A 1QK0A 3NQFA 3ZR4A 2PP3A 2DZSA 3JU2A 2ICSA 2JE8A 1LL7A 3G1XA 3TC6A 2Z29A 1YDOA 1AFSA 2BMBA 4RCXA 1EZ2A 1TV2A 4QAWA 4DEFA 1WDQA 5DELA 4P8WA 4EANA 3BOLA 4JL1A 4ZCWA 3ZYZA 3H55A 1K9TA 4AEFA 4NL1A 5FF7A 5BU6A 4P8VA 4DNMA 2Z2AA 4KFNA 1JCJA 1JZ6A 4E4PA 1OG6A 1E73M 1JRCA 2Z6IA 4BEQA 4Q22A 4R85A 2NQZA 3IJ9A 4H6EA 4KBXA 4X3ZA 4MWAB 2VX6A 3WH6A 1KA9F 3AMGA 3CC1A 2OQYA 2OEKA 3MY9A 3SDOA 5LNRA 1W1VA 1DE5A 4DBEA 1UKSA 3LLXA 1Q8AA 4XIAA 1OIFA 3WFAA 3NL3A 3AMLA 3S2NA 3I6RA 2PDMA 3GXFA 4O50A 5T26A 1ZFJA 3THUA 2J8FA 3F03K 3DKJA 3B4UA 2HK1A 2ZZ7A 2EPLX 4H9UA 1FDZA 3AICA 2EO7A 3W7KA 4Q7IA 2ZWZA 1MFVA 4FX7A 3KWSA 1NARA 3MBFA 1F2JA 3THAA 3BARA 3L4XA 5K2ZA 3M0ZA 6XIAA 2A5HA 3TNBA 1DYSA 1DIKA 3SN0A 4CVWA 1MXGA 4J7RA 2J62A 2E6AA 3WNKA 5XIAA 3WJXA 5C5YA 4PBGA 3AIWA 4IIBA 1S3TC 9CGTA 3QR3A 1FWFC 3B03A 3EPNA 4NNBA 5HJXA 3PANA 5C7HA 2A0NA 2FGZA 1UOKA 4HD5A 4M0XA 1PJ9A 3HPAA 1ZPTA 3PBVA 3KP0A 2C15A 4IPNB 3MP5A 2ISWA 3HGJA 3VGEA 3H54A 1NOWA 1G67A 2E6YA 1LROA 5HQEA 4PTXA 3MUY1 5I24A 1CX9A 2XIIA 3V35A 1H61A 3B8WA 2FPTA 3GB6A 4WJEA 4DX3A 3IACA 4IQEA 4JFWA 2W0UA 2Z24A 5DF0A 1OFRA 3WLRA 4GQRA 1NJJA 1OF6A 1QU4A 1X6NA 1X38A 1Z44A 3WK0A 1CXIA 4PUJA 3KDOA 1TPEA 1VQTA 5BXSA 3P8IA 4AG0A 4DO7A 4DF2A 3RO6A 4WVXA 1KM0A 1AA1B 3L2LA 3KEHA 3V0SA 3DHDA 2DT3A 4AMAA 4JTAA 1XIFA 2E9MA 2CC0A 5HJYA 3BWWA 2G50A 5DLCA 5EMYA 4C6EA 3CPGA 1X1OA 1PZ0A 3WUFA 2PD5A 2XH4A 2O92A 3IARA 4EAYA 1CNVA 4C6NA 4BWLA 2B7OA 4ZGYA 3R11A 3OLDA 3T8QA 3UXKA 3SY8A 4O1AA 2BTMA 3TW7A 1ZCCA 1TJ0A 2GQ8A 4CLMA 4HMEA 2PWUA 3KOZA 1BAGA 2RDWA 3PTQA 1VPYA 3TN3A 1QUMA 4Y9AA 3I3BA 2OWXA 1H49A 1UPPA 3K1DA 3CQ0A 4LUSA 4ZSTA 1GQLA 1RCXB 4WDWA 1EL3A 4Q3MA 3O63A 2P8BA 3VM5A 4JY9A 3WEMA 1C7SA 5A6KA 1R46A 1D3HA 4TVDA 3V5FA 3VNIA 4JTGA 1MW2A 3PBUA 4U2ZA 2XFFA 1H7WA 3AO0A 3RCNA 1EDTA 3L2IA 3RX4A 3FA3A 4NZ1A 3IUDA 4QJ3B 3MV11 5DANA 1AL7A 2WZEA 5JBFA 1A3HA 1UKTA 2WAGA 3L4ZA 3A5VA 2P0OA 4UNIA 3C3UA 5T9BG 2ACQA 3APYA 3MZNA 1DL3A 1R5YA 3UWZA 3HV9A 2JKPA 1S2TA 2WLZA 1TIWA 4QISA 2WCGA 3I6EA 5LNWA 3G1RA 3M9YA 4NAEA 3URNA 1FA2A 1FY6A 3E0IA 2QMKA 4MMWA 1LCOA 4W9TA 1HKWA 4I7WA 1VKFA 1E9LA 1P0DA 2G5WA 3E1F1 3F2BA 3CUGA 1V8EA 2X7WA 5AYIA 1AJ0A 1BVZA 5I09A 1HUVA 2E68A 1EQCA 2QUUA 1OF8A 2Y5SA 4AF0A 4JR5A 2A3CA 4J3UA 4YWSA 4CCZA 3WK1A 1M7OA 3JS3A 2OSYA 4FI4A 2XM2A 1ZALA 1OM0A 4BZYA 2I5QA 1KQYA 1IEWA 3UZ5A 4LUSB 2ZYFA 3QLDA 3PJUA 2XZ9A 5CXPA 1XGEA 3R43A 3KX6A 3H2FA 3U7BA 4JTDA 5DMMA 4PMUA 2XN0A 3CL8A 3B9EA 2J7DA 4JFSA 1WZLA 1P6BA 4QE4A 4I7VA 4F2UA 3POHA 4V27A 4O57A 4GI8A 4U31A 2GGEA 3S2LA 4KWVA 2BFGA 4NUWA 1C8QA 3M43A 3B8IA 1ELSA 4ATWA 4RNFA 1M3UA 4J35A 3TEVA 4K1GA 3VX0A 3PNUA 2TMDA 4AWTA 4LEQA 3TA9A 4Z17A 4WSHA 4Q8NA 1W54A 1N55A 5HR7A 2GK1A 8XIMA 1AH3A 3A4XA 3LCXA 3UJFA 4NAFA 2JKEA 1CXHA 4JQ1A 4NAEB 4PBFA 1WOAA 2VDGA 3LU2A 3HG5A 2WO5A 3GC5A 1VYPX 2CLOA 1E6NA 3RXZA 3WUGA 4M6UA 5CGTA 3P67A 3LM7A 