4IPGA

Structure of the n-terminal domain of rpa70, e7r, e100r mutant
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
b'HMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELRVLKSAEAVGVKIGNPVPYNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Surface Reengineering of RPA70N Enables Cocrystallization with an Inhibitor of the Replication Protein A Interaction Motif of ATR Interacting Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 31
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ipgA00
2HHHL 4LNQA 4AYBE 3M7NA 1I50H 1YBYA 4HIKA 3HOUH 4DV7L 2K5HA 1D7QA 1A0IA 2CWAA 2RHSB 5C4XH 1N8RC 1K8AC 5LMNL 4P74A 3KYHC 4HJAA 3AQQA 2V1CC 1W2BA 2IX1A 1FGUA 4IFDG 2WAQE 4JV5Q 4DR3Q 2WB1E 3I4MH 2VZAA 5FLMH 1FL0A 4IPCA 3GTKH 4JI8Q 1OTCA 4MZ9A 3J7ZC 3J7A5 4A3MG 1AE3A 2RCNA 4H02A 3CCQA 4K0KL 2UXCQ 1C9OA 1JE5A 3WWVA 4QY7A 5IP7H 3CC2A 1VQ9A 4B3MQ 1PVOA 4X6AH 4FDBA 3HKZG 4L5QA 1IBML 2D0OA 4A3DH 4OX9Q 4RG1A 4LF4L 2UXBL 5GAGC 1YZ6A 3CMAA 2JA5H 4JI0Q 1HR0L 4DV6Q 3J80c 4TVAB 2EQSA 1PH5A 1CKNA 3T1HQ 5GQOA 3CCLA 1JMCA 3HOYH 3A0JA 3BU2A 4P71A 3TRZA 4X62Q 3S2HH 3HOVG 4B3RL 4GKJL 4YWLA 5AJ3L 2VQEL 1OXUA 1WCMG 3CCRA 4DUZL 1EOVA 1VQ5A 3CMEA 2B63G 1C7YA 1K3RA 2E5LL 1SN8A 5M3MG 3S1MH 3HOZG 2OWOA 2EXDA 1IYJB 4A3GG 2PQAA 5GROA 1QZHA 2I0QA 4QIWE 2F4VQ 2AWOA 4KI0A 2JA8G 3H0GG 4LF8L 4XTCS 2NN6I 1Q1BA 2IT1A 3NENA 3GD7A 3DLLA 1VQJA 4DR6Q 3AFPA 3T1YL 1KIXA 1VQNA 3ER0A 1GM5A 3K8AA 4A3MH 1N9WA 1VQGA 4A76A 4OXPA 1XNQL 4L5RC 4A3FG 3E0EA 2MNAA 1IZ6A 5JJLA 5GAEC 3RNUA 1XMOQ 1Z47A 2D62A 4DV0L 3RZDH 4JOIA 5E7NA 4AQYL 2BH2A 2R93G 2Z6KA 2N49A 3UDXA 3OW2A 4A3IG 2YTXA 3RLOA 3S16H 4A3LG 1IBLL 4KHZA 1MJEA 4LF9Q 4HIMA 2R7FA 4A3CG 1YHBA 3IRBA 3K7AH 2ZM6Q 3HOVH 4DK3C 1WCMH 2VY3A 2B63H 5IYDG 1VS0A 3CPWA 4LUZA 5M3MH 3GTQH 3HOZH 3I55A 1HNZL 4B3SL 4A3GH 1WOCA 2HHHQ 4B3TL 1O7IA 1GKHA 3B6YA 3M9BA 4R4OA 3RR5A 3I4OA 3G6EA 2JA8H 1B7YB 