4IOTA

High-resolution structure of triosephosphate isomerase from e. coli
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
254
structure length
254
Chain Sequence
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Triosephosphate isomerase is a common crystallization contaminant of soluble His-tagged proteins produced in Escherichia coli.
pubmed doi rcsb
molecule tags Isomerase
total genus 94
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4iotA00
3CIWA 5L6UA 3NL2A 3Q58A 5J5RA 4H4IA 3MHGA 3EX4A 1PCWA 4O10A 4AEOA 5IBXC 2HMCA 1K7FA 4FIQA 3ZR4A 2A4AA 1KFKA 2YR1A 5DELA 1FXQA 2EF9A 2C15A 2TRSA 1VCGA 3WJWA 3GAKA 3KVKA 3UYCA 4LU0A 3QF0A 1I2NA 3GXTA 2DZVA 1OF8A 5F4WA 4Z1DA 3O6DA 4PL2A 5D38A 1JUBA 1N7KA 1DOSA 3P81A 4QAIA 4Z1BA 3NQ8A 2ABBA 4AXKA 3H54A 5CGQA 3P80A 2BWGA 3LXAA 4UNLA 1ZFJA 4QITA 2ZRZA 1OX6A 3NL6A 1A53A 2ZCGA 3I68A 5G2HA 1HG3A 1ZAIA 1JCXA 2ZZ2A 4BK9A 1IXQA 2DJXA 2X1TA 4K6AA 5G4WA 3LCWA 3BW3A 1YADA 4HNTA 3S1WA 2DZUA 3I7QA 3PUDA 2A6LA 3Q2DA 5F4XA 1QMLA 1GYLA 3QJAA 4YMZA 3W7EA 4FF7A 5KZEA 2ZQ0A 1MEHA 5D37A 3HO8A 2BXVA 3NQVA 1N8FA 2TPSA 2CFFA 3G3MA 3L67A 5LNSA 3B06A 1HL2A 1WXJA 1F7BA 4K36A 3GDTA 4PCFA 1B4KA 1KFCA 1T8XA 2NXHA 3HF3A 1YYAA 1OG0A 3CT7A 5CPOA 3FYOA 4TMBA 1FCVA 3W84A 3HBLA 1KFLA 2RDUA 4JTFA 1DVJA 5CZTA 2GQAA 3W7PA 1KM0A 4O1BA 4BWLA 3ABRA 5HR6A 4GUGA 2E1DA 1DORA 2YXGA 3FYPA 4GBUA 1EWEA 4FNUA 3GXNA 4N6FA 3OIXA 4FX7A 3TQ0A 1SU5A 1OJXA 4RR4A 3L9CA 4XKYB 2NZLA 2E77A 1BWKA 3SZ8A 1UB3A 3W72A 3TNOA 1P0NA 4JR5A 1WBHA 3L68A 3R12A 1OX4B 4FNQA 3O06A 1ZHAA 1TTPA 1EWDA 3NNTA 2F84A 2B7PA 4D2JA 1OFQA 3BLEA 1RZMA 3IEBA 4I7WA 4IUOA 3CM4A 4XQ6A 1SUXA 5AHIA 1GWJA 1LBMA 3C2VA 3A24A 1XFBA 3RFAA 5I3FA 2QCDB 4AWTA 4N02A 4I9AA 5LHFA 4M19A 2I1OA 3GR8A 3HGSA 4IMFA 2ATMA 4LC8A 4MLRA 3B0VC 4HSOA 3INPA 2B7NA 4CNPA 4RZ6A 3TW6A 1A50A 1VPXA 1W3IA 3N9RA 4KFPA 4QIUA 3BV4A 1I8JA 1PS9A 3Q37A 4NJKA 4O0KA 2JKAA 2NWSA 1K8ZA 3UY7A 1SO4A 5FF0A 1IF2A 5AC6A 3DI1A 5HUOA 3E12A 1TV5A 4UTWA 4LVGA 3UWVA 3TU9A 2H90A 1BEUA 5D33A 4ONVA 3TSBA 5K9XA 3E0IA 2GUUA 1KM4A 3NA8A 5K9CA 3CEUA 4FNTA 1P1XA 3LB0A 3F1QA 2I14A 4OE7A 4FX8A 4OV9A 2E5DA 3LCIA 3QZEA 1JULA 3G0SA 5LNVA 1TPVA 3MP4A 3C0JA 2TMDA 1O60A 2VEPA 1O95A 5HR7A 4IWWA 4UTTC 1YDVA 3W1LA 2NX3A 3L66A 4FHAA 3R2GA 4ZQPA 5AYZA 2W79A 3FKRA 3V1PA 3M0ZA 4A3UA 2P1FA 3LTPA 3P62A 2GQ9A 5HULA 1OFDA 2J27A 1GVQA 4O52A 1GTEA 1IGSA 3TKFA 5KINA 4LY8A 4TX9A 3JR2A 3HJZA 4NNCA 1GEQA 4XTIA 2FQIA 4N2YA 4EVZA 1F2JA 3NR0A 1WA3A 3KVLA 1R46A 3PM6A 1KV5A 1G4PA 4ML9A 3NOEA 1HO4A 3U6WA 1N55A 2GJLA 3TSMA 4JXCA 3HB9A 3LGEA 2HS8A 1KM6A 4RZ5A 3W85A 5DCDA 4NUWA 3TFXA 2Y85A 4PODA 3TX9A 4GUIA 3EX2A 4MJZA 3NL5A 2P0OA 4G1KA 3PG9A 3W9ZA 2ZDRA 2CLHA 3MW7A 3W7HA 1QAPA 2FJKA 3TC7A 5DBTA 2Y6ZA 4UUIA 1FUYA 1WAUA 4NZJA 4O53A 4ZQOA 1GPWA 4O1AA 1TO3A 2CLOA 5AYYA 4GC4A 4XKYA 4RXGA 5LSMA 4WOZA 2CLMA 1EP1A 3I7SA 1L2UA 2HS6A 2C3ZA 3PBUA 1VJIA 1OX4A 2FLIA 4O0ZA 3LERA 1B57A 3NQGA 1MZHA 3W7CA 4LV9A 3W76A 1XXXA 3T78A 3VE7A 1W1ZA 1I45A 4XUGA 3UWZA 1X1OA 2FPVA 3BLFA 4ICNA 3NQCA 5D2XA 4O14A 4L4MA 1NEYA 1OYBA 1KFJA 1JRCA 3MI2A 4UCGA 2C1HA 4O54A 2YDAA 4IJBA 3IRDA 3STGA 3OA3A 5HJLA 2WV8A 3UWYA 1YXYA 3P5YA 3AJXA 1P5BA 1YPFA 4POCA 1OFPA 1G6CA 3EXTA 3QSRA 5AN7A 1O5XA 4QSHA 1P0KA 2WSYA 1R30A 4LNYA 4MFEA 3G18A 2VEIA 1SW0A 3IGSA 3L65A 1LTDA 1LBLA 3GK0A 4C1LA 2WQPA 1W37A 1VQTA 4HIBA 1OFBA 3UQNA 5LGXA 1QO2A 2JKPA 4BR1A 3UPWA 1V5XA 3W7QA 1QNVA 4LVBA 2Y7DA 4UTUA 3W1QA 5LNWA 1QCWA 1ZNNA 4JX4A 3FOKA 3ATYA 2VEKA 4R7JA 1CX9A 3LI1A 3A21A 3LRMA 3EKLA 4JYFA 4R34A 4GJ1A 4LOCA 1JQVA 3PSWA 2Y88A 5KMYA 3QMTA 1SZEA 4Y9AA 4WUIA 1H51A 4Y90A 1AMKA 2DJLA 2OT1A 3S1UA 1PV8A 1RD5A 4J9JA 1LZOA 3G1DA 5AHFA 1VHNA 2J88A 3LBCA 5I3KA 3HGRA 3DH7A 3RLUA 2XN2A 2G97A 3EX6A 4O28A 2Q3OA 4X3ZA 3NPXA 3S5ZA 4FIRA 2NWRA 4OWGA 5FEPA 3TIMA 1YDNA 4YWIA 4AB4A 4S1FA 5I3IA 1JVNA 3KX6A 5SWUA 3W71A 1DKWA 2V0TA 4TR9A 2FTPA 1F05A 4JTSA 2DORA 3IIOA 1QFEA 4UTLA 3NYZA 3G1VA 2QJHA 3A5FA 5DLCA 4E38A 2OCZA 3BO9A 2VKZG 1A5SA 5G1TA 3G8EA 3N2XA 1FCBA 4YL2A 3TMQA 5F1VA 2CLKA 4P61A 3EWWA 3EX3A 1EP3A 3ELFA 3W7OA 2F7FA 3GIYA 2GPTA 1QDSA 3DHDA 2LLEA 3TR2A 3F4WA 1KM2A 4LUIA 2KZHA 1ZCOA 4NZFA 1IXPA 4E0CA 1FWSA 1ZY9A 3N3MA 4O1CA 3F4NA 1LOSA 5K3VA 5FF3A 1Q6RA 5D02A 3NQ2A 3EWUA 5FEZA 1Z48A 1F6PA 3G0XA 1GVSA 4MVAA 4O12A 5GVJA 1GT8A 4CNOA 4NJJA 4N9DA 1VR6A 2WNZA 5D2TA 2JBMA 3LHWA 3RNDA 2QCNA 4FXSA 1TV8A 1XDMA 4FO4A 3PVFA 1YTDA 1OK4A 3EB2A 2ZZ5A 4FNPA 5C6MA 4M6QA 1KTCA 3V75A 2CZEA 3R8RA 3R5EA 1T0OA 1TPWA 3ANYA 3M9YA 1H5YA 3LCHA 3O1NA 1OF6A 5EMUA 3B05A 2WKJA 2Z0IA 4RXFA 4CQ8A 1ADOA 3L0GA 1OFRA 4NT0A 2A7NA 1YTEA 1TRDA 4IXXA 3M5ZA 4OQVA 3NM3A 1SO5A 4XZ9A 2ZRXA 2ZRWA 5K4XA 1ME8A 2NV2A 3E96A 1TPDA 4IPIA 3C6CA 5DBUA 4JTLA 4MJMA 2NV1A 2H6RA 3P61A 4JTTA 1UASA 4IX2A 1QOQA 2G5WA 5K9DA 2JGYA 4UFJA 3MI6A 1KLZA 3LHVA 5DY2A 3O07A 1GG1A 1LORA 2X1UA 3BGGA 1LLWA 5G2IA 4MYXA 2FB3A 3VI2A 3ABOA 3P8JA 4FXRA 4E2DA 3W83A 3HPSA 3TCEA 1CI1A 4FNRA 3NDOA 4UFMA 2RKXA 3THQA 1FWNA 1KW1A 1GVRA 4HN4A 4OHQA 3LHTA 4JTJA 3KVMA 3N2MA 1KTNA 1ZJIA 2A21A 2YCEA 4Z0JA 3L5AA 