1GHRA 5EGRA 1CGUA 1GOWA 4KW2A 2JEPA 4FNRA 1XUZA 3F2CA 4WKHA 1NH6A 2Z1WA 1OT1A 2YDRA 4M8UA 4GJIA 2Y7EA 4AF0B 2FTPA 1AQHA 3H2AA 3KOWA 1MVYA 3CHVA 4GIAA 5DCBA 1VH7A 3N2CA 1OEPA 2YBTA 4QCFA 5LIKX 3SFWA 3WFLA 3M7SA 4E3TA 3RMEA 1UWTA 3IK2A 3FDKA 3EEZA 3LENA 3FEMA 4A3HA 4B5UA 1NDZA 2NVDA 2BOEX 1ZTVA 4ZQNA 2INZA 1U22A 1V6TA 3EWYA 2A79A 4GFIA 3WQ6A 5C54A 3TWBA 1B4KA 5C9XA 2A7NA 1KTCA 5FEZA 3VIMA 1VHNA 4QITA 4F8XA 2FTWA 3U8GA 4LS2A 2PDPA 4MZ8A 1FVPA 5H6HA 1J0KA 5LNSA 4KESA 4I5UA 3ITXA 1OFBA 3M44A 3OVQA 3AZSA 3NSMA 2OU4A 4XAFA 2DSWA 3FVMA 1TPB1 3GBDA 2E09A 3W1TA 2GK1B 2GDVA 4IUOA 5C9ZA 3VM7A 5L9FA 2WNNA 2Y7GA 4NAFB 5PTDA 1FWDC 1S2WA 2AL2A 2PDNA 1EJ7L 4DI9A 3L2MA 2VQTA 2VOTA 3CHFA 2ZUMA 2G96A 4LS0A 3QJAA 1BYDA 1ZENA 3W07A 2ZX8A 4C6JA 4CD6A 4K8GA 2DPEA 5EL1A 1EZWA 2YA2A 2Z1KA 4WSKA 1L8NA 4HGXA 2C71A 3K13A 6PTDA 1TWZA 4H04A 4C5YA 4B5XA 4JTTA 3E3HA 4LANA 4HU0A 4QX4A 2VHLA 2NQJA 3GDKA 1VIWA 1G69A 2XJ7A 4GQ0A 4E4UA 2V5CA 3QZAA 2DT1A 5CPQA 1JAEA 4V2XA 3AC0A 3F1QA 2BZNA 2H8XA 2YR1A 3ARXA 4S23A 1JD7A 4JX6A 4MY8A 3WH8A 4Q7NA 1XLKA 4GGHA 3H12A 2O7SA 2ZA2A 1KB3A 2VGFA 4AY7A 4HK7A 4U33A 1YYAA 1H7OA 4HYWA 4LUJA 4D1IA 4D6HA 2ZIDA 4O18A 3L23A 4L5ZA 3T81A 5JXQA 3PJXA 1BSLA 3R8GA 5HBFA 1BTMA 3OG2A 4PMNA 5BZAA 1KCKA 3TSMA 1PWLA 3OLGA 3CTLA 2YYTA 4JKMA 2X2GA 2ADAA 1TSIA 1UZ1A 4WUIA 3VX1A 2W63A 3UWYA 1X1ZA 2AL2B 4Z42C 2WSPA 4Q4PA 3EA2A 1QBBA 3LBCA 3S1WA 4RE4A 4KWSA 3KBNA 3VNMA 2HXUA 4DZAA 1SW0A 2QDGA 1DKWA 5I00A 3BSHA 3CU2A 4PA8A 3PF3A 1CXLA 3IIZA 1SPQA 1JZ8A 2GQ3A 3FFSA 1XLJA 2RDXA 4DBSA 4CUCA 1F3TA 1VB9A 3BGJA 1TIMA 3KAOA 1ZGDA 5D05A 3XIMA 3AS2A 5C9WA 1ML1A 2OEMA 3CUIA 1GVOA 3S5ZA 2UWFA 4W87A 3AUOA 3S8HA 1MYRA 1LOSA 5E1QA 4IFRA 1ZL1A 2W3ZA 2V8ZA 2VENA 4UR9A 2PC4A 5HJLA 2P3ZA 1GW1A 3EWUA 3LN3A 3UPWA 1XYFA 3N25A 5FJTA 3BMVA 3NQ8A 3P61A 2IPWA 3PZTA 4YXGA 1O60A 3P84A 3CYJA 4D1JA 1MZHA 1NWRA 1PEZA 1DWHM 4Y9PA 3UR2A 1DJZA 1OGBA 2FMOA 2WJFA 5HQMA 5I5RA 3EGJA 2W79A 3E12A 3SR7A 3TTYA 2X30A 3MO4A 3TMLA 3MMDA 5H8UA 2PBOA 4PMOA 2FJUB 5TNVA 5FJJA 4QCEA 1TMHA 2HQAA 4PH6A 4Y90A 1GVEA 4KEZA 1JCMP 2VGBA 3KS5A 4PC8A 5CSUA 3MHGA 2V9DA 3DFOA 3LNMA 2C79A 3AI0A 4RW5A 4IP7A 4IG2A 2QAFA 1UH2A 1KKRA 1PTDA 4C6BA 1DWJM 1W2VA 1TPVA 4QNWA 2GFTA 4PMQA 1FH9A 5D09A 3BJFA 4UTKA 3U7VA 1RJPA 3CHCA 4DNHA 5CPLA 3WMBA 1ISZA 3QMRA 5FF2A 2VZOA 1CLXA 4GLEA 3CZKA 4IGMA 5LA2A 2IKJA 2EJAA 1R85A 4ORMA 4DI8A 2CETA 3GZ3A 4MAVA 4G7EA 3ECQA 1QI0A 2YGYA 3O05A 4WDUA 1FOBA 1YBQA 5FIPA 6ENLA 2X1IA 4L7ZA 3LBOA 1EA9C 1V6XA 5HOSA 2EJ1A 1MUCA 2VRKA 4GO9A 3F5LA 3HA1A 4X9YA 1DVJA 3UZYA 4CKQA 2C8NA 1Q6FA 2HISA 5CAHA 3QV7A 3CBWA 1H5VA 2GVYA 1Q6RA 2NSXA 4WXYA 5DO8A 3WQDA 4PCPA 5DMYA 2DZWA 2GVJA 3CL7A 5DY3A 1EP3A 4AZGA 2VZSA 4WOZA 1E0VA 1NOUA 3ABXA 4KRUA 2FVMA 3NPWA 3RM9A 3VOIA 1XBYA 3RPMA 1EJXC 2RAGA 3CUHA 4B91A 3S6DA 4K39A 2YYUA 2IMRA 2FZMA 2F6KA 4QRNA 2VDHA 3B40A 4DPPA 