3H0GH 3UDFA 2HT1A 1M90C 3S14H 3PO2G 4JV5L 2UU9L 1Q81C 1EWIA 4C2MH 4A3BG 3I4NG 1FVIA 4DV3L 4RMFA 3K80C 4OWXB 4X64Q 4LF6L 1FJGL 4LW1A 1N34Q 2BA1A 5M5XH 3S15H 3RLNA 4A3FH 1EQQA 4NB3A 1TWAH 1KAWA 1X3EA 4X65L 1AH9A 4IPHA 4OWTB 5LMUL 4YCWA 3CCSA 2PMZE 4UP8A 3RZOH 4OO1G 2R93H 3HKZE 1U0LA 1IBKQ 3OYYA 2CFMA 5C0XI 1QUQB 4UP7A 1MKHA 2JQOA 3HOXH 4A3IH 2GVAA 1PH6A 1SROA 4DNIA 4JYAL 3RN5A 2UXBQ 4BY1G 2H5XA 1L0WA 2VL6A 1HR0Q 5FLXc 4A3CH 4EX5A 3G71A 2PI2A 1HZ9A 3AYHB 3ULPA 1X9NA 4B3RQ 2B29A 3J81i 1K73C 1V9PA 1NMGA 3OTOL 5IYDH 1UEBA 1RIPA 3EN2A 2UUAQ 4DUZQ 1N32Q 1YEZA 4DV2L 1Q7YC 2Y0SG 2E5LQ 4L5TA 4JCVE 1VQPA 4POGA 4POFA 2I5MX 3PO2H 2IX0A 1PH9A 1CSQA 3CD6A 3STBD 2RF4A 1JT8A 3ICEA 1PFSA 4Y7NH 4A3BH 3KF6A 2NN6G 3I4NH 1JB7A 1E1OA 2K5NA 1V1QA 2YU9H 3JC66 4L5SA 1X3GA 4IPGA 4DR4L 4R4IA 4HIDA 1E3PA 4C3HH 1K9MC 4JI7Q 3HOWG 2BH8A 2EIFA 1XNRQ 4LUVA 3G48A 1PA6A 4LF7L 2E8GA 1NMFA 4NXNL 1XNQQ 4A3LH 1HZAA 5IY0A 2R7DA 2A19A 4DR7L 5BR8L 4AQYQ 4J15A 2HIXA 3JAMi 4BY1H 3CC7A 4HJ5A 1C0AA 3F8TA 3I7FA 2JE6I 3GTOH 4PMWA 1HZCA 4OONA 1EUJA 1YJ9A 2ASBA 4LFAQ 3K81C 1Y1WG 2HQLA 4JI5L 5HY6A 5C3EG 1SE8A 2JEBI 3CCEA 1PH4A 4JI2L 2F3IA 2I5HA 1OXSC 1VQBA 1L1OA 3HKSA 4JOIC 1GO3E 4C3IH 2NVQH 2Z6KC 1I94Q 3KLWA 4BXXG 3G4SA 1VQ4A 2QGQA 3E9HA 1E24A 5IWAL 3KDFA 2UXDQ 4WJ4A 1SR3A 4JBKA 2KENA 4DV3Q 3ULLA 3HOWH 1LM0A 1HR0W 1BVSA 2Q2IA 3BZCA 1Q1EA 4JBWA 4P73A 4YCUA 1S3OA 4LUOA 2K50A 3PUXA 2ZTCA 4O2DA 5M5WH 3D31A 5LMUQ 4BY7G 1B70B 1V43A 4JC0A 3MEFA 5C4JH 4DPGA 2ZJRA 3D0FA 3H15A 5C0XG 2MFIA 1VQOA 4DV5Q 2NVXH 3A74A 4KHPQ 4PZ8A 3RN2A 1QVGA 2Q2TA 4JI4L 1QVFA 3LGJA 2KHIA 4X66L 3ZJYC 5IT9c 2ATWA 3TS2A 3H3VI 1WFQA 1P16A 2XTIA 4R4TA 1E7ZA 3M85A 1Y1WH 5C3EH 1HJPA 2C35B 3F2BA 1KXLA 3PIPA 1WYDA 4DR5L 1KD1C 4QJFA 2Y0SE 4LF5L 4LWCA 4YHHQ 5EAYA 1KC8C 4PZ7A 2UUCQ 4BXXH 3HOXG 1JJ2A 2LXJA 3L0OA 4DKAC 3L2PA 2WP8J 4A75A 1I6HH 5K36G 1HNXL 1CSPA 5J3BA 1KRSA 2IHEA 1G6PA 