4TO8A 1AL8A 4UC5A 4QQ3A 4AWUA 4ZL1A 1W0MA 3W75A 4PL1A 1I2QA 1NVMA 1H7WA 2E6AA 5LNRA 1R2TA 5CKSA 1TTJA 2Q3RA 5AYXA 4HNNA 1TV7A 3KRZA 5TIMA 4XTDA 1QPOA 1F5ZA 3S5NA 1L6YA 3SFKA 6ALDA 3LV5A 1H1ZA 3T4CA 2V2CA 3I7RA 5I3JA 2QAFA 4HHPA 1LP6A 3QFEA 3M43A 3TC6A 4KFNA 2HTMA 3KRSA 1QR7A 2QEZA 3BLIA 2JKEA 3DFOA 4LVAA 4RCXA 1RQEA 4LS1A 4N9BA 5FESA 2BLEA 3TAKA 5ABTA 2OMAA 2WOQA 5FF4A 3CPRA 2W0UA 2ZZ6A 1PVNA 3DI0A 3SGUA 3W7MA 2RDWA 1RQHA 4OU1A 4O15A 1WQ5A 3O8AA 1A5CA 1XCFA 1RR2A 4KWWA 3MUXA 1TQJA 4IXHA 2ISSA 3BPWA 2NX1A 3QQ0A 1Z42A 4NXSA 2Y89A 4AHPA 3QH2A 1RPXA 2R14A 5EA9A 4TIMA 1H60A 3KOFA 4MIMA 1FDZA 1F6KA 3RU6A 3G1SA 1RV8A 4UTKA 3GYEA 4M7TA 1SZGA 1L6WA 1LRTA 3W7IA 2EHHA 5G2WA 4NNBA 3WJSA 4OT7A 2V82A 2EKCA 1RVGA 4YXGA 4DF2A 5C5YA 1S5WA 1MO0A 3W07A 5DCBA 4Z1AA 3ZWTA 4PTNA 4JDBA 2PE4A 4K7YA 2XN0A 2QAPA 5EBUA 4DO6A 3I6RA 3MYOA 3NM1A 3CEPA 1JCMP 2FPTA 2QKFA 3W2MA 1YTKA 3CC1A 2ZRYA 3HG5A 2WSRA 4U28A 3KRUA 2V5LA 3PG8A 1FQ0A 3OEXA 1TREA 3L0KA 4JNMA 4FNSA 3IVSA 2QJIA 1O5KA 1K03A 1W5OA 4N4PA 4ALDA 2QCHA 3W2LA 1JCJA 5EL1A 2QCFA 3A22A 4WD0A 3M1ZA 5C54A 3C2FA 4UMBA 3LI0A 1F74A 2V30A 3QQ1A 3TQKA 1XUZA 5CZ0A 3WFAA 5D32A 3SI9A 4ZVJA 1EB3A 4XBKA 1I4NA 2OZ0A 5D2VA 1OFEA 2X2GA 4JGDA 4CQAA 4WY0B 3IIVA 4AHQA 1B4EA 1VC4A 1G7UA 5CPNA 1ICQA 5MHBA 1JJKA 2Z6JA 4ADTA 1TCDA 2ABAA 1JQXA 3B4UA 1SSGA 4ADSA 2YW3A 1G67A 2ZBTA 1H63A 1HUVA 1EPXA 3UWQA 4NNAA 1FWTA 3LLDA 1D3GA 1FWRA 1AG1O 2Y61A 1P4CA 3PUEA 5BMXA 2AAMA 4ZQNA 1ZAHA 2NUYA 4IOTA 4UIOA 2CZDA 4A22A 2PCQA 1MSSA 3TUUA 2J6XA 4LVFA 2GOUA 3UY8A 3W1XA 3STEA 1LRNA 3W7RA 3LXCA 3GR7A 4AHOA 1H7OA 1W8SA 3E9AA 4K38A 4YLWA 5F2MA 3TQVA 5AC8A 4NQ1A 3A23A 4EIVA 1OVDA 4AWSA 1FDYA 3SSJA 1G7VA 1DHPA 3A9IA 1D3HA 2A2IA 4ZMGA 2E6FA 1W5NA 3NQDA 4HKPA 3TV8A 3W1RA 1SFLA 4R53A 1J5TA 3HIJA 4UMCA 5HWNA 1KFBA 1I2RA 1VHCA 5HWMA 3PWAA 5IBXA 2V81A 4MLJA 3GZ3A 1DJQA 3M41A 2JGQA 1KA9F 1TYGA 4IMCA 4BI7A 4GRSA 4K8HA 1TJRA 1K8XA 3M7WA 4GWEA 3ZS4A 4DEFA 4RK8A 5HMSA 3IVTA 2CLFA 3ZWSA 1PHQA 1Y0EA 2B0MA 5G4EA 1VZWA 1RQBA 3C2EA 1R2RA 1UUMA 3O16A 4IX0A 1L9WA 4WXYA 5H91A 2PRLA 5F4SA 1XBZA 1H1YA 4K37A 4LS0A 1Q6QA 3PUOA 2ZRVA 3SJ3A 1H7RA 2E09A 1EX5A 1NSJA 3B04A 3NPWA 4MZYA 4O11A 1BKSA 4MOZA 4HNVA 1G4SA 2C6QA 3U8GA 4QNWA 1GYNA 3DGRA 1QWGA 1M7OA 3GKAA 4U4MA 3GNNA 1K7XA 3GKFA 2OT0A 1J2WA 1KLYA 3GX9A 4DBEA 3Q94A 4KKXA 3PULA 5BOOA 4O1DA 3IGUA 1VGAA 3GDKA 5EPDA 2A0NA 2H3DA 2ZA2A 2GQ8A 3LCLA 1XC4A 3M5XA 4JN6A 4Z1CA 2WNQA 3DXIA 3W88A 4NJHA 4DO4A 1IIGA 2YFNA 1TQXA 4AH7A 1MEWA 2GVJA 2BTMA 1GQNA 2RFGA 2Z1BA 2PC4A 1SO6A 1V7YA 4X9SA 3RLVA 5D04C 3EXSA 2Y7GA 3PY2A 4JX6A 5TBOA 1W56A 3SY5A 1JCLA 3G24A 3TMLA 2JK2A 1K02A 3TA6A 3TJXA 3NGJA 4ZQRA 1B3OA 4IMDA 1QOPA 1VYPX 1DL3A 3TJLA 2QCDA 4MKNA 5FF7A 1H62A 2C0AA 4WY0A 5AOUA 4JTGA 1EA0A 3P8IA 2YYTA 2RH9A 3PF3A 7TIMA 4WOQA 1A5BA 3WK0A 4MZ8A 1ML1A 4A21A 4Y6GA 4A2SA 3BARA 5AHMA 5DCEA 5IM51 3P74A 1ME9A 5TQLA 5E93A 3VCRA 1F73A 2W6RA 3KHJA 2A5HA 2X30A 4TMCA 4LC6A 2XN1A 3C2OA 4O57A 2VFEA 4JEQA 4CCEA 3CTLA 3FS2A 1FDJA 4MY8A 1OK6A 3PBWA 2DZWA 1Q6LA 2Y63A 5F2IA 1XM3A 2X16A 2I9EA 3L0NA 4LW7A 4AF0B 1A5AA 3M5YA 3AO0A 2BSLA 4C1KA 1XDLA 1M5WA 1Q45A 2V2DA 3W1UA 3GNDA 2QUUA 4TU1A 1G4EA 3QSTA 2VENA 2YGYA 3S9YA 1JCYA 1W5MA 3NQ6A 5HINA 1I2PA 3HPXA 3N14A 3GB6A 3N19B 3S1XA 1NAL1 5K7JA 3T40A 1HO1A 5F2LA 3THAA 1TJPA 2QDHA 3S8HA 3FJ6A 4LRSA 2NXGA 3E02A 3LHYA 1VCVA 1BTMA 3K30A 3T55A 3W22A 2V5BA 2QUVA 1F76A 3UZ5A 3EWXA 2FPYA 2WNNA 4ORMA 1GTHA 3HG3A 5CPLA 1ZALA 3SW6A 2ZZ7A 3HGJA 1OYAA 4FB7A 4CQ9A 4UTTA 2Y62A 4GXMA 3B0UX 3S5OA 4H6KA 1SQ7A 1X8FA 3CWOX 3P5ZA 2VFIA 2Z6IA 4IQLA 3FA5A 4Q4KA 4NX0A 3DFTA 3LCFA 3KXQA 4DXVA 2ZA1A 1XL9A 2A7PA 3CB8A 3MBDA 3UD6A 1VYSX 3PR2A 2WPBA 3MMTA 1UCWA 3WK3A 1NF0A 3G1XA 1T96A 5D2WA 2DZPA 3ABSA 5F2GA 2CZ5A 2Y70A 2QR6A 3EWBX 1VLWA 3H55A 2NX9A 4N9CA 2FIQA 4KWVA 3R89A 3A5VA 5AHLA 4CLMA 3EWYA 4M7SA 1MXSA 3B0PA 3GLCA 3R13A 5AHEA 3GAYA 1G69A 1ICPA 5A8GA 1VLIA 2ZFAA 3W23A 2Y7EA 3G0UA 5LZLA 1KV8A 2J24A 2C13A 1ALDA 2ZYFA 5HWJA 2NXIA 3NEVA 4PFMA 5LKYA 1Z41A 3UNDA 3GVGA 3TE9A 2R94A 3W2JA 3W2NA 4E2BA 5DXXA 3QMRA 3W86A 3KFTA 1TB3A 4GUJA 1VYRA 3LRLA 1WYIA 3RMJA 5AFDA 4Z08A 1NF7A 1J4EA 1WBJA 1NFBA 3QC3A 4WJEA 3TK7A 4LWWA 4Y8FA 3IIXA 3NL3A 2FFCA 5KSWA 4MPQA 4RLIA 2QJGA 3NZ1A 5EY5A 1S5TA 1WOAA 4GFSA 5LHEA 5CSSA 3IIPA 1D9EA 2YZRA 4RV8A 4I7VA 1R2SA 4UTHA 2GVLA 3C52A 5K2ZA 2QCEA 4DQWA 2VOMA 1SFJA 3PAJA 5F1UA 3C3NA 4WY0F 4AF0A 3IIZA 4CCCA 1LM1A 1ZENA 2WJZA 4UFHA 4XBSA 1S3HA 2C16A 4NJGA 1GOXA 4OGZA 3FKKA 2FB2A 3BK0A 3T44A 3DFNA 1PHWA 2ZTKA 3PSVA 1W54A 3O6CA 3LV6A 4Y96A 2J9XA 4MUZA 5BMWA 4UFLA 5T26A 3W73A 2EAWA 3STFA 1C9DA 4LUJA 3C4UA 3W1MA 3FIGA 2FDSA 5FEXA 4S2BA 2R91A 3YPIA 1WDWA 4JIQA 3TROA 3NG3A 1C8VA 2E68A 2VELA 3FJLA 3S5YA 1Q3NA 1FX6A 1DV7A 3OVRA 1SZFA 1PE1A 1H7PA 5BW6A 1FCQA 1TIMA 2CLIA 3HOJA 2QCGA 2ZTJA 4BFAA 4FX6M 1OFOA 1PCKA 4NX5A 1CW2A 2BZNA 4UMAA 4JY8A 3SIZA 4BI5A 3N34A 4GUHA 3G3DA 4QM1A 3QRHA 1M7PA 4MFDA 3S6DA 3G22A 1SZNA 3CWNA 4O8RA 2NLIA 3LCXA 2E6YA 1C29A 3QW4B 1ICSA 5KITA 1OX5A 1WX0A 1OHLA 3PS7A 4O18A 3W7DA 1YXCA 4UTIA 4PEKA 4EF8A 