2IKGA 4JIEA 4B2DA 4KEVA 4GYPC 4HZ8A 1PS9A 1IXNA 4R5EA 1KM2A 1E0WA 3WQ4A 4KCWA 1Z7AA 6CGTA 5CZTA 1CEOA 3CZLA 4RL3A 5FF4A 1V02A 2DSUA 2W5FA 4IL0A 3FJ6A 4Q8PA 4NF7A 3IVUA 2C0AA 3H21A 5AOUA 3O6YX 1JNEA 4F0KA 3NZQA 2J13A 4EKJA 1GOKA 1PPIA 4QQUA 4JTHA 3GSMA 1GPWA 1TG7A 3TFCA 4G7EB 2CBVA 1EP2A 2XWEA 2BVWA 1S1RA 4H9VA 3EOUA 1B9BA 1YBQB 1ZUAX 3LEPA 3H22A 3KW3A 5A3HA 1C91A 1GEQA 3PG8A 2WSYA 2ZBTA 3GLCA 2OKOA 3STPA 5I79A 3UCCA 5D37A 1EC8A 3JRKA 3VOHA 4LC8A 3WD3A 2QS8A 3WBYA 4XV0A 3DEQA 3M0KA 4P8XA 1HJSA 4TX6A 1GG0A 4GIYA 4PRTA 5AC5A 4B5VA 5C71A 4OV4A 1HJVA 3BK0A 1FCBA 2XVNA 4JQ3A 4JOMA 3SCSA 2PURA 2J66A 4PMVA 3W25A 5EKYA 5U7SA 3RIKA 4UQ9A 3HTWA 4C6DA 1W31A 3O07A 3VILA 1X1NA 4QQ3A 2PGEA 5AYXA 5HMEA 3BW4A 4KRTA 5D2VA 3STEA 1W1IE 3SJNA 2OEJA 2Y24A 4JTLA 3SCTA 3UPMA 3PAJA 4L6DA 2RDTA 5E93A 3ZR6A 4MTVA 3VMOA 3TOPA 2Y5EA 2PDYA 3WDPP 4ADSA 4O13A 4FK9A 4AZ6A 5DY2A 4ASTA 1MW0A 1H50A 3BAWA 1A47A 4FNSA 2PZNA 3ITOA 2P8CA 1VCFA 2ABBA 3VGFA 1R3TA 2NXGA 1FHUA 4XUYA 5AECA 3P7YA 2ZUSA 5AC8A 3N18A 3L67A 1KGWA 4U3CA 4OUEA 5FJPA 3WUBA 1GYNA 2OSWA 1WUEA 3PZNA 1K3UA 3W27A 2ZRYA 3N15A 1T8XA 4RUBA 3W7CA 3W2LA 1QPRA 1NQ6A 1T8QA 3WEZA 3PUDA 2FZ9A 3UW6A 2AAMA 4Q6XA 2Z1SA 3H4GA 3WK2A 1Q65A 3C61A 3DHUA 4DM2A 3THQA 1XYZA 3K1GA 1W32A 3N2MA 4TXEA 2FPVA 1EO7A 2PCEA 3EEGA 1PTGA 4AISA 1HJUA 3A12A 3B9OA 3QSRA 4AYSA 3RK8A 3E2RA 4O1EA 4O14A 2YBUA 3GG8A 1GVFA 4Q4RA 4CNPA 3TMQA 4AZBA 1IT7A 4JX4A 2EPOA 3TR2A 3NQEA 1QHPA 3W6LA 4OIFA 1XD1A 1YMYA 4LBRA 3F4WA 4LY4A 2R91A 1IV8A 4N42A 4CU8A 3EMCA 3CZGA 3TQPA 4JYFA 4BQ3A 1E0XA 4AZIA 1US2A 1A0CA 2E7FA 3QKEA 5CPOA 3S2MA 1J93A 3H2MA 4GRSA 1ICSA 3WIJA 3KTSA 5LIWX 1J0IA 2GVEA 1KFEA 3BAJA 3QMSA 5BRPA 3AYTA 1C29A 4PYSA 7TIMA 3JVAA 3C56A 1OFAA 1VHCA 2Y8UA 2OQHA 4C6PA 1XBXA 3VI2A 2QIWA 2CZEA 2G8ZA 4R3UA 2D69A 3RITA 5JQ9A 2XFYA 3RCYA 3EWZA 3S1UA 2VWTA 1W9DM 3S1GA 3OA3A 2V81A 1XGZA 2WVSA 1T6MA 1ONXA 4K7VA 1QK2A 1W5OA 1O5QA 2X8RA 1N8WA 6TAAA 4GVGA 3O1NA 3F5KA 4HMNA 5JIWA 3FW6A 1E71M 4LRTA 5CG0A 3ITLA 4L4OA 1ZRQA 4CCEA 3W85A 4F0SA 2QIIA 1OD0A 2GGHA 4M56A 1CPUA 1GVRA 2FHCA 3E6EA 4R9XA 3W83A 4MPQA 2BLEA 2BODX 3WLIA 1LRNA 4Z2GA 4UMAA 3WSUA 1BEUA 4LU0A 5LNUA 3FKKA 2BXVA 1GORA 4KCUA 1MEWA 4MWAE 2G4JA 3PVFA 3VD7A 4GNVA 1P6WA 4CD4A 4N9DA 5CBBA 1W3IA 3GNXA 1L6YA 3SEPA 4GCAA 1MNSA 3VZXA 5FEWA 3DUGA 3EDFA 4JTQA 3ZLHA 1ZBCA 1JZ3A 4OKDA 3U2CA 1ODZA 4H9TA 4JQ4A 4L6OA 2GJLA 1EFZA 2W27A 1Q85A 4ZOEA 1VCVA 4AIOA 3MHFA 2E28A 1TZ9A 3AU2A 3MCOA 2TRSA 2F6UA 3CQIA 1PKLA 1U5HA 1XIIA 2CCRA 1MQRA 2P88A 5I6SA 5M5DA 1UR8A 3OLEA 3UWEA 1OADA 1EDQA 1KGXA 3NQ6A 1F8IA 4XD3A 1PVNA 3AHYA 5I0DA 2QCFA 2VTFA 3ZFHA 4DJDD 3SI9A 1UYQA 4CD7A 1QWGA 5A8GA 3QGKC 1E15A 1XPGA 5D2YA 4AWEA 5M3WA 2ABAA 5REQA 4ZEPA 1ZU8A 1V3JA 4FR1A 4ONVA 2HSAA 3T9PA 1AK5A 3PBGA 3KL0A 2YB4A 3CL6A 3H8AA 4YS1A 2ZVRA 1UKPA 4OZOA 4QG8A 2UY4A 5CPSA 1CI1A 1U5JA 3CASA 3CUJA 