3CPFA 4O0AA 4IOAA 1X3FA 2OTLA 3PCOB 4GKKL 4GLXA 1XMQL 1G291 4JI3L 1JJCB 1MIUA 4DR4Q 4JI1L 4AYBG 2K75A 3GO5A 1R9TH 4JI6Q 3GDEA 1YHQA 2ZJPA 3KJOA 4YCVA 4LF7Q 4DV7Q 4NXNQ 4BY7H 4IFDI 4ME3A 3U4ZA 4P72A 2YTYA 4GLAC 4BBRG 1EFWA 5LMNQ 1TWCH 4IFDJ 3NBHB 2WB1G 3J80i 2KBNA 4DUYL 4DR3L 4R4QA 1N33L 1NY4A 3KFUA 1SRUA 4WJ3M 1RL2A 3FHWA 2CKZB 3GTJH 1NTGA 2FXQA 1J5EL 4GNXA 2ZTEA 3RLFA 4KLKA 2YTVA 1PHJA 1TWGH 1VQ7A 2F52A 4K0KQ 1JJGA 1GVPA 1OXXK 4UPAA 2VW9A 1VQDA 4GOPA 2D0PA 4HJ7A 2WFWA 2DUDA 1K8GA 1Y1VG 2R92G 1IBMQ 5M5YH 3TEHB 4DV4L 4LF4Q 1AE2A 4JI2Q 4DV6L 4MTNA 4IPDA 5ELOA 1PYSB 1P8LA 1X6OA 1PYBA 4JBJA 4YY3L 3PF5A 4X62L 3JAMc 3S2DH 4JG2A 1LYLA 1VQKA 4GKJQ 3M3YH 1HNWL 5IP9G 4NXML 5AJ3Q 4DK6C 3S1RH 2VQEQ 2OQKA 1Q12A 1UE6A 3PSIA 2B3GA 4MNOA 2YV5A 1PH3A 2I5LX 4BBRH 3K7UC 4YWKA 2VQFL 2VNUD 4HIOA 3PUZA 1NJIC 1YJWA 1YNXA 4LF8Q 1L1OC 2E2IH 1YHAA 1L2FA 4DAYB 2NZOA 2JA9A 1B8AA 3E9IA 3F1ZA 3T1YQ 1LUZA 4DV1L 2OTJA 3AFQA 1HZBA 4PG3A 3I2ZA 4X66Q 2HIVA 3PUWA 4BA2I 1H95A 1EIYB 2R92H 3ULJA 2PI2E 4HJ9A 1Y1VH 4DR5Q 1IL2A 3MXNB 2AMCB 3PGZA 2A1AA 4GN3B 4DV0Q 4LF5Q 2IY5B 1QUQA 4TQUS 1IXRA 4AIMA 3Q8DA 4Y52H 1QZGA 1CKNB 3DM3A 3M4PA 3ERSX 3PV0A 4LFCL 2RHQB 2ZTDA 1HNXQ 5C44G 1IBLQ 5LMNW 1VQIA 3L7ZC 5IP9H 5IYBG 4NPSA 2F4VL 3BJUA 1PH7A 3GTPH 4DR1L 5DLQE 3W1GA 1KQSA 4GKKQ 3VDYA 1PH8A 4R4CA 3FP9A 3F2CA 1YJNA 4JI3Q 2AHOB 1GD7A 4JI1Q 3PIOA 1HNZQ 3TS0A 4B3SQ 4UY8C 1Q86C 1Q8KA 3CQZH 1UE7A 1DGSA 2PQAB 1CUKA 4B3TQ 4LFBL 1S40A 3NEMA 1A63A 5JEAG 1VQ8A 2QA4A 1PH2A 2UU9Q 2KCTA 4DR2L 4DUYQ 1J6QA 1N33Q 2PNHA 2Q2HA 2VS1A 4X64L 2GVBA 1N34L 1FJGQ 4LF6Q 3GTMH 2JEAI 1T9HA 2R7ZG 3H3VH 1J5EQ 5H1SE 1N36L 1HH2P 1CKMA 3CXCA 2A8VA 4GN5A 3NELA 4OO1I 2K52A 1UE5A 4X65Q 4IJHA 1IBKL 2IHFA 1SLJA 2AKWB 5HGQA 1VQAA 1ASYA 2UUBQ 4DV4Q 1E1TA 4P75A 1ASZA 4A93G 5ELNA 4JYAQ 1UWVA 5IE8A 5C44H 2Z0SA 4YY3Q 2ID0A 5IYBH 3KF8B 5JJKA 2UUAL 5JJIA 1I3QH 1X55A 4DAMA 1Y14B 3OTOQ 