4IPGA

Structure of the n-terminal domain of rpa70, e7r, e100r mutant
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
HMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELRVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Surface Reengineering of RPA70N Enables Cocrystallization with an Inhibitor of the Replication Protein A Interaction Motif of ATR Interacting Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 31
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ipgA00
3AQQA 1JJ2A 2NVQH 3CP0A 2E5LL 4DR6Q 3HOUG 3L2PA 2IT1A 3GTLH 4GNXA 1YVCA 4L5QA 3PO2G 1YHBA 1L1OA 1IXRA 3CCEA 4MNOA 4A3JG 4LUOA 1P16A 4OWWB 3S15H 1IBML 4DK3C 3TS2A 2E5LQ 1X3GA 1EFWA 4WJ3M 1EQQA 2CKZB 1JJGA 5FJ8G 1YIJA 3UE0A 1A8VA 1KQSA 3EBEA 4POGA 2PI2E 3BZCA 3K81C 1HNXQ 3UE1A 4O2DA 5C4XG 5IWAL 1KXLA 4L5RC 3I4NG 2VQFL 2N3SA 3GTOH 4NXML 1KRSA 2MO0A 1PYBA 3GO5A 1H95A 1N9WA 2MFIA 5BR8Q 3F2BA 2V1CC 3S16H 2ZTCA 1JT8A 2UUCQ 1G6PA 1Z9FA 2Y0SG 1A62A 5JEAJ 4DV0L 4POFA 4DV6Q 1SR3A 3S1NH 5IWAQ 3STBC 2VQFQ 1VQLA 4GLXA 1TWFH 1VQFA 4B3TL 3DM3A 3KDFA 1E3PA 4GN3B 1C0AA 1VQBA 3HKZE 1I6HH 4GLVB 4GS3A 4JI1Q 1KAWA 4IOAA 1UE7A 1VQKA 3I4OA 2UUBL 2HHHQ 1JB7A 4UP7A 4GKKL 2UU9L 3D31A 4A3IH 2RHSB 4BBSG 2OQKA 1X3FA 5IE8A 1OTCA 1M90C 1HZ9A 1NMGA 1XNQL 3CPFA 2HIXA 3UDIA 2QA4A 4LWCA 1Q8KA 5IYDH 1GKHA 4P75A 4DV2L 1HR0L 1IBLQ 4JC0A 1WI5A 5GQOA 3CAMA 5C3EG 1C7YA 3L7ZC 5FLMG 4JI4L 1NBWA 1PH9A 1IYJB 2JJQA 3J7ZC 4ALPA 4JI3Q 3U50C 5C4JH 2BA0A 3RLNA 3CCMA 2LSSA 2R93G 1HH2P 1Q82C 1CKNA 2VL6A 1W3SA 3RR5A 3HOZG 3GD7A 1U5KA 3JAMc 4H02A 4DR1L 4A3FH 1PH8A 2ZJQA 4BY1H 1GVPA 3I2ZA 3M4PA 5EAYA 3U4ZA 3Q8DA 5C0XI 1GM5A 4A3GH 4RMFA 2JA9A 4LFCQ 3H15A 2BH2A 2I5MX 5GAGC 4NB3A 4JI5L 1BKBA 4PZ7A 5C44H 3CCLA 1VQIA 4NPSA 1I5FA 1GD7A 2NN6G 2ALYB 5HY6A 3OTOL 4O0AA 2NVXH 1N32L 1UE6A 2CCZA 2NVYH 4QY7A 2B63H 3PO3G 2IHFA 1VQ4A 5IYBG 4KI0A 3U4VA 3HOVH 2JK8A 3GTJH 1KD1C 4X6AH 2UUAL 1HNWL 2UXBL 1WFQA 4AQYQ 2QEXA 4APVA 3T1HQ 4IJLA 1XMOL 4Y7NH 4DR2L 2RHQB 3OTOQ 4J15A 1PH4A 1N32Q 1Q7YC 3BJUA 4YY3L 4DAMA 3HFZB 4DV4L 1HNZL 4OX9L 5LMNL 2VW9A 4HIOA 4LF4L 3CMEA 1A0IA 3HOXG 3PV0A 4LF6Q 2UXBQ 4IO9A 1G51A 2E2HH 1W2BA 3F8TA 1XMOQ 4JI8Q 3GTMH 3IRBA 4JI7Q 4UY8C 3OYYA 3W5OA 3HKZG 4A3CH 2R92G 4KHPL 1K8GA 3EIVA 1HZCA 3FP9A 1HNZQ 4LF5Q 3K7UC 1LM0A 3NENA 1U0LA 3KJOA 2K5HA 3AYHB 4GLAC 4LF9L 4AYBG 3PF5A 2CWAA 4BY7G 1E24A 2K4KA 3T1YL 1VQOA 4TQUS 1Y1WG 4A3BG 3CW2C 3E9HA 3S17H 4DR3Q 2VNUD 2CQOA 4BBRH 4JI6L 1WJJA 4DR5L 1DGSA 1KC8C 2NZOA 3LGJA 3VDYA 1LYLA 1OXXK 4JBWA 4LFBL 1CSQA 4X65L 3L0OA 1PH2A 3PO3H 4UP9A 2JA5H 1Q1EA 1QVCA 4A93G 3PSIA 4FDBA 1TWHH 1I94Q 1LTLA 4OONA 1X6OA 1Q46A 3DLLA 3FHWA 2E2IH 5M3FH 2WAQE 1YZ6A 4JI6Q 1XNRQ 4MTNA 1L2FA 1N36L 1RIPA 5M3MG 4A3DG 5M5YH 1VQEA 4X66L 4JOIC 2NVTH 1VQAA 3TEHB 2JA7H 1BBUA 1WYDA 4DPGA 4X65Q 4GOPB 1FVIA 4OWXB 4OWTB 2EXDA 4OO1I 4BXXG 1Y14B 2PNHA 4X64Q 2R7ZH 1SN8A 3J81c 1XPOA 2OTLA 1KHIA 1WCMG 3E0EA 1D7QA 2XGTA 1ASZA 1OXVA 1XMQQ 2VUMH 4B3RL 4A4IA 2GN5A 2XTIA 3AFPA 5GROA 4DV3L 4A3KH 4K0KL 5JJKA 2ZJPA 2JA6H 3I56A 3STBD 3K7AH 5IP7H 3S14H 1PH5A 3CC2A 1PHJA 2N8NA 3NEMA 3HOUH 4B3RQ 2I5HA 4IFDJ 4YCWA 1IBMQ 4UP8A 3UDXA 4QIWE 2WFWA 3S1RH 3H0GG 4L5TA 3RZOH 3ZJYC 4IOCA 5FJ8H 1K83H 4QGUA 3BZKA 4DV1L 4JI2L 4L5SA 4PZ8A 4EX5A 4JI0L 4NXMQ 3S24A 4GNXC 5C4XH 1HR0W 3RLOA 3I4NH 1V1QA 4A3LG 3H3VI 2NZHA 1L1OC 2MO1A 2VY3A 3S1MH 4DV0Q 3GTKH 4IPDA 1YJWA 1K73C 1PH7A 3CQZH 4B3TQ 4JI2Q 4PZ6A 2WB1E 4X62L 4A3MH 1YHQA 3W1BA 4JI0Q 1FGUA 3CXCA 2PMZE 4A76A 1UEBA 2UUBQ 1QUQB 3T1HL 2Z6KA 4GKKQ 4DUYL 1HJPA 2UU9Q 1EIYB 2Q2TA 1KL9A 2N78A 2JQOA 2RF4A 1XNQQ 5DLQE 3CCUA 1C9OA 1VQGA 1V9PA 1V43A 3D0FA 3F1ZA 1TWAH 3NBHB 4IPGA 3PUXA 3UDFA 1FL0A 4HJ7A 3U58A 3RZDH 4XIGS 1EYGA 4DV2Q 4YWMA 1HR0Q 3TRZA 5HGQA 2PQAB 3S2DH 1XPUA 3I4MH 3PUYA 1VQNA 4NXNL 3RN2A 1P8LA 3HOYG 4JI4Q 2JE6I 3ULJA 4HJ8A 2JA8G 4MZ9A 2ID0A 4GNXB 2MNAA 1AE2A 3CD6A 5C3EH 5ELNA 1PH1A 5FLMH 2AKWB 3W1GA 3JAMi 2K14A 1OXTA 3RLFA 4DR1Q 3ER0A 3FKIG 2IX0A 1YI2A 1VQ9A 2CFMA 2Q2UA 3KOJA 3M9BA 2R93H 3HOZH 3HOWG 1XPRA 1NTGA 4HJ9A 4LFAL 2MQHA 1KIXA 1Q1BA 4LF7L 1YEZA 2E8GA 1VQ6A 2YU9H 2F4VL 4JI5Q 2YV5A 4DK6C 4DR4L 3KJPA 4C3IH 2ZM6L 1XJVA 3M7NA 4A75A 1TXYA 3KFUA 3G71A 4GOPA 2KCMA 3CPWA 4P72A 1L0WA 4B3ML 1X55A 2LXKA 1YITA 1Q81C 4LF7Q 2GVBA 2AWOA 2UUAQ 5IYCG 2F4VQ 1HNWQ 1SLJA 3ERSX 5IP9H 4DUZL 4HIDA 1EOVA 1CKMA 4DR4Q 2IHEA 5IYBH 1E1TA 2ZM6Q 3I7FA 3KDFB 4YCUA 4DR2Q 3AFQA 3RN5A 2JEBI 4YY3Q 1E1OA 4B3MQ 5LMUL 4DV4Q 1VQPA 1SFOH 4LF8L 5LMNQ 4OX9Q 2PI2A 4IFDG 2VQEL 4LF4Q 4A3CG 5GAEC 2I0QA 1EWIA 3AEVA 3CCQA 4DUZQ 2A19A 1X56A 3CC7A 3CF5A 2ES2A 5JJLA 2DUDA 1VCIA 3ULLA 3HOXH 2IX1A 4LW1A 1YJ9A 2ZTDA 3PIPA 4KHPQ 2OTJA 4LF8Q 3WWVA 3CCJA 2KBNA 4R4OA 2AHOB 5AJ3L 1AH9A 2NN6I 2Q2IA 3A0JA 4LF9Q 2R92H 2L15A 1PH6A 2Q2HA 3T1YQ 1SMXA 1YJNA 1BBWA 4BA2I 4ME3A 2D0PA 4BY7H 3GDEA 4JG2A 1EIFA 2JA5G 2A8VA 5IT9c 3KF6B 4PG3A 4DR5Q 1B70B 4AH6A 1X65A 3K8AA 4LNQA 3J80c 4A3BH 4LFBQ 1D8LA 4A3EG 1QVFA 1SROA 3G48A 1J5EL 1Y1VG 3BU2A 1WOCA 1QUQA 3S1QH 3J7A5 1GO3E 2ZTEA 3J80i 4A93H 1N36Q 1IBKL 2R7ZG 2YTYA 4X66Q 3MEFA 1CUKA 3TREA 4C3JH 3TS0A 3KF8B 4AIMA 1QVGA 4GN5A 2ASBA 3KYHC 4P71A 1JMCA 4IFDI 5M3MH 3H3VH 2LXJA 3J81i 4QQBX 5J3BA 2UXDL 2R7DA 4KHZA 3S2HH 4BBSH 3PO2H 3KLWA 5IP7G 4BXXH 1YBYA 5K36G 1YHAA 1I3QH 2K50A 4DV3Q 4K0KQ 2F3IA 1WCMH 1S72A 4A3JH 1CSPA 1J6QA 2B29A 2VZAA 2FXQA 2UXDQ 3M4QA 1HNXL 4R4QA 4R1JA 3GTPH 2HQLA 4B3SL 2OQ0A 1MIUA 3TQYA 5IY0A 3MXNB 2B3GA 2YYZA 5M5XH 3PUZA 3G6EA 1Q12A 2WP8J 1PH3A 5BR8L 4GKJL 4HJ5A 3ULPA 1UE1A 2UUCL 4RG1A 4DV6L 4DR7L 4B3SQ 1VQMA 1T9HA 3PCOB 1KRTA 5FLXc 1RL2A 4DV1Q 4A3IG 2IY5B 4JV5L 3H0GH 2A1AA 4JI1L 5C0XG 1NMFA 3PUWA 2K5VA 1ASYA 2HHHL 2OWOA 1QZHA 4GKJQ 2JEAI 2CWPA 4A3MG 1TWCH 5IYDG 4TVAB 1NY4A 2KCTA 4YHHL 1OXUA 2D0OA 4DR7Q 3NELA 1X9NA 4HJAA 4C3HH 4A3LH 1X3EA 4X62Q 1TWGH 4LUZA 3PUVA 2YTXA 2ZJRA 3M85A 3B6YA 1IBLL 4YCVA 2WAQG 3CCSA 2AMCB 3JC66 1CKOA 5GADC 4DUYQ 2D62A 4IPCA 1Q86C 1PVOA 2K5NA 4YHHQ 1UE5A 3K0XA 4AYBE 4JYAL 4IPHA 5GAHC 4JI3L 4A3FG 4BY1G 1K0RA 4DNIA 1EQRA 2YTVA 1N33L 3CC4A 3I4MG 3M4OH 2N49A 1VQ5A 5ELOA 1I50H 2R7FA 2QGQA 4A3GG 1L1OB 4JV5Q 1LUZA 2BA1A 3HKSA 4NXNQ 3F2DA 4JYAQ 5C44G 1PFSA 3UDGA 1SE8A 3F2CA 1N33Q 4LFCL 1OXSC 3CCRA 5LMNW 3OW2A 1E22A 4JBJA 3HOYH 1VS0A 2B63G 3KF6A 1NJIC 2Z6KC 2JA8H 2EQSA 1N8RC 3HOVG 1E7ZA 1JJCB 3RNUA 1MJEA 5H1SE 1QZGA 4LFAQ 1VQDA 3FKIH 1BVSA 4DKAC 3PF4A 2HT1A 2KHJA 2EIFA 5M5WH 3J81j 4XTCS 3SGIA 2C35B 4R4TA 5C0XJ 4AQYL 1S40A 1Z47A 4JBMA 1HZAA 3HOWH 3ICEA 2AWNA 3G4SA 2KHIA 3E9IA 1JE5A 1B7YB 5IP9G 4HIMA 1PV4A 1PYSB 1FJGL 2F52A 4LF6L 2E2JH 4R4IA 2DGYA 4YWKA 4JBKA 4HIKA 1K9MC 4QJFA 4GN4B 1IL2A 2RCNA 4WJ4A 4JI8L 4JI7L 2K75A 4YWLA 2WB1G 1K8AC 3CCVA 1PA6A 5IYCH 1M1KC 4LF5L 4LUVA 4OO1G 5LMUQ 1A63A 3PGZA 2H5XA 1FJGQ 1YNXA 4C2MH 3I55A 1K3RA 2GVAA 1B8AA 2I5LX 2Y0SE 2VQEQ 1NE3A 1AE3A 2K52A 4JOIA 1UWVA 1VQHA 4PMWA 4BBRG 4DV5L 1HZBA 2BH8A 2KENA 4DV7L 3GTGH 4GOPC 1VQ8A 2OCEA 4R4CA 4DR3L 1VQCA 1G291 1MKHA 1EUJA 1X54A 1O7IA 1CKNB 5AJ3Q 2Z0SA 1R9TH 1Y1WH 2VS1A 5M3FG 4Y52H 4DV5Q 4IJHA 2UXCL 4BA1I 4P74A 1I94L 4EQ5A 4DV7Q 5JEAG 2JA7G 1MJCA 5E7NA 4KLKA 1XNRL 1N34L 1VQ7A 1IZ6A 2HIVA 2R6GA 3EN2A 4OXPA 4DR6L 3K80C 3CMAA 2UXCQ 3A5UA 2VUMG 1J5EQ 3PIOA 4P73A 4A3DH 4X64L 1S3OA 1VQJA 4A3KG 1SRUA 4UPAA 3A5ZB 5JJIA 1N34Q 4DAYB 4A3EH 2PQAA 4QL5A 3GTQH 2JA6G 4JCVE 1XMQL 2ATWA 1XTDA 3M3YH 3A74A 1Y1VH 1IBKQ
chains in the Genus database with same CATH superfamily
1DM0B 1EY8A 3CP0A 3L2PA 1YVCA 1QNKA 3CCEA 2F0FA 4FF2A 4J1MA 4A3JG 4LUOA 2NUCA 3TS2A 1BR9A 5E3FA 1JJGA 5FJ8G 1YIJA 1JORA 1E2VA 3UE0A 4Q0FA 1ZYRC 5ELCA 4O2DA 3CKIB 1JICA 3GTOH 1KRSA 2MO0A 3GO5A 1BQQT 5BR8Q 3GV6A 2V1CC 4K6DA 3JAME 3HOXB 1JT8A 4NDXA 1QOHA 4F8MA 1A62A 1EY9A 1XTCD 5JEAJ 3S1NH 4LK1C 4GLXA 1TWFH 3KDFA 1E3PA 1TR5A 4GN3B 3N52A 4GLVB 1KAWA 3I4OA 4UP7A 3SK6A 2UU9L 2Q8IB 4BBSG 4H44C 5G3LF 5C0XH 2XRQD 4LWCA 4JK1C 2F1MA 1ICFB 1SYGA 2FHTA 3CAMA 3SEBA 3ND8A 4JI4L 1PH9A 4A93B 2TMPA 2EVBA 1JQYD 4RAUC 1Q90A 1B3AA 1HH2P 2VL6A 1Q82C 1W3SA 3D6WA 3U9OA 4XQNA 3LWEA 4DR1L 5M3MB 1GUWA 1D5ZC 1GVPA 4DXFA 3Q8DA 5C0XI 4C3IG 2WACA 3H15A 2F0SA 2BH2A 5CV9A 5BN4A 1BKBA 3CCLA 4NPSA 5EKIA 2NN6G 3OTOL 3K5OA 4DNTB 4L8JA 5IYBG 4KI0A 1PRTF 3GTJH 5M5XB 4KD3A 2UUAL 3NTIA 1SYBA 3MXPA 4APVA 3A56A 1PH4A 4Y7NH 4DR2L 4F88A 2XSCA 3J81L 3QOLA 2VW9A 4LF4L 3H0GB 4RGMA 4HSVA 2UXBQ 1PFBA 5DM63 3DWPA 3A54A 2JP1A 1W2BA 4XDXA 3NWTA 4JI8Q 3IRBA 3W5OA 4FF3A 4KHPL 2DY8A 3FP9A 3K7UC 1TWGB 4GLAC 2RBMA 4C1NI 3PF5A 1XWEA 2K4KA 4TQUS 1Y1WG 2L5TA 2CQOA 1PRTB 4JI6L 1DGSA 1NUCA 1LYLA 1I50B 4JBWA 2SEBD 4LFBL 4X3SA 1PH2A 4UP9A 3NBIA 1Q1EA 1QVCA 3PSIA 2JYOA 1V8QA 1LTLA 1X6OA 3Q6SA 4C3JG 3QJYA 5C4ZA 3FHWA 2HCIA 2E2IH 2WAQE 3NXWA 5I9PA 3BS1A 5KNCA 1N36L 1RIPA 4A3DG 1NNXA 2DY7A 2NVTH 1KNAA 2NB0A 1VQAA 4JOIC 2RDHA 3WOEA 4GOPB 1ZYRD 4BXXG 2OTLA 1GUNA 3H94A 1HUMA 2GA4B 4UAIA 1SYFA 2VUMH 4A4IA 3MVVA 5M5WB 2XTIA 3AFPA 3EROA 4A3KH 4K0KL 3PO3B 4R8IA 2L0CA 3K5NA 1ONLA 3A8JE 5IGFA 5IP7H 3CC2A 3TZDA 2N8NA 3WOFA 4B3RQ 1S4ZA 4ME5A 1STHA 4QIWE 2WFWA 1HTPA 4IOCA 5FJ8H 2EYMA 4N9PA 3D4WA 2K28A 4JI2L 4L5SA 4PZ8A 3LNNA 4CDCC 1V1QA 4C3HG 4A3LG 1Y69U 2NZHA 1L1OC 4XT3B 3R2TA 4B9WA 1YHQA 4A3MH 1LT6D 4HR7B 4H7BA 1IKLA 2N55A 1QUQB 4GKKQ 3QO2A 2QILA 4DUYL 2IPKD 2Q2TA 1SDFA 2RF4A 2F0KA 5DLQE 1GUSA 3CCUA 2VB3X 3F1ZA 3D0FA 1EU4A 4BBSH 3RZDH 3PUXA 4QUFA 3TRZA 2PQAB 4NXNL 