3W0KA 1F05A 3K8KA 4ATLA 4M5PA 3AS1A 2Z1BA 1RLDA 1QW7A 1XLEA 1YXDA 1A5KC 2DIJA 1FWJC 4HA3A 3B8SA 1W1A1 3EWXA 3IGXA 3SRHA 2NWSA 1OFOA 3SSZA 1B3YA 4R7JA 4WSJA 5HR6A 1FWRA 1AQMA 2EEXA 1A49A 4QJ1A 1EBGA 4DVOA 2XIMA 2OWWA 4KCTA 1I8JA 2BOGX 2QJGA 3GRIA 2BG5A 1TWSA 1UZDA 4HCHA 3QSTA 4IX0A 1TJRA 3W7QA 1NQKA 4HHHA 2XSAA 1ITUA 2JBMA 3KOFA 1W9VA 2FZNA 2WMIA 2J79A 4V1YA 3QXBA 1HN1A 2V5JA 4HNTA 3QH2A 4G5DA 3ZJ8A 3EOEA 1U1UA 3D5HA 1UMYA 2WSRA 4WY0F 4X0NA 3TFXA 1E72M 2HBXA 3WBEA 4TV6A 1ZAHA 2E8YA 1JZ4A 3TLQA 4QNEA 4AIBA 3DKLA 3FK4A 3LCLA 1KW1A 1A5OC 4EPKA 3WG6A 5TBOA 3UJSA 1X8CA 2J75A 5REQB 4E2DA 3VTRA 1FKXA 3UR5A 1IWBA 3R0UA 3W1NA 3AISA 2QCNA 2J4GA 2OLHA 5K7JA 1SW3A 5A6JA 4JL2A 2IXVA 5G2IA 4NRRA 3W7JA 4U3AA 3C6CA 1J2WA 3M4HA 1E56A 1ME8A 1F4AA 4R7WA 2PC8A 2J6VA 3FCPA 4S3EA 1VPQA 1TREA 1VFHA 3BURA 4ZMGA 1CGTA 2ZUWA 4B90A 1HQTA 1J9YA 3NXLA 3EWDA 4KF1A 2Y70A 1MW3A 1IEQA 2VR2A 5IXEA 5EMKA 3CT2A 4N6EA 3VOCA 1AODA 3Q94A 4RXFA 4KIRA 3CLMA 3EDDA 3W24A 5AC4A 4H8VA 3WJYA 2QCHA 3ZT5A 3H2CA 3LZ3A 3MMUA 3PS7A 3D0CA 3HPFA 3BC9A 3OEXA 1PIFA 1S2UA 2D2JA 2FH6A 4MNMA 1IQ8A 4IF2A 3V18A 3VKDA 1TTIA 1YRRA 2WMIB 4LC6A 1L6FA 4NILA 1L2QA 1DQUA 2V2DA 2WQPA 1SFLA 4YN5A 1VS1A 4QEEA 4RE2A 1RQHA 3S47A 1K9EA 1MZRA 4F0MA 1NU5A 1V7YA 1UD6A 3FV9A 2E5CA 4P61A 1Y5WA 3FJLA 1VFLA 3A47A 1GUVA 3CWOX 1QOQA 1AW2A 1LWJA 3BZGA 1DJGA 1O1ZA 1BWKA 3PUOA 4D71A 1SU5A 2YCJA 3M1ZA 1BRLA 3K46A 1YDVA 1XSJA 3IGSA 4UFLA 5B7ZA 3W86A 3T2QA 2DV0A 2ZXAA 1F3EA 4G1KA 2GZXA 3U5YA 2XGBA 4PMRA 2O4MA 4E2OA 1HVQA 4P8UA 2GJRA 4ZQOA 5LHEA 3OGRA 1N8FA 1ZAJA 2OVLA 4MOZA 4AIUA 3VNZA 1GVSA 5DMNA 3GY1A 3MUIA 5CPMA 2ZZ4A 2J77A 2BXZA 4L9ZA 3VZZA 1QOPA 4Q8VA 1QNSA 4NZ5A 2HS8A 1GKRA 4GWEA 3DYOA 3VNKA 4QGCA 4AHQA 4I9MA 3NDZA 4ZQPA 3LXCA 5E6ZA 1QNVA 1PWMA 4KETA 1QI3A 4US5D 1HIZA 4RZ6A 1C8VA 2DUXA 3WLPA 1RR2A 1XIJA 4LFYA 1EJUC 1B5TA 1UR9A 1TE6A 4LTSA 3URQA 3VIOA 1BXNA 3WLMA 4IGSA 2NW0A 5J8LA 4GH3A 3HZ3A 3OW1A 3ZVHA 4FXSA 5CJNA 1EH9A 1U2YA 5CAKA 1RALA 1H5YA 1E0UA 2ZXBA 1W3LA 1XCXA 1WOBA 3WUEA 3OBKA 1P0EA 1VF8A 2ZUNA 1DWAM 3A4JA 1TPFA 2B31A 2R1PA 3H2EA 4DUOA 4C65A 1B31A 5GPRA 2ZDRA 1A5NC 3GU9A 3W87A 3KBJA 1FH7A 4BF9A 1EJRC 1V51A 1EPVA 2V68A 4EACA 1DXIA 2CYGA 1HG3A 1BRLB 4I3GA 4NU7A 4HVXA 1R3VA 1TUFA 1JYNA 1SYTA 1EX1A 4IMDA 2BY0A 1FWWA 3ID7A 1F3WA 1QPKA 4JIQA 2EXOA 4AZCA 3M64A 1S3HA 4TQTA 4PODA 3LZ5A 4IIFA 1Q4NX 4DN1A 3QN3A 4O4VA 3K4DA 1H60A 4FX6M 1B0IA 2EKGA 4MAZA 5F4SA 1VPXA 4ZENA 1F6PA 3N6HA 3IVSA 2PWEA 3WH7A 4CQ8A 4FOKA 8XIAA 4RNJA 2R82A 6ALDA 3GNDA 3PZOA 5LSMA 1QOXA 4S38A 3W7DA 2P3EA 4NX5A 2WKLA 2EAWA 3FAWA 4F40A 1TJ2A 5EMJA 2JGYA 5DFAA 5CZKA 1H3GA 3LCGA 2WZIA 3ZVHB 1JZ5A 3KL5A 4QE5A 1MMFA 2BX7A 1FX6A 5D8ZA 1I1WA 2W92A 3E2SA 1IXPA 3C2FA 3W26A 1HL9A 3WBXA 4WY0A 4P7OA 3ANUA 3U2ZA 3ORWA 1GZJA 1QPQA 4PB5A 3GFZA 1TMQA 4D6GA 3GH4A 3AMCA 1DIDA 4DF0A 3MZ2A 3DXIA 2XIOA 4CN4A 2IKIA 