3DKLA 3DZ1A 2O7SA 3VNDA 4JD4A 3KAOA 1ONRA 4WXZA 3SECA 5LGZA 1ZAJA 3ATZA 1H61A 3W87A 3RF9A 4O19A 2EPHA 1GVOA 1AL7A 3HMJG 3HQ1A 3UXDA 1XBVA 1B9BA 2RHGA 3DHFA 5AB3A 1DJNA 4X22A 3TDFA 3CIXA 4YCOA 3MHUA 2CWNA 4DPPA 2DZTA 1DQWA 1O94A 4JTHA 5HUPA 3CQ0A 5K4ZA 2O7QA 2YFOA 2G96A 3C61A 4IMGA 2H3BA 2A6NA 2VC6A 5EKYA 1U83A 3L2IA 3W70A 5G1YA 3QYQA 2CZFA 1HFBA 3CLMA 2IQTA 3LHUA 2OJPA 3U2OA 2QDGA 3UXAA 5C55A 4YCPA 1AW5A 2E5CA 4S2CA 3M47A 4CNNA 1SR9A 4XWUA 1W5PA 3FFSA 2RDTA 3G1HA 1VH7A 2E6DA 3LXBA 3G8RA 4ORIA 4BI6A 3P82A 3C8FA 4EOUA 3EKZA 4HPJA 4JYDA 4MY9A 2B4GA 1TMHA 1X7FA 1IIHA 5KZMA 2J9ZA 4HT3A 1TPB1 3N73A 1XKYA 3DKJA 5DY3A 2Q8LA 3WK2A 1K3UA 1X6UA 3MBFA 1KM5A 1ME7A 4RJEA 3LLFA 3MP3A 1JR1A 2CLLA 2C18A 3M16A 1LDCA 3NQ7A 3QPZA 4GUFA 3W1NA 2H8ZA 3PB2A 3B03A 5D30A 2QCMA 4H3DA 5G5IA 4JYEA 1O4UA 3VE9A 2A85A 2YW4A 3W7JA 4IGHA 3EX1A 2J9YA 1YDOA 4WX2A 4DO5A 4ZQCA 3SGZA 4UTMA 2BX7A 1HTIA 1XUUA 2ISVA 5A5WA 4WZHA 1M6JA 4WQ6A 2CW6A 5FI8A 4JTKA 2D73A 3QEZA 3LCGA 4K39A 3W6YA 4M6PA 4M6VA 1LOLA 1LCOA 1W5QA 5I3HA 3DFSA 1FWWA 3QMSA 5LNUA 1LRQA 4Z0SA 4LRTA 2PRMA 2B7QA 3S1VA 1EUAA 3OVQA 3MP5A 3PC0A 1G4TA 2GJNA 3SR7A 3MYPA 4HNUA 2GVGA 4JIPA 1TTQA 1SPQA 2OX1A 1R47A 5D09A 3GDRA 1GJPA 1XBYA 3DENA 4LVDA 4O17A 3VFLA 3EWZA 2Z2UA 4K8EA 5CZJA 4O13A 1KM1A 3O6YX 1GZGA 5C2XA 5H2ZA 3HPZA 3NO5A 4JS3A 4PH6A 1JUEA 3DBPA 1H7NA 4ZQMA 1PL9A 2C14A 1H50A 3OBKA 2YX0A 4GNJA 3W2UA 4JTUA 3W1TA 4I7UA 1TSIA 2ZRUA 1TRIA 3W1PA 4JDYA 4O4WA 2UV8G 3BG9A 5AC7A 2A1YA 2X1RA 2E5BA 1EIXA 3GDLA 3P60A 4HSNA 3CHVA 1H7XA 3LRKA 5DN1A 4QISA 2TYSA 3LM7A 3UPBA 3N9SA 4O16A 4NU7A 2NUWA 1LOQA 3O63A 4DELA 4EWND 3NXFA 1E51A 3MO7A 3OG3A 3D0CA 4BF9A 2PRHA 1GG0A 1QPQA 2DP3A 3JS3A 5BNKA 2VXNA 3FEMA 3BGJA 5U4NA 3C2RA 1KBIA 3L21A 1VCFA 3NQMA 4NXKA 4JTIA 3W1AA 4AMAA 3C56A 4AAJA 3KVJA 2G95A 3TAOA 4UNKA 1W31A 3O15A 3NVTA 4HPXA 3W7GA 5D2YA 3FLUA 4AVFA 1LBFA 1JRBA 1YPIA 2X1SA 2Q8ZA 4DF1A 3VKJA 5E1QA 2NUXA 1LYXA 4OBTA 5I3GA 1FXPA 1GVFA 5D05A 5EYWA 3GXPA 2ZZ3A 1I2OA 4B5NA 3EEGA 4DBDA 3TXZA 3NAVA 4MY1A 4W9TA 1FCUA 4LS2A 1OYCA 1W3NA 8TIMA 1AK5A 1DBTA 4DPQA 3LTYA 3UWWA 3G1YA 3H53A 3PBVA 5FEWA 2R8WA 4RZ4A 4Q33A 2ZZ1A 1THFD 3TSDA 3NZRA 3WJXA 4EF9A 3L5MA 3OHIA 3BG5A 2P10A 2QCLA 3IGXA 3DAQA 4LTSA 1S5VA 1QO5A 3HG2A 2AQWA 3GDMA 4A2RA 5CSRA 1TPH1 3LTSA 3LHZA 2ISWA 3CU2A 3QM3A 2WO5A 5KZDA 5U7SA 6TIMA 3BW2A 3F03K 1LROA 3G1AA 3M44A 1OABA 1Z44A 4GE8A 3ZFHA 3PBYA 3L5LA 4FEZA 2QF7A 1OFAA 2V2HA 1X1ZA 3DFPA 2H8XA 3NQAA 1SW7A 2DZXA 3BW4A 4JICA 4ZZ9A 1EEPA 1IXNA 5BRBA 3TFCA 3TH6A 3HG4A 3IV3A 2VFHA 3BG3A 2V9DA 3MWAA 2A7RA 1KTBA 4NVTA 2Y7FA 3LBMA 3P84A 1EUNA 5CZSA 3WK1A 4UTJA 4IMEA 1UJPA 4MYAA 4OV4A 2YPIA 4IPJA 3I65A 3S42A 3WJYA 3NQEA 2C19A 1KBJA 1MEIA 2V8ZA 3TXVA 1QPRA 2DZSA 4JX5A 2ZZ4A 4BWLC 3S0CA 2ATSA 2HSAA 1Q6OA 3W7KA 2YSWA 1FBAA 1XI3A 2AGKA 2ZA3A 2YYUA 4PA8A 3W3OA 4N4QA 1KFEA 1TPEA 2CLEA 3G1FA 3MJYA 4UR8A 4JTEA 1QPNA 3M5VA 2ALDA 3MHFA 3USBA 3EXRA 2DU2A 5AHNA 1SW3A 4O4VA 1SO3A 3LDVA 2TSYA 1IXOA 5L9FA 2VFDA 5D03A 1UUOA 1YXDA 1WV2A 1L6SA 2EGZA 4A29A 3UZJA 1PIIA 2CU0A 3DU0A 3QPYA 3P7YA 1AW2A 4P2VA 5CG7A 1JUKA 4O50A 5HNRA 1DQXA 3OVPA 3B8DA 3W2KA 3W7NA 4M5PA 1WOBA 3IVUA 4UXDA 3STCA 3W7LA 1TPUA 4ADUA 4JY9A 2XFWA 1K8YA 1SSDA 1W3TA 1U5JA 4LT9A 3LOTA 3E49A 1TPFA 2B7OA 4UR7A 1XBXA 4RX0A 2VFFA 4UFKA 3NPVA 1VS1A 4Q32A 1UBSA 2PURA 3NQFA 4L4LA 4MZ1A 1YLVA 3LX9A 5E0KA 3M6YA 3T7VA 1TPC1 4NJIA 3BVJA 5J5DA 3HGOA 3UWUA 3W74A 5HQEA 3ABQA 4R33A 1K7EA 4UTWC 3P67A 5CPMA 3WJZA 4CCDA 4N9EA 3DFQA 2WSQA 4UFIA 5FF2A 4N6EA 2VEMA 3NPUA 5KTLA 2VFGA 3PB0A 3TW7A 1EP2A 1TTIA 2QUTA 1VRDA 4X2RA 2QCCA 5DXYA 4DF0A 3QW3A 3O05A 4QNEA 4QJ1A 3RK8A 1KM3A 1AW1A 1BWLA 4LV4A 4KFOA 1T99A 3MI3A 1JCNA 1FY6A 1LLZA 4PC8A 4K7VA 3JRKA 4RKAA
chains in the Genus database with same CATH superfamily
3CIWA 4KETA 2BOEX 3NL2A 4JIEA 5MKGA 2G4JA 1PCWA 4O10A 4AU0A 1K7FA 3ZR4A 2YXOA 3M0JA 2YR1A 5DO8A 1FXQA 2V5CA 1M65A 1A4MA 1Q6EA 5I06A 4LU0A 1FA2A 1I2NA 3PK7A 2DZVA 3DFHA 5PTDA 4MAVA 4Z1DA 4GIYA 4D8LA 4PL2A 1JUBA 3RRXA 3P81A 1J9YA 3XINA 1JYWA 1PYFA 2WVTA 4CNSA 2BWGA 1BF6A 5G2HA 4CEXC 1HG3A 3AMCA 2WZEA 4BK9A 1W9PA 1ZJBA 2X1TA 3LCWA 5HQMA 2J74A 2DZUA 2A6LA 2XPKA 4QJ3B 3THDA 4B5UA 4KIEA 4XV0A 1VP5A 3EB4A 4FI4A 3DCPA 2QXWA 3HO8A 3SDOA 4GD0A 2HBXA 3L67A 2YKKA 1XLIA 1QOXA 4L65A 3VUSA 1B4KA 1NWUA 1HF6A 4QTGA 3HF3A 4F66A 3RM4A 2ZIDA 3ARUA 3RLHA 3A4XA 1DXEA 4LY4A 3K1DA 4JTFA 2GGEA 3K46A 4GUGA 1IWAA 3QY7A 1E40A 3R4IA 1TMQA 3DC8A 4J3VA 2QJMA 1EWEA 1V03A 3T81A 1UH4A 5A8PA 4CD7A 4N42A 1KXVA 3OIXA 4QRNA 4XD6A 4Y9PA 2ACUA 1ITQA 2E77A 2XFYA 1VBGA 3C8NA 1XLFA 4F79A 3SCVA 3RCMA 3R12A 3F7JA 4L9XA 3VIOA 3O06A 1CLKA 2YA0A 4FOKA 5REQA 2F84A 1QT1A 2GSEA 1PX4A 4FF5A 2OEJA 3KUMA 4YIWA 4GI9A 3SUVA 2J6VA 3C2VA 5I3FA 4AWTA 3W28A 3UZXA 4FMVA 3WQOA 5LHFA 3UCDA 1N8IA 4LCSA 4DLFA 4M19A 4FLOA 3HGSA 4IMFA 4Q7BA 4DRSA 2CETA 4YTQA 4KF1A 2FZ8A 4CNPA 2DSWA 2VQTA 4EXAA 1VFUA 5BCAA 2Z26A 3USZA 2BV9A 3BV4A 4M81A 4RNFA 1H5VA 2J62A 3V1HA 5I3DA 3UY7A 1V02E 1IF2A 3DI1A 3E12A 1TV5A 1JPHA 2D0HA 3GIQA 4IMAA 1ESWA 4AZIA 1CECA 4A35A 4ONVA 4UQ9A 