3HOYG 2JE6I 3ULJA 4HJ8A 2ID0A 5CV4A 2MNAA 1AE2A 2AKWB 4IALA 1OXTA 3J7AF 5CMDA 3ER0A 1IW7C 2IX0A 3FKIG 1ENFA 2A68C 2Q2UA 4CJ2C 2WINB 4V190 4CHTB 1CA6A 1EWHA 1XPRA 5KRUA 3MXUA 4Z9CB 3CRKC 2YU9H 4JI5Q 2K5QA 2YV5A 3KJPA 4C3IH 3M7NA 4FXDA 4DK1A 2EYPA 3KFUA 3G71A 4GOPA 3E6ZX 2LS01 3M7GA 1Q81C 3Q23A 4ULLA 4LF7Q 2GVBA 5IYCG 3ERSX 4K5XA 4DUZL 3S16B 4WJWA 3VR2A 5IYBH 1TIID 1E1TA 3LX0A 2ZM6Q 3RN5A 3TP6A 2JEBI 3IAYA 2X6GA 4B3MQ 3FPPA 1VQPA 1SFOH 2F0NA 4JW0A 3URYA 2BOSA 2EYJA 4X3TA 1IHZA 2DUDA 3ULLA 1FR3A 3WWVA 2KBNA 1RF2D 1AH9A 2NN6I 2Q2IA 4LF9Q 1K3BC 1WTWA 1MBYA 1YJNA 2E76C 4RCNA 4HMJA 4BA2I 4ME3A 4UHVA 3VA7A 1DZ1A 5FO8B 4PG3A 5C4JB 4AH6A 3K8AA 4LNQA 3G48A 1SJED 3H6MA 1Y1VG 2EOTA 2B8GA 1QUQA 2F0WA 4A3GB 3S1QH 3J7A5 1GO3E 2ZTEA 2R7ZG 5HGTA 5C44B 4C3JH 1QVGA 4P71A 4PMCA 2F0UA 1SE4A 2CHBD 2NVYB 2B63B 2ZXRA 4K8JA 4QF4A 3KLWA 4BXXH 5K36G 1MHWC 5C4HA 4DV3Q 1S72A 1J6QA 1QILA 3HS0C 5EPJA 3M4QA 3OWEB 4FO2A 2AQ1B 3Q24A 2Q8RE 3TQYA 3MXNB 2K5DA 3G6EA 2E2HB 4RWSC 5I9OA 5BR8L 4GKJL 1WD0A 4I7AA 4KJOA 3SE0A 4TSSA 2JSOA 2L4NA 1SXTA 4C56C 5FLXc 1RL2A 1EIHA 5JVG3 1QE6A 4RGNA 3K5LA 1PTOC 4XT1B 3NQTA 2O2LD 3S17B 4YHHL 2K7VA 1OXUA 1TVXA 4DR7Q 4BBRB 3KLRA 4C3HH 4A3LH 4K5VA 3NTHA 4LUZA 1IW7D 3PUVA 1BUVT 2A68D 1HQMC 3SDZA 1AN8A 2K5NA 1UE5A 1NCVA 3IFDA 4IPHA 5M5YB 1EQRA 3E5SA 4K5WA 2JA7B 3HZXA 2QW7A 2R7FA 4JV5Q 3V96A 2BA1A 3HKSA 3R2IA 5KIXA 3F2DA 1LTTD 1PFSA 2FMCA 1N33Q 3SXHA 1E22A 1STGA 3HOYH 1NJIC 1O80A 5CC4A 3S14B 2OEOA 3NTKA 1HHVA 3BYYB 2EYOA 1E7ZA 4DFAA 1MJEA 4ZCKA 2EJMA 2K6AA 3FKIH 3K58A 1LTAD 4XTCS 1S40A 2Z4HA 5C0XJ 4JBMA 3S1RB 1GHJA 3FVQA 1B7YB 5A2QL 3GV3A 4HIMA 2F52A 1B4OA 1QNUA 2DGYA 5C4XB 1IL2A 2RCNA 4KN4C 4JI8L 3S1MB 3QR8A 1K8AC 1PA6A 1S5DD 5IYCH 3BDLA 5LMUQ 1KDBA 1YNXA 3K6OA 1HPCA 2Y0SB 4C2MH 3I55A 2VQEQ 1BNZA 1LTRD 3D8GA 1BDOA 4KKSA 1HZBA 2BH8A 3K59A 1MGSA 4MTKA 3VYSA 1MKHA 1X54A 3I91A 1M8AA 4IUQA 4B08A 4K2KA 3GP7A 5M3FG 3D3RA 2UXCL 5FK9C 5CORA 4BA1I 1HFNA 4DV7Q 1MJCA 4O42A 4HAEA 1N34L 1IZ6A 1QG7A 4OXPA 4DR6L 4KHVA 4KMUC 3CMAA 3A5UA 1OO9B 4S3SA 1S3OA 3A5ZB 3HOZB 5IODA 1JWUD 2ATWA 1XTDA 3A74A 1Y1VH 1IBKQ 3AQQA 1JJ2A 2NVQH 3HOUG 1KABA 2MGSA 3GTLH 4GNXA 4L5QA 1YHBA 2MP1A 2B2UC 1MSGA 1VMPA 2ZXPA 3MC0B 2F0VA 3VA5A 5T1GA 1PTOD 3S15H 4WJ3M 2E5LQ 1EFWA 1EQQA 4MIUA 4OGQC 4MN3A 3FMCA 3EBEA 5K36H 4POGA 1K8OA 5C5LA 1KTKA 1KXLA 2FJ2A 3I4NG 2VQFL 4HN7A 2N3SA 1PYBA 1H95A 1N9WA 5IGCA 5JVH3 4K8IA 2EY2A 1VF5C 1GUTA 2UUCQ 1G6PA 1SR3A 2KEEA 5IWAQ 1VQBA 3HKZB 1I6HH 4GS3A 3TMEA 4IOAA 3G6JB 1ML0D 4GKKL 2HUGA 3A7LA 4NMZA 5ELFA 2RHSB 2OQKA 4N9TA 4AYBB 1SJHD 3TP8A 5L37A 5CV5A 1HZ9A 2PPBC 2KUMA 2QA4A 1Q8KA 4P75A 1LLRD 3EQLC 1RKNA 1WI5A 4U68A 3L7ZC 5FLMG 1CT1D 5CV8A 2L11A 3I4LA 4JI3Q 3RLNA 1LT3D 3KBXA 1U5KA 2PCFB 3JAMc 1PH8A 2ZJQA 4IUVA 1A3UA 1I4GA 4CKBA 5KNBA 1T5XD 3S2HB 3PO2B 1IYVA 2JA9A 2M2LA 4UDUC 1I3QB 4QMGA 3BZDB 4RKBA 3MHBA 2K05A 4JI5L 1MI2A 2DJGC 4L6TB 1GD7A 2NVXH 1N32L 3D6CA 5HY6A 3GTPB 1UE6A 2FMMA 3KF8A 3I8ZA 4QY7A 1SNPA 2CCZA 3PO3G 2IHFA 1VQ4A 4QB4A 1J8IA 4ZYSA 1PXUA 3U4VA 1G6ZA 2DJFC 2QEXA 4IJLA 3SK5A 1Q7YC 3HFZB 3E0JA 4I65A 3SHLA 2XVSA 2ZT9C 1XMOQ 1L0XB 3X3NA 1LACA 3GTMH 4A3CH 3OYYA 2R92G 1CHQD 1K8GA 1HNZQ 1HZCA 3TP7A 1CQFA 4IUUA 2M9VA 2G5DA 2K5HA 4LF9L 4BY7G 2CWAA 2EPBA 4HCSA 4A3BG 3CW2C 3PQIA 3OHXC 3V2TA 4CDFC 1FNWA 2H4OA 4R8NA 1WJJA 2NZOA 3M4OB 1HA6A 1DOKA 5M9OA 1CSQA 4X65L 2JA5H 1I94Q 1TWHH 5I6YA 1ENAA 3DLLA 5M3FH 5C6AA 3I70A 4MTNA 1L2FA 4ZUIA 2CH4W 1JWSD 3TEHB 1PZID 1WYDA 4DPGA 4DN4M 1FVIA 4OWXB 2D9UA 2EXDA 4OWTB 1QWYA 4K14A 1KHIA 1WCMG 3OOCA 1ASZA 2R61A 3BVGA 5GROA 2H1EA 4DV3L 3QWNA 1J9OA 1Y8PB 2XNAC 3HOUH 3NEMA 1E0BA 2AQ3B 1LTID 3QOJA 2P5ZX 1SNOA 1EY0A 3RZOH 1F2LA 1K83H 4QGUA 2FFKB 1D2BA 1NR2A 3S24A 4CGYB 3I4NH 2QDBA 1RTNA 5EGTA 2EJFC 3H3VI 2B2VA 1L0YB 5ELEA 2HD3A 1YJWA 1PH7A 5A35A 1PFNA 4B3TQ 5KGUA 4JI0Q 3W1BA 2PMZE 2L12A 1HJPA 1KL9A 2N78A 2B2YA 1XNQQ 1CQVA 1C9OA 1V43A 3ONAB 3UDFA 1TWAH 1D6EC 1FL0A 3TBIB 4P2CB 1FYCA 1RJTA 1XPUA 3I4MH 1VQNA 3WDNA 2F0JA 4A3EB 2JA8G 3M3YB 1ZKOA 2B39A 3CD6A 2A69C 1PH1A 1A15A 3V05A 2RDFA 5FLMH 4DF7A 3A55A 2PQEA 5EPKA 3RLFA 4NP5A 1YI2A 1VQ9A 3FEWX 1SE2A 3KOJA 3AB9A 3HOWG 1BOSA 2IL8A 3W2DA 2MQHA 1Q1BA 2E8GA 1I4PA 2A74C 1BCPC 3DWAA 1EY4A 5J22A 1XJVA 1TU2B 2KCMA 3CPWA 4P72A 1L0WA 2C5CA 1DCZA 2LXKA 3IKJA 5IT9E 1YITA 3GTOB 3VYTA 3J80E 1HNWQ 2F4VQ 5JPNC 2O5IC 5IP9H 4DR4Q 2IHEA 4YCUA 2PNRC 3S1NB 4YY3Q 1E1OA 1R4PB 1TWFB 3DHQA 5LMUL 2QKIC 5LMNQ 4DV4Q 4OX9Q 2VQEL 1VF7A 3NQIA 5GAEC 1U9RA 1TS3A 2A19A 1Q3LA 3CC7A 2ES2A 1CZWA 4L63B 4LW1A 1O7LA 2ZTDA 3PIPA 4LF8Q 2MJ8A 4MHEA 1QCBD 2QEJC 2IJ0A 4DAPA 5J39A 3A0JA 3VR6A 2R92H 1ILPA 1BF4A 2L15A 2Q2HA 3T1YQ 1BBWA 4DK0A 4BY7H 3GDEA 2A8VA 3KF6B 2A6HC 4DR5Q 5FLXL 4HMIA 4A3BH 2SNMA 1SROA 3MXGA 2PW7A 2F0GA 5EKLA 1DONA 3BU2A 1CTMA 5C3XA 4ZQ3A 3NP8A 1C48A 1K28A 1Z7TA 1IBKL 1W6KA 4X66Q 1CUKA 1PTOH 1STAA 2KCCA 4IURA 4IFDI 1JR0D 2LXJA 3J81i 3H91A 2Z1CA 4QQBX 2UXDL 1B50A 3GTJB 1A3VA 1YBYA 1YHAA 4ZKBB 2J7ZA 3KUPA 2F3IA 1WCMH 4LMQD 4Y7NB 4TRDA 4A3JH 2OF1A 2FINB 1CZGA 1TKWB 1G91A 4U673 2OQ0A 2MHVA 5IY0A 4J6HA 2WP8J 2PZWA 3PIO3 2RQXA 3RD4A 3ULPA 1UE1A 2UUCL 4O1NA 1VMCA 4B3SQ 3M3YH 1T9HA 3PCOB 1KRTA 1TS5A 4DV1Q 4A3IG 2IY5B 2WB1B 2G9DA 2JEAI 2CWPA 1TWCH 1EEID 5IYDG 2KCTA 3H3VC 3A8IE 4DAVA 2HDLA 4RH6A 2A69D 4K2LA 5EKKA 4HJAA 2RSOA 2ZJRA 3T1HQ 2WAQG 1CKOA 1PVOA 3EJIA 3R8BA 1B9NA 4AYBE 5DNFA 1NAPA 2E2IB 4RCOA 4A3FG 4JI3L 1E2ZA 4BY1G 1BCPD 4DNIA 3FRPB 3CC4A 2QGQA 1LUZA 2L1BA 4JYAQ 5C5MA 5KYLA 1GJXA 2VUMB 5FO7B 1SE8A 3UDGA 3F2CA 2F0DA 3OW2A 4A3KB 2F0MA 1EU3A 4JBJA 1VS0A 3KF6A 4IQZA 4FXGC 2JA8H 1N8RC 4HTHA 3HOVG 1JJCB 2XIWA 3T13A 3RNUA 1HUNA 4LFAQ 1VQDA 2NYZD 1KNEA 2NN6H 3J81j 1RCVD 1KDAA 1Z47A 3HOWH 1HZAA 2K33A 3E9IA 2R3ZA 1JE5A 1Q8IA 1PV4A 1FJGL 1PRTC 2E2JH 3FDTA 3FPUB 3BVZA 4JBKA 4HIKA 3T51B 2KECA 4YWLA 2A6HD 1M1KC 1H9KA 5D14A 2WKDA 4XQQA 4OO1G 3PGZA 1XX8A 4A3MB 1K3RA 2GVAA 3TDQA 1NE3A 3O13A 1XXGA 3KLSX 1AZPA 2KENA 3GTGH 1S5ED 4GOPC 2OCEA 3NK9A 3J7AV 1O7IA 1CKNB 1O7YA 5AJ3Q 2Z0SA 3OWFA 1R9TH 4BBSB 3RZDB 1Y1WH 3Q22A 4DV5Q 1I94L 3BG3A 3VR5A 5E7NA 4KLKA 3ND9A 1DOLA 3PMFA 2HIVA 4ZUJA 1D1IA 1H9SB 2OT2A 4HCEA 1J5EQ 4DA2A 4A3DH 1VQJA 4DAYB 3GTQH 2PQAA 1A2UA 2JA6G 3P7JA 3CU7A 2YU9B 3C1EA 3H09A 2F0LA 2G9HD 4C3IB 3PO2G 1V1PB 3DMUA 4EVOA 1P16A 1MSHA 4OWWB 3HG9A 1X3GA 4KY7A 2F0HA 2CKZB 4M8AA 3JAML 3DUZA 4FXKC 5CV6A 2Z9HA 3BZCA 3K81C 1HNXQ 3UE1A 1SFOB 5IOCA 1I4RA 3KLSA 1ENCA 1ZXTA 3F2BA 4LJZC 2ZTCA 5G3LD 2C9OA 2NZ1D 1VQLA 4B3TL 1VQFA 2Z6BA 3CHBD 4CKCA 5CR3A 4OL7A 3IFTA 1LV9A 1TS4A 2HHHQ 2KQ3A 3D31A 4A3IH 1OTCA 1XNQL 4RHRA 3UDIA 5IYDH 3HRZC 3OPOA 1WTHA 1IBLQ 3TSSA 5GQOA 5C3EG 1H9MA 3S1QB 1T5EA 1NBWA 2F3WA 2JJQA 5I4DA 4HEDA 3J7ZC 3MA2B 4C3JB 3CCMA 2R93G 1EYAA 1CKNA 2HDMA 3GD7A 3NHHA 4A3FH 4BY1H 2O5JC 1YNNC 1WTVA 3I2ZA 3M4PA 5EAYA 1PRTD 3U4ZA 1GM5A 4RMFA 2E74C 4LFCQ 3RUZA 2I5MX 5NUCA 5GAGC 1VQIA 1BO0A 4XYOA 1I5FA 4O0AA 3A7AB 3C46A 1U4MA 3HOVH 4X6AH 2JK8A 1KD1C 4IUTA 4DAYA 3ITPA 1HNWL 2UXBL 1JC7A 2RHQB 3OTOQ 4J15A 1K0SA 4YY3L 1V1PA 4KTAA 4DV4L 4OX9L 5LMNL 4NKLA 1U4PA 1A0IA 3HOXG 3PV0A 4ZKCB 1HXYD 2J4XA 2LMCB 1JWMD 3F8TA 3MXNA 4UY8C 4JI7Q 1S5FD 2K5WA 5LL6S 4C3HB 1CA5A 1LM0A 2QDLA 2RVLA 1W6JA 1AW7A 1B3QA 1SYCA 4OO1H 3T1YL 3P75A 1VQOA 3E9HA 2NTSA 3DXJC 5COYA 2L9HA 4DR5L 1KC8C 3VDYA 3LGJA 4ID6A 3X3MA 3ZYYX 4ZK9B 4ODGA 3P1HA 1AFPA 4XYQA 4KJNA 4GZYC 4A93G 3VR4A 3EA6A 4FDBA 5JAVA 4OONA 1PMRA 1XNRQ 4JI6Q 1YZ6A 1RD9D 5M3MG 2Z8LA 3HOYB 1VQEA 4X66L 1A6XA 1E2WA 1GUGA 2EYHA 1Y8NB 4OO1I 1Y14B 2PNHA 4X64Q 2R7ZH 1SN8A 3E0EA 1WVLA 2XGTA 3TZUA 1OXVA 3FKIB 3E3XA 4B3RL 2GN5A 2BE5C 2ZJPA 5CGKA 1DJRD 2JA6H 1IL8A 2AUJD 2AQ2B 4QUCA 3K7AH 2F0IA 1PHJA 5ELBA 4WORA 2I5HA 4IFDJ 4CBVA 1IBMQ 4ILWA 1HRJA 2LFNA 3UDXA 4IUNA 1DD2A 4OHJA 1B1ZA 3H0GG 4L5TA 3ZJYC 3R3OA 4DV1L 4I7ZC 4C2MB 4WRDA 4EX5A 4NXMQ 4KN7C 4GNXC 1F77A 1GOZA 3D4RA 4RA8A 2MO1A 4DV0Q 3GTKH 1K73C 1F2ZA 3CQZH 1EYDA 1RDPD 3T53B 3Q0AA 4JI2Q 4PZ6A 2WB1E 3TP5A 1FGUA 3CXCA 4A76A 1UEBA 2UUBQ 1YNND 3T1HL 2Z6KA 2A6EC 2EZVA 3BVMA 1GHKA 2SOBA 1VQGA 3NBHB 3NSWA 4IPGA 1SE3A 1ESRA 1EYGA 3U58A 3J7YW 4KV6A 4DV2Q 1ZEQX 4YWMA 1HR0Q 5HGQA 3S2DH 1PFMA 3RN2A 3MEHA 1P8LA 3EVQA 4MZ9A 1Y1VB 3BDCA 2NVQB 5C3EH 5ELNA 3W1GA 3GTLB 1TY0A 2CFMA 3M9BA 5IGDA 2R93H 1PZKD 4LFAL 2IW3A 1KIXA 3S15B 4LF7L 3C3LA 2CQAA 1BCPF 1VQ6A 4IZ8A 4KKUA 2ZM6L 4G7OC 1RODA 1SNCA 3QG1A 4B3ML 1X55A 2F3VA 3VYUA 1G2TA 1O7ZA 2F0TA 5I2YA 2M00A 1SLJA 2XRSD 3P20A 1CKMA 2TSSA 5D65A 2EY1A 3I7FA 3KDFB 3AFQA 3K0YA 2PI2A 4IFDG 1I6HB 1D1KA 1SBBB 1EWIA 3AEVA 4DUZQ 1X56A 5JJLA 1Y8OB 1VCIA 3HOXH 1F9RA 4G7ZC 4ABNA 3SK8A 3CCJA 2AHOB 3KK7A 5AJ3L 1STYA 1PH6A 1SYEA 1UNSA 5IGEA 4IN3A 2I46A 5ISRA 1S5CD 5IT9c 2BE5D 5EBDA 1B70B 3J80c 1D8LA 1QVFA 3SK4A 1J5EL 2EY5A 4JVZA 1C4QA 4A93H 2YTYA 2ASBA 2NVXB 5M3MH 3H3VH 1EY6A 4KY5A 2R7DA 4EQNA 3I90A 5IP7G 1B9MA 1UUPA 2K50A 3I73A 1KAAA 1PZJD 1H9RA 5CV7A 2FXQA 5D3DA 1HNXL 1HFGA 3NUCA 1LT4D 4H13C 4KD4A 2PYKA 2B2WA 1MIUA 2K01A 5M5XH 2A6ED 1PH3A 4CJ0B 3GTMB 2X6LA 4HJ5A 1F2YA 4RG1A 4OIKA 1RHPA 2D5DA 2KCNA 4DR7L 2RSNA 1X3QA 2XWJB 3OSOA 4KKTA 5DEHA 1CHPD 4G7HC 3H0GH 5HURA 1NMFA 3PUWA 2K5VA 1ASYA 5E4WC 2HHHL 1QZHA 2OWOA 4GKJQ 4A3MG 3L9AX 4PNYA 3A8KE 1X9NA 3M4YA 5EQ0A 1EOTA 4X62Q 1TWGH 1A3TA 1X32A 1WTXA 2YTXA 2JA5B 1IBLL 4YCVA 1Q86C 1U4LA 1TWHB 2AMCB 3JC66 4JV5L 4IPCA 4YHHQ 3K0XA 5M3FB 2F0QA 