1TR1A 2MNRA 1W37A 1AQ0A 5A94A 3NQAA 3CPRA 3PUGA 3FNDA 2AGTA 3LTSA 4PEEA 3PB0A 5A5WA 4JIRA 4DZHA 1KLYA 4AZCB 3O6DA 2VYOA 1VGAA 4PZVA 4XO7A 1NOFA 3PNZA 3W7PA 1OYCA 3UJRA 3HQOA 3LTYA 3HM7A 3WMCA 1HXJA 3IRDA 3VNJA 3KRSA 1LQ0A 3SCPA 1NM9A 1E0TA 3EDJA 2WM1A 2YL6A 3PR2A 1C7TA 3WD4A 2J9YA 3QC0A 3HMJG 1KCXA 1EWDA 2Y4SA 2ASHA 4US6A 4UTJA 1JQXA 4M80A 3DFYA 3AWNA 1VP5A 3WLNA 4FMVA 1IGWA 2YZRA 1K4GA 3VU2A 4LXFA 3VGGA 3F4CA 1FDJA 3TROA 3ABOA 4AZ5A 1ADDA 3BJTA 1EWEA 3LMZA 3WCZA 1ENUA 3T0CA 4GG9A 2QT3A 1O6IA 5E0CA 1XFBA 3TYUA 3RNDA 2MANA 4HN8A 4F0HA 5FAGA 4NZCA 2WBKA 2V30A 4WY0B 3SZ8A 4QG6A 2DDXA 2XH7A 4MNKA 5F2MA 3MT1A 3GK0A 3LCHA 4ZL1A 4CNTA 1IGSA 2I16A 1C93A 1QXLA 3HURA 3VGHA 1OX5A 3H23A 1T7LA 3RLHA 2CBUA 2X1UA 3OOQA 3OIXA 1DHKA 1PZ2A 3M0MA 4PB3A 3TOYA 1UKOA 4OVXA 3N4FA 4GI9A 5GVJA 3U3HA 2OYKA 1EX5A 1OABA 3HV8A 1W91A 4CNOA 4MZ1A 3UBPC 4HU8A 3EA1A 1BF2A 4LAOA 2KAUC 3G3MA 5DRIA 5G1MA 1FWBC 4GABA 2RJHA 3LV5A 4PN2A 1UWRA 3C0QA 3LGEA 3B0XA 1NF0A 2F6XA 4BS0A 1A5AA 1Q2SA 1KBJA 3NZRA 3C0LA 1ZBWA 4N02A 4RX0A 1LOQA 2QHAA 1OCNA 1X96A 3QBUA 4UTLA 3SY1A 1L8PA 2FZBA 2QCDA 1BWVA 4JNZA 2FPYA 2VX7A 4LUIA 1MRQA 2NXIA 1PCWA 3EYPA 2ZQ0A 2DUAA 4LH8A 3RRXA 4O19A 3T78A 1O5KA 2AKZA 5A6AA 3LNPA 5KINA 2NUXA 3A3XA 3P2VA 5C6MA 3IWPA 2QKFA 2NXHA 3V5OA 4H83A 3SIZA 3T7VA 2E8ZA 3I3DA 4TMBA 3UR8A 2VNCA 4DXXA 1JDCA 1R30A 1XQKA 3CAKA 2WNQA 4FO4A 2X41A 3G1SA 4BFAA 2XZ7A 1W1PA 3MP4A 3PZMA 3H6OA 3NZ1A 2QF8A 3HBLA 3AIRA 3HQ1A 4AZHA 4U4MA 1ZZMA 3QTGA 1XXXA 4GYKA 3WNMA 3S83A 1SJCA 4O54A 3TZNA 2BY1A 2ZC8A 3N2OA 3IJQA 1UJQA 2AKMA 3TTEA 1WPCA 3YPIA 1PZ1A 1Q6QA 2XN2A 1JL8A 3LLFA 3DFTA 1LG2A 4Z1BA 3VKAA 3VIPA 2WNWA 2POTA 2CLMA 2PDUA 3BLFA 1OSEA 4F79A 2V63A 2W91A 3KCOA 2G0WA 3R7MA 3GC2A 5G4WA 1MEHA 2DZUA 3UZWA 2OZTA 1SJAA 1GONA 1OYBA 2F61A 5AHIA 4DYEA 3GIYA 2YXOA 2J7GA 3PTKA 1V3IA 4RKAA 3UCQA 3W7IA 2QCDB 4NHVA 5FF0A 5I78A 4L65A 1RSCA 5DCEA 4Q8WA 3NM3A 1XLAA 2PWGA 3ZM8A 4ZO7A 1EHAA 2NQ5A 1QAPA 4HPJA 3KRZA 3UA4A 2ON3A 3ISIX 3W2MA 4Y8FA 3A6OA 3L4UA 3MKCA 3VMNA 3PUEA 4UFKA 2Z28A 1RA0A 2WB5A 3U4FA 1IZKA 2WVUA 4KMQA 1HP4A 3PPGA 2QDHA 3GNOA 1EJVC 4O53A 1PYFA 1BKHA 2VT0A 4ZXLA 1GOXA 1PYMA 3JZEA 4LWWA 2WHMA 3OO2A 5GJPA 3L7RA 3I6TA 3PZGA 1M7PA 4A8RA 4LX4A 3VIIA 4BKNA 3KBMA 1ISVA 1GQKA 2HVMA 3ABZA 1TB3A 4J3SA 1FWAC 3V3WA 4G6CA 3L4YA 3D3AA 2GGGA 4PMXA 4IFKA 4KGJA 5FESA 1MQQA 1SFTA 3R58A 2QZRA 2W62A 1E4IA 3LRLA 2GJNA 1V3LA 2QUMA 1HKMA 3AYSA 3WBAA 3B0PA 4GBUA 2ALDA 4MZYA 2VKZG 3M16A 3MANA 3UG4A 2MUCA 3W7HA 3E96A 3T1GA 3H53A 5EMLA 4UQBA 3FXYA 3GS6A 4Z2HA 4RZ4A 3SGZA 3RM4A 2WMJA 1VEMA 2Q3RA 3SM0A 3TCEA 3QZ6A 3GD6A 3P60A 3IEBA 3NUKA 2ISFA 4S3JA 4JHMA 1HX0A 4XAYA 3OPSA 1G6CA 1B9ZA 1XYLA 3WLLA 1N8IA 3HF3A 1A5CA 4DBDA 2WYSA 3DCPA 1I4NA 4GY7A 3P82A 3DECA 3EDEA 4HA1A 4A2SA 1J01A 2D0GA 4ZQRA 4X9SA 2GYIA 5CC3A 2D2OA 4KPLA 1ZCOA 1HL8A 3M7WA 1V02E 3UESA 1CT5A 1VZWA 