2CLPA 3OP2A 4C6CA 2PWHA 1P0DA 4X0VA 4EXQA 3RM9A 4YTUA 1KB3A 5BRPA 2E5DA 2WZHA 1DJGA 3LCIA 1EX1A 3PTKA 1RJRA 4LF2A 1AODA 1JAEA 3VX1A 1F4HA 1O60A 4GY0A 1BKHA 2POTA 2XTKA 1WNOA 2PGRA 3AIEA 1BYAA 2OLAA 4PRWA 3CASA 2A79A 3WNOA 4AFYA 1XLMA 3QY6A 4G7EB 4HVXA 3LTPA 3P62A 3ARWA 1OFDA 1CPUA 1IGSA 1SMAA 1XP3A 3URNA 4G56A 2BXYA 2J7GA 3JZUA 1EXPA 2ONEA 3HJZA 1EJXC 3QGVA 4XTIA 4EVZA 1HKIA 3SUUA 3T8LA 1R46A 3PM6A 1RPKA 3UXIA 1ISZA 2QMKA 1Q63A 3EWDA 4MWAA 1CYGA 1KCLA 2GJLA 4JXCA 3HB9A 3RX2A 1KM6A 4QG8A 3QYSA 3VOFA 2XM2A 4TVCA 2WANA 4NUWA 5DCDA 3P6LA 1A5OC 4PODA 3TX9A 1QW7A 3VGGA 4I8DA 3W9ZA 2ZDRA 5IFPA 2CLHA 2VDIA 3W7HA 4AZ6A 2FJKA 3TC7A 3ZJKA 4UUIA 3WNPA 4NZJA 8XIMA 4O53A 1V08A 2CLOA 5AYYA 4GC4A 4XKYA 3EKGA 4RXGA 5A6KA 5FA5A 1E5JA 3VK5A 3UZZA 4XZIA 1NWSA 3FAWA 4KPLA 3KZSA 1EP1A 3I7SA 4A6GA 5I2UA 3PBUA 3VIKA 3GXMA 1LL7A 3NQGA 5EBAA 4F4RA 1EDGA 4G6CA 4H2HA 4O14A 1CGUA 1OEPA 3RG6A 1OZMA 1AFSA 4PN2A 3MI2A 4UCGA 4O54A 3IPWA 2YDAA 2F6XA 3IRDA 3WLHA 2VT0A 1G6CA 1C8YA 4NZCA 4TV5A 1PZ3A 4H9ZA 4LNYA 1IV8A 3G18A 1SW0A 5DMMA 2A3HA 3TWAA 1JDDA 3IGSA 2WCSA 3NZPA 4QG6A 3S2NA 1LTDA 3GK0A 4QJ5B 1X39A 5LGXA 1DTUA 2JKPA 1S2AA 4A8RA 3W7QA 1W32A 1V7AA 3W1QA 1QCWA 1ZNNA 2PLCA 3FOKA 4R7JA 1CX9A 2VEFA 3M0IA 3LRMA 1JQVA 2Y88A 5ABFB 3BAKA 5KMYA 3IACA 3IUDA 5A8NA 4Y9AA 1XRVA 4O8AA 3UERA 2OT1A 1EBHA 5E6ZA 1RD5A 1Q7ZA 5J04A 3PZMA 5I3KA 3EX6A 2G97A 2PSNA 1G01A 4C6OA 2WCGA 3T0AA 5B80A 1DJZA 1ZTVA 3W71A 3B8VA 1R8LA 2V0TA 5IFTA 3WUEA 1F05A 2DORA 3HU7A 1JAKA 2CBIA 1DJIA 3WQWA 4E38A 3QZAA 5G1TA 3N2XA 2PDLA 1FCBA 1VENA 2CLKA 3EX3A 4NAFA 3W7OA 3CMJA 2F7FA 4Z1YA 3GIYA 5I23A 2GPTA 3BXWA 3TR2A 3O0FA 3IJQA 3WFLA 4NZFA 1IXPA 3BSMA 5M5DA 1ZY9A 2GWGA 3N3MA 2NT0A 4HSHA 3NXLA 3VOGA 1LOSA 5K3VA 5FF3A 1CXIA 2X0SA 3EWUA 5FEZA 2CEQA 2ZUWA 3WDHA 3WY1A 4HTBA 2RUSA 4HU4A 1RXOB 3AXHA 4N9DA 3LHWA 2D2GA 1IEVA 2ZXDA 4XZHA 4LGXA 3WD4A 1J0HA 1E73M 2P88A 3EB2A 2HV5A 3AXKA 4M6QA 3BQ5A 3KOZA 1W2PA 3GU2A 1TPWA 4RNJA 3ANYA 3B40A 1H5YA 3O1NA 4JHMA 2Z0IA 2VYOA 4XO7A 3L0GA 1XRFA 1YEYA 1JYXA 2A7NA 4G5DA 1TRDA 3HPAA 3KTXA 3CPUA 1VEMA 1SO5A 5K4XA 3C6CA 1W9DM 3E2QA 1W3LA 4ZO6A 3IJ6A 4MB1A 2NV1A 3WLJA 1P1MA 3IANA 1QOQA 5K9DA 3GU1A 3POHA 3LHVA 4KEUA 3O07A 5FD0A 7PTDA 5I78A 3EOSA 3H2NA 1H09A 3BGGA 1LLWA 4XKMA 4MYXA 3THUA 1W17A 3UCCA 1QHOA 3VI2A 3ABOA 1Q7MA 3P8JA 2CBVA 4X9YA 4B5WA 5XIAA 1P0BA 2RKXA 2PDHA 1GVRA 3VOHA 5EFFA 4ERGA 3AMGA 3LLXA 4D1IA 4WLCA 4Z0JA 2PWDA 3KOYA 1NH6A 5AZ0A 1S2VA 1BHGA 3GG7A 1NVMA 3WELA 5LNRA 4RW5A 3QLDA 1S1PA 1RY8A 1R2TA 3VGEA 3WLPA 1BXBA 1US3A 1TV7A 2XSAA 4XTDA 4PEEA 3S5NA 1L6YA 3V18A 4X2PA 3T4CA 4YHGA 3ZZ1A 5I3JA 1XH0A 3AUJA 3M43A 3O9NA 3LNMA 1XPYA 4U5IA 3KRSA 2QEZA 4AUBA 3JZEA 5FESA 2BLEA 2G4FA 1GGOA 3TAKA 3CZLA 1ODZA 4HNCA 1XIGA 3WMSA 1PVNA 3DI0A 3SGUA 1RQHA 3BAWA 4O15A 1W9XA 1WQ5A 2VOTA 1XCFA 1RR2A 2I7GA 2IXVA 2PU0A 3TONA 4IJRA 1R3TA 3NYDA 1TQJA 2FVLA 3WQ8A 2WMIB 3HFYA 1Z42A 1A5UA 3V16A 5EA9A 4IFRA 1F6KA 3DHPA 1RV8A 4UTKA 4M29A 4Q3MA 3K4AA 1A3XA 1VFSA 4EE9A 1LRTA 3W7IA 3AWOA 2V82A 1S2WA 2Z1VA 4YXGA 5C5YA 3AMLA 4A8NA 3OHMB 3HV9A 1UQZA 1BGAA 3EDEA 4M6UA 2XN0A 2QAPA 1E6RA 4PBFA 3NM1A 1PKYA 2YL6A 1Y5VA 3CEPA 2QKFA 3F5KA 3HG5A 3KRUA 2QPUA 1FQ0A 2OZTA 4TXEA 5F7UA 2QJIA 4FR6A 1O5KA 4DWSB 5FIPA 2XZ7A 2ZDSA 4N4PA 4S3GA 3BOLA 5AVHA 4XAFA 2PLMA 3A22A 2AMXA 3KL0A 5C54A 4HA3A 5M3WA 3WDQA 1F74A 4UOZA 2V30A 4GY7A 3QQ1A 4GJIA 1GPFA 2PODA 3WFAA 1XW8A 4M1RA 4V28A 3ARPA 2X2GA 3IIVA 4AHQA 2PP1A 4AX6A 1XIEA 2CKRA 5H1WA 4KGJA 4KWUA 1TCDA 2ABAA 2VRKA 3S2MA 1GW9A 5KEZA 3RM8A 1OC7A 1KD0A 3CZGA 4H9UA 1FWRA 1AG1O 3ERPA 3UZWA 3OYZA 4CNTA 2I56A 3EYPA 3H2MA 4ZQNA 1ZAHA 2BHUA 4IOTA 4UIOA 2ZUVA 3U7BA 5JQ9A 2CIPA 2X05A 2OWWA 3VZZA 3VD4A 4HPNA 3W7RA 3LXCA 3IJ7A 4OUEA 4XAPA 2QJNA 3E9AA 1GOQA 1V4YA 3R0DA 1IR2A 1OWQA 4NQ1A 5DANA 2V3EA 3GVRA 2EBNA 2YL8A 3SCNA 4G8TA 4YYCA 3SSJA 4DYKA 1G7VA 3LG3A 4DHGA 2FKPA 5DMNA 2INFA 2E6FA 2J8TA 1LT8A 2BGNE 5HWNA 3TYZA 1I2RA 5HWMA 4E4FA 2V81A 4HK5A 1QI2A 3M41A 4N7QA 1X38A 2DSZA 2NV9A 3NIYA 3AHZA 2J78A 3ZS4A 4DJDC 2FYMA 4EPDC 2CLFA 3AISA 1Y0EA 2B0MA 2RDXA 4PMZA 2NVDA 1YNQA 4DVOA 5H91A 5A6JA 1UR3M 3XIMA 4K37A 4HMDA 1Z6KA 1Q6QA 2ZRVA 4PMNA 1EX5A 1NSJA 2PU1A 1UYQA 3WLRA 4MOZA 2GJXB 3N11A 1G4SA 2C6QA 1EGMA 2NQHA 1XIHA 1M7OA 1K7XA 1AA1B 4GGHA 7TAAA 3UGVA 3S46A 3Q94A 3PULA 4O1DA 4Y7EA 1DYSA 4CCZA 5HPCA 2A0NA 1TIWA 1U2YA 3M5XA 4Z1CA 4H6EA 3DXIA 1O68A 4J7RA 4R9XA 1IIGA 3GBDA 3QR3A 1HZYA 3ZLHA 2GVJA 2BTMA 2Z1BA 2PC4A 1V7YA 1HN1A 2ZUMA 1UIOA 4RE3A 3BLOA 3K8LA 5D04C 1UD8A 4GXWA 1U22A 1US2A 2FZBA 2JK2A 2Y24A 2WYSA 1BQGA 3TJXA 1JZ7A 2Y8VA 3NGJA 1UWQA 3APGA 1QOPA 3B8UA 4QP0A 4FZIA 4WKFA 4Q8NA 1A49A 2Y4SA 3NDZA 4WY0A 3ZO9A 3E2RA 2VJXA 4JTGA 3P8IA 2HXTA 4H04A 4EKJA 1RJQA 3GR4A 1LWIA 2F2HA 1A5BA 1VFOA 4GACA 3BLLA 1ML1A 4A2SA 1UR2A 5DCEA 4UNIA 3H26A 6CGTA 2EXOA 4KH2A 4FLQA 3VCRA 4M24A 1PWMA 1F73A 2W6RA 4I6KA 4K1GA 3VFCA 1J96A 2J8FA 3WNMA 3C2OA 3IV8A 2P0IA 1MYRA 1PJ9A 4US6A 3OZYA 1FDJA 3PBWA 1Q6LA 2Y63A 2MNRA 3MSRA 4RV3A 3EA2A 2I9EA 1XIJA 4AF0B 4B9ZA 1M5WA 1Q45A 4QEHA 2V2DA 2EKGA 3W1UA 4L1XA 2QUUA 