1HNWQ 4NXMQ 1VQ6A 3PF4A 1N32L 4GNXC 2NVYH 2LSSA 3PO3G 4BBSG 1BBUA 4DV2Q 3TREA 2ES2A 1PH1A 2VUMH 3A5ZB 4GN4B 4HJ8A 2R6GA 4A4IA 4GOPC 2CWPA 4A3EG 2VQFQ 1YVCA 3K0XA 1MJCA 3UE0A 1EQRA 1X56A 4QQBX 2AWNA 3W1BA 1UE1A 3A5UA 2L15A 1KRTA 2K4KA 3S1NH 1BBWA 4DV1Q 4JI7L 3J81c 2R7ZH 4GNXB 1QVCA 5FJ8G 1XNRL 1EIFA 1X54A 4C3JH 1D8LA 2JA6G 3CCMA 3CC4A 4GOPB 2WAQG 4BA1I 1K0RA 1VCIA 3GTGH 3GTLH 4JBMA 4DR7Q 3M4OH 1A62A 3UDGA 4A93H 5BR8Q 3EBEA 2JA7G 2YYZA 1VQMA 1BKBA 3FKIG 1NBWA 5M3FG 1VQFA 1YITA 4JI5Q 1TXYA 1X65A 4JI8L 2QEXA 2Q2UA 4LFCQ 1VQCA 2VUMG 2OCEA 1XPOA 4LFAL 2DGYA 1Q46A 2UXCL 1XTDA 4GLVB 3U58A 1TWHH 1KL9A 3PO3H 4DR1Q 4B3ML 2ALYB 4BBSH 5GADC 3HFZB 4R1JA 4QL5A 3KJPA 2NVTH 3U50C 4OX9L 1XPUA 4APVA 4JI0L 4A3JG 2K14A 1VQHA 4A3EH 4IOCA 2UUBL 1I94L 4LFBQ 1I5FA 1OXVA 3T1HL 1U5KA 5JEAJ 3W5OA 3F2DA 1XJVA 2CCZA 3M4QA 1NE3A 3KF6B 3PUYA 2UXDL 2N78A 1VQLA 5IWAQ 4DR2Q 2MQHA 3UDIA 2LXKA 5FJ8H 4A3KG 1VQEA 3CCUA 1EYGA 5IYCG 3EIVA 4UP9A 2CQOA 2KHJA 2JA6H 1WI5A 1SMXA 3STBC 1YIJA 4AH6A 1LTLA 1N36Q 1WJJA 2XGTA 4IO9A 3HOUG 5C4XG 4ALPA 3CF5A 2ZJQA 4DR6L 3CCVA 3TQYA 2E2JH 2JA7H 4QGUA 1Z9FA 1KHIA 2NZHA 3FKIH 3PUVA 5C0XJ 2OQ0A 2JJQA 2K5VA 2N8NA 3CW2C 5M3FH 2KCMA 4DV5L 2N3SA 3I4MG 4KHPL 3SGIA 4OWWB 3CAMA 1K83H 1A8VA 5FLMG 4JI4Q 3CP0A 4EQ5A 3KOJA 1YI2A 1G51A 1XPRA 1Q82C 1E22A 1XMOL 5IP7G 1OXTA 4PZ6A 1PV4A 2MO0A 4YHHL 1SFOH 4GS3A 1TWFH 4XIGS 1CKOA 4A3JH 2UUCL 4A3DG 3AEVA 1L1OB 3UE1A 2JA5G 3I56A 4LF9L 3BZKA 3J81j 4IJLA 2ZM6L 1M1KC 2MO1A 3S24A 2GN5A 2JK8A 3KDFB 5GAHC 2E2HH 3HOYG 3S17H 4YWMA 1S72A 3CCJA 1W3SA 4A3KH 3S1QH 3U4VA 4JI6L 5IYCH 2BA0A 1XMQQ
chains in the Genus database with same CATH superfamily