1MUWA 2W4XA 3RX2A 4W7UA 1M6JA 2JFEX 3GBEA 1SR9A 1OC5A 2VXNA 4R53A 1EPXA 1FWSA 3UWUA 4DJDA 1RD5A 2DZXA 4B92A 2PGWA 1XKYA 2OYLA 2PDHA 2OO0A 4ECLA 3IS4A 1OX4A 3TTSA 2V3DA 3ZR5A 1OT2A 4DLMA 1KD0A 3FIGA 4RZBA 1XIEA 4MVAA 4IFKB 2RDUA 4EXAA 4G7FA 2CHRA 2Z7KA 4NZ3A 1P5BA 1S2VA 3QHOA 3CT7A 1R3SA 4PUEA 3UY7A 4AB4A 5BNKA 3H2NA 1OWQA 2TAAA 4LF2A 2PTZA 1TCDA 2INFA 2ZZ6A 3ZSTA 4FHAA 1J8VA 1B2YA 3BG9A 3LYEA 1JR1A 3VDGA 4LYKA 4ICNA 1EHNA 3EZ4A 1ADSA 1XCFA 1DPMA 5BXPA 2XG9A 5CG7A 2J9ZA 4HYRA 5ABEA 3B06A 5HNNA 1SVDA 4B9YA 5I03A 1V3HA 3CXOA 4M7TA 2FHFA 2E5BA 1QW8A 1WP6A 4U28A 3MYOA 2I1OA 3SY5A 3FA4A 4AD4A 5HNTA 4JTKA 1O7AA 1YEYA 1JUKA 4MIMA 1FWCC 3OA5A 1J4EA 5CZJA 4JKLA 5HUOA 3FGCA 3V5CA 5T91A 4KKXA 1CDGA 1DP0A 2FFCA 3R89A 4NIRA 1E5JA 2Z2UA 1QHZA 1TCMA 4UQAA 3UQNA 3SURA 2NV1A 4JFUA 1UKQA 5A8PA 2GVGA 4R27A 5ECVA 1V0LA 2X40A 3NVDA 2FJKA 1OX4B 2J24A 2WSQA 3EB4A 3IJDA 1GYMA 1XBZA 2O9TA 3I4EA 3T0AA 1ME9A 4N4PA 5LXEA 1AJ2A 2XVKA 4AFYA 4C5ZA 3CTTA 2J74A 3FN9A 5HMDA 3T42A 4Q8OA 4AU0A 2HVNA 1QMLA 4ML9A 2ZUUA 5HAOA 1CIUA 1TPDA 1DXEA 2PBGA 5CSSA 4GIRA 4E6MA 4CQCA 4XVEA 1VRXA 1JCLA 3C2YA 2PTDA 2FHBA 1A3WA 3AROA 5LIYX 2HPMA 2HV5A 4FNPA 4MJ4A 3LX9A 4EK7A 4B5SA 4DF1A 4XKMA 3WX7A 2OT0A 1ZBKA 3WO8A 3P0WA 4UTFA 2OMAA 3NSXA 1JF5A 3PTDA 2CESA 3MUAA 1E1CA 3RU6A 2BHZA 3QR0A 4C7FA 1IWPA 3GXDA 3EX4A 4S3GA 4ZO6A 3GG7A 1KXVA 3AJXA 3QRHA 1AW1A 1TV3A 4RXGA 1FCUA 2PWDA 3LI0A 1EA0A 2OGJA 1IIGA 4QM1A 1F4HA 3NAVA 4NY2A 3VCCA 3RLVA 1JCXA 1U83A 2BB0A 4FEZA 3GYCA 1W3HA 3S5OA 1MRAA 3TQKA 2XH0A 1X6UA 2PE4A 2CPUA 3PC0A 4EPDC 1I2PA 4OTKA 2C19A 3FGCB 3UYIA 1VFUA 2REQA 3QV9A 4NZJA 4WLCA 1UMLA 1AL8A 3AS3A 2X16A 4WR3A 3TNOA 1Q6EA 4XISA 1EBHA 4WK9A 3B05A 1YX1A 1XRVA 5LKYA 3ZLGA 2Y2WA 3PN8A 3WKZA 3NEHA 1G4TA 4M3PA 3AHXA 1Q7ZA 1FFQA 5FSEC 1UQYA 3G1YA 2DQWA 1E6XM 3WDQA 3H7VA 5C9RA 4AVOA 3VD9A 4Z2LA 2XSXA 2YPIA 4Q4KA 4C7DA 5F1UA 2YBVA 5C55A 1XICA 2ZZ5A 3URBA 4Z1CA 4Z1DA 5D32A 2IQDA 2YA1A 1XV8A 3BJSA 4XZ9A 1H1NA 3QR1A 1IEIA 4NNAA 1XC4A 4KERA 5I3KA 2C13A 4IISA 5I2UA 2VJXA 3ZS4A 1E1CB 4AZ7A 1TZZA 4NNCA 3SUUA 3IIOA 1M5WA 3TC3A 2J27A 3QW4B 3DENA 3G6MA 2HE5A 4ERAA 2ZA1A 1BTCA 3S3GA 1DEDA 2VVSA 2FGLA 4P7QA 4BI6A 3CMJA 4CQBA 2CEQA 1GT8A 3G18A 3O3RA 2OKTA 1E1EA 5BXRA 1XLBA 5LIUX 5E9XA 1W3KA 2WJDA 2G97A 1PUDA 3GNNA 4AWSA 2REQB 4QDPA 4O8AA 3LGGA 2GUUA 5MKGA 1FH8A 3W2NA 1UWIA 3BVJA 3TQ0A 3FAXA 3TWAA 2DW7A 4L4PA 3P8JA 3S5SA 4FNTA 3WK3A 2GJPA 3R79A 3B97A 4N9EA 1A3XA 3WQCA 3VPLA 3PB2A 2DGAA 4ZOCA 1H41A 4I8YA 1E6SM 1EUAA 4S3BA 5CEWA 3KRUA 3L0KA 3IUIA 3CV2A 4PE8A 3OYZA 3FLUA 1KO0A 3ERPA 3GH7A 2DVTA 3AYVA 3DBNA 3GDMA 3EXTA 1XIMA 1GZGA 1RK5A 4N7QA 5GJNA 3G0UA 3ZT7A 4E8DA 5I77A 2Y85A 5F7UA 5IHSA 4MYAA 1KRAC 4U5IA 3TYZA 4TIMA 3WJZA 1V03A 3QFWA 1VFMA 5DRCA 1MDLA 3NPXA 4GY0A 2WMHA 5E0FA 1JULA 4Y9MA 2PF0A 4MNLA 3UNDA 3BPWA 2FTYA 3VFCA 3AIUA 1PDYA 4ZO9A 4UOQA 3AHVA 5FF3A 3CHEA 