2B2WC 1WTQA 1K0RA 1C8CA 1XYIA 1N33L 4B9XA 2N49A 1VQ5A 1I50H 4A3GG 1L1OB 2B2VC 2O4XA 3DM1A 2SNSA 1SAPA 1RTOA 4BWGB 5C44G 1D5MC 4LFCL 1OXSC 3VYRA 3CCRA 2B63G 2DNCA 2IWHA 3HOUB 3DEOA 2KJXA 2B2YC 3NE5B 1BBXC 1QZGA 4FYDA 3PF4A 2HT1A 2KHJA 2EIFA 5M5WH 1O78A 1AZQA 3SGIA 4F87A 3MTSA 3PO3H 3ICEA 2KVMA 3RZOB 5FKAC 1FGBD 1K83B 1PYSB 2A73B 3L3OC 1NSNS 1YNJC 4R4IA 2WV6D 4YWKA 1DOMA 1K9MC 1EQTA 3I4NB 4GN4B 5LHY1 4XXEA 4JI7L 2K75A 2RDGA 1LTBD 1GXDC 5A2QE 2V4DA 1B8AA 2Y0SE 2K52A 4H0LC 4JOIA 1H9JA 1UWVA 1EFID 1VQHA 5ELDA 4BBRG 4HSPA 5IGBA 2NTTA 4IFDH 4DV7L 3F2UA 1VQ8A 4N8FA 1VQCA 1G291 1EUJA 5FOBB 4BS9A 1TWAB 2VS1A 4Y52H 4IJHA 3I4MB 4EQ5A 5JEAG 2JA7G 2SDFA 1XNRL 1VQ7A 3OW7A 1DYQA 1WTPA 1KDCA 3RMHA 2UXCQ 1F9SA 4X64L 1CI3M 1SRUA 4UPAA 1WTRA 2BCOA 1MD2D 1N34Q 1STNA 1STEA 4JCVE 3EFXD 1XPOA 2OXPA 1EY7A 2IX3A 1JOOA 4DR6Q 4CJ1B 1ET6A 5D3IB 2E5LL 3SVMA 2IT1A 4PMBA 3GQBA 2PZTA 2XWBB 4DGZA 1L1OA 4J8QA 1IXRA 3IL8A 4MNOA 3C1FA 1IBML 4DK3C 1HA5A 1X3PA 3S9WA 4KY6A 2WIIB 1A8VA 1KQSA 2PI2E 5C4XG 5IWAL 4L5RC 1G2SA 2X69A 4NXML 1PTOF 2MFIA 3S16H 1JOKA 3K57A 1Z9FA 2Y0SG 4DV0L 4DV6Q 4POFA 4TKOB 1JCKB 1I4HA 4CKEA 3STBC 4PV1C 4F7XA 2VQFQ 3DM3A 1C0AA 2R92B 3HKZE 4JI1Q 1UE7A 1VQKA 2UUBL 1JB7A 5LL6X 4RGTA 2DN8A 4BY7B 1PDQA 1X3FA 5IE8A 1M90C 3SR1A 1NMGA 2EYLA 3CPFA 2HIXA 4A3BB 2NVTB 4Q5VA 2K1BA 1GKHA 4DV2L 1HR0L 4JC0A 4WFN3 1SMYC 1C7YA 5DM73 1IYJB 2D2CC 1HQRD 2Z4IA 4ALPA 3ERQA 3U50C 5C4JH 2BA0A 1PTOB 2LSSA 4KK7A 3HOZG 3RR5A 2JXMB 4H02A 5EJWA 3I72A 1F9QA 1YNJD 1EWCA 4A3GH 1TQOA 2PZUA 4EQPA 1II3A 1WCMB 2AUKA 4NB3A 4PZ7A 5C44H 4A3JB 3T4AC 2ALYB 5KYIA 1AP0A 2NVYH 2B63H 3T16A 1ILQA 1WTOA 2CVRA 5JJZA 1U4RA 1B53A 1WFQA 1I6VC 2EDGA 4AQYQ 1LO5D 2A5HA 1XMOL 1N32Q 3BJUA 4DAMA 1ESFA 1HNZL 4HIOA 3CMEA 4LF6Q 3R93A 4IO9A 1EEFD 1G51A 2EY6A 4JPBW 2E2HH 5IGGA 1TWCB 5IIFA 1SEBD 3HKZG 2CW0C 3EIVA 4LF5Q 3HEJA 3NENA 4DU9A 1U0LA 3KJOA 3AYHB 2F0PA 4AYBG 1E24A 1IKMA 3MWYW 4QCLA 2F4IA 4ZAIA 3S17H 4DR3Q 2VNUD 1JB3A 4BBRH 2VB2X 1FNVA 1OXXK 4DXGA 2E75C 3L0OA 2LY7A 2JN4A 3CRLC 4OELB 2MUYA 1Q46A 2F0OA 1K8MA 2WKCA 5M5YH 2RCFA 5JEAH 2JA7H 1BBUA 4X65Q 2JA8B 2E2DC 2QCPX 3PIP3 3J81c 1D7QA 1GUOA 1EL0A 1XMQQ 1KLUD 4V0BA 5J1ZA 5BN5A 4N8X1 5JJKA 3HOWB 3I56A 1UEAB 2DNEA 4ZRZA 3STBD 3S14H 1SNQA 1PH5A 1VDZA 5BN3A 2E2JB 4YCWA 3N6RA 3AMUA 1B2TA 4ZLTF 5AFWA 4UP8A 3S1RH 3DEPA 1FNUA 3BZKA 4JI0L 3BYTB 1PYWD 1CK1A 1SMYD 5C4XH 1HR0W 3RLOA 3GTGB 1SNMA 2VY3A 3S1MH 4IPDA 2QF7A 3KBGA 1R9TB 1B44D 4X62L 1Y1WB 2PMZB 5C3WA 4RGOS 2N88A 1CFMA 2UU9Q 1EIYB 5CYUA 2JQOA 5K5PA 1LTGD 2ENBA 1V9PA 4HJ7A 4XIGS 4EQOA 2PO4A 4A3DB 3PUYA 2HCCA 4JI4Q 3GTQB 1S5BD 4GNXB 3JAMi 2K14A 1FD7D 4DR1Q 1H9SA 2ZXOA 2J0TD 5JOBA 5E4XA 3HOZH 5IT9L 1NTGA 4HJ9A 1NR4A 1YEZA 3OMGA 3J80L 2F4VL 1IYUA 4DK6C 4DR4L 2PW5A 2CW0D 3OMCA 4A75A 1TXYA 4PQXA 4E6IA 2AWOA 2UUAQ 4HIDA 1EOVA 5JPMC 2HQEA 1STBA 4DR2Q 4RKLA 1QB5D 4LF8L 3J81E 4FNFA 4A3CG 4LF4Q 1V1OA 4OIJA 2I0QA 4FF1A 3CCQA 3BDOA 5I2XA 3CF5A 4A3IB 3UI2A 2IX1A 2EXZA 1YJ9A 2NBFA 4KHPQ 2OTJA 4R4OA 2Q8TA 4YIJA 5I6WA 5DAUA 2ICEC 1TY2A 2KOLA 1JOQA 3W3AA 1SMXA 1F9PA 1ET9A 3DWQA 2B2UA 2D0PA 3NPPA 4JG2A 1EIFA 2JA5G 2B2TA 2WAQB 4NW2A 4FVMA 1X65A 2BDNA 4X3UA 4EGVA 3HGBA 4LFBQ 3AU7A 4A3EG 4A3FB 4BY1B 4RHSA 1CM9A 1ICWA 1QJOA 4G4KA 1WOCA 1R4QB 3HP3A 2RA4A 3U9SA 3J80i 1EY5A 1N36Q 5FLXE 3LWUA 3MEFA 3TREA 3TS0A 2L55A 1HTLD 3KF8B 4AIMA 4GN5A 1TT2A 3KYHC 1JMCA 1UAPA 3D4DA 5J3BA 1M4VA 2XN9C 5T1IA 3QIAA 3MFYA 4KHZA 3S2HH 3HOVB 1G8ZD 3PO2H 3I3CA 1I3QH 4K0KQ 4X3KA 1CSPA 2B29A 2VZAA 4QIWB 1PLFA 2UXDQ 2B2TC 3OIQA 4R4QA 4R1JA 3GTPH 2HQLA 4B3SL 3OIPA 2B3GA 2YYZA 3PUZA 5CBEE 1Q12A 1D5XC 4CDEC 5CBAE 4DV6L 2LKVA 2EE1A 4R9WA 1VQMA 1HCZA 4JI1L 2A1AA 5C0XG 4CDDC 4TVAB 2K04A 1NY4A 3MFGA 2D0OA 3MAQA 3NELA 2KEDA 1F2MA 5TSSA 4FF4A 1X3EA 2MPMA 1DXMA 1JE4A 3M85A 3B6YA 5KEEA 3CCSA 5GADC 3K5MA 4DUYQ 2D62A 1EZ6A 3VR3A 4JYAL 2K32A 3G7LA 5GAHC 3I4MG 2YTVA 3M4OH 1LT5D 5ELOA 2K03A 2R7ZB 4NXNQ 4XQJA 1EIGA 2I07B 4M1UB 5LMNW 4IUPA 2RKSA 2VXWA 1TS2A 4OEMB 2Z6KC 2JA6B 2EQSA 3K7AB 1WD1A 5KNDA 3C2PA 5H1SE 1SSOA 1BVSA 4DKAC 3TN2A 1EZ8A 4LAAA 4FP5D 2EYFA 2C35B 4R4TA 5FO9B 4AQYL 4DNRB 3NWSA 2AWNA 3G4SA 2KHIA 1LABA 5IP9G 5EBCA 1SNDA 2KHSA 4LF6L 4G57A 4QJFA 5E1FA 1AEXA 2CH4A 4RFBA 4WJ4A 3T56B 2EJGC 2WB1G 3GTKB 3CCVA 3CQZB 4LF5L 4LUVA 1SYDA 1A63A 2H5XA 1FJGQ 1BCPB 1BXTA 2I5LX 1AE3A 5F2DA 1I4XA 4PMWA 4DV5L 1A2TA 5EPLA 4DR3L 4R4CA 1EYCA 1EQVA 2F0EA 4K6LA 3S2DB 4P74A 2F03A 2NWGA 1I4QA 1KLGD 1LTSD 3MZ5A 2ICIA 2R6GA 3QB3A 5C3EB 4C1NK 3EN2A 1Z6HA 3K80C 2VUMG 3PIOA 2BDOA 3NBHA 2KA7A 4P73A 4A3KG 2R93B 5JJIA 4A3EH 4QL5A 1XMQL 2B8FA
chains in the Genus database with same CATH topology
3AQQA 1JJ2A 2NVQH 3CP0A 2E5LL 4DR6Q 3HOUG 3L2PA 2IT1A 3GTLH 4GNXA 1YVCA 4L5QA 3PO2G 1YHBA 1L1OA 1IXRA 3CCEA 4MNOA 4A3JG 4LUOA 1P16A 4OWWB 3S15H 1IBML 4DK3C 3TS2A 2E5LQ 1X3GA 1EFWA 4WJ3M 1EQQA 2CKZB 1JJGA 5FJ8G 1YIJA 3UE0A 1A8VA 1KQSA 3EBEA 4POGA 2PI2E 3BZCA 3K81C 1HNXQ 3UE1A 4O2DA 5C4XG 5IWAL 1KXLA 4L5RC 3I4NG 2VQFL 2N3SA 3GTOH 4NXML 1KRSA 2MO0A 1PYBA 3GO5A 1H95A 1N9WA 2MFIA 5BR8Q 3F2BA 2V1CC 3S16H 2ZTCA 1JT8A 2UUCQ 1G6PA 1Z9FA 2Y0SG 1A62A 5JEAJ 4DV0L 4POFA 4DV6Q 1SR3A 3S1NH 5IWAQ 3STBC 2VQFQ 1VQLA 4GLXA 1TWFH 1VQFA 4B3TL 3DM3A 3KDFA 1E3PA 4GN3B 1C0AA 1VQBA 3HKZE 1I6HH 4GLVB 4GS3A 4JI1Q 1KAWA 4IOAA 1UE7A 1VQKA 3I4OA 2UUBL 2HHHQ 1JB7A 4UP7A 4GKKL 2UU9L 3D31A 4A3IH 2RHSB 4BBSG 2OQKA 1X3FA 5IE8A 1OTCA 1M90C 1HZ9A 1NMGA 1XNQL 3CPFA 2HIXA 3UDIA 2QA4A 4LWCA 1Q8KA 5IYDH 1GKHA 4P75A 4DV2L 1HR0L 1IBLQ 4JC0A 1WI5A 5GQOA 3CAMA 5C3EG 1C7YA 3L7ZC 5FLMG 4JI4L 1NBWA 1PH9A 1IYJB 2JJQA 3J7ZC 4ALPA 4JI3Q 3U50C 5C4JH 2BA0A 3RLNA 3CCMA 2LSSA 2R93G 1HH2P 1Q82C 1CKNA 2VL6A 1W3SA 3RR5A 3HOZG 3GD7A 1U5KA 3JAMc 4H02A 4DR1L 4A3FH 1PH8A 2ZJQA 4BY1H 1GVPA 3I2ZA 3M4PA 5EAYA 3U4ZA 3Q8DA 5C0XI 1GM5A 4A3GH 4RMFA 2JA9A 4LFCQ 3H15A 2BH2A 2I5MX 5GAGC 4NB3A 4JI5L 1BKBA 4PZ7A 5C44H 3CCLA 1VQIA 4NPSA 1I5FA 1GD7A 2NN6G 2ALYB 5HY6A 3OTOL 4O0AA 2NVXH 1N32L 1UE6A 2CCZA 2NVYH 4QY7A 2B63H 3PO3G 2IHFA 1VQ4A 5IYBG 4KI0A 3U4VA 3HOVH 2JK8A 3GTJH 1KD1C 4X6AH 2UUAL 1HNWL 2UXBL 1WFQA 4AQYQ 2QEXA 4APVA 3T1HQ 4IJLA 1XMOL 4Y7NH 4DR2L 2RHQB 3OTOQ 4J15A 1PH4A 1N32Q 1Q7YC 3BJUA 4YY3L 4DAMA 3HFZB 4DV4L 1HNZL 4OX9L 5LMNL 2VW9A 4HIOA 4LF4L 3CMEA 1A0IA 3HOXG 3PV0A 4LF6Q 2UXBQ 4IO9A 1G51A 2E2HH 1W2BA 3F8TA 1XMOQ 4JI8Q 3GTMH 3IRBA 4JI7Q 4UY8C 3OYYA 3W5OA 3HKZG 4A3CH 2R92G 4KHPL 1K8GA 3EIVA 1HZCA 3FP9A 1HNZQ 4LF5Q 3K7UC 1LM0A 3NENA 1U0LA 3KJOA 2K5HA 3AYHB 4GLAC 4LF9L 4AYBG 3PF5A 2CWAA 4BY7G 1E24A 2K4KA 3T1YL 1VQOA 4TQUS 1Y1WG 4A3BG 3CW2C 3E9HA 3S17H 4DR3Q 2VNUD 2CQOA 4BBRH 4JI6L 1WJJA 4DR5L 1DGSA 1KC8C 2NZOA 3LGJA 3VDYA 1LYLA 1OXXK 4JBWA 4LFBL 1CSQA 4X65L 3L0OA 1PH2A 3PO3H 4UP9A 2JA5H 1Q1EA 1QVCA 4A93G 3PSIA 4FDBA 1TWHH 1I94Q 1LTLA 4OONA 1X6OA 1Q46A 3DLLA 3FHWA 2E2IH 5M3FH 2WAQE 1YZ6A 4JI6Q 1XNRQ 4MTNA 1L2FA 1N36L 1RIPA 5M3MG 4A3DG 5M5YH 1VQEA 4X66L 4JOIC 2NVTH 1VQAA 3TEHB 2JA7H 1BBUA 1WYDA 4DPGA 4X65Q 4GOPB 1FVIA 4OWXB 4OWTB 2EXDA 4OO1I 4BXXG 1Y14B 2PNHA 4X64Q 2R7ZH 1SN8A 3J81c 1XPOA 2OTLA 1KHIA 1WCMG 3E0EA 1D7QA 2XGTA 1ASZA 1OXVA 1XMQQ 2VUMH 4B3RL 4A4IA 2GN5A 2XTIA 3AFPA 5GROA 4DV3L 4A3KH 4K0KL 5JJKA 2ZJPA 2JA6H 3I56A 3STBD 3K7AH 5IP7H 3S14H 1PH5A 3CC2A 1PHJA 2N8NA 3NEMA 3HOUH 4B3RQ 2I5HA 4IFDJ 4YCWA 1IBMQ 4UP8A 3UDXA 4QIWE 2WFWA 3S1RH 3H0GG 4L5TA 3RZOH 3ZJYC 4IOCA 5FJ8H 1K83H 4QGUA 3BZKA 4DV1L 4JI2L 4L5SA 4PZ8A 4EX5A 4JI0L 4NXMQ 3S24A 4GNXC 5C4XH 1HR0W 3RLOA 3I4NH 1V1QA 4A3LG 3H3VI 2NZHA 1L1OC 2MO1A 2VY3A 3S1MH 4DV0Q 3GTKH 4IPDA 1YJWA 1K73C 1PH7A 3CQZH 4B3TQ 4JI2Q 4PZ6A 2WB1E 4X62L 4A3MH 1YHQA 3W1BA 4JI0Q 1FGUA 3CXCA 2PMZE 4A76A 1UEBA 2UUBQ 1QUQB 3T1HL 2Z6KA 4GKKQ 4DUYL 1HJPA 2UU9Q 1EIYB 2Q2TA 1KL9A 2N78A 2JQOA 2RF4A 1XNQQ 5DLQE 3CCUA 1C9OA 1VQGA 1V9PA 1V43A 3D0FA 3F1ZA 1TWAH 3NBHB 4IPGA 3PUXA 3UDFA 1FL0A 4HJ7A 3U58A 3RZDH 4XIGS 1EYGA 4DV2Q 4YWMA 1HR0Q 3TRZA 5HGQA 2PQAB 3S2DH 1XPUA 3I4MH 3PUYA 1VQNA 4NXNL 3RN2A 1P8LA 3HOYG 4JI4Q 2JE6I 3ULJA 4HJ8A 2JA8G 4MZ9A 2ID0A 4GNXB 2MNAA 1AE2A 3CD6A 5C3EH 5ELNA 1PH1A 5FLMH 2AKWB 3W1GA 3JAMi 2K14A 1OXTA 3RLFA 4DR1Q 3ER0A 3FKIG 2IX0A 1YI2A 1VQ9A 2CFMA 2Q2UA 3KOJA 3M9BA 2R93H 3HOZH 3HOWG 1XPRA 1NTGA 4HJ9A 4LFAL 2MQHA 1KIXA 1Q1BA 4LF7L 1YEZA 2E8GA 1VQ6A 2YU9H 2F4VL 4JI5Q 2YV5A 4DK6C 4DR4L 3KJPA 4C3IH 2ZM6L 1XJVA 3M7NA 4A75A 1TXYA 3KFUA 3G71A 4GOPA 2KCMA 3CPWA 4P72A 1L0WA 4B3ML 1X55A 2LXKA 1YITA 1Q81C 4LF7Q 2GVBA 2AWOA 2UUAQ 5IYCG 2F4VQ 1HNWQ 1SLJA 3ERSX 5IP9H 4DUZL 4HIDA 1EOVA 1CKMA 4DR4Q 2IHEA 5IYBH 1E1TA 2ZM6Q 3I7FA 3KDFB 4YCUA 4DR2Q 3AFQA 3RN5A 2JEBI 4YY3Q 1E1OA 4B3MQ 5LMUL 4DV4Q 1VQPA 1SFOH 4LF8L 5LMNQ 4OX9Q 2PI2A 4IFDG 2VQEL 4LF4Q 4A3CG 5GAEC 2I0QA 1EWIA 3AEVA 3CCQA 4DUZQ 2A19A 1X56A 3CC7A 3CF5A 2ES2A 5JJLA 2DUDA 1VCIA 3ULLA 3HOXH 2IX1A 4LW1A 1YJ9A 2ZTDA 3PIPA 4KHPQ 2OTJA 4LF8Q 3WWVA 3CCJA 2KBNA 4R4OA 2AHOB 5AJ3L 1AH9A 2NN6I 2Q2IA 3A0JA 4LF9Q 2R92H 2L15A 1PH6A 2Q2HA 3T1YQ 1SMXA 1YJNA 1BBWA 4BA2I 4ME3A 2D0PA 4BY7H 3GDEA 4JG2A 1EIFA 2JA5G 2A8VA 5IT9c 3KF6B 4PG3A 4DR5Q 1B70B 4AH6A 1X65A 3K8AA 4LNQA 3J80c 4A3BH 4LFBQ 1D8LA 4A3EG 1QVFA 1SROA 3G48A 1J5EL 1Y1VG 3BU2A 1WOCA 1QUQA 3S1QH 3J7A5 1GO3E 2ZTEA 3J80i 4A93H 1N36Q 1IBKL 2R7ZG 2YTYA 4X66Q 3MEFA 1CUKA 3TREA 4C3JH 3TS0A 3KF8B 4AIMA 1QVGA 4GN5A 2ASBA 3KYHC 4P71A 1JMCA 4IFDI 5M3MH 3H3VH 2LXJA 3J81i 4QQBX 5J3BA 2UXDL 