2FVMA 4TU1A 3CZEA 1TUXA 1ITXA 1UKPA 1W5MA 5HINA 4IG2B 2XVKA 4JTRA 1O1HA 4ATLA 1M01A 3N14A 4NHVA 2PGWA 3GB6A 3N19B 4OBRA 3S1XA 5K7JA 4WKAA 3T40A 3VDCA 4R88A 5ABHA 4B9YA 1S5NA 3BCFA 4EPEC 1VCVA 2QUVA 3CV2A 2PWVA 4ORMA 1GTHA 1S1RA 4TTGA 1ZALA 2CHOA 3AHYA 1PUDA 3HGJA 1OYAA 3PJXA 4CQ9A 2Y62A 1QHZA 4GXMA 5DRIA 1R3RA 1SQ7A 3SB0A 4G2DA 3P5ZA 4F2UA 4IQLA 1KRBC 5HK4A 1LWJA 4Q4KA 3DFTA 4S3JA 3LCFA 5HPOA 4DXVA 2ZA1A 3AIVA 3UD6A 2YCIX 2OFJA 2VC7A 3QOKA 5BXTA 1EOKA 1U33A 3LY0A 3ABSA 5D8ZA 4KWVA 3A5VA 1VJZA 3RXZA 3R13A 1VLIA 4LB3A 1KRCC 4MKSA 2Q02A 2C13A 3M7SA 3R79A 1XYFA 2ZYFA 5HWJA 4GG9A 3NEVA 5CH9A 3MV01 1G5AA 3KEHA 3RITA 1KRAC 4LUTA 1E6PA 2JF6A 2QQ6A 3U4AA 1CB7B 2WZTA 4CD4A 5E70A 3R8GA 4E2BA 3QMRA 4JTAA 1DJHA 1TB3A 3LRLA 2E1WA 2FZMA 3DOPA 1QNRA 5CZKA 5EB8A 5AFDA 4RE2A 2Z2BA 1NF7A 3LZ5A 4Z08A 3DN5A 3FK4A 2GGJA 1T41A 3A13A 4Y8FA 3OJGA 2VNCA 5KSWA 3V5FA 3NZ1A 4GQRA 5EY5A 2YDSA 5GNZA 1JZ8A 3IIPA 3BOXA 4U10A 4RV8A 3RJYA 1Q6CA 3BAYA 3CZ8A 1R2SA 3C52A 3I3EA 2HZGA 1H41A 3LNPA 4DQWA 3PAJA 1C9WA 3W29A 4WY0F 1KQYA 1DWFM 2AL2B 4CCCA 1ZENA 3KTSA 4JZ5A 3I4KA 4NJGA 1Q85A 7CGTA 1TE6A 2FB2A 2PDQA 4AIOA 1KQZA 4MWAE 7REQB 5A6BD 3EA3A 3L4ZA 2ZTKA 1TJ0A 1W54A 3GTXA 5A2CA 1K4GA 2OZ3A 2E9MA 4Z42C 4A05A 4M3PA 2PDXA 2P3ZA 4LUJA 3N3TA 2FDSA 1GQLA 5FEXA 3YPIA 4JIQA 4GZEA 4JOMA 3ZM8A 2VELA 3I3DA 4F0MA 1DV7A 3IK2A 1X8CA 2AKZA 1DEDA 5FSEC 4ZE5A 1TIMA 2CLIA 4S23A 3A4AA 3DYOA 2ZTJA 1OFOA 1PCKA 1V3MA 4KWOA 4U31A 2BZNA 4UMAA 3PBGA 4L9ZA 1BGGA 4MM1A 4GUHA 4QLJA 1IEXA 4J3SA 3FGCA 4KGLA 1SZNA 4U2YA 3U9IA 4RDVA 2NLIA 1KR0A 2E6YA 1C29A 1BXNA 4ACZA 4BJHA 1ICSA 3U57A 4O18A 3W7DA 2WMKA 4PEKA 4EF8A 4JD4A 3KAOA 4WXZA 3SECA 1J10A 3SURA 1WXZA 1XV8A 1O5RA 2EPHA 3TVAA 1AL7A 1BSLA 1TX2A 3SN0A 1JNEA 3GFZA 4DJFC 4B5VA 1XDJA 1Q7QA 2RHGA 2V3DA 5AB3A 4X22A 3ZJ7A 4Z2LA 1M7XA 4KERA 2CWNA 2C1IA 3VGBA 3VGFA 1DQWA 4MNKA 3EPNA 4FA3A 2D24A 5CJMA 3VZXA 1FVPA 2PPGA 1ZP3A 3QYQA 1EJTC 2CZFA 2VQUA 3C0QA 3U2OA 3UXAA 5C55A 2YBUA 2E40A 1AW5A 4AYGA 1YKWA 1O5QA 5C2GA 3DYPA 2RDTA 3TOPA 1VH7A 3VDGA 2OSWA 4E4PA 3C8FA 3UNTA 4AMCA 1TV2A 1ECEA 3UT0A 1JDCA 4DJDD 4JTDA 1X7FA 2WVVB 1JNDA 1IIHA 1FKWA 5KZMA 2QGYA 1J11A 4CN4A 4HT3A 4CQCA 1TPB1 5DFAA 3DKJA 1A0CA 4A3RA 3URAA 3OQ8A 4OFCA 1X6UA 1XLJA 4D6JA 1BD0A 3SCWA 3CV7A 1LDCA 2A3EA 3WFZA 3QPZA 3AI0A 4GUFA 3GNXA 1BAGA 3MMUA 5D30A 1KCXA 2QCMA 4H3DA 3MUY1 5G5IA 3RHGA 2YW4A 2VMFA 1WDPA 1YDOA 4WX2A 4DO5A 2DFAA 4ZQCA 4UTMA 3NJ3A 5RUBA 1OD8A 4WZHA 4E4UA 4C6EA 3RAOA 2HEJA 4MB3A 2CW6A 3GVQA 4R27A 4KMQA 1PO9A 3MUAA 3LCGA 3PNZA 4M6PA 4WR3A 5I3HA 1RHCA 3QMSA 5CBBA 5LNUA 1LRQA 4AD1A 2B7QA 3OVQA 1X6NA 1G4TA 2GJNA 3NFUA 3PTDA 2V67A 3A4WA 4HHHA 1SPQA 2GSJA 4LVDA 2ISFA 4W93A 2XIJA 5C71A 9CGTA 3AAMA 4HYWA 3T42A 4PH6A 1UZDA 2GJRA 4CD5A 4ZQMA 1OGBA 4GNJA 4QS6A 4PTMA 3W02A 1EEXA 3W2UA 4PZVA 3AZSA 3W1PA 3BICA 1UD5A 4JDYA 4JNZA 4O4WA 2NSOA 2W61A 1I6NA 3IARA 3BG9A 2UV8G 4HHLA 5LA2A 2E5BA 4KWSA 3CHVA 5IXEA 3LRKA 3GFYA 4QE5A 2NUWA 1LOQA 2WAGA 1NFPA 3WD0A 1GG0A 2PDCA 3CAKA 2HVOA 1UKSA 4PMOA 1NWRA 3CHCA 3GTNA 4GY1A 3EWCA 3M64A 1WKDA 3C2RA 4PCSA 1XLGA 3L21A 4FOUA 2Y8KA 5A6BA 4NXKA 4JTIA 2G3IA 3RR4A 4OKDA 3TAOA 4GYFA 2C79A 1R7AA 4F40A 3TZFA 3EOOA 3N6QA 3E38A 3TW9A 1CXLA 2VM8A 1V51A 5D2YA 3UGRA 1V3KA 2Z27A 3FLUA 2F9RA 5DMLA 1GQJA 2NUXA 1SJDA 2DVXA 1GVFA 4AX7A 3ES8A 3VIMA 4CQBA 1JI2A 3VABA 4JQ1A 2Z2AA 2BGSA 4W86A 4BF5A 4B5NA 4R9OA 2NQZA 3TXZA 4W9TA 4QGCA 1R87A 1TZZA 1DBTA 3LTYA 4RKAA 2W4XA 3WX7A 1B2YA 3B9OA 2I16A 2WMGA 3WL0A 4RZ4A 5DQPA 1D7FA 1THFD 2ZZ1A 4HMNA 1Q8JA 2AOSA 3SRHA 4EF9A 5CAHA 5AKQA 3OHIA 3BG5A 1RLCL 3RN6A 3ZJ6A 3DAQA 4M8UA 4NKCA 3BGAA 3UESA 2OQHA 4ROPA 4U5KA 1TPH1 3PFMA 3LHZA 2NQ5A 3OBEA 1AD1A 2WO5A 3ONCA 3S2CA 3F03K 4DIAA 1OABA 1TFVA 4GE8A 3WLNA 5DX7A 3L5LA 4DWDA 5EMLA 2V2HA 3NSMA 2H8XA 2DZXA 3MKKA 1IXNA 1RD6A 5BRBA 2EPKX 2OLSA 2A7RA 1KTBA 2X42A 4NVTA 4PMDA 2QULA 3P84A 3WK1A 4UTJA 4AVNA 4IMEA 4KEVA 4D6GA 4GIRA 1GK8A 1RP9A 3TXVA 2DIJA 2PZNA 3WG6A 1QPRA 2ANUA 2ZZ4A 3HPFA 4DJDA 1AQ0A 1TX0A 2NT1A 2PWEA 2VCBA 2V5KA 4EX4A 2A3CA 4FALA 4U3CA 4XIAA 4N4QA 1TPEA 2CLEA 3N6JA 1OG6A 4JTEA 1QPNA 1C91A 2HE5A 1EJVC 5AHNA 4B3ZA 3JU2A 3IUIA 2TSYA 3LDVA 1IXOA 5L9FA 3U48A 4D6HA 1WV2A 1M3UA 3RO8A 3F2DA 4REQB 5I7GA 3P7YA 1XQKA 2ZVRA 1WDSA 2XIIA 3OVPA 3N2TA 2QPXA 4UXDA 3STCA 1UBPC 2Q8XA 1TPUA 3PJUA 3UF9A 3TC3A 4IIEA 4NI3A 3UA3A 4LSBA 3E49A 3R58A 2B7OA 1EXBA 2O56A 2VFFA 3NPVA 4PMQA 2HQAA 4IJCA 3NQFA 4MZ1A 5T91A 5J8LA 2ODOA 4NJIA 5FAJA 5J5DA 1X97A 5HQEA 3MY9A 4H6QA 4GISA 4R33A 3A12A 4J1OA 3U7VA 3P67A 4NL1A 3WJZA 2W62A 3MVTA 4O1FA 3H2CA 4Q6JA 1AD4A 3CQJA 2XVNA 2P8BA 1TTIA 2QUTA 1VRDA 4X2RA 2ZX5A 3FHQA 1VFMA 4QNEA 2WBKA 4ZOEA 3A9BA 1KM3A 3RMEA 3R1ZA 2D2JA 2YB4A 1GCYA 5I03A 2Z1KA 3VILA 3MI3A 2HXUA 3TLLA 4K7VA 3E5BA 1I60A 2J7CA 1JCTA 5J5RA 3FN9A 3KBJA 4H4IA 1QNOA 3MHGA 3EX4A 4WKHA 3RYSA 4AEOA 3VVGA 3R10A 4H8HA 2ICSA 4ROQA 1UR4A 1XS2A 1KFKA 4Q8TA 1ISWA 1ZSXA 3TYCA 4MHBA 3UYCA 2CHRA 3VIPA 3GXTA 4GO9A 5JIWA 5F4WA 2ZADA 2P76A 1R6WA 4Q4QA 3NQ8A 2VCAA 3CHFA 3P80A 1PYMA 1ZFJA 1DE5A 1EJWC 2WZMA 1A53A 2WWDA 3WIJA 1O1ZA 