1BYBA 5FCZA 3LPFA 3C4UA 5G2WA 2XISA 5HNUA 4F66A 6TIMA 1JZ2A 3HG3A 1ESWA 3O7UA 2GUBA 4C6CA 1U5VA 2PU1A 3B0VC 1LOLA 4MHBA 3RX3A 3H70A 2Y62A 1DWGM 4HHPA 1J11A 2NWRA 3C3NA 3GNRA 4IICA 3DYPA 1ONWA 5MKGB 1V6YA 2W61A 3SRDA 2GGJA 3LPPA 1DWIM 1ICPA 2WV8A 4DYKA 4MY9A 3DC0A 1PKMA 3GHUA 4EAMA 4HPXA 4WDTA 1IT8A 2QXWA 4H7ZA 4E2VA 1AD1A 3IRSA 3K4WA 1DBTA 1SZGA 3UWWA 1Q6OA 1RVGA 2NV9A 1IT0A 1RLCL 2ZADA 3EBVA 1S5NA 1XSKA 2XIJA 1K02A 4GOAA 3UXIA 2VP8A 2WVVA 3O6AA 4Q4OA 2Z4GA 4M7SA 1UC4A 3AXMA 3EOOA 4QHRA 3H2OA 2QCCA 4CQDA 3LDVA 4LYRA 2CHOA 4FOUA 4FXJA 4M24A 3AXXA 2GUYA 1FBAA 3QM3A 4B2DD 4YIWA 3BOXA 4D6DA 4S39A 3NEVA 2BY2A 4IIDA 2QV5A 4GA8A 1J5SA 4B15A 3G22A 1KXQA 2WKGA 1XI3A 5ABGA 3UGRA 4N2YA 4C6KA 3S1XA 3C2EA 1HKIA 1XW8A 4A29A 2ACSA 1LYXA 3IJ7A 2E0PA 1RJQA 5FJIA 4GI4A 1H4PA 3KBWA 1QPNA 2VEFA 1XF0A 3LXAA 5A6LA 3WF1A 1IF2A 1XRSA 1GYLA 3SQMA 1P1XA 3U57A 4UCFA 2WMKA 5E5CA 2DT0A 4AWUA 4L64A 4RJEA 4F3HA 2Z00A 3MDUA 1EYEA 3TKFA 3LB0A 1IEVA 3DH7A 4O15A 3GDBA 4U5KA 1M65A 4WF7A 1QNOA 1T96A 1FCVA 3W53A 3KLKA 1SO4A 1NY1A 1K77A 2V69A 4MJ2A 4XO6A 3AQUA 1Z9AA 4AY1A 5T9CE 1HGWA 3FOKA 1JCNA 2HRWA 1EKOA 2DJXA 3WLTA 1TJ1A 4JKKA 4ATDA 4EF9A 3BGGA 2W6RA 2HCVA 2WVVB 1UD5A 1MWOA 3SQLA 2QEZA 3LOTA 5JMUA 2X1TA 3O0KA 3EXSA 4DAIA 1W5MA 1HFBA 2PEVA 1OBAA 2WCSA 2UY3A 3WL0A 4ZBCA 1HKVA 2PUZA 3W72A 3M0JA 2OYMA 1PL9A 1S2AA 3FVDA 3BLKA 1LBLA 3NVTA 1JPDX 4W8BA 1H7NA 3JR2A 3ZQ9A 2VR4A 3UNTA 5HNRA 1GOOA 3WJSA 4Z08A 1EC7A 3MA8A 4ZVJA 3REQA 1KCLA 3EMZA 2WXDM 3PZ9A 1JXJA 5TIMA 6REQA 4JGDA 1V0MA 3TH6A 1TX0A 1K7XA 1XG3A 3DFSA 2ZDSA 3NOYA 4GUIA 5M17A 4ADUA 3A4AA 4URIA 1IHIA 3LY0A 4PMYA 4B3ZA 3DIPA 4I9JA 1S39A 1PKNA 2QJNA 2VCAA 4CN1A 4ADTA 2JGQA 3CAWA 3WQEA 5I3GA 3A3WA 4I90A 1GOMA 1QNPA 4JY8A 1YTKA 1UBPC 1DIEA 1G4SA 4JTRA 5AFDA 2XWDA 2PTXA 3ATYA 1ITQA 4XKYA 3WQFA 1TPWA 1OC6A 4M6PA 3K5XA 3FDGA 4HCDA 3POCA 1D7FA 4A3QA 3ICJA 2QCLA 1IXQA 2ESCA 2WPGA 1TELA 1NSJA 4KCVA 1BD0A 2PDIA 4LUTA 3QOKA 2UV8G 1JIBA 4JQAA 1ZP3A 2A21A 3CB3A 5C2XA 2E1WA 3W38A 4C6QA 3PPFA 4LUYA 1JPKA 1XIGA 5IFPA 1E6QM 1XLDA 7ODCA 3GDTA 3M0VA 5ABTA 2V3FA 1A5LC 4LBSA 4C1KA 3RR1A 1FXQA 1JF6A 4X61A 5CGQA 2IPGA 3OVRA 1W9BM 3REQB 4JTFA 3D47A 2C7FA 3VDAA 3E0LA 1G7VA 3QYSA 7PTDA 4MFEA 6REQB 2VFGA 4YLWA 1O94A 1YPFA 4S3DA 1Q8JA 3NTYA 1R3YA 1ISXA 3VIJA 4IQJA 1EOKA 4BQ5A 4O17A 3W37A 3CAVA 2A3HA 4TMCA 3LPOA 4JHZA 2QPSA 3M0HA 4PEKA 2GOUA 4K7YA 1H1YA 4QROA 4LW7A 3VKKA 5D33A 3LG3A 4B5NA 4HA4A 2NQLA 4GINA 3T08A 2QQ6A 3OYXA 4K1WA 2CU0A 3LQGA 2J7CA 2VMFA 3EPOA 1OHLA 1UR0A 4OOUA 1RH9A 3KVMA 2DZAA 2VRJA 2Y63A 3MO7A 4KEUA 5A8QA 1R9YA 1TRIA 1XYBA 1E4LA 3DAQA 4J27A 4LY8A 4XKYB 3TJ4A 1HGYA 1NFGA 1V08A 1JYWA 3TN4A 5CKSA 4C1LA 2P50A 3VDBA 3COTA 3VE9A 5E6YA 2UY5A 2XFRA 4Z2JA 2WBGA 4XIMA 2P53A 2QJMA 4LUTB 4DJEA 2AL1A 3BCFA 4OV9A 3S46A 1V4YA 4IX2A 3BAXA 3QY7A 2Z6JA 4PULA 1AW5A 1F73A 5D2TA 3LXBA 1ITXA 3SBFA 