2R7DA 4KHZA 3S2HH 4BBSH 3PO2H 3KLWA 5IP7G 4BXXH 1YBYA 5K36G 1YHAA 1I3QH 2K50A 4DV3Q 4K0KQ 2F3IA 1WCMH 1S72A 4A3JH 1CSPA 1J6QA 2B29A 2VZAA 2FXQA 2UXDQ 3M4QA 1HNXL 4R4QA 4R1JA 3GTPH 2HQLA 4B3SL 2OQ0A 1MIUA 3TQYA 5IY0A 3MXNB 2B3GA 2YYZA 5M5XH 3PUZA 3G6EA 1Q12A 2WP8J 1PH3A 5BR8L 4GKJL 4HJ5A 3ULPA 1UE1A 2UUCL 4RG1A 4DV6L 4DR7L 4B3SQ 1VQMA 1T9HA 3PCOB 1KRTA 5FLXc 1RL2A 4DV1Q 4A3IG 2IY5B 4JV5L 3H0GH 2A1AA 4JI1L 5C0XG 1NMFA 3PUWA 2K5VA 1ASYA 2HHHL 2OWOA 1QZHA 4GKJQ 2JEAI 2CWPA 4A3MG 1TWCH 5IYDG 4TVAB 1NY4A 2KCTA 4YHHL 1OXUA 2D0OA 4DR7Q 3NELA 1X9NA 4HJAA 4C3HH 4A3LH 1X3EA 4X62Q 1TWGH 4LUZA 3PUVA 2YTXA 2ZJRA 3M85A 3B6YA 1IBLL 4YCVA 2WAQG 3CCSA 2AMCB 3JC66 1CKOA 5GADC 4DUYQ 2D62A 4IPCA 1Q86C 1PVOA 2K5NA 4YHHQ 1UE5A 3K0XA 4AYBE 4JYAL 4IPHA 5GAHC 4JI3L 4A3FG 4BY1G 1K0RA 4DNIA 1EQRA 2YTVA 1N33L 3CC4A 3I4MG 3M4OH 2N49A 1VQ5A 5ELOA 1I50H 2R7FA 2QGQA 4A3GG 1L1OB 4JV5Q 1LUZA 2BA1A 3HKSA 4NXNQ 3F2DA 4JYAQ 5C44G 1PFSA 3UDGA 1SE8A 3F2CA 1N33Q 4LFCL 1OXSC 3CCRA 5LMNW 3OW2A 1E22A 4JBJA 3HOYH 1VS0A 2B63G 3KF6A 1NJIC 2Z6KC 2JA8H 2EQSA 1N8RC 3HOVG 1E7ZA 1JJCB 3RNUA 1MJEA 5H1SE 1QZGA 4LFAQ 1VQDA 3FKIH 1BVSA 4DKAC 3PF4A 2HT1A 2KHJA 2EIFA 5M5WH 3J81j 4XTCS 3SGIA 2C35B 4R4TA 5C0XJ 4AQYL 1S40A 1Z47A 4JBMA 1HZAA 3HOWH 3ICEA 2AWNA 3G4SA 2KHIA 3E9IA 1JE5A 1B7YB 5IP9G 4HIMA 1PV4A 1PYSB 1FJGL 2F52A 4LF6L 2E2JH 4R4IA 2DGYA 4YWKA 4JBKA 4HIKA 1K9MC 4QJFA 4GN4B 1IL2A 2RCNA 4WJ4A 4JI8L 4JI7L 2K75A 4YWLA 2WB1G 1K8AC 3CCVA 1PA6A 5IYCH 1M1KC 4LF5L 4LUVA 4OO1G 5LMUQ 1A63A 3PGZA 2H5XA 1FJGQ 1YNXA 4C2MH 3I55A 1K3RA 2GVAA 1B8AA 2I5LX 2Y0SE 2VQEQ 1NE3A 1AE3A 2K52A 4JOIA 1UWVA 1VQHA 4PMWA 4BBRG 4DV5L 1HZBA 2BH8A 2KENA 4DV7L 3GTGH 4GOPC 1VQ8A 2OCEA 4R4CA 4DR3L 1VQCA 1G291 1MKHA 1EUJA 1X54A 1O7IA 1CKNB 5AJ3Q 2Z0SA 1R9TH 1Y1WH 2VS1A 5M3FG 4Y52H 4DV5Q 4IJHA 2UXCL 4BA1I 4P74A 1I94L 4EQ5A 4DV7Q 5JEAG 2JA7G 1MJCA 5E7NA 4KLKA 1XNRL 1N34L 1VQ7A 1IZ6A 2HIVA 2R6GA 3EN2A 4OXPA 4DR6L 3K80C 3CMAA 2UXCQ 3A5UA 2VUMG 1J5EQ 3PIOA 4P73A 4A3DH 4X64L 1S3OA 1VQJA 4A3KG 1SRUA 4UPAA 3A5ZB 5JJIA 1N34Q 4DAYB 4A3EH 2PQAA 4QL5A 3GTQH 2JA6G 4JCVE 1XMQL 2ATWA 1XTDA 3M3YH 3A74A 1Y1VH 1IBKQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQQ A;  1JJ2 A;  2NVQ H;  3CP0 A;  2E5L L;  4DR6 Q;  3HOU G;  3L2P A;  2IT1 A;  3GTL H;  4GNX A;  1YVC A;  4L5Q A;  3PO2 G;  1YHB A;  1L1O A;  1IXR A;  3CCE A;  4MNO A;  4A3J G;  4LUO A;  1P16 A;  4OWW B;  3S15 H;  1IBM L;  4DK3 C;  3TS2 A;  2E5L Q;  1X3G A;  1EFW A;  4WJ3 M;  1EQQ A;  2CKZ B;  1JJG A;  5FJ8 G;  1YIJ A;  3UE0 A;  1A8V A;  1KQS A;  3EBE A;  4POG A;  2PI2 E;  3BZC A;  3K81 C;  1HNX Q;  3UE1 A;  4O2D A;  5C4X G;  5IWA L;  1KXL A;  4L5R C;  3I4N G;  2VQF L;  2N3S A;  3GTO H;  4NXM L;  1KRS A;  2MO0 A;  1PYB A;  3GO5 A;  1H95 A;  1N9W A;  2MFI A;  5BR8 Q;  3F2B A;  2V1C C;  3S16 H;  2ZTC A;  1JT8 A;  2UUC Q;  1G6P A;  1Z9F A;  2Y0S G;  1A62 A;  5JEA J;  4DV0 L;  4POF A;  4DV6 Q;  1SR3 A;  3S1N H;  5IWA Q;  3STB C;  2VQF Q;  1VQL A;  4GLX A;  1TWF H;  1VQF A;  4B3T L;  3DM3 A;  3KDF A;  1E3P A;  4GN3 B;  1C0A A;  1VQB A;  3HKZ E;  1I6H H;  4GLV B;  4GS3 A;  4JI1 Q;  1KAW A;  4IOA A;  1UE7 A;  1VQK A;  3I4O A;  2UUB L;  2HHH Q;  1JB7 A;  4UP7 A;  4GKK L;  2UU9 L;  3D31 A;  4A3I H;  2RHS B;  4BBS G;  2OQK A;  1X3F A;  5IE8 A;  1OTC A;  1M90 C;  1HZ9 A;  1NMG A;  1XNQ L;  3CPF A;  2HIX A;  3UDI A;  2QA4 A;  4LWC A;  1Q8K A;  5IYD H;  1GKH A;  4P75 A;  4DV2 L;  1HR0 L;  1IBL Q;  4JC0 A;  1WI5 A;  5GQO A;  3CAM A;  5C3E G;  1C7Y A;  3L7Z C;  5FLM G;  4JI4 L;  1NBW A;  1PH9 A;  1IYJ B;  2JJQ A;  3J7Z C;  4ALP A;  4JI3 Q;  3U50 C;  5C4J H;  2BA0 A;  3RLN A;  3CCM A;  2LSS A;  2R93 G;  1HH2 P;  1Q82 C;  1CKN A;  2VL6 A;  1W3S A;  3RR5 A;  3HOZ G;  3GD7 A;  1U5K A;  3JAM c;  4H02 A;  4DR1 L;  4A3F H;  1PH8 A;  2ZJQ A;  4BY1 H;  1GVP A;  3I2Z A;  3M4P A;  5EAY A;  3U4Z A;  3Q8D A;  5C0X I;  1GM5 A;  4A3G H;  4RMF A;  2JA9 A;  4LFC Q;  3H15 A;  2BH2 A;  2I5M X;  5GAG C;  4NB3 A;  4JI5 L;  1BKB A;  4PZ7 A;  5C44 H;  3CCL A;  1VQI A;  4NPS A;  1I5F A;  1GD7 A;  2NN6 G;  2ALY B;  5HY6 A;  3OTO L;  4O0A A;  2NVX H;  1N32 L;  1UE6 A;  2CCZ A;  2NVY H;  4QY7 A;  2B63 H;  3PO3 G;  2IHF A;  1VQ4 A;  5IYB G;  4KI0 A;  3U4V A;  3HOV H;  2JK8 A;  3GTJ H;  1KD1 C;  4X6A H;  2UUA L;  1HNW L;  2UXB L;  1WFQ A;  4AQY Q;  2QEX A;  4APV A;  3T1H Q;  4IJL A;  1XMO L;  4Y7N H;  4DR2 L;  2RHQ B;  3OTO Q;  4J15 A;  1PH4 A;  1N32 Q;  1Q7Y C;  3BJU A;  4YY3 L;  4DAM A;  3HFZ B;  4DV4 L;  1HNZ L;  4OX9 L;  5LMN L;  2VW9 A;  4HIO A;  4LF4 L;  3CME A;  1A0I A;  3HOX G;  3PV0 A;  4LF6 Q;  2UXB Q;  4IO9 A;  1G51 A;  2E2H H;  1W2B A;  3F8T A;  1XMO Q;  4JI8 Q;  3GTM H;  3IRB A;  4JI7 Q;  4UY8 C;  3OYY A;  3W5O A;  3HKZ G;  4A3C H;  2R92 G;  4KHP L;  1K8G A;  3EIV A;  1HZC A;  3FP9 A;  1HNZ Q;  4LF5 Q;  3K7U C;  1LM0 A;  3NEN A;  1U0L A;  3KJO A;  2K5H A;  3AYH B;  4GLA C;  4LF9 L;  4AYB G;  3PF5 A;  2CWA A;  4BY7 G;  1E24 A;  2K4K A;  3T1Y L;  1VQO A;  4TQU S;  1Y1W G;  4A3B G;  3CW2 C;  3E9H A;  3S17 H;  4DR3 Q;  2VNU D;  2CQO A;  4BBR H;  4JI6 L;  1WJJ A;  4DR5 L;  1DGS A;  1KC8 C;  2NZO A;  3LGJ A;  3VDY A;  1LYL A;  1OXX K;  4JBW A;  4LFB L;  1CSQ A;  4X65 L;  3L0O A;  1PH2 A;  3PO3 H;  4UP9 A;  2JA5 H;  1Q1E A;  1QVC A;  4A93 G;  3PSI A;  4FDB A;  1TWH H;  1I94 Q;  1LTL A;  4OON A;  1X6O A;  1Q46 A;  3DLL A;  3FHW A;  2E2I H;  5M3F H;  2WAQ E;  1YZ6 A;  4JI6 Q;  1XNR Q;  4MTN A;  1L2F A;  1N36 L;  1RIP A;  5M3M G;  4A3D G;  5M5Y H;  1VQE A;  4X66 L;  4JOI C;  2NVT H;  1VQA A;  3TEH B;  2JA7 H;  1BBU A;  1WYD A;  4DPG A;  4X65 Q;  4GOP B;  1FVI A;  4OWX B;  4OWT B;  2EXD A;  4OO1 I;  4BXX G;  1Y14 B;  2PNH A;  4X64 Q;  2R7Z H;  1SN8 A;  3J81 c;  1XPO A;  2OTL A;  1KHI A;  1WCM G;  3E0E A;  1D7Q A;  2XGT A;  1ASZ A;  1OXV A;  1XMQ Q;  2VUM H;  4B3R L;  4A4I A;  2GN5 A;  2XTI A;  3AFP A;  5GRO A;  4DV3 L;  4A3K H;  4K0K L;  5JJK A;  2ZJP A;  2JA6 H;  3I56 A;  3STB D;  3K7A H;  5IP7 H;  3S14 H;  1PH5 A;  3CC2 A;  1PHJ A;  2N8N A;  3NEM A;  3HOU H;  4B3R Q;  2I5H A;  4IFD J;  4YCW A;  1IBM Q;  4UP8 A;  3UDX A;  4QIW E;  2WFW A;  3S1R H;  3H0G G;  4L5T A;  3RZO H;  3ZJY C;  4IOC A;  5FJ8 H;  1K83 H;  4QGU A;  3BZK A;  4DV1 L;  4JI2 L;  4L5S A;  4PZ8 A;  4EX5 A;  4JI0 L;  4NXM Q;  3S24 A;  4GNX C;  5C4X H;  1HR0 W;  3RLO A;  3I4N H;  1V1Q A;  4A3L G;  3H3V I;  2NZH A;  1L1O C;  2MO1 A;  2VY3 A;  3S1M H;  4DV0 Q;  3GTK H;  4IPD A;  1YJW A;  1K73 C;  1PH7 A;  3CQZ H;  4B3T Q;  4JI2 Q;  4PZ6 A;  2WB1 E;  4X62 L;  4A3M H;  1YHQ A;  3W1B A;  4JI0 Q;  1FGU A;  3CXC A;  2PMZ E;  4A76 A;  1UEB A;  2UUB Q;  1QUQ B;  3T1H L;  2Z6K A;  4GKK Q;  4DUY L;  1HJP A;  2UU9 Q;  1EIY B;  2Q2T A;  1KL9 A;  2N78 A;  2JQO A;  2RF4 A;  1XNQ Q;  5DLQ E;  3CCU A;  1C9O A;  1VQG A;  1V9P A;  1V43 A;  3D0F A;  3F1Z A;  1TWA H;  3NBH B;  4IPG A;  3PUX A;  3UDF A;  1FL0 A;  4HJ7 A;  3U58 A;  3RZD H;  4XIG S;  1EYG A;  4DV2 Q;  4YWM A;  1HR0 Q;  3TRZ A;  5HGQ A;  2PQA B;  3S2D H;  1XPU A;  3I4M H;  3PUY A;  1VQN A;  4NXN L;  3RN2 A;  1P8L A;  3HOY G;  4JI4 Q;  2JE6 I;  3ULJ A;  4HJ8 A;  2JA8 G;  4MZ9 A;  2ID0 A;  4GNX B;  2MNA A;  1AE2 A;  3CD6 A;  5C3E H;  5ELN A;  1PH1 A;  5FLM H;  2AKW B;  3W1G A;  3JAM i;  2K14 A;  1OXT A;  3RLF A;  4DR1 Q;  3ER0 A;  3FKI G;  2IX0 A;  1YI2 A;  1VQ9 A;  2CFM A;  2Q2U A;  3KOJ A;  3M9B A;  2R93 H;  3HOZ H;  3HOW G;  1XPR A;  1NTG A;  4HJ9 A;  4LFA L;  2MQH A;  1KIX A;  1Q1B A;  4LF7 L;  1YEZ A;  2E8G A;  1VQ6 A;  2YU9 H;  2F4V L;  4JI5 Q;  2YV5 A;  4DK6 C;  4DR4 L;  3KJP A;  4C3I H;  2ZM6 L;  1XJV A;  3M7N A;  4A75 A;  1TXY A;  3KFU A;  3G71 A;  4GOP A;  2KCM A;  3CPW A;  4P72 A;  1L0W A;  4B3M L;  1X55 A;  2LXK A;  1YIT A;  1Q81 C;  4LF7 Q;  2GVB A;  2AWO A;  2UUA Q;  5IYC G;  2F4V Q;  1HNW Q;  1SLJ A;  3ERS X;  5IP9 H;  4DUZ L;  4HID A;  1EOV A;  1CKM A;  4DR4 Q;  2IHE A;  5IYB H;  1E1T A;  2ZM6 Q;  3I7F A;  3KDF B;  4YCU A;  4DR2 Q;  3AFQ A;  3RN5 A;  2JEB I;  4YY3 Q;  1E1O A;  4B3M Q;  5LMU L;  4DV4 Q;  1VQP A;  1SFO H;  4LF8 L;  5LMN Q;  4OX9 Q;  2PI2 A;  4IFD G;  2VQE L;  4LF4 Q;  4A3C G;  5GAE C;  2I0Q A;  1EWI A;  3AEV A;  3CCQ A;  4DUZ Q;  2A19 A;  1X56 A;  3CC7 A;  3CF5 A;  2ES2 A;  5JJL A;  2DUD A;  1VCI A;  3ULL A;  3HOX H;  2IX1 A;  4LW1 A;  1YJ9 A;  2ZTD A;  3PIP A;  4KHP Q;  2OTJ A;  4LF8 Q;  3WWV A;  3CCJ A;  2KBN A;  4R4O A;  2AHO B;  5AJ3 L;  1AH9 A;  2NN6 I;  2Q2I A;  3A0J A;  4LF9 Q;  2R92 H;  2L15 A;  1PH6 A;  2Q2H A;  3T1Y Q;  1SMX A;  1YJN A;  1BBW A;  4BA2 I;  4ME3 A;  2D0P A;  4BY7 H;  3GDE A;  4JG2 A;  1EIF A;  2JA5 G;  2A8V A;  5IT9 c;  3KF6 B;  4PG3 A;  4DR5 Q;  1B70 B;  4AH6 A;  1X65 A;  3K8A A;  4LNQ A;  3J80 c;  4A3B H;  4LFB Q;  1D8L A;  4A3E G;  1QVF A;  1SRO A;  3G48 A;  1J5E L;  1Y1V G;  3BU2 A;  1WOC A;  1QUQ A;  3S1Q H;  3J7A 5;  1GO3 E;  2ZTE A;  3J80 i;  4A93 H;  1N36 Q;  1IBK L;  2R7Z G;  2YTY A;  4X66 Q;  3MEF A;  1CUK A;  3TRE A;  4C3J H;  3TS0 A;  3KF8 B;  4AIM A;  1QVG A;  4GN5 A;  2ASB A;  3KYH C;  4P71 A;  1JMC A;  4IFD I;  5M3M H;  3H3V H;  2LXJ A;  3J81 i;  4QQB X;  5J3B A;  2UXD L;  2R7D A;  4KHZ A;  3S2H H;  4BBS H;  3PO2 H;  3KLW A;  5IP7 G;  4BXX H;  1YBY A;  5K36 G;  1YHA A;  1I3Q H;  