3I68A 1ZAIA 3CL8A 3L2LA 3CWHA 1C90A 2IPJA 5CPTA 1LWHA 1IXQA 4K6AA 1CCWB 4ZOBA 2HISA 1YADA 3PUDA 1GYLA 3T1GA 4YMZA 3W7EA 1Y5XA 1WZAA 1FWGC 4CN1A 5KZEA 1HKMA 4EPBC 1EDTA 1MNZA 2TPSA 2CFFA 5LNSA 5M03A 3B06A 1WDRA 4BQ5A 4K36A 1HX0A 1MQRA 4C5ZA 1IE7C 1KFCA 4WDTA 2NXHA 2Z7KA 3CT7A 1F8MA 1A0EA 3CUXA 4C6FA 1MI3A 4Z2KA 2RDUA 3BANA 1OD0A 3VMOA 2E1DA 3B4YA 4ENLA 1W9VA 4GH3A 3E6EA 3N17A 1F9CA 3GXNA 4N6FA 1P6BA 1MQQA 3FX4A 5G1MA 3ARXA 1YQ2A 1FWFC 3DG3A 1JZ2A 2PDFA 1QI4A 4CU7A 3O0KA 2AAAA 3TNOA 4AWEA 5TF0A 1OX4B 4FNQA 1CXFA 5KETA 2BFGA 2B7PA 4AISA 1UPMB 2W66A 4IUOA 4DNMA 1XH1A 3CM4A 4XQ6A 1GWJA 4PUMA 2V3GA 3T0BA 3ZLFA 3N9KA 1WXYA 4N02A 1Q5MA 4A4AA 1OT1A 2FZDA 3ZXWA 2ATMA 4LC8A 4HD5A 4EACA 3B0VC 1PAMA 3INPA 3AS1A 4YWSA 4RZ6A 5LYRA 3TW6A 3N9RA 4QIUA 2DZAA 4O0KA 4WVXA 1K8ZA 4AYSA 1SO4A 5AC6A 4J4KA 4UTWA 5D33A 1BF2A 4IP4A 2X40A 2YCKX 1KM4A 5K9CA 4G7FA 3LB0A 3WEZA 3F1QA 4OE7A 4FX8A 4OV9A 4DI8A 3G0SA 1JI1A 1IYXA 2OWCA 3FEQA 1KR1A 1O95A 2ALRA 3E0LA 4UTTC 3UJSA 1Y7VA 3B9AA 3W1LA 3TN5A 3APTA 3L66A 4FHAA 3R2GA 5AYZA 3QC0A 4ILSA 5CLTA 4P8UA 5E0FA 1TR1A 1LJYA 2HBVA 4PMJA 2GQ9A 3WCZA 2J27A 1EOMA 3TKFA 1AQHA 4LY8A 3H12A 3VGHA 3REQB 4FPSA 4NNCA 3NR0A 3KVLA 1XGZA 1EGVA 1MZRA 1UD2A 1V3IA 1HO4A 4HU3A 3TSMA 2HS8A 3A64A 2OEKA 1LQ0A 2Y85A 3RPDA 3EX2A 3VNZA 2P5NA 1FUYA 5AC4A 4ZQOA 1TO3A 1ZBWA 4CU8A 4WOZA 1QPKA 3VU2A 4AD4A 4MNMA 1S38A 2OKTA 2HS6A 1VJIA 2FLIA 4O0ZA 3LERA 4LV9A 3W76A 3SCRA 1S2TA 1XXXA 5JBEA 1X1OA 4C6LA 1EKOA 3U2CA 4HGXA 1JRCA 2J8GA 2C1HA 4HJFA 1H0GA 3UWYA 1YXYA 3P5YA 1T6MA 3BTNA 3NZQA 1P5BA 1YPFA 4POCA 6A3HA 5AN7A 4S3EA 3FAXA 2VEIA 4C1NB 1L6GA 5E9XA 1LBLA 2WQPA 1VEOA 4HIBA 1C8QA 1QO2A 3UPWA 4LVBA 4WJXA 5BU6A 3VCCA 2Y7DA 4HTYA 2VEKA 3A21A 4QJ4B 3ABZA 4D6DA 5A6AA 4JYFA 4GJ1A 3LMZA 3KL5A 1SZEA 4WUIA 2J47A 3CH0A 2PTYA 4J9JA 3SCOA 5H8MA 3TTEA 4S39A 3L4TA 3G1DA 5AHFA 4OOZA 2J88A 2PD9A 3EDKA 3EPOA 2PZ0A 3HGRA 1I1WA 4YTTA 2OO0A 3WL1A 4O28A 3UR8A 4X3ZA 4GMEA 4QX4A 4YTRA 5FEPA 1WE5A 4AB4A 5I3IA 4W88A 2O55A 1DKWA 4G7EA 4C6IA 3MCOA 2FTPA 3DX5A 4JTSA 3UVAA 3AMDA 1QFEA 4IFKB 4LUYA 4ZENA 2PDJA 4LANA 2PDYA 3A5FA 1P43A 1PDYA 1TCMA 2X7VA 3BO9A 1UZHA 3IJDA 2VKZG 1A5SA 1SFSA 3A3XA 1RBLA 3G8EA 5F1VA 3ITLA 3SY1A 3E3HA 3EMCA 4AD0A 1DWJM 1RLDA 2NQLA 3UG4A 3NGFA 2LLEA 3F4WA 2V3FA 4H41A 4GFIA 3FGCB 2KX9A 1NDVA 2OU4A 1FWSA 4O1CA 4AIEA 1QVBA 4X0NA 4C6PA 3AUOA 1F6PA 4KQNA 1ITCA 4MVAA 1OB0A 4CNOA 3IGHX 4PSPA 4Q8VA 2DGAA 4NJJA 4M56A 1JYNA 2JBMA 2QCNA 4FXSA 5EMMA 4H01A 1Z69A 1W8GA 1YTDA 5FSDC 2ZZ5A 4FNPA 5C6MA 2Z25A 3THCA 2CZEA 4L80A 1V6UA 3LCHA 1OF6A 5CPSA 3B97A 5EMUA 3B05A 1QNSA 3FSTA 1ADOA 2GFTA 2UY2A 1JXKA 3M5ZA 3NM3A 1K8CA 4XZ9A 4JN7A 1TPDA 4IPIA 4NI8A 2XIQA 3TTSA 4JTLA 4F0RA 4ZTYA 1V0MA 2VR5A 3WQ5A 5H6HA 4TOQA 4DNHA 5TNVA 4JTTA 1UASA 4PSRA 1JPKA 4F8XA 2JGYA 1ONEA 1UA3A 1LORA 1UJQA 1T40A 1HJSA 1I75A 4BCEA 1W3HA 3OLIA 4FXRA 2W63A 3UBPC 3W83A 2VD9A 2GGGA 1CI1A 1CNVA 3N2OA 3THQA 4Y2WA 1HJUA 4Q22A 4OHQA 4HN4A 4ZEPA 3IJ8A 5CPQA 3WQPA 4JTJA 2FVKA 3KVMA 4D8ZA 1ZJIA 5ABFA 1E9IA 2Z1WA 2A21A 2YCEA 1FWHC 2A3LA 2PF0A 4QQ3A 1LF1A 4ZL1A 4DWSD 4IIGA 1K9DA 1I2QA 1TA3A 2E6AA 3AYTA 1WDQA 3KBSA 1KBBA 1TTJA 4B91A 4HNNA 2GWNA 5I6SA 1QPOA 1F5ZA 4Q7NA 2CXEA 3SFKA 1H1ZA 2DPEA 4AZHA 5IOBA 1E1CB 1HVQA 1JZ4A 2J66A 3I7RA 2VVNA 4HHPA 2ACRA 1HGYA 3QFEA 4D6FA 1FWIC 4QLKA 1E4IA 1LQ2A 3CUGA 1QR7A 1UWUA 2JKEA 3DFOA 4LVAA 4RCXA 4UZUA 4N9BA 4LPCA 1TJ2A 3CTTA 2OMAA 1V3HA 2WOQA 5FF4A 2Y0FA 2CESA 2XWEA 2BOGX 3W7MA 4HOZA 1RCOB 4OU1A 1A5CA 1ITUA 2V6AA 2CC0A 3MUXA 5I07A 5ECUA 3STPA 4B15A 1I9CB 4IXHA 3CV1A 2NX1A 3QQ0A 3NO3A 4I8YA 2Y89A 1QASA 3MMDA 4JL1A 1TZ9A 4XO6A 2VO5A 4DUWA 4CUCA 3GYEA 4I5UA 4M7TA 2PP0A 2IUZA 4PCTA 4PCNA 4L6HA 3U2ZA 2EHHA 1QWKA 4NSBA 2GGIA 3NOYA 4DF2A 1OY0A 4IGMA 3LENA 4A8IA 3WBAA 3WBWA 4Z1AA 5LIYX 3ZWTA 4PTNA 4AZCB 1QI5A 3QFWA 1UWAA 5I0DA 2PE4A 2QGHA 4HMCA 5EBUA 1IZCA 3PPFA 3SM0A 2X2YA 3FVDA 2ZX6A 2PWGA 4LAMA 1JCMP 1W91A 2WSRA 4IPPA 4U28A 3TYUA 3MSDA 2NVAA 2V5LA 4OUIA 3IVSA 2YB1A 2QCFA 3EEZA 4MKVA 2WM0A 4WSHA 2BS9A 3C2FA 3E74A 3ITXA 5FJIA 2GDQA 3R43A 1XUZA 4GNKB 5CZ0A 3WLSA 1BYCA 3SI9A 1EB3A 1ONXA 4XBKA 3T0TA 2OZ0A 5D2VA 3URQA 3Q65A 4IL2A 2DUAA 4JGDA 1CIUA 2Y8UA 2ADAA 1REQA 1B4EA 2IKHA 3H21A 4YPJA 1ICQA 1JJKA 4ADTA 3VNJA 4LCRA 3V5OA 1EJUC 1JQXA 3B4UA 1QBAA 1ZB5A 4Z2JA 1Q13A 2YW3A 1H63A 1HUVA 2I5GA 1EPXA 2F8QA 1ZS2A 3BMVA 1EHAA 1JF6A 5DT5A 4IP7A 1D3GA 5TD4A 2E9LA 2HRWA 4GQQA 1XIFA 3PUEA 2AAMA 4C91A 2CZDA 4A22A 1MSSA 3TUUA 4LVFA 3PN8A 2WKLA 2E25A 2BASA 4AHOA 1H7OA 1W8SA 4F48A 1MW0A 2UBPC 4QCEA 9XIMA 2ZUNA 5AC8A 1J18A 3A23A 4EIVA 1WZLA 3D47A 1FDYA 3A9IA 2A2IA 2J7EA 1SM9A 3AALA 3GTIA 1BXCA 1W5NA 3NQDA 4HKPA 4PRRA 4R53A 3IS4A 3LM3A 2XIBA 3PWAA 4QG9A 4MLJA 1DJQA 1JYVA 1PPIA 2JGQA 4BI7A 1OQFA 3EDFA 3M7WA 1NM9A 4R85A 4GWEA 4DEFA 5HMSA 1L0PA 3BJSA 1EJRC 1E43A 1PHQA 2WMIA 5G4EA 3FYYA 4XB3A 1UUQA 1RQBA 3C2EA 3LQLA 4V2XA 4F2BA 5FL0A 3VYLA 2PC8A 2VR2A 4KT2A 4WXYA 2PRLA 5F4SA 1OBAA 1IZJA 1XBZA 2QS8A 3LSCA 3N29A 4PTWA 2E09A 3NPWA 4O11A 2BOFX 5D8WA 3GU9A 1POJA 4QNWA 1GYNA 3KP1A 1QWGA 3GKAA 4U4MA 1LL6A 