4NKLA 3M7NA 1U4MA 4HIKA 2A68D 3AB9A 4R9WA 3I4MB 3AQQA 1W2BA 3J81L 4DR3Q 2MJ8A 2PZWA 2VZAA 1VMCA 2D2CC 5FLMH 2FFKB 3GTKH 3UI2A 4MZ9A 5KNDA 2LKVA 4A3MG 1AE3A 2RCNA 1JE5A 1A2UA 4OELB 3K5OA 4X6AH 2K28A 2IWHA 4K2KA 4OX9Q 4A3DH 1YZ6A 4UHVA 3J80c 1CKNA 4CKBA 4P71A 2WINB 1GOZA 4X62Q 3S2HH 3HOVG 4YWLA 2F0WA 1VQ5A 1EOVA 5J39A 4K5XA 3J80E 2E5LL 4N8X1 1LTGD 5M3MG 3S1MH 2MHVA 4A3GG 5KYIA 1R4QB 4IFDH 2JA8G 4CGYB 4IN3A 5FKAC 4XTCS 2NN6I 3HEJA 4DR6Q 1TIID 1VQNA 4EQOA 1HCZA 3PIO3 5KRUA 3K8AA 4X3UA 2L9HA 4L5RC 4A3FG 1F77A 1NAPA 3T53B 1IZ6A 5JJLA 5GAEC 1XMOQ 3SK5A 3S16B 2D62A 4JOIA 2BH2A 3UDXA 4KHZA 1MJEA 5FOBB 4LF9Q 4HIMA 1YHBA 4DK3C 2XWJB 1WCMH 3SE0A 1IKLA 1PZKD 4A3GB 3CPWA 1CA5A 4LUZA 4A3EB 2JA8B 1WOCA 4PV1C 4XQQA 3I4OA 2KUMA 1F9QA 1XWEA 4C2MH 4A3BG 4DV3L 2PCFB 3IAYA 1LTRD 2KOLA 2BA1A 2B2WC 2WAQB 5KNCA 3X3NA 3WDNA 2F0PA 1X3EA 1EIGA 5CV9A 4IPHA 4OWTB 4X65L 2I46A 3CCSA 1D5MC 1E0BA 5F2DA 3HOXH 4A3IH 2CQAA 1QUQB 1IBKQ 2VNUD 2JQOA 1PH6A 2D5DA 2GVAA 3SR1A 1K83B 1SROA 3RN5A 4BY1G 3P75A 1L0WA 4XQNA 4OL7A 3A8KE 2EYLA 1GHJA 3NQIA 2DJGC 1K73C 1V9PA 3QR8A 1DZ1A 2NTTA 4DV2L 1HTPA 2Y0SG 2E5LQ 4L5TA 5D3DA 1MBYA 2M9VA 1LABA 3K57A 3PO2H 2IX0A 1M4VA 2PW7A 1PH9A 3S17B 1JOQA 4DFAA 3MXPA 4R8IA 2O5IC 4A3KB 5C4HA 2YU9H 3JC66 5DM63 1U4PA 1EZ8A 5C4XB 2BH8A 4KD3A 2GA4B 4KN4C 2PO4A 4BY1B 1SNDA 3KLSX 4DR7L 2B2TC 2VB2X 1WD1A 3JAMi 2M2LA 1WTVA 3CU7A 3I7FA 1AFPA 3BZDB 2F0FA 2Y0SB 1BNZA 2ASBA 3DWPA 3K81C 4IQZA 2D9UA 1BF4A 5HY6A 3CCEA 3MXNA 1HUNA 4JI2L 2F3IA 2I5HA 1B9NA 1VQBA 4C3IH 2NVQH 4N8FA 2NN6H 3HG9A 2F0LA 1SJHD 1SR3A 2RSNA 2KENA 4DV3Q 2C9OA 1BVSA 1LTBD 1LTAD 1Q1EA 4JBWA 3A8JE 4YCUA 1F2MA 2HCIA 3D31A 4BY7G 5C3WA 1V43A 5C0XG 2MFIA 4ZKBB 4DV5Q 3A74A 4K2LA 4PZ8A 3BVMA 1CFMA 3ZJYC 1JOKA 3AMUA 3H3VI 5ELDA 4LK1C 2XTIA 4R4TA 5NUCA 3A7LA 1Y1WH 4J8QA 2C35B 2F0IA 3PIPA 4DF7A 4QJFA 1K3BC 4LWCA 2EZVA 4PZ7A 2UUCQ 4JPBW 2LXJA 4U68A 1QNUA 3WOFA 5K36G 3SXHA 1CSPA 5J3BA 2B63B 5ISRA 2IHEA 1BCPC 1G6PA 3CPFA 3D4WA 4IOAA 1X3FA 2EXZA 1R9TB 4FF1A 1SNMA 1RF2D 4AYBG 2K75A 3GDEA 1YHQA 2F3WA 2YTYA 3X3MA 5G3LD 1EIHA 3J80i 5M5XB 4WJ3M 1LT6D 2XWBB 1EYDA 2LY7A 1BCPD 3RLFA 2XSCA 2R93B 2