2K50 A;  4DV3 Q;  4K0K Q;  2F3I A;  1WCM H;  1S72 A;  4A3J H;  1CSP A;  1J6Q A;  2B29 A;  2VZA A;  2FXQ A;  2UXD Q;  3M4Q A;  1HNX L;  4R4Q A;  4R1J A;  3GTP H;  2HQL A;  4B3S L;  2OQ0 A;  1MIU A;  3TQY A;  5IY0 A;  3MXN B;  2B3G A;  2YYZ A;  5M5X H;  3PUZ A;  3G6E A;  1Q12 A;  2WP8 J;  1PH3 A;  5BR8 L;  4GKJ L;  4HJ5 A;  3ULP A;  1UE1 A;  2UUC L;  4RG1 A;  4DV6 L;  4DR7 L;  4B3S Q;  1VQM A;  1T9H A;  3PCO B;  1KRT A;  5FLX c;  1RL2 A;  4DV1 Q;  4A3I G;  2IY5 B;  4JV5 L;  3H0G H;  2A1A A;  4JI1 L;  5C0X G;  1NMF A;  3PUW A;  2K5V A;  1ASY A;  2HHH L;  2OWO A;  1QZH A;  4GKJ Q;  2JEA I;  2CWP A;  4A3M G;  1TWC H;  5IYD G;  4TVA B;  1NY4 A;  2KCT A;  4YHH L;  1OXU A;  2D0O A;  4DR7 Q;  3NEL A;  1X9N A;  4HJA A;  4C3H H;  4A3L H;  1X3E A;  4X62 Q;  1TWG H;  4LUZ A;  3PUV A;  2YTX A;  2ZJR A;  3M85 A;  3B6Y A;  1IBL L;  4YCV A;  2WAQ G;  3CCS A;  2AMC B;  3JC6 6;  1CKO A;  5GAD C;  4DUY Q;  2D62 A;  4IPC A;  1Q86 C;  1PVO A;  2K5N A;  4YHH Q;  1UE5 A;  3K0X A;  4AYB E;  4JYA L;  4IPH A;  5GAH C;  4JI3 L;  4A3F G;  4BY1 G;  1K0R A;  4DNI A;  1EQR A;  2YTV A;  1N33 L;  3CC4 A;  3I4M G;  3M4O H;  2N49 A;  1VQ5 A;  5ELO A;  1I50 H;  2R7F A;  2QGQ A;  4A3G G;  1L1O B;  4JV5 Q;  1LUZ A;  2BA1 A;  3HKS A;  4NXN Q;  3F2D A;  4JYA Q;  5C44 G;  1PFS A;  3UDG A;  1SE8 A;  3F2C A;  1N33 Q;  4LFC L;  1OXS C;  3CCR A;  5LMN W;  3OW2 A;  1E22 A;  4JBJ A;  3HOY H;  1VS0 A;  2B63 G;  3KF6 A;  1NJI C;  2Z6K C;  2JA8 H;  2EQS A;  1N8R C;  3HOV G;  1E7Z A;  1JJC B;  3RNU A;  1MJE A;  5H1S E;  1QZG A;  4LFA Q;  1VQD A;  3FKI H;  1BVS A;  4DKA C;  3PF4 A;  2HT1 A;  2KHJ A;  2EIF A;  5M5W H;  3J81 j;  4XTC S;  3SGI A;  2C35 B;  4R4T A;  5C0X J;  4AQY L;  1S40 A;  1Z47 A;  4JBM A;  1HZA A;  3HOW H;  3ICE A;  2AWN A;  3G4S A;  2KHI A;  3E9I A;  1JE5 A;  1B7Y B;  5IP9 G;  4HIM A;  1PV4 A;  1PYS B;  1FJG L;  2F52 A;  4LF6 L;  2E2J H;  4R4I A;  2DGY A;  4YWK A;  4JBK A;  4HIK A;  1K9M C;  4QJF A;  4GN4 B;  1IL2 A;  2RCN A;  4WJ4 A;  4JI8 L;  4JI7 L;  2K75 A;  4YWL A;  2WB1 G;  1K8A C;  3CCV A;  1PA6 A;  5IYC H;  1M1K C;  4LF5 L;  4LUV A;  4OO1 G;  5LMU Q;  1A63 A;  3PGZ A;  2H5X A;  1FJG Q;  1YNX A;  4C2M H;  3I55 A;  1K3R A;  2GVA A;  1B8A A;  2I5L X;  2Y0S E;  2VQE Q;  1NE3 A;  1AE3 A;  2K52 A;  4JOI A;  1UWV A;  1VQH A;  4PMW A;  4BBR G;  4DV5 L;  1HZB A;  2BH8 A;  2KEN A;  4DV7 L;  3GTG H;  4GOP C;  1VQ8 A;  2OCE A;  4R4C A;  4DR3 L;  1VQC A;  1G29 1;  1MKH A;  1EUJ A;  1X54 A;  1O7I A;  1CKN B;  5AJ3 Q;  2Z0S A;  1R9T H;  1Y1W H;  2VS1 A;  5M3F G;  4Y52 H;  4DV5 Q;  4IJH A;  2UXC L;  4BA1 I;  4P74 A;  1I94 L;  4EQ5 A;  4DV7 Q;  5JEA G;  2JA7 G;  1MJC A;  5E7N A;  4KLK A;  1XNR L;  1N34 L;  1VQ7 A;  1IZ6 A;  2HIV A;  2R6G A;  3EN2 A;  4OXP A;  4DR6 L;  3K80 C;  3CMA A;  2UXC Q;  3A5U A;  2VUM G;  1J5E Q;  3PIO A;  4P73 A;  4A3D H;  4X64 L;  1S3O A;  1VQJ A;  4A3K G;  1SRU A;  4UPA A;  3A5Z B;  5JJI A;  1N34 Q;  4DAY B;  4A3E H;  2PQA A;  4QL5 A;  3GTQ H;  2JA6 G;  4JCV E;  1XMQ L;  2ATW A;  1XTD A;  3M3Y H;  3A74 A;  1Y1V H;  1IBK Q; 
#chains in the Genus database with same CATH topology
 1DM0 B;  1EY8 A;  3CP0 A;  3L2P A;  1YVC A;  1QNK A;  3CCE A;  2F0F A;  4FF2 A;  4J1M A;  4A3J G;  4LUO A;  2NUC A;  3TS2 A;  1BR9 A;  5E3F A;  1JJG A;  5FJ8 G;  1YIJ A;  1JOR A;  1E2V A;  3UE0 A;  4Q0F A;  1ZYR C;  5ELC A;  4O2D A;  3CKI B;  1JIC A;  3GTO H;  1KRS A;  2MO0 A;  3GO5 A;  1BQQ T;  5BR8 Q;  3GV6 A;  2V1C C;  4K6D A;  3JAM E;  3HOX B;  1JT8 A;  4NDX A;  1QOH A;  4F8M A;  1A62 A;  1EY9 A;  1XTC D;  5JEA J;  3S1N H;  4LK1 C;  4GLX A;  1TWF H;  3KDF A;  1E3P A;  1TR5 A;  4GN3 B;  3N52 A;  4GLV B;  1KAW A;  3I4O A;  4UP7 A;  3SK6 A;  2UU9 L;  2Q8I B;  4BBS G;  4H44 C;  5G3L F;  5C0X H;  2XRQ D;  4LWC A;  4JK1 C;  2F1M A;  1ICF B;  1SYG A;  2FHT A;  3CAM A;  3SEB A;  3ND8 A;  4JI4 L;  1PH9 A;  4A93 B;  2TMP A;  2EVB A;  1JQY D;  4RAU C;  1Q90 A;  1B3A A;  1HH2 P;  2VL6 A;  1Q82 C;  1W3S A;  3D6W A;  3U9O A;  4XQN A;  3LWE A;  4DR1 L;  5M3M B;  1GUW A;  1D5Z C;  1GVP A;  4DXF A;  3Q8D A;  5C0X I;  4C3I G;  2WAC A;  3H15 A;  2F0S A;  2BH2 A;  5CV9 A;  5BN4 A;  1BKB A;  3CCL A;  4NPS A;  5EKI A;  2NN6 G;  3OTO L;  3K5O A;  4DNT B;  4L8J A;  5IYB G;  4KI0 A;  1PRT F;  3GTJ H;  5M5X B;  4KD3 A;  2UUA L;  3NTI A;  1SYB A;  3MXP A;  4APV A;  3A56 A;  1PH4 A;  4Y7N H;  4DR2 L;  4F88 A;  2XSC A;  3J81 L;  3QOL A;  2VW9 A;  4LF4 L;  3H0G B;  4RGM A;  4HSV A;  2UXB Q;  1PFB A;  5DM6 3;  3DWP A;  3A54 A;  2JP1 A;  1W2B A;  4XDX A;  3NWT A;  4JI8 Q;  3IRB A;  3W5O A;  4FF3 A;  4KHP L;  2DY8 A;  3FP9 A;  3K7U C;  1TWG B;  4GLA C;  2RBM A;  4C1N I;  3PF5 A;  1XWE A;  2K4K A;  4TQU S;  1Y1W G;  2L5T A;  2CQO A;  1PRT B;  4JI6 L;  1DGS A;  1NUC A;  1LYL A;  1I50 B;  4JBW A;  2SEB D;  4LFB L;  4X3S A;  1PH2 A;  4UP9 A;  3NBI A;  1Q1E A;  1QVC A;  3PSI A;  2JYO A;  1V8Q A;  1LTL A;  1X6O A;  3Q6S A;  4C3J G;  3QJY A;  5C4Z A;  3FHW A;  2HCI A;  2E2I H;  2WAQ E;  3NXW A;  5I9P A;  3BS1 A;  5KNC A;  1N36 L;  1RIP A;  4A3D G;  1NNX A;  2DY7 A;  2NVT H;  1KNA A;  2NB0 A;  1VQA A;  4JOI C;  2RDH A;  3WOE A;  4GOP B;  1ZYR D;  4BXX G;  2OTL A;  1GUN A;  3H94 A;  1HUM A;  2GA4 B;  4UAI A;  1SYF A;  2VUM H;  4A4I A;  3MVV A;  5M5W B;  2XTI A;  3AFP A;  3ERO A;  4A3K H;  4K0K L;  3PO3 B;  4R8I A;  2L0C A;  3K5N A;  1ONL A;  3A8J E;  5IGF A;  5IP7 H;  3CC2 A;  3TZD A;  2N8N A;  3WOF A;  4B3R Q;  1S4Z A;  4ME5 A;  1STH A;  4QIW E;  2WFW A;  1HTP A;  4IOC A;  5FJ8 H;  2EYM A;  4N9P A;  3D4W A;  2K28 A;  4JI2 L;  4L5S A;  4PZ8 A;  3LNN A;  4CDC C;  1V1Q A;  4C3H G;  4A3L G;  1Y69 U;  2NZH A;  1L1O C;  4XT3 B;  3R2T A;  4B9W A;  1YHQ A;  4A3M H;  1LT6 D;  4HR7 B;  4H7B A;  1IKL A;  2N55 A;  1QUQ B;  4GKK Q;  3QO2 A;  2QIL A;  4DUY L;  2IPK D;  2Q2T A;  1SDF A;  2RF4 A;  2F0K A;  5DLQ E;  1GUS A;  3CCU A;  2VB3 X;  3F1Z A;  3D0F A;  1EU4 A;  4BBS H;  3RZD H;  3PUX A;  4QUF A;  3TRZ A;  2PQA B;  4NXN L;  3HOY G;  2JE6 I;  3ULJ A;  4HJ8 A;  2ID0 A;  5CV4 A;  2MNA A;  1AE2 A;  2AKW B;  4IAL A;  1OXT A;  3J7A F;  5CMD A;  3ER0 A;  1IW7 C;  2IX0 A;  3FKI G;  1ENF A;  2A68 C;  2Q2U A;  4CJ2 C;  2WIN B;  4V19 0;  4CHT B;  1CA6 A;  1EWH A;  1XPR A;  5KRU A;  3MXU A;  4Z9C B;  3CRK C;  2YU9 H;  4JI5 Q;  2K5Q A;  2YV5 A;  3KJP A;  4C3I H;  3M7N A;  4FXD A;  4DK1 A;  2EYP A;  3KFU A;  3G71 A;  4GOP A;  3E6Z X;  2LS0 1;  3M7G A;  1Q81 C;  3Q23 A;  4ULL A;  4LF7 Q;  2GVB A;  5IYC G;  3ERS X;  4K5X A;  4DUZ L;  3S16 B;  4WJW A;  3VR2 A;  5IYB H;  1TII D;  1E1T A;  3LX0 A;  2ZM6 Q;  3RN5 A;  3TP6 A;  2JEB I;  3IAY A;  2X6G A;  4B3M Q;  3FPP A;  1VQP A;  1SFO H;  2F0N A;  4JW0 A;  3URY A;  2BOS A;  2EYJ A;  4X3T A;  1IHZ A;  2DUD A;  3ULL A;  1FR3 A;  3WWV A;  2KBN A;  1RF2 D;  1AH9 A;  2NN6 I;  2Q2I A;  4LF9 Q;  1K3B C;  1WTW A;  1MBY A;  1YJN A;  2E76 C;  4RCN A;  4HMJ A;  4BA2 I;  4ME3 A;  4UHV A;  3VA7 A;  1DZ1 A;  5FO8 B;  4PG3 A;  5C4J B;  4AH6 A;  3K8A A;  4LNQ A;  3G48 A;  1SJE D;  3H6M A;  1Y1V G;  2EOT A;  2B8G A;  1QUQ A;  2F0W A;  4A3G B;  3S1Q H;  3J7A 5;  1GO3 E;  2ZTE A;  2R7Z G;  5HGT A;  5C44 B;  4C3J H;  1QVG A;  4P71 A;  4PMC A;  2F0U A;  1SE4 A;  2CHB D;  2NVY B;  2B63 B;  2ZXR A;  4K8J A;  4QF4 A;  3KLW A;  4BXX H;  5K36 G;  1MHW C;  5C4H A;  4DV3 Q;  1S72 A;  1J6Q A;  1QIL A;  3HS0 C;  5EPJ A;  3M4Q A;  3OWE B;  4FO2 A;  2AQ1 B;  3Q24 A;  2Q8R E;  3TQY A;  3MXN B;  2K5D A;  3G6E A;  2E2H B;  4RWS C;  5I9O A;  5BR8 L;  4GKJ L;  1WD0 A;  4I7A A;  4KJO A;  3SE0 A;  4TSS A;  2JSO A;  2L4N A;  1SXT A;  4C56 C;  5FLX c;  1RL2 A;  1EIH A;  5JVG 3;  1QE6 A;  4RGN A;  3K5L A;  1PTO C;  4XT1 B;  3NQT A;  2O2L D;  3S17 B;  4YHH L;  2K7V A;  1OXU A;  1TVX A;  4DR7 Q;  4BBR B;  3KLR A;  4C3H H;  4A3L H;  4K5V A;  3NTH A;  4LUZ A;  1IW7 D;  3PUV A;  1BUV T;  2A68 D;  1HQM C;  3SDZ A;  1AN8 A;  2K5N A;  1UE5 A;  1NCV A;  3IFD A;  4IPH A;  5M5Y B;  1EQR A;  3E5S A;  4K5W A;  2JA7 B;  3HZX A;  2QW7 A;  2R7F A;  4JV5 Q;  3V96 A;  2BA1 A;  3HKS A;  3R2I A;  5KIX A;  3F2D A;  1LTT D;  1PFS A;  2FMC A;  1N33 Q;  3SXH A;  1E22 A;  1STG A;  3HOY H;  1NJI C;  1O80 A;  5CC4 A;  3S14 B;  2OEO A;  3NTK A;  1HHV A;  3BYY B;  2EYO A;  1E7Z A;  4DFA A;  1MJE A;  4ZCK A;  2EJM A;  2K6A A;  3FKI H;  3K58 A;  1LTA D;  4XTC S;  1S40 A;  2Z4H A;  5C0X J;  4JBM A;  3S1R B;  1GHJ A;  3FVQ A;  1B7Y B;  5A2Q L;  3GV3 A;  4HIM A;  2F52 A;  1B4O A;  1QNU A;  2DGY A;  5C4X B;  1IL2 A;  2RCN A;  4KN4 C;  4JI8 L;  3S1M B;  3QR8 A;  1K8A C;  1PA6 A;  1S5D D;  5IYC H;  3BDL A;  5LMU Q;  1KDB A;  1YNX A;  3K6O A;  1HPC A;  2Y0S B;  4C2M H;  3I55 A;  2VQE Q;  1BNZ A;  1LTR D;  3D8G A;  1BDO A;  4KKS A;  1HZB A;  2BH8 A;  3K59 A;  1MGS A;  4MTK A;  3VYS A;  1MKH A;  1X54 A;  3I91 A;  1M8A A;  4IUQ A;  4B08 A;  4K2K A;  3GP7 A;  5M3F G;  3D3R A;  2UXC L;  5FK9 C;  5COR A;  4BA1 I;  1HFN A;  4DV7 Q;  1MJC A;  4O42 A;  4HAE A;  1N34 L;  1IZ6 A;  1QG7 A;  4OXP A;  4DR6 L;  4KHV A;  4KMU C;  3CMA A;  3A5U A;  1OO9 B;  4S3S A;  1S3O A;  3A5Z B;  3HOZ B;  5IOD A;  1JWU D;  2ATW A;  1XTD A;  3A74 A;  1Y1V H;  1IBK Q;  3AQQ A;  1JJ2 A;  2NVQ H;  3HOU G;  1KAB A;  2MGS A;  3GTL H;  