3DG7A 4LYRA 1J2WA 4DBEA 4KKXA 3FJ4A 4CD8A 1JD7A 3M0MA 2ZA2A 3S3GA 2PDWA 4H8NA 1HKKA 3LCLA 1XC4A 1M7JA 4JN6A 3W88A 3GC5A 3T2QA 2YFNA 4AH7A 1TZ7A 1GQNA 1KGUA 3NUKA 4DWSA 3PUGA 4X9SA 2Y7GA 3PY2A 5TBOA 1W56A 4L7ZA 4ASTA 3AHTA 3TA6A 4JTQA 3RIKA 4IMDA 1KGXA 5CC7A 1VYPX 1DL3A 1J6OA 3G1RA 1GHSA 4XZBA 3WF2A 2C0AA 4ZFMA 4JKMA 2VTFA 5AOUA 5A69A 2YYTA 3UXLA 3ZJ8A 3PPGA 4K1WA 2QF8A 5KZ6A 4PMUA 4JHOA 5IM51 2DSKA 5TQLA 1VIWA 1ZCCA 3CZKA 2QVHA 3GHUA 4FXJA 3KHJA 2A5HA 2X30A 4TMCA 4QE4A 3R11A 2VFEA 1HT6A 3CTLA 1CT5A 1B54A 3WZ0E 1EC7A 1R3WA 4MY8A 1HGWA 1B90A 4WK9A 4P8VA 1V6TA 1R9XA 1W9UA 3AZTA 3L0NA 1R3SA 1U30A 3AO0A 3QLLA 3PFRA 3R94A 4IGSA 4KCVA 3BURA 3KBVA 2FH6A 2YGYA 1I2PA 3AS2A 4FAMA 3UG8A 3CL6A 3TN4A 1GZ1A 1NAL1 3V4BA 4FS9A 4P7OA 2J7DA 4UQCA 3WLQA 3KZPA 1J93A 4LRSA 2NXGA 2XG9A 1OM0A 5JBFA 1PDZA 1MQPA 1VBUA 1O12A 4D6IA 2WNNA 3SW6A 2ZZ7A 4O0QA 1W2VA 3W6MA 1M41A 2D3NA 4UTTA 3N15A 3CWOX 3KOXA 4B4FA 3ECQA 2GJXA 1AH4A 3QPEA 3PJTA 1ODUA 4NX0A 3CV6A 1XLAA 1XL9A 1XINA 3RO6A 2WPBA 3MMTA 3WK3A 3G1XA 4URIA 1NTHA 2DZPA 2EEXA 1SJBA 5F2GA 2CZ5A 5I09A 3EWBX 1VLWA 1W9BM 2MUCA 2NX9A 3GD6A 1JZ5A 2FIQA 4J3ZA 4I6VA 2OG9A 1GVIA 3BJFA 4XD4A 4CLMA 1VBJA 3CT2A 2XH0A 5A8GA 3E0VA 1O66A 4GNVA 2Y7EA 4GABA 5LZLA 1KV8A 1HJWA 1YMYA 1CLVA 1AQFA 3PNUA 1YIXA 3SQLA 1V93A 3GVGA 3H4XA 4Q4OA 3HV8A 2H9AB 1H2JA 1KC7A 1VYRA 3LYEA 1WYIA 4GIEA 2J7HA 1AJ0A 3EDDA 1J4EA 3SEPA 1NFBA 4HA0A 2DT0A 4ZFCA 1DWGM 3S47A 3TK7A 3H22A 2WKGA 3IIXA 4WDXA 2FTWA 4MPQA 4RLIA 4UQAA 4BQ4A 2VUNA 1RK6A 4WGHA 1S5TA 4GFSA 5CSSA 2PAJA 1U1UA 1E9LA 3SN4A 3GNRA 1B30A 3UWEA 3ZMRA 1MXDA 2WSKA 2VOMA 1EH9A 3L4VA 5F1UA 2QUMA 3C3NA 2DUZA 4AF0A 1MDLA 2ZX7A 3ZR6A 4UFHA 1S3HA 1UWIA 5ECVA 4OVXA 1GOXA 4NILA 4LH8A 4WDUA 1M1BA 4PRTA 3CL7A 2X0YA 4Z2HA 4IG2A 3IAPA 3O6CA 3FXGA 4HQVA 4Y96A 2J9XA 2GJPA 1IGWA 3SIMA 3VX0A 3C4UA 4E8CA 1NOWA 3SQMA 4GO8A 1XWYA 3FIGA 2WB5A 2R91A 7ODCA 1J0JA 1WDWA 1DIDA 4HCLA 2PS2A 1C8VA 3FJLA 3BQ6A 1EGZA 1Q3NA 3S5YA 3WQ6A 1SZFA 2BDQA 4F9DA 3AHVA 1FCQA 4J2MA 3MS8A 4Q8PA 4DXXA 4BFAA 4KESA 2DW7A 1CW2A 1EYEA 2ZWYA 4JY8A 4DN1A 1WKEA 5JVLA 5LIXX 4QM1A 3QRHA 3S6DA 1GQIA 2BY2A 3CWNA 4MTVA 3OOQA 4O8RA 3RX4A 3QW4B 5KITA 2X0HA 4Q6XA 4JQ3A 2WQDA 3DKLA 2O7SA 3VNDA 1CENA 1JPIA 5MF5A 3MMWA 3OGRA 3PZGA 5LGZA 1FP8A 1ZAJA 3ATZA 1H61A 3RF9A 5JIPA 1XGDA 3VKDA 2R1MA 4WSJA 1XBVA 1EO7A 1W1VA 3DHFA 1DJNA 2G3MA 2VL4A 2EPNA 3TDFA 3FSUA 5JU6A 2D1ZA 3MHUA 4Y8EA 2HE8A 1A5KC 2FTYA 3WH5A 1B0IA 1FHLA 2G96A 2R1LA 4IMGA 2H3BA 1IZKA 1OCQA 4AG0A 1YE6A 1X6LA 3MQTA 3VDHA 5HMDA 1EQCA 2OJPA 4J40A 2QDGA 2OTDA 4P8WA 4QROA 2E5CA 3M47A 3WDRA 3FFSA 3K8MA 3AC0A 4GYJA 1E0WA 4U33A 3LXBA 1OGGA 3P2VA 3P82A 4D8AA 4JYDA 1KWKA 4JAWA 1XLBA 1E9ZB 2GVEA 3GC2A 3AWNA 1T8QA 3OO2A 2Q8LA 3WK2A 1K3UA 2CYGA 3AXXA 4DUXA 2AL2A 1JFXA 2JFEX 3GZAA 3LLFA 4LJ3A 4FLRA 3QHOA 2C18A 1XQLA 3GG1A 3NQ7A 3TYDA 3ARRA 2OSXA 4LQ1A 3PB2A 1WAWA 1Z9AA 3QGAC 4C6NA 3ITTA 7REQA 4RPQA 1OIMA 3GG0A 3EX1A 1UR9A 3BLKA 2G41A 3SGZA 2BX7A 1HTIA 4L6OA 1QHPA 2IPGA 2C1GA 5FJUA 3MO4A 3CHEA 4JTKA 2D73A 4HZ8A 5FJRA 2UY3A 1W5QA 4H8UA 5AYBA 5LXXA 4Z0SA 2PRMA 3NTYA 2GQ3A 1TMLA 3S1VA 1EUAA 1GQKA 3MP5A 3CUFA 3SR7A 2V5JA 1D8WA 4HNLA 3V0UA 1XBYA 3DENA 3BWWA 3VFLA 3AXIA 4K8EA 1KO0A 4QLLA 4H00A 1KM1A 2WZIA 5C2XA 1NARA 5H2ZA 1JUEA 3AYRA 1F6YA 1H7NA 1PL9A 3ITVA 3IAQA 3UU0A 4I7UA 1TSIA 2WNWA 4K2SA 4BA0A 3BSHA 5AC7A 2DT3A 3EGJA 2X1RA 3P60A 1EIXA 1W6TA 4W8BA 1A5MC 2GVYA 4NIRA 3SCPA 1BVZA 2D69A 3N9SA 1MW3A 4O16A 3UFYA 3O63A 4DELA 1E51A 3MO7A 2J77A 4DZAA 3D0CA 4BF9A 1ZZMA 4DXKA 4AD5A 1QPQA 3M07A 1ISXA 3DUGA 3KBMA 1E55A 2XVPA 4KRZA 3BGJA 3NDYA 2UY4A 1KBIA 1VCFA 3NQMA 3TCSA 3W1AA 3C56A 3EB3A 3KVJA 4C90A 2G95A 3W38A 1MUCA 2D2OA 4RNIA 2VWSA 4HPXA 1JXJA 3VDBA 4GI8A 2F6KA 2X1SA 1E0VA 5HQLA 3HQNA 8A3HA 3V3WA 2WVVA 1LYXA 5I3GA 3POCA 2EPOA 2Y2WA 5D05A 3NEHA 3KWXA 3A3HA 3KRBA 1JDFA 4DZHA 3KLKA 3EEGA 4PMXA 4KBXA 4ZB5A 2Z7GA 3NAVA 3S1GA 3ISIX 2Y5JA 2G0WA 3SSZA 3QGKC 4LS2A 3ORWA 4PULA 1IEIA 1WKYA 2V69A 1BQCA 2OEMA 1ZJAA 2IKIA 3QV6A 3SGGA 1GONA 2YCLA 3NZRA 2QV4A 3W00A 3N12A 4BS0A 1S5VA 3GDMA 4ZO8A 2ISWA 1CGYA 1VD6A 2FHCA 4ZCWA 4JEJA 5KZDA 1FH9A 3SN1A 1LROA 3G1AA 3MC5A 1Z44A 3V0TA 1TA3B 4PUDA 3MUIA 4FEZA 1QJWA 1OFAA 3DFPA 3SUWA 2DSVA 1EEPA 4AZ7A 1C93A 3UW6A 1U1HA 2XU2A 3VKAA 3TFCA 4HB7A 4JPGA 5C2CA 3TH6A 3HG4A 2VFHA 3BG3A 1XISA 3LBMA 5HDRA 1UJPA 1K9TA 3T8QA 4AD3A 4DM1A 3FDGA 5LA0A 3I65A 2VX4A 1KBJA 1UOZA 2V8ZA 3FCPA 4LF1A 4ICMA 4HYVA 4GJJA 4D6CA 3S0CA 1TWZA 1M68A 2HSAA 1FBAA 4CD6A 4INFA 1YNYA 1AJ2A 1W1A1 2YYUA 4PA8A 1WO2A 3W3OA 3MJYA 4UR8A 4LBSA 4QR6A 3USBA 2Z29A 3OVGA 1SW3A 3B3DA 4O4VA 1SO3A 4OECA 1R3VA 4QDMA 3H4WA 1DWIM 4PUKA 3SFWA 2GDVA 3T07A 2VFDA 1NOUA 3AIWA 5D03A 1NIUA 2EGZA 4CQDA 2CU0A 3DU0A 2W27A 4OJYA 2OB3A 4P2VA 5CG7A 3B8SA 1DQXA 4H83A 4NRRA 3B8DA 3W7NA 4EK7A 3SAZA 4LNCA 3WQFA 1WOBA 2PLJA 2X09A 3A6OA 2CHNA 3AHXA 3PZUA 3KWSA 2ZKMX 3OLEA 1SSDA 5CC5A 5I24A 3LOTA 4PTVA 1Q6GA 2QHAA 3QTPA 1ADDA 2WK2A 4RX0A 4UFKA 1JG9A 4JN8A 3Q4DA 3P93A 1UBSA 3LD5A 3LX9A 2PBOA 3M6YA 1FH8A 3TTOA 3GNOA 3W74A 1I1XA 4MUPA 4U3AA 2DZBA 4AW7A 