4JIHA 4NYYA 3GUWA 1KRMA 4OUIA 4JN7A 1H2JA 3L5AA 4QAIA 3KS6A 1RBOB 2ZX6A 4HB7A 1VFTA 1MO0A 3DGRA 3CGTA 3WDJA 3DFHA 1HJXA 5HMSA 2Y89A 2Y7FA 2J47A 4QIUA 1TVNA 4D6IA 1UQZA 2HE8A 2GSEA 1EC9A 2QUTA 2QJJA 4EP8C 4F2BA 1LLZA 3TAOA 1E40A 1WBJA 3SCWA 1RY8A 4TU1A 4WZHA 3AHZA 4WD0A 2CXGA 2NX3A 1TV5A 4O1CA 5FJUA 3CEPA 4UTIA 4TTUA 3NIYA 2CZVA 2HDJA 2WVTA 1Q6GA 4S2CA 2YFOA 5DMLA 1P0BA 1KBLA 4KEMA 3GC4A 3WLJA 2QVHA 4KWOA 1JYVA 4JYDA 3IJLA 3W88A 3HGRA 3CQKA 3B8UA 3ES7A 4MYXA 3I4KA 3R8HA 9XIMA 1GQNA 4GNJA 1NDWA 4MNJA 2X05A 3NWRA 4YJ5A 3N11A 4Z0SA 4ZTYA 2PDKA 4F0LA 1L9WA 3VUSA 4W4QA 4UTHA 1A5SA 3C52A 4NYUA 3BXWA 5G5IA 3KVJA 1ZJHA 2WMFA 3WZ0E 4J3VA 1WDRA 1VBRA 3UCDA 5MHBA 4N6FA 3UG3A 2QUVA 1Q6CA 4P7RA 5JVLA 3EA3A 2RUSA 3BANA 3J7HA 3WQGA 4L9YA 2FQIA 1JGIA 2YJQA 1M03A 5ECUA 4TX8A 2Y7DA 4XG1A 3KL3A 1M7JA 4F0RA 1LQAA 2YW3A 5I3JA 4LNYA 2PP1A 3LPGA 7TAAA 3V7PA 1I2RA 3VIHA 3OZPA 3AIQA 3DG7A 4E4FA 1A4LA 5BWFA 2YW4A 3BUVA 2OLSA 4AUBA 1PX3A 1XG4A 1OY0A 4O12A 3A4WA 3DFQA 1Q66A 3MUCA 4K8EA 5AB3A 2YCKX 2Q6ZA 3P81A 5JUVA 4UFMA 1GJPA 3LHUA 1MXDA 3QY8A 1RA5A 5EMMA 3UEQA 2YKKA 3BG5A 4QXIA 5D2WA 3SUVA 4A6GA 4QTGA 8A3HA 1PDZA 3AIBA 5EMUA 1E6ZA 2WC3A 5DX7A 4PCSA 2Z1VA 2A85A 2ZX5A 3GR8A 1XISA 1OFQA 1BKSA 2WZHA 5D38A 1K8ZA 2FH8A 5EU9A 1CWYA 3VDHA 2EGZA 1ZS2A 3IIVA 4W8LA 3BO9A 2FVKA 4HQVA 3U6WA 1ZJBA 4ROQA 1NFBA 2Y88A 4TR9A 4UBPC 1KFBA 1JXKA 4LAKA 1JZ7A 3W84A 4L80A 1UD8A 1GQIA 3MJYA 3I65A 3APTA 3UGVA 1EOMA 2F84A 3MYPA 1W3TA 4DAFA 4HOXA 2YXGA 3C2VA 4YWIA 1UR1A 5HWJA 3RN6A 3OIHA 4XZLX 3TTQA 5EB8A 1SFJA 5AC7A 3NQGA 5CBJA 4Y96A 3FKRA 5L6UA 4O28A 3E2QA 1IXOA 3D3FA 2F2KA 3P62A 4HA0A 3JUGA 3GZAA 2G3IA 5AKQA 2Z27A 3QPYA 3PY2A 3EDKA 1P48A 1XFCA 3HJZA 1JRBA 3FJNA 2RGMA 3H4XA 1OZQA 4F2TA 3VKBA 2KZHA 5I7GA 2CKRA 1KR0A 2DZBA 4AXNA 3L5MA 5AZ0A 1EO5A 4LBUA 1U30A 1V5XA 3P0XA 2HPIA 1FWNA 1PXGA 1TQXA 1L2UA 3VGDA 1KFCA 3UETA 4HPHA 4D6FA 3R6IA 3VD4A 1KTNA 4UFJA 4YCPA 3BLOA 2E40A 3G6LA 4DO6A 3R5EA 3GTXA 2DVXA 1A5UA 2PTYA 1QT1A 3RMJA 2UY2A 3DG6A 2Y0FA 1XL9A 4HU4A 2WSKA 1J2BA 3WH5A 1TV8A 4Y7EA 2DEPA 2YL9A 1R3QA 1YXCA 1CLVA 1TFVA 3NJ3A 5LHFA 3OHIA 5CH9A 4KWUA 1VFOA 1M41A 2CNCA 2Q02A 5FOOA 1QTWA 3DHFA 1R7AA 1J0YA 4NKCA 4HNLA 3VIFA 4QP0A 1KFJA 1GPFA 5G4EA 3OVGA 1JYXA 4XAPA 1WO2A 2WKJA 1TUXA 1YW1A 1LL4A 2BSLA 4Y9NA 3TJLA 1RXOB 3G0SA 2IPFA 5LGXA 4NJGA 4O11A 3E5BA 4KFOA 3P93A 1ZNNA 3TJIA 3W1RA 4IPLA 2BGSA 2WQDA 4QS6A 1OB0A 3M41A 1POJA 3ZXWA 3GVRA 4W85A 1SM9A 1XRFA 1CENA 4QSHA 5HATA 1W9UA 3N4AA 3WMSA 5GNXA 4ZXOA 1WA3A 2VURA 1B1YA 5H8MA 1Q5MA 1Y7VA 4UWMA 3EWWA 3TSBA 3BW3A 3ANVA 4AMCA 3VOGA 1FWGC 5JBDA 1UCWA 1NEYA 1WXYA 4AY8A 4FLSA 3N73A 1UC5A 2HJPA 3CJPA 5D9MA 3VCNA 2FB3A 1O95A 3W1AA 1VC4A 1R9ZA 4UUIA 1X8FA 2JIEA 3LCFA 1OCQA 1LDCA 2QDDA 2ZE3A 2Z26A 2I17A 3E9AA 2C18A 3T40A 1S46A 3ZWTA 1HKJA 3WD1A 4D6CA 1LORA 2WJEA 3H7UA 3V0TA 4IQDA 2XU2A 3AFBA 3GHRA 1WCGA