4GNX A;  4L5Q A;  1YHB A;  2MP1 A;  2B2U C;  1MSG A;  1VMP A;  2ZXP A;  3MC0 B;  2F0V A;  3VA5 A;  5T1G A;  1PTO D;  3S15 H;  4WJ3 M;  2E5L Q;  1EFW A;  1EQQ A;  4MIU A;  4OGQ C;  4MN3 A;  3FMC A;  3EBE A;  5K36 H;  4POG A;  1K8O A;  5C5L A;  1KTK A;  1KXL A;  2FJ2 A;  3I4N G;  2VQF L;  4HN7 A;  2N3S A;  1PYB A;  1H95 A;  1N9W A;  5IGC A;  5JVH 3;  4K8I A;  2EY2 A;  1VF5 C;  1GUT A;  2UUC Q;  1G6P A;  1SR3 A;  2KEE A;  5IWA Q;  1VQB A;  3HKZ B;  1I6H H;  4GS3 A;  3TME A;  4IOA A;  3G6J B;  1ML0 D;  4GKK L;  2HUG A;  3A7L A;  4NMZ A;  5ELF A;  2RHS B;  2OQK A;  4N9T A;  4AYB B;  1SJH D;  3TP8 A;  5L37 A;  5CV5 A;  1HZ9 A;  2PPB C;  2KUM A;  2QA4 A;  1Q8K A;  4P75 A;  1LLR D;  3EQL C;  1RKN A;  1WI5 A;  4U68 A;  3L7Z C;  5FLM G;  1CT1 D;  5CV8 A;  2L11 A;  3I4L A;  4JI3 Q;  3RLN A;  1LT3 D;  3KBX A;  1U5K A;  2PCF B;  3JAM c;  1PH8 A;  2ZJQ A;  4IUV A;  1A3U A;  1I4G A;  4CKB A;  5KNB A;  1T5X D;  3S2H B;  3PO2 B;  1IYV A;  2JA9 A;  2M2L A;  4UDU C;  1I3Q B;  4QMG A;  3BZD B;  4RKB A;  3MHB A;  2K05 A;  4JI5 L;  1MI2 A;  2DJG C;  4L6T B;  1GD7 A;  2NVX H;  1N32 L;  3D6C A;  5HY6 A;  3GTP B;  1UE6 A;  2FMM A;  3KF8 A;  3I8Z A;  4QY7 A;  1SNP A;  2CCZ A;  3PO3 G;  2IHF A;  1VQ4 A;  4QB4 A;  1J8I A;  4ZYS A;  1PXU A;  3U4V A;  1G6Z A;  2DJF C;  2QEX A;  4IJL A;  3SK5 A;  1Q7Y C;  3HFZ B;  3E0J A;  4I65 A;  3SHL A;  2XVS A;  2ZT9 C;  1XMO Q;  1L0X B;  3X3N A;  1LAC A;  3GTM H;  4A3C H;  3OYY A;  2R92 G;  1CHQ D;  1K8G A;  1HNZ Q;  1HZC A;  3TP7 A;  1CQF A;  4IUU A;  2M9V A;  2G5D A;  2K5H A;  4LF9 L;  4BY7 G;  2CWA A;  2EPB A;  4HCS A;  4A3B G;  3CW2 C;  3PQI A;  3OHX C;  3V2T A;  4CDF C;  1FNW A;  2H4O A;  4R8N A;  1WJJ A;  2NZO A;  3M4O B;  1HA6 A;  1DOK A;  5M9O A;  1CSQ A;  4X65 L;  2JA5 H;  1I94 Q;  1TWH H;  5I6Y A;  1ENA A;  3DLL A;  5M3F H;  5C6A A;  3I70 A;  4MTN A;  1L2F A;  4ZUI A;  2CH4 W;  1JWS D;  3TEH B;  1PZI D;  1WYD A;  4DPG A;  4DN4 M;  1FVI A;  4OWX B;  2D9U A;  2EXD A;  4OWT B;  1QWY A;  4K14 A;  1KHI A;  1WCM G;  3OOC A;  1ASZ A;  2R61 A;  3BVG A;  5GRO A;  2H1E A;  4DV3 L;  3QWN A;  1J9O A;  1Y8P B;  2XNA C;  3HOU H;  3NEM A;  1E0B A;  2AQ3 B;  1LTI D;  3QOJ A;  2P5Z X;  1SNO A;  1EY0 A;  3RZO H;  1F2L A;  1K83 H;  4QGU A;  2FFK B;  1D2B A;  1NR2 A;  3S24 A;  4CGY B;  3I4N H;  2QDB A;  1RTN A;  5EGT A;  2EJF C;  3H3V I;  2B2V A;  1L0Y B;  5ELE A;  2HD3 A;  1YJW A;  1PH7 A;  5A35 A;  1PFN A;  4B3T Q;  5KGU A;  4JI0 Q;  3W1B A;  2PMZ E;  2L12 A;  1HJP A;  1KL9 A;  2N78 A;  2B2Y A;  1XNQ Q;  1CQV A;  1C9O A;  1V43 A;  3ONA B;  3UDF A;  1TWA H;  1D6E C;  1FL0 A;  3TBI B;  4P2C B;  1FYC A;  1RJT A;  1XPU A;  3I4M H;  1VQN A;  3WDN A;  2F0J A;  4A3E B;  2JA8 G;  3M3Y B;  1ZKO A;  2B39 A;  3CD6 A;  2A69 C;  1PH1 A;  1A15 A;  3V05 A;  2RDF A;  5FLM H;  4DF7 A;  3A55 A;  2PQE A;  5EPK A;  3RLF A;  4NP5 A;  1YI2 A;  1VQ9 A;  3FEW X;  1SE2 A;  3KOJ A;  3AB9 A;  3HOW G;  1BOS A;  2IL8 A;  3W2D A;  2MQH A;  1Q1B A;  2E8G A;  1I4P A;  2A74 C;  1BCP C;  3DWA A;  1EY4 A;  5J22 A;  1XJV A;  1TU2 B;  2KCM A;  3CPW A;  4P72 A;  1L0W A;  2C5C A;  1DCZ A;  2LXK A;  3IKJ A;  5IT9 E;  1YIT A;  3GTO B;  3VYT A;  3J80 E;  1HNW Q;  2F4V Q;  5JPN C;  2O5I C;  5IP9 H;  4DR4 Q;  2IHE A;  4YCU A;  2PNR C;  3S1N B;  4YY3 Q;  1E1O A;  1R4P B;  1TWF B;  3DHQ A;  5LMU L;  2QKI C;  5LMN Q;  4DV4 Q;  4OX9 Q;  2VQE L;  1VF7 A;  3NQI A;  5GAE C;  1U9R A;  1TS3 A;  2A19 A;  1Q3L A;  3CC7 A;  2ES2 A;  1CZW A;  4L63 B;  4LW1 A;  1O7L A;  2ZTD A;  3PIP A;  4LF8 Q;  2MJ8 A;  4MHE A;  1QCB D;  2QEJ C;  2IJ0 A;  4DAP A;  5J39 A;  3A0J A;  3VR6 A;  2R92 H;  1ILP A;  1BF4 A;  2L15 A;  2Q2H A;  3T1Y Q;  1BBW A;  4DK0 A;  4BY7 H;  3GDE A;  2A8V A;  3KF6 B;  2A6H C;  4DR5 Q;  5FLX L;  4HMI A;  4A3B H;  2SNM A;  1SRO A;  3MXG A;  2PW7 A;  2F0G A;  5EKL A;  1DON A;  3BU2 A;  1CTM A;  5C3X A;  4ZQ3 A;  3NP8 A;  1C48 A;  1K28 A;  1Z7T A;  1IBK L;  1W6K A;  4X66 Q;  1CUK A;  1PTO H;  1STA A;  2KCC A;  4IUR A;  4IFD I;  1JR0 D;  2LXJ A;  3J81 i;  3H91 A;  2Z1C A;  4QQB X;  2UXD L;  1B50 A;  3GTJ B;  1A3V A;  1YBY A;  1YHA A;  4ZKB B;  2J7Z A;  3KUP A;  2F3I A;  1WCM H;  4LMQ D;  4Y7N B;  4TRD A;  4A3J H;  2OF1 A;  2FIN B;  1CZG A;  1TKW B;  1G91 A;  4U67 3;  2OQ0 A;  2MHV A;  5IY0 A;  4J6H A;  2WP8 J;  2PZW A;  3PIO 3;  2RQX A;  3RD4 A;  3ULP A;  1UE1 A;  2UUC L;  4O1N A;  1VMC A;  4B3S Q;  3M3Y H;  1T9H A;  3PCO B;  1KRT A;  1TS5 A;  4DV1 Q;  4A3I G;  2IY5 B;  2WB1 B;  2G9D A;  2JEA I;  2CWP A;  1TWC H;  1EEI D;  5IYD G;  2KCT A;  3H3V C;  3A8I E;  4DAV A;  2HDL A;  4RH6 A;  2A69 D;  4K2L A;  5EKK A;  4HJA A;  2RSO A;  2ZJR A;  3T1H Q;  2WAQ G;  1CKO A;  1PVO A;  3EJI A;  3R8B A;  1B9N A;  4AYB E;  5DNF A;  1NAP A;  2E2I B;  4RCO A;  4A3F G;  4JI3 L;  1E2Z A;  4BY1 G;  1BCP D;  4DNI A;  3FRP B;  3CC4 A;  2QGQ A;  1LUZ A;  2L1B A;  4JYA Q;  5C5M A;  5KYL A;  1GJX A;  2VUM B;  5FO7 B;  1SE8 A;  3UDG A;  3F2C A;  2F0D A;  3OW2 A;  4A3K B;  2F0M A;  1EU3 A;  4JBJ A;  1VS0 A;  3KF6 A;  4IQZ A;  4FXG C;  2JA8 H;  1N8R C;  4HTH A;  3HOV G;  1JJC B;  2XIW A;  3T13 A;  3RNU A;  1HUN A;  4LFA Q;  1VQD A;  2NYZ D;  1KNE A;  2NN6 H;  3J81 j;  1RCV D;  1KDA A;  1Z47 A;  3HOW H;  1HZA A;  2K33 A;  3E9I A;  2R3Z A;  1JE5 A;  1Q8I A;  1PV4 A;  1FJG L;  1PRT C;  2E2J H;  3FDT A;  3FPU B;  3BVZ A;  4JBK A;  4HIK A;  3T51 B;  2KEC A;  4YWL A;  2A6H D;  1M1K C;  1H9K A;  5D14 A;  2WKD A;  4XQQ A;  4OO1 G;  3PGZ A;  1XX8 A;  4A3M B;  1K3R A;  2GVA A;  3TDQ A;  1NE3 A;  3O13 A;  1XXG A;  3KLS X;  1AZP A;  2KEN A;  3GTG H;  1S5E D;  4GOP C;  2OCE A;  3NK9 A;  3J7A V;  1O7I A;  1CKN B;  1O7Y A;  5AJ3 Q;  2Z0S A;  3OWF A;  1R9T H;  4BBS B;  3RZD B;  1Y1W H;  3Q22 A;  4DV5 Q;  1I94 L;  3BG3 A;  3VR5 A;  5E7N A;  4KLK A;  3ND9 A;  1DOL A;  3PMF A;  2HIV A;  4ZUJ A;  1D1I A;  1H9S B;  2OT2 A;  4HCE A;  1J5E Q;  4DA2 A;  4A3D H;  1VQJ A;  4DAY B;  3GTQ H;  2PQA A;  1A2U A;  2JA6 G;  3P7J A;  3CU7 A;  2YU9 B;  3C1E A;  3H09 A;  2F0L A;  2G9H D;  4C3I B;  3PO2 G;  1V1P B;  3DMU A;  4EVO A;  1P16 A;  1MSH A;  4OWW B;  3HG9 A;  1X3G A;  4KY7 A;  2F0H A;  2CKZ B;  4M8A A;  3JAM L;  3DUZ A;  4FXK C;  5CV6 A;  2Z9H A;  3BZC A;  3K81 C;  1HNX Q;  3UE1 A;  1SFO B;  5IOC A;  1I4R A;  3KLS A;  1ENC A;  1ZXT A;  3F2B A;  4LJZ C;  2ZTC A;  5G3L D;  2C9O A;  2NZ1 D;  1VQL A;  4B3T L;  1VQF A;  2Z6B A;  3CHB D;  4CKC A;  5CR3 A;  4OL7 A;  3IFT A;  1LV9 A;  1TS4 A;  2HHH Q;  2KQ3 A;  3D31 A;  4A3I H;  1OTC A;  1XNQ L;  4RHR A;  3UDI A;  5IYD H;  3HRZ C;  3OPO A;  1WTH A;  1IBL Q;  3TSS A;  5GQO A;  5C3E G;  1H9M A;  3S1Q B;  1T5E A;  1NBW A;  2F3W A;  2JJQ A;  5I4D A;  4HED A;  3J7Z C;  3MA2 B;  4C3J B;  3CCM A;  2R93 G;  1EYA A;  1CKN A;  2HDM A;  3GD7 A;  3NHH A;  4A3F H;  4BY1 H;  2O5J C;  1YNN C;  1WTV A;  3I2Z A;  3M4P A;  5EAY A;  1PRT D;  3U4Z A;  1GM5 A;  4RMF A;  2E74 C;  4LFC Q;  3RUZ A;  2I5M X;  5NUC A;  5GAG C;  1VQI A;  1BO0 A;  4XYO A;  1I5F A;  4O0A A;  3A7A B;  3C46 A;  1U4M A;  3HOV H;  4X6A H;  2JK8 A;  1KD1 C;  4IUT A;  4DAY A;  3ITP A;  1HNW L;  2UXB L;  1JC7 A;  2RHQ B;  3OTO Q;  4J15 A;  1K0S A;  4YY3 L;  1V1P A;  4KTA A;  4DV4 L;  4OX9 L;  5LMN L;  4NKL A;  1U4P A;  1A0I A;  3HOX G;  3PV0 A;  4ZKC B;  1HXY D;  2J4X A;  2LMC B;  1JWM D;  3F8T A;  3MXN A;  4UY8 C;  4JI7 Q;  1S5F D;  2K5W A;  5LL6 S;  4C3H B;  1CA5 A;  1LM0 A;  2QDL A;  2RVL A;  1W6J A;  1AW7 A;  1B3Q A;  1SYC A;  4OO1 H;  3T1Y L;  3P75 A;  1VQO A;  3E9H A;  2NTS A;  3DXJ C;  5COY A;  2L9H A;  4DR5 L;  1KC8 C;  3VDY A;  3LGJ A;  4ID6 A;  3X3M A;  3ZYY X;  4ZK9 B;  4ODG A;  3P1H A;  1AFP A;  4XYQ A;  4KJN A;  4GZY C;  4A93 G;  3VR4 A;  3EA6 A;  4FDB A;  5JAV A;  4OON A;  1PMR A;  1XNR Q;  4JI6 Q;  1YZ6 A;  1RD9 D;  5M3M G;  2Z8L A;  3HOY B;  1VQE A;  4X66 L;  1A6X A;  1E2W A;  1GUG A;  2EYH A;  1Y8N B;  4OO1 I;  1Y14 B;  2PNH A;  4X64 Q;  2R7Z H;  1SN8 A;  3E0E A;  1WVL A;  2XGT A;  3TZU A;  1OXV A;  3FKI B;  3E3X A;  4B3R L;  2GN5 A;  2BE5 C;  2ZJP A;  5CGK A;  1DJR D;  2JA6 H;  1IL8 A;  2AUJ D;  2AQ2 B;  4QUC A;  3K7A H;  2F0I A;  1PHJ A;  5ELB A;  4WOR A;  2I5H A;  4IFD J;  4CBV A;  1IBM Q;  4ILW A;  1HRJ A;  2LFN A;  3UDX A;  4IUN A;  1DD2 A;  4OHJ A;  1B1Z A;  3H0G G;  4L5T A;  3ZJY C;  3R3O A;  4DV1 L;  4I7Z C;  4C2M B;  4WRD A;  4EX5 A;  4NXM Q;  4KN7 C;  4GNX C;  1F77 A;  1GOZ A;  3D4R A;  4RA8 A;  2MO1 A;  4DV0 Q;  3GTK H;  1K73 C;  1F2Z A;  3CQZ H;  1EYD A;  1RDP D;  3T53 B;  3Q0A A;  4JI2 Q;  4PZ6 A;  2WB1 E;  3TP5 A;  1FGU A;  3CXC A;  4A76 A;  1UEB A;  2UUB Q;  1YNN D;  3T1H L;  2Z6K A;  2A6E C;  2EZV A;  3BVM A;  1GHK A;  2SOB A;  1VQG A;  3NBH B;  3NSW A;  4IPG A;  1SE3 A;  1ESR A;  1EYG A;  3U58 A;  3J7Y W;  4KV6 A;  4DV2 Q;  1ZEQ X;  4YWM A;  1HR0 Q;  5HGQ A;  3S2D H;  1PFM A;  3RN2 A;  3MEH A;  1P8L A;  3EVQ A;  4MZ9 A;  1Y1V B;  3BDC A;  2NVQ B;  5C3E H;  5ELN A;  3W1G A;  3GTL B;  1TY0 A;  2CFM A;  3M9B A;  5IGD A;  2R93 H;  1PZK D;  4LFA L;  2IW3 A;  1KIX A;  3S15 B;  4LF7 L;  3C3L A;  2CQA A;  1BCP F;  1VQ6 A;  4IZ8 A;  4KKU A;  2ZM6 L;  4G7O C;  1ROD A;  1SNC A;  3QG1 A;  4B3M L;  1X55 A;  2F3V A;  3VYU A;  1G2T A;  1O7Z A;  2F0T A;  5I2Y