3IJIA 1OINA 3S6OA 3M0VA 4DUOA 4ES4A 1XIIA 2OVLA 4W84A 4N6EA 4P5UA 3NPUA 1WUEA 1REQB 4V15A 2VFGA 1XX1A 4S3CA 1EP2A 4GKLA 3GXFA 1AJZA 4DF0A 1OGSA 4GKTA 5GJNA 1W1TA 3RK8A 3C86A 3W81A 5H8PA 1K70A 4Q4PA 1JCNA 3UETA 4AD2A 1SGJA 1E0UA 5L6UA 4PR4A 3U0HA 3ZOAA 3GH4A 4WF7A 5IBXC 4FIQA 4GYPA 2A4AA 5DELA 3EPMA 1VCGA 3WJWA 3GAKA 3KVKA 3OIHA 3OYXA 2WJFA 3M0XA 1QRQA 3LZ3A 2BBFA 2XM1A 5CAKA 1QK2A 3HA1A 5D38A 2J75A 1N7KA 4WSKA 2QIIA 4Z1BA 1HJQA 4D6EA 1H49A 2ZICA 2ABBA 4AXKA 4RUBA 4U2ZA 1V6YA 1B3XA 1M04A 2GUYA 1OX6A 3NL6A 3MWCA 3T9PA 2ZCGA 3BE7A 3ITYA 2PDGA 2DJXA 4MWAC 3M0YA 1W1B1 2FZ9A 3S1WA 3Q2DA 1MUMA 5E0CA 1LLOA 1EIBA 2PDUA 1R85A 2VVSA 3QBUA 1FFRA 2ZQ0A 1MEHA 1NOFA 3H4GA 1U5HA 2X7WA 3NQVA 4JHZA 4HZ7A 3G3MA 1IHIA 1HL2A 3T08A 1F7BA 3C3UA 3GDTA 4PCFA 3L2MA 3DYMA 5C9XA 3PZVA 3T6CA 1ZBVA 1OSEA 3GY1A 1JDAA 1YYAA 1OG0A 5T8GA 3VKKA 5BOEA 5CPOA 4TVUA 3W84A 4REQA 4L9YA 3HBLA 8XIAA 3WDJA 5CZTA 4PTXA 1KM0A 2UWFA 4O1BA 2QV5A 4BWLA 1FWBC 3ABRA 1HP4A 5HR6A 1OCJA 2VDHA 2FGLA 5M17A 2YXGA 4GBUA 1XG3A 5CC6A 2BVYA 3TQ0A 4RR4A 3GO2A 3L9CA 4B2DD 5G4HC 1BWKA 3SZ8A 3W72A 3WNKA 4MMWA 1TWDA 1P0NA 4JR5A 5C70A 8CGTA 4WHBA 2J7BA 2Q6ZA 2YA2A 1TTPA 1ZJHA 1EWDA 2JF7A 3NNTA 3ZR5A 1IWPA 4D2JA 3D6NA 1OFQA 1E72M 1RZMA 3IEBA 1H0IA 5HBFA 1SUXA 2WJDA 4PB4A 2OR2A 3MTWA 4AZBA 3A24A 1XFBA 3RFAA 1N2VA 5DEZA 1XSJA 4YTSA 2XIMA 1HL8A 4I9AA 3VC6A 1I0DA 5DF0A 3N04A 2XIOA 1IT0A 4HSOA 3GHRA 2B7NA 2FMOA 3WBEA 1A50A 1VPXA 1W3IA 3CGTA 3RPTA 1AH0A 1UWRA 2VRJA 3GDBA 1I8JA 3Q37A 4NJKA 1FHDA 2OYMA 2JKAA 4AXNA 1DJXA 5HUOA 3H2FA 3UCQA 4LVGA 3TU9A 2XYLA 2H90A 4ATDA 1BEUA 3TSBA 3NA8A 4GC3A 2REQB 1P1XA 4C6BA 1FFQA 1UC4A 3QZEA 5LNVA 1K6WA 1TPVA 2D20A 3MP4A 4PBEA 4Y9NA 4F2TA 2TMDA 4H7CA 1BYDA 3NCOA 3QY8A 4HU8A 3B0YA 4IWWA 4RDYA 1RSCA 1YDVA 1FRBA 4OBSA 3RRAA 4QDPA 1CXHA 2ZOXA 3N4FA 3WLIA 3FKRA 2BY1A 3M0ZA 2ZUSA 2P1FA 1GVQA 4O52A 4L64A 4OTKA 3OBAA 4HA1A 4A3QA 5KINA 4J3XA 1GOKA 5FJOA 5E5CA 5GJMA 2E0PA 2VGIA 4F0LA 2J79A 2FQIA 2NSXA 3SCTA 1WA3A 1SMDA 4XAZA 3CO4A 1KV5A 1G4PA 4W7VA 1DWHM 3JW7A 1F3TA 3U6WA 1N55A 2DH2A 3ARYA 4V27A 1KKRA 1LUCB 4RZ5A 3W85A 4B5XA 2AQOA 3UXKA 3TFXA 1E70M 5A2BA 4DZIA 1R0MA 4GUIA 3NL5A 1H1NA 2P0OA 4P8XA 3PG9A 3WUGA 1QAPA 1UROA 2Y6ZA 5CEWA 1KCZA 2VC9A 1WAUA 3CS2A 2XUCA 2XVLA 3AIRA 5LSMA 4WIWA 5LIKX 2CLMA 3TTQA 4R7WA 3HQPA 1GW1A 1OX4A 3R0KA 3WUFA 1MMFA 1B57A 1PXGA 2QJJA 3W7CA 2PGEA 4DAFA 2DUXA 3UG5A 3VE7A 3WDIA 2E7FA 3MV11 2G37A 4HHMA 3UWZA 2FPVA 3BLFA 1GVYA 1FWEC 4ICNA 3PBMA 3NQCA 1NEYA 3DGBA 1Z89A 1NY1A 4XK2A 5AVNA 3WLOA 1HKVA 3EMZA 3STGA 2OZ8A 5IHRA 4Q8UA 2WV8A 3MUCA 4B3KA 3AJXA 4TX8A 4HNOA 3QR1A 3EXTA 3QSRA 4YS1A 1O5XA 4E3TA 4ERIA 1V6VA 4MFEA 1R30A 3C0SA 4RDZA 3IRSA 4IIDA 1MW2A 4C1LA 2B31A 3WYZA 1W37A 1VQTA 1OFBA 2AGTA 4I9JA 1V5XA 1QNVA 3BOFA 1XPGA 3IJ9A 4JX4A 2X41A 2XZ9A 3ATYA 4R34A 4LOCA 2O4MA 3HN3A 4W85A 3N2CA 4Y90A 4F0HA 1AMKA 1K9EA 4JCLA 1GVEA 3F2BA 3CJPA 3BV7A 4JL2A 1FHVA 3S1UA 1PV8A 1MDRA 3F4DA 1PIGA 2D0GA 1VHNA 2C7FA 3GW3A 3DH7A 3RLUA 4UQDA 4IP5A 2DT2A 4C6KA 1GHRA 2NWRA 4OWGA 3TIMA 1YDNA 4YWIA 4S1FA 1JVNA 3KX6A 5SWUA 1Q66A 5CC3A 1VFHA 1KFWA 4B2DA 2E3ZA 1BPLB 2WM1A 4TR9A 1DP0A 2PA6A 3G1VA 2QJHA 2FDMA 4GIAA 2OCZA 3CAVA 4PGLA 1L8NA 3REQA 2BXZA 1TR9A 3TMQA 4P61A 1UZ4A 1EP3A 3ELFA 5I77A 1VBRA 1KM2A 4PYSA 4E0CA 1P6WA 1D3CA 3WH7A 4XZNX 5HATA 1GUVA 3H70A 3WENA 1BVWA 1GVSA 4KCTA 1UHVA 4O12A 5GVJA 1GT8A 1XHGA 4DBUA 4NG3A 4HU0A 4PMRA 5D2TA 2WNZA 3RNDA 1H4PA 5D9OA 5BWAA 1XDMA 3GVWA 3GXIA 3U5YA 1OK4A 3MCNA 1KTCA 3V75A 3R8RA 1SZRA 3R5EA 1R86A 3TN3A 1Y8BA 2IPFA 2ZX9A 3XISA 2GYIA 1OFRA 4OQVA 3SJNA 2ZRXA 2ZRWA 3BH4A 3AROA 2NV2A 4ML4A 5DBUA 5GPRA 1UMYA 4MJMA 1A0DA 4JTCA 3P61A 4KEMA 4S38A 4HPHA 2VI0A 3U3HA 5DY2A 2G50A 4C1NA 3B0XA 4Q8WA 5G2IA 3RDKA 3ZSSA 1YX1A 3NSXA 4E2DA 1J0YA 3HPSA 3TCEA 2WPGA 4BHYA 1C8XA 4FNRA 3NDOA 1NQ6A 3LHTA 4H7VA 1JZ6A 1QW9A 1KTNA 1NWTA 5FOOA 4GQGA 1AL8A 5DMYA 2QIWA 4JKLA 4UC5A 4D72A 2B81A 1H7WA 4BKNA 5CKSA 1CGWA 1CGXA 2Q3RA 3WLLA 3K4DA 3VUPA 5AYXA 3KRZA 5TIMA 1XC6A 3U2EA 6ALDA 3LV5A 5JH2A 3E0WA 3CYJA 1LP6A 3WDPP 4KFNA 4C65A 1B3YA 1Q4WA 3HTWA 4BQ2A 4IFKA 4ACYA 1Q2RA 1P7TB 2D3LA 4J3TA 1EDQA 4S3BA 5ABTA 3CPRA 2ZZ6A 3AYSA 4V1YA 2AQVA 4S3FA 3O8AA 2X8RA 4DBWA 3KCOA 4H7ZA 3BPWA 4NXSA 3QH2A 1RPXA 2W92A 4TIMA 2CERA 1VAHA 3QQWA 4P7QA 3RU6A 2VRQA 2UZ9A 2XH7A 2CCRA 1MRQA 2ZWZA 1NFGA 1RCXB 5G2WA 2PDBA 3WJSA 5A6TC 1RVGA 3IWPA 3AXMA 4M1BA 3GHSA 3M6DA 3DIPA 1J12A 2W67A 2GUBA 4AEEA 1MO0A 4IGNA 4LAZA 3W07A 2DH3A 1MFVA 2HWGA 4JDBA 2YOCA 4K7YA 1E9YB 2XH2A 1FWCC 2OXNA 1KXHA 4PCPA 3WH6A 1E0XA 4ZA0A 2FPTA 3W2MA 1YTKA 4EPKA 3GH7A 3PG8A 4GINA 3OEXA 5A6SA 1RY0A 2ACQA 4JNMA 4Q4MA 1PTDA 1W5OA 4GCXA 3P3BA 4D9PA 1JCJA 5EL1A 4HZMA 3AFBA 4IQJA 3C5QA 4WD0A 3CUHA 3KE0A 4MADA 1N8WA 3TQKA 2F6UA 5HMFA 4ZVJA 4HK6A 1V0NA 1I4NA 1OFEA 3H8AA 4CQAA 3UR2A 1VC4A 3MT1A 1G7UA 5CPNA 3L4WA 2Z6JA 3R7MA 1SSGA 3T4WA 4ADSA 4LYQA 3NO1A 1G67A 2ZBTA 3UWQA 1OIFA 2WC4A 1UMLA 4NNAA 3LLDA 1VB9A 1P4CA 4PUJA 5BMXA 3OQEA 2NUYA 1FWJC 3MB9A 3NQBA 2QT3A 2J6XA 2GOUA 3UY8A 3QXBA 3STEA 1LRNA 4GCAA 5F2MA 4YLWA 1UWSA 3V35A 1E1CA 2YCLB