A;  2M00 A;  1SLJ A;  2XRS D;  3P20 A;  1CKM A;  2TSS A;  5D65 A;  2EY1 A;  3I7F A;  3KDF B;  3AFQ A;  3K0Y A;  2PI2 A;  4IFD G;  1I6H B;  1D1K A;  1SBB B;  1EWI A;  3AEV A;  4DUZ Q;  1X56 A;  5JJL A;  1Y8O B;  1VCI A;  3HOX H;  1F9R A;  4G7Z C;  4ABN A;  3SK8 A;  3CCJ A;  2AHO B;  3KK7 A;  5AJ3 L;  1STY A;  1PH6 A;  1SYE A;  1UNS A;  5IGE A;  4IN3 A;  2I46 A;  5ISR A;  1S5C D;  5IT9 c;  2BE5 D;  5EBD A;  1B70 B;  3J80 c;  1D8L A;  1QVF A;  3SK4 A;  1J5E L;  2EY5 A;  4JVZ A;  1C4Q A;  4A93 H;  2YTY A;  2ASB A;  2NVX B;  5M3M H;  3H3V H;  1EY6 A;  4KY5 A;  2R7D A;  4EQN A;  3I90 A;  5IP7 G;  1B9M A;  1UUP A;  2K50 A;  3I73 A;  1KAA A;  1PZJ D;  1H9R A;  5CV7 A;  2FXQ A;  5D3D A;  1HNX L;  1HFG A;  3NUC A;  1LT4 D;  4H13 C;  4KD4 A;  2PYK A;  2B2W A;  1MIU A;  2K01 A;  5M5X H;  2A6E D;  1PH3 A;  4CJ0 B;  3GTM B;  2X6L A;  4HJ5 A;  1F2Y A;  4RG1 A;  4OIK A;  1RHP A;  2D5D A;  2KCN A;  4DR7 L;  2RSN A;  1X3Q A;  2XWJ B;  3OSO A;  4KKT A;  5DEH A;  1CHP D;  4G7H C;  3H0G H;  5HUR A;  1NMF A;  3PUW A;  2K5V A;  1ASY A;  5E4W C;  2HHH L;  1QZH A;  2OWO A;  4GKJ Q;  4A3M G;  3L9A X;  4PNY A;  3A8K E;  1X9N A;  3M4Y A;  5EQ0 A;  1EOT A;  4X62 Q;  1TWG H;  1A3T A;  1X32 A;  1WTX A;  2YTX A;  2JA5 B;  1IBL L;  4YCV A;  1Q86 C;  1U4L A;  1TWH B;  2AMC B;  3JC6 6;  4JV5 L;  4IPC A;  4YHH Q;  3K0X A;  5M3F B;  2F0Q A;  2B2W C;  1WTQ A;  1K0R A;  1C8C A;  1XYI A;  1N33 L;  4B9X A;  2N49 A;  1VQ5 A;  1I50 H;  4A3G G;  1L1O B;  2B2V C;  2O4X A;  3DM1 A;  2SNS A;  1SAP A;  1RTO A;  4BWG B;  5C44 G;  1D5M C;  4LFC L;  1OXS C;  3VYR A;  3CCR A;  2B63 G;  2DNC A;  2IWH A;  3HOU B;  3DEO A;  2KJX A;  2B2Y C;  3NE5 B;  1BBX C;  1QZG A;  4FYD A;  3PF4 A;  2HT1 A;  2KHJ A;  2EIF A;  5M5W H;  1O78 A;  1AZQ A;  3SGI A;  4F87 A;  3MTS A;  3PO3 H;  3ICE A;  2KVM A;  3RZO B;  5FKA C;  1FGB D;  1K83 B;  1PYS B;  2A73 B;  3L3O C;  1NSN S;  1YNJ C;  4R4I A;  2WV6 D;  4YWK A;  1DOM A;  1K9M C;  1EQT A;  3I4N B;  4GN4 B;  5LHY 1;  4XXE A;  4JI7 L;  2K75 A;  2RDG A;  1LTB D;  1GXD C;  5A2Q E;  2V4D A;  1B8A A;  2Y0S E;  2K52 A;  4H0L C;  4JOI A;  1H9J A;  1UWV A;  1EFI D;  1VQH A;  5ELD A;  4BBR G;  4HSP A;  5IGB A;  2NTT A;  4IFD H;  4DV7 L;  3F2U A;  1VQ8 A;  4N8F A;  1VQC A;  1G29 1;  1EUJ A;  5FOB B;  4BS9 A;  1TWA B;  2VS1 A;  4Y52 H;  4IJH A;  3I4M B;  4EQ5 A;  5JEA G;  2JA7 G;  2SDF A;  1XNR L;  1VQ7 A;  3OW7 A;  1DYQ A;  1WTP A;  1KDC A;  3RMH A;  2UXC Q;  1F9S A;  4X64 L;  1CI3 M;  1SRU A;  4UPA A;  1WTR A;  2BCO A;  1MD2 D;  1N34 Q;  1STN A;  1STE A;  4JCV E;  3EFX D;  1XPO A;  2OXP A;  1EY7 A;  2IX3 A;  1JOO A;  4DR6 Q;  4CJ1 B;  1ET6 A;  5D3I B;  2E5L L;  3SVM A;  2IT1 A;  4PMB A;  3GQB A;  2PZT A;  2XWB B;  4DGZ A;  1L1O A;  4J8Q A;  1IXR A;  3IL8 A;  4MNO A;  3C1F A;  1IBM L;  4DK3 C;  1HA5 A;  1X3P A;  3S9W A;  4KY6 A;  2WII B;  1A8V A;  1KQS A;  2PI2 E;  5C4X G;  5IWA L;  4L5R C;  1G2S A;  2X69 A;  4NXM L;  1PTO F;  2MFI A;  3S16 H;  1JOK A;  3K57 A;  1Z9F A;  2Y0S G;  4DV0 L;  4DV6 Q;  4POF A;  4TKO B;  1JCK B;  1I4H A;  4CKE A;  3STB C;  4PV1 C;  4F7X A;  2VQF Q;  3DM3 A;  1C0A A;  2R92 B;  3HKZ E;  4JI1 Q;  1UE7 A;  1VQK A;  2UUB L;  1JB7 A;  5LL6 X;  4RGT A;  2DN8 A;  4BY7 B;  1PDQ A;  1X3F A;  5IE8 A;  1M90 C;  3SR1 A;  1NMG A;  2EYL A;  3CPF A;  2HIX A;  4A3B B;  2NVT B;  4Q5V A;  2K1B A;  1GKH A;  4DV2 L;  1HR0 L;  4JC0 A;  4WFN 3;  1SMY C;  1C7Y A;  5DM7 3;  1IYJ B;  2D2C C;  1HQR D;  2Z4I A;  4ALP A;  3ERQ A;  3U50 C;  5C4J H;  2BA0 A;  1PTO B;  2LSS A;  4KK7 A;  3HOZ G;  3RR5 A;  2JXM B;  4H02 A;  5EJW A;  3I72 A;  1F9Q A;  1YNJ D;  1EWC A;  4A3G H;  1TQO A;  2PZU A;  4EQP A;  1II3 A;  1WCM B;  2AUK A;  4NB3 A;  4PZ7 A;  5C44 H;  4A3J B;  3T4A C;  2ALY B;  5KYI A;  1AP0 A;  2NVY H;  2B63 H;  3T16 A;  1ILQ A;  1WTO A;  2CVR A;  5JJZ A;  1U4R A;  1B53 A;  1WFQ A;  1I6V C;  2EDG A;  4AQY Q;  1LO5 D;  2A5H A;  1XMO L;  1N32 Q;  3BJU A;  4DAM A;  1ESF A;  1HNZ L;  4HIO A;  3CME A;  4LF6 Q;  3R93 A;  4IO9 A;  1EEF D;  1G51 A;  2EY6 A;  4JPB W;  2E2H H;  5IGG A;  1TWC B;  5IIF A;  1SEB D;  3HKZ G;  2CW0 C;  3EIV A;  4LF5 Q;  3HEJ A;  3NEN A;  4DU9 A;  1U0L A;  3KJO A;  3AYH B;  2F0P A;  4AYB G;  1E24 A;  1IKM A;  3MWY W;  4QCL A;  2F4I A;  4ZAI A;  3S17 H;  4DR3 Q;  2VNU D;  1JB3 A;  4BBR H;  2VB2 X;  1FNV A;  1OXX K;  4DXG A;  2E75 C;  3L0O A;  2LY7 A;  2JN4 A;  3CRL C;  4OEL B;  2MUY A;  1Q46 A;  2F0O A;  1K8M A;  2WKC A;  5M5Y H;  2RCF A;  5JEA H;  2JA7 H;  1BBU A;  4X65 Q;  2JA8 B;  2E2D C;  2QCP X;  3PIP 3;  3J81 c;  1D7Q A;  1GUO A;  1EL0 A;  1XMQ Q;  1KLU D;  4V0B A;  5J1Z A;  5BN5 A;  4N8X 1;  5JJK A;  3HOW B;  3I56 A;  1UEA B;  2DNE A;  4ZRZ A;  3STB D;  3S14 H;  1SNQ A;  1PH5 A;  1VDZ A;  5BN3 A;  2E2J B;  4YCW A;  3N6R A;  3AMU A;  1B2T A;  4ZLT F;  5AFW A;  4UP8 A;  3S1R H;  3DEP A;  1FNU A;  3BZK A;  4JI0 L;  3BYT B;  1PYW D;  1CK1 A;  1SMY D;  5C4X H;  1HR0 W;  3RLO A;  3GTG B;  1SNM A;  2VY3 A;  3S1M H;  4IPD A;  2QF7 A;  3KBG A;  1R9T B;  1B44 D;  4X62 L;  1Y1W B;  2PMZ B;  5C3W A;  4RGO S;  2N88 A;  1CFM A;  2UU9 Q;  1EIY B;  5CYU A;  2JQO A;  5K5P A;  1LTG D;  2ENB A;  1V9P A;  4HJ7 A;  4XIG S;  4EQO A;  2PO4 A;  4A3D B;  3PUY A;  2HCC A;  4JI4 Q;  3GTQ B;  1S5B D;  4GNX B;  3JAM i;  2K14 A;  1FD7 D;  4DR1 Q;  1H9S A;  2ZXO A;  2J0T D;  5JOB A;  5E4X A;  3HOZ H;  5IT9 L;  1NTG A;  4HJ9 A;  1NR4 A;  1YEZ A;  3OMG A;  3J80 L;  2F4V L;  1IYU A;  4DK6 C;  4DR4 L;  2PW5 A;  2CW0 D;  3OMC A;  4A75 A;  1TXY A;  4PQX A;  4E6I A;  2AWO A;  2UUA Q;  4HID A;  1EOV A;  5JPM C;  2HQE A;  1STB A;  4DR2 Q;  4RKL A;  1QB5 D;  4LF8 L;  3J81 E;  4FNF A;  4A3C G;  4LF4 Q;  1V1O A;  4OIJ A;  2I0Q A;  4FF1 A;  3CCQ A;  3BDO A;  5I2X A;  3CF5 A;  4A3I B;  3UI2 A;  2IX1 A;  2EXZ A;  1YJ9 A;  2NBF A;  4KHP Q;  2OTJ A;  4R4O A;  2Q8T A;  4YIJ A;  5I6W A;  5DAU A;  2ICE C;  1TY2 A;  2KOL A;  1JOQ A;  3W3A A;  1SMX A;  1F9P A;  1ET9 A;  3DWQ A;  2B2U A;  2D0P A;  3NPP A;  4JG2 A;  1EIF A;  2JA5 G;  2B2T A;  2WAQ B;  4NW2 A;  4FVM A;  1X65 A;  2BDN A;  4X3U A;  4EGV A;  3HGB A;  4LFB Q;  3AU7 A;  4A3E G;  4A3F B;  4BY1 B;  4RHS A;  1CM9 A;  1ICW A;  1QJO A;  4G4K A;  1WOC A;  1R4Q B;  3HP3 A;  2RA4 A;  3U9S A;  3J80 i;  1EY5 A;  1N36 Q;  5FLX E;  3LWU A;  3MEF A;  3TRE A;  3TS0 A;  2L55 A;  1HTL D;  3KF8 B;  4AIM A;  4GN5 A;  1TT2 A;  3KYH C;  1JMC A;  1UAP A;  3D4D A;  5J3B A;  1M4V A;  2XN9 C;  5T1I A;  3QIA A;  3MFY A;  4KHZ A;  3S2H H;  3HOV B;  1G8Z D;  3PO2 H;  3I3C A;  1I3Q H;  4K0K Q;  4X3K A;  1CSP A;  2B29 A;  2VZA A;  4QIW B;  1PLF A;  2UXD Q;  2B2T C;  3OIQ A;  4R4Q A;  4R1J A;  3GTP H;  2HQL A;  4B3S L;  3OIP A;  2B3G A;  2YYZ A;  3PUZ A;  5CBE E;  1Q12 A;  1D5X C;  4CDE C;  5CBA E;  4DV6 L;  2LKV A;  2EE1 A;  4R9W A;  1VQM A;  1HCZ A;  4JI1 L;  2A1A A;  5C0X G;  4CDD C;  4TVA B;  2K04 A;  1NY4 A;  3MFG A;  2D0O A;  3MAQ A;  3NEL A;  2KED A;  1F2M A;  5TSS A;  4FF4 A;  1X3E A;  2MPM A;  1DXM A;  1JE4 A;  3M85 A;  3B6Y A;  5KEE A;  3CCS A;  5GAD C;  3K5M A;  4DUY Q;  2D62 A;  1EZ6 A;  3VR3 A;  4JYA L;  2K32 A;  3G7L A;  5GAH C;  3I4M G;  2YTV A;  3M4O H;  1LT5 D;  5ELO A;  2K03 A;  2R7Z B;  4NXN Q;  4XQJ A;  1EIG A;  2I07 B;  4M1U B;  5LMN W;  4IUP A;  2RKS A;  2VXW A;  1TS2 A;  4OEM B;  2Z6K C;  2JA6 B;  2EQS A;  3K7A B;  1WD1 A;  5KND A;  3C2P A;  5H1S E;  1SSO A;  1BVS A;  4DKA C;  3TN2 A;  1EZ8 A;  4LAA A;  4FP5 D;  2EYF A;  2C35 B;  4R4T A;  5FO9 B;  4AQY L;  4DNR B;  3NWS A;  2AWN A;  3G4S A;  2KHI A;  1LAB A;  5IP9 G;  5EBC A;  1SND A;  2KHS A;  4LF6 L;  4G57 A;  4QJF A;  5E1F A;  1AEX A;  2CH4 A;  4RFB A;  4WJ4 A;  3T56 B;  2EJG C;  2WB1 G;  3GTK B;  3CCV A;  3CQZ B;  4LF5 L;  4LUV A;  1SYD A;  1A63 A;  2H5X A;  1FJG Q;  1BCP B;  1BXT A;  2I5L X;  1AE3 A;  5F2D A;  1I4X A;  4PMW A;  4DV5 L;  1A2T A;  5EPL A;  4DR3 L;  4R4C A;  1EYC A;  1EQV A;  2F0E A;  4K6L A;  3S2D B;  4P74 A;  2F03 A;  2NWG A;  1I4Q A;  1KLG D;  1LTS D;  3MZ5 A;  2ICI A;  2R6G A;  3QB3 A;  5C3E B;  4C1N K;  3EN2 A;  1Z6H A;  3K80 C;  2VUM G;  3PIO A;  2BDO A;  3NBH A;  2KA7 A;  4P73 A;  4A3K G;  2R93 B;  5JJI A;  4A3E H;  4QL5 A;  1XMQ L;  2B8F A; 
#chains in the Genus database with same CATH homology
 3AQQ A;  1JJ2 A;  2NVQ H;  3CP0 A;  2E5L L;  4DR6 Q;  3HOU G;  3L2P A;  2IT1 A;  3GTL H;  4GNX A;  1YVC A;  4L5Q A;  3PO2 G;  1YHB A;  1L1O A;  1IXR A;  3CCE A;  4MNO A;  4A3J G;  4LUO A;  1P16 A;  4OWW B;  3S15 H;  1IBM L;  4DK3 C;  3TS2 A;  2E5L Q;  1X3G A;  1EFW A;  4WJ3 M;  1EQQ A;  2CKZ B;  1JJG A;  5FJ8 G;  1YIJ A;  3UE0 A;  1A8V A;  1KQS A;  3EBE A;  4POG A;  2PI2 E;  3BZC A;  3K81 C;  1HNX Q;  3UE1 A;  4O2D A;  5C4X G;  5IWA L;  1KXL A;  4L5R C;  3I4N G;  2VQF L;  2N3S A;  3GTO H;  4NXM L;  1KRS A;  2MO0 A;  1PYB A;  3GO5 A;  1H95 A;  1N9W A;  2MFI A;  5BR8 Q;  3F2B A;  2V1C C;  3S16 H;  2ZTC A;  1JT8 A;  2UUC Q;  1G6P A;  1Z9F A;  2Y0S G;  1A62 A;  5JEA J;  4DV0 L;  4POF A;  4DV6 Q;  1SR3 A;  3S1N H;  5IWA Q;  3STB C;  2VQF Q;  1VQL A;  4GLX A;  1TWF H;  1VQF A;  4B3T L;  3DM3 A;  3KDF A;  1E3P A;  4GN3 B;  1C0A A;  1VQB A;  3HKZ E;  1I6H H;  4GLV B;  4GS3 A;  4JI1 Q;  1KAW A;  4IOA A;  1UE7 A;  1VQK A;  3I4O A;  2UUB L;  2HHH Q;  1JB7 A;  4UP7 A;  4GKK L;  2UU9 L;  3D31 A;  4A3I H;  2RHS B;  4BBS G;  2OQK A;  1X3F A;  5IE8 A;  1OTC A;  1M90 C;  1HZ9 A;  1NMG A;  1XNQ L;  3CPF A;  2HIX A;  3UDI A;  2QA4 A;  4LWC A;  1Q8K A;  5IYD H;  1GKH A;  4P75 A;  4DV2 L;  1HR0 L;  1IBL Q;  4JC0 A;  1WI5 A;  5GQO A;  3CAM A;  5C3E G;  1C7Y A;  3L7Z C;  5FLM G;  4JI4 L;  1NBW A;  1PH9 A;  1IYJ B;  2JJQ A;  3J7Z C;  4ALP A;  4JI3 Q;  3U50 C;  5C4J H;  2BA0 A;  3RLN A;  3CCM A;  2LSS A;  2R93 G;  1HH2 P;  1Q82 C;  1CKN A;  2VL6 A;  1W3S A;  3RR5 A;  3HOZ G;  3GD7 A;  1U5K A;  3JAM c;  4H02 A;  4DR1 L;  4A3F H;  1PH8 A;  2ZJQ A;  4BY1 H;  1GVP A;  3I2Z A;  3M4P A;  5EAY A;  3U4Z A;  3Q8D A;  5C0X I;  1GM5 A;  4A3G H;  4RMF A;  2JA9 A;  4LFC Q;  3H15 A;  2BH2 A;  2I5M X;  5GAG C;  4NB3 A;  4JI5 L;  1BKB A;  4PZ7 A;  5C44 H;  3CCL A;  1VQI A;  4NPS A;  1I5F A;  1GD7 A;  2NN6 G;  2ALY B;  5HY6 A;  3OTO L;  4O0A A;  2NVX H;  1N32 L;  1UE6 A;  2CCZ A;  2NVY H;  4QY7 A;  2B63 H;  3PO3 G;  2IHF A;  1VQ4 A;  5IYB G;  4KI0 A;  3U4V A;  3HOV H;  2JK8 A;  3GTJ H;  1KD1 C;  4X6A H;  2UUA L;  1HNW L;  2UXB L;  1WFQ A;  4AQY Q;  2QEX A;  4APV A;  3T1H Q;  4IJL A;  1XMO L;  4Y7N H;  4DR2 L;  2RHQ B;  3OTO Q;  4J15 A;  1PH4 A;  1N32 Q;  1Q7Y C;  3BJU A;  4YY3 L;  4DAM A;  3HFZ B;  4DV4 L;  1HNZ L;  4OX9 L;  5LMN L;  2VW9 A;  4HIO A;  4LF4 L;  3CME A;  1A0I A;  3HOX G;  3PV0 A;  4LF6 Q;  2UXB Q;  4IO9 A;  1G51 A;  2E2H H;  1W2B A;  3F8T A;  1XMO Q;  4JI8 Q;  3GTM H;  3IRB A;  4JI7 Q;  4UY8 C;  3OYY A;  3W5O A;  3HKZ G;  4A3C H;  2R92 G;  4KHP L;  1K8G A;  3EIV A;  1HZC A;  3FP9 A;  1HNZ Q;  4LF5 Q;  3K7U C;  1LM0 A;  3NEN A;  1U0L A;  3KJO A;  2K5H A;  3AYH B;  4GLA C;  4LF9 L;  4AYB G;  3PF5 A;  2CWA A;  4BY7 G;  1E24 A;  2K4K A;  3T1Y L;  1VQO A;  4TQU S;  1Y1W G;  4A3B G;  3CW2 C;  3E9H A;  3S17 H;  4DR3 Q;  2VNU D;  2CQO A;  4BBR H;  4JI6 L;  1WJJ A;  4DR5 L;  1DGS A;  1KC8 C;  2NZO A;  3LGJ A;  3VDY A;  1LYL A;  1OXX K;  4JBW A;  4LFB L;  1CSQ A;  4X65 L;  3L0O A;  1PH2 A;  3PO3 H;  4UP9 A;  2JA5 H;  1Q1E A;  1QVC A;  4A93 G;  3PSI A;  4FDB A;  1TWH H;  1I94 Q;  1LTL A;  4OON A;  1X6O A;  1Q46 A;  3DLL A;  3FHW A;  2E2I H;  5M3F H;  2WAQ E;  1YZ6 A;  4JI6 Q;  1XNR Q;  4MTN A;  1L2F A;  1N36 L;  1RIP A;  5M3M G;  4A3D G;  5M5Y H;  1VQE A;  4X66 L;  4JOI C;  2NVT H;  1VQA A;  3TEH B;  2JA7 H;  1BBU A;  1WYD A;  4DPG A;  4X65 Q;  4GOP B;  1FVI A;  4OWX B;  4OWT B;  2EXD A;  4OO1 I;  4BXX G;  1Y14 B;  2PNH A;  4X64 Q;  2R7Z H;  1SN8 A;  3J81 c;  1XPO A;  2OTL A;  1KHI A;  1WCM G;  3E0E A;  1D7Q A;  2XGT A;  1ASZ A;  1OXV A;  1XMQ Q;  2VUM H;  4B3R L;  4A4I A;  2GN5 A;  2XTI A;  3AFP A;  5GRO A;  4DV3 L;  4A3K H;  4K0K L;  5JJK A;  2ZJP A;  2JA6 H;  3I56 A;  3STB D;  3K7A H;  5IP7 H;  3S14 H;  1PH5 A;  3CC2 A;  1PHJ A;  2N8N A;  3NEM A;  3HOU H;  4B3R Q;  2I5H A;  4IFD J;  4YCW A;  1IBM Q;  4UP8 A;  3UDX A;  4QIW E;  2WFW A;  3S1R H;  3H0G G;  4L5T A;  3RZO H;  3ZJY C;  4IOC A;  5FJ8 H;  1K83 H;  4QGU A;  3BZK A;  4DV1 L;  4JI2 L;  4L5S A;  4PZ8 A;  4EX5 A;  4JI0 L;  4NXM Q;  3S24 A;  4GNX C;  5C4X H;  1HR0 W;  3RLO A;  3I4N H;  1V1Q A;  4A3L G;  3H3V I;  2NZH A;  1L1O C;  2MO1 A;  2VY3 A;  3S1M H;  4DV0 Q;  3GTK H;  4IPD A;  1YJW A;  1K73 C;  1PH7 A;  3CQZ H;  4B3T Q;  4JI2 Q;  4PZ6 A;  2WB1 E;  4X62 L;  4A3M H;  1YHQ A;  3W1B A;  4JI0 Q;  1FGU A;  3CXC A;  2PMZ E;  4A76 A;  1UEB A;  2UUB Q;  1QUQ B;  3T1H L;  2Z6K A;  4GKK Q;  4DUY L;  1HJP A;  2UU9 Q;  1EIY B;  2Q2T A;  1KL9 A;  2N78 A;  2JQO A;  2RF4 A;  1XNQ Q;  5DLQ E;  3CCU A;  1C9O A;  1VQG A;  1V9P A;  1V43 A;  3D0F A;  3F1Z A;  1TWA H;  3NBH B;  4IPG A;  3PUX A;  3UDF A;  1FL0 A;  4HJ7 A;  3U58 A;  3RZD H;  4XIG S;  1EYG A;  4DV2 Q;  4YWM A;  1HR0 Q;  3TRZ A;  5HGQ A;  2PQA B;  3S2D H;  1XPU A;  3I4M H;  3PUY A;  1VQN A;  4NXN L;  3RN2 A;  1P8L A;  3HOY G;  4JI4 Q;  2JE6 I;  3ULJ A;  4HJ8 A;  2JA8 G;  4MZ9 A;  2ID0 A;  4GNX B;  2MNA A;  1AE2 A;  3CD6 A;  5C3E H;  5ELN A;  1PH1 A;  5FLM H;  2AKW B;  3W1G A;  3JAM i;  2K14 A;  1OXT A;  3RLF A;  4DR1 Q;  3ER0 A;  3FKI G;  2IX0 A;  1YI2 A;  1VQ9 A;  2CFM A;  2Q2U A;  3KOJ A;  3M9B A;  2R93 H;  3HOZ H;  3HOW G;  1XPR A;  1NTG A;  4HJ9 A;  4LFA L;  2MQH A;  1KIX A;  1Q1B A;  4LF7 L;  1YEZ A;  2E8G A;  1VQ6 A;  2YU9 H;  2F4V L;  4JI5 Q;  2YV5 A;  4DK6 C;  4DR4 L;  3KJP A;  4C3I H;  2ZM6 L;  1XJV A;  3M7N A;  4A75 A;  1TXY A;  3KFU A;  3G71 A;  4GOP A;  2KCM A;  3CPW A;  4P72 A;  1L0W A;  4B3M L;  1X55 A;  2LXK A;  1YIT A;  1Q81 C;  4LF7 Q;  2GVB A;  2AWO A;  2UUA Q;  5IYC G;  2F4V Q;  1HNW Q;  1SLJ A;  3ERS X;  5IP9 H;  4DUZ L;  4HID A;  1EOV A;  1CKM A;  4DR4 Q;  2IHE A;  5IYB H;  1E1T A;  2ZM6 Q;  3I7F A;  3KDF B;  4YCU A;  4DR2 Q;  3AFQ A;  3RN5 A;  2JEB I;  4YY3 Q;  1E1O A;  4B3M Q;  5LMU L;  4DV4 Q;  1VQP A;  1SFO H;  4LF8 L;  5LMN Q;  4OX9 Q;  2PI2 A;  4IFD G;  2VQE L;  4LF4 Q;  4A3C G;  5GAE C;  2I0Q A;  1EWI A;  3AEV A;  3CCQ A;  4DUZ Q;  2A19 A;  1X56 A;  3CC7 A;  3CF5 A;  2ES2 A;  5JJL A;  2DUD A;  1VCI A;  3ULL A;  3HOX H;  2IX1 A;  4LW1 A;  1YJ9 A;  2ZTD A;  3PIP A;  4KHP Q;  2OTJ A;  4LF8 Q;  3WWV A;  3CCJ A;  2KBN A;  4R4O A;  2AHO B;  5AJ3 L;  1AH9 A;  2NN6 I;  2Q2I A;  3A0J A;  4LF9 Q;  2R92 H;  2L15 A;  1PH6 A;  2Q2H A;  3T1Y Q;  1SMX A;  1YJN A;  1BBW A;  4BA2 I;  4ME3 A;  2D0P A;  4BY7 H;  3GDE A;  4JG2 A;  1EIF A;  2JA5 G;  2A8V A;  5IT9 c;  3KF6 B;  4PG3 A;  4DR5 Q;  1B70 B;  4AH6 A;  1X65 A;  3K8A A;  4LNQ A;  3J80 c;  4A3B H;  4LFB Q;  1D8L A;  4A3E G;  1QVF A;  1SRO A;  3G48 A;  1J5E L;  1Y1V G;  3BU2 A;  1WOC A;  1QUQ A;  3S1Q H;  3J7A 5;  1GO3 E;  2ZTE A;  3J80 i;  4A93 H;  1N36 Q;  1IBK L;  2R7Z G;  2YTY A;  4X66 Q;  3MEF A;  1CUK A;  3TRE A;  4C3J H;  3TS0 A;  3KF8 B;  4AIM A;  1QVG A;  4GN5 A;  2ASB A;  3KYH C;  4P71 A;  1JMC A;  4IFD I;  5M3M H;  3H3V H;  2LXJ A;  3J81 i;  4QQB X;  5J3B A;  2UXD L;  2R7D A;  4KHZ A;  3S2H H;  4BBS H;  3PO2 H;  3KLW A;  5IP7 G;  4BXX H;  1YBY A;  5K36 G;  1YHA A;  1I3Q H;  2K50 A;  4DV3 Q;  4K0K Q;  2F3I A;  1WCM H;  1S72 A;  4A3J H;  1CSP A;  1J6Q A;  2B29 A;  2VZA A;  2FXQ A;  2UXD Q;  3M4Q A;  1HNX L;  4R4Q A;  4R1J A;  3GTP H;  2HQL A;  4B3S L;  2OQ0 A;  1MIU A;  3TQY A;  5IY0 A;  3MXN B;  2B3G A;  2YYZ A;  5M5X H;  3PUZ A;  3G6E A;  1Q12 A;  2WP8 J;  1PH3 A;  5BR8 L;  4GKJ L;  4HJ5 A;  3ULP A;  1UE1 A;  2UUC L;  4RG1 A;  4DV6 L;  4DR7 L;  4B3S Q;  1VQM A;  1T9H A;  3PCO B;  1KRT A;  5FLX c;  1RL2 A;  4DV1 Q;  4A3I G;  2IY5 B;  4JV5 L;  3H0G H;  2A1A A;  4JI1 L;  5C0X G;  1NMF A;  3PUW A;  2K5V A;  1ASY A;  2HHH L;  2OWO A;  1QZH A;  4GKJ Q;  2JEA I;  2CWP A;  4A3M G;  1TWC H;  5IYD G;  4TVA B;  1NY4 A;  2KCT A;  4YHH L;  1OXU A;  2D0O A;  4DR7 Q;  3NEL A;  1X9N A;  4HJA A;  4C3H H;  4A3L H;  1X3E A;  4X62 Q;  1TWG H;  4LUZ A;  3PUV A;  2YTX A;  2ZJR A;  3M85 A;  3B6Y A;  1IBL L;  4YCV A;  2WAQ G;  3CCS A;  2AMC B;  3JC6 6;  1CKO A;  5GAD C;  4DUY Q;  2D62 A;  4IPC A;  1Q86 C;  1PVO A;  2K5N A;  4YHH Q;  1UE5 A;  3K0X A;  4AYB E;  4JYA L;  4IPH A;  5GAH C;  4JI3 L;  4A3F G;  4BY1 G;  1K0R A;  4DNI A;  1EQR A;  2YTV A;  1N33 L;  3CC4 A;  3I4M G;  3M4O H;  2N49 A;  1VQ5 A;  5ELO A;  1I50 H;  2R7F A;  2QGQ A;  4A3G G;  1L1O B;  4JV5 Q;  1LUZ A;  2BA1 A;  3HKS A;  4NXN Q;  3F2D A;  4JYA Q;  5C44 G;  1PFS A;  3UDG A;  1SE8 A;  3F2C A;  1N33 Q;  4LFC L;  1OXS C;  3CCR A;  5LMN W;  3OW2 A;  1E22 A;  4JBJ A;  3HOY H;  1VS0 A;  2B63 G;  3KF6 A;  1NJI C;  2Z6K C;  2JA8 H;  2EQS A;  1N8R C;  3HOV G;  1E7Z A;  1JJC B;  3RNU A;  1MJE A;  5H1S E;  1QZG A;  4LFA Q;  1VQD A;  3FKI H;  1BVS A;  4DKA C;  3PF4 A;  2HT1 A;  2KHJ A;  2EIF A;  5M5W H;  3J81 j;  4XTC S;  3SGI A;  2C35 B;  4R4T A;  5C0X J;  4AQY L;  1S40 A;  1Z47 A;  4JBM A;  1HZA A;  3HOW H;  3ICE A;  2AWN A;  3G4S A;  2KHI A;  3E9I A;  1JE5 A;  1B7Y B;  5IP9 G;  4HIM A;  1PV4 A;  1PYS B;  1FJG L;  2F52 A;  4LF6 L;  2E2J H;  4R4I A;  2DGY A;  4YWK A;  4JBK A;  4HIK A;  1K9M C;  4QJF A;  4GN4 B;  1IL2 A;  2RCN A;  4WJ4 A;  4JI8 L;  4JI7 L;  2K75 A;  4YWL A;  2WB1 G;  1K8A C;  3CCV A;  1PA6 A;  5IYC H;  1M1K C;  4LF5 L;  4LUV A;  4OO1 G;  5LMU Q;  1A63 A;  3PGZ A;  2H5X A;  1FJG Q;  1YNX A;  4C2M H;  3I55 A;  1K3R A;  2GVA A;  1B8A A;  2I5L X;  2Y0S E;  2VQE Q;  1NE3 A;  1AE3 A;  2K52 A;  4JOI A;  1UWV A;  1VQH A;  4PMW A;  4BBR G;  4DV5 L;  1HZB A;  2BH8 A;  2KEN A;  4DV7 L;  3GTG H;  4GOP C;  1VQ8 A;  2OCE A;  4R4C A;  4DR3 L;  1VQC A;  1G29 1;  1MKH A;  1EUJ A;  1X54 A;  1O7I A;  1CKN B;  5AJ3 Q;  2Z0S A;  1R9T H;  1Y1W H;  2VS1 A;  5M3F G;  4Y52 H;  4DV5 Q;  4IJH A;  2UXC L;  4BA1 I;  4P74 A;  1I94 L;  4EQ5 A;  4DV7 Q;  5JEA G;  2JA7 G;  1MJC A;  5E7N A;  4KLK A;  1XNR L;  1N34 L;  1VQ7 A;  1IZ6 A;  2HIV A;  2R6G A;  3EN2 A;  4OXP A;  4DR6 L;  3K80 C;  3CMA A;  2UXC Q;  3A5U A;  2VUM G;  1J5E Q;  3PIO A;  4P73 A;  4A3D H;  4X64 L;  1S3O A;  1VQJ A;  4A3K G;  1SRU A;  4UPA A;  3A5Z B;  5JJI A;  1N34 Q;  4DAY B;  4A3E H;  2PQA A;  4QL5 A;  3GTQ H;  2JA6 G;  4JCV E;  1XMQ L;  2ATW A;  1XTD A;  3M3Y H;  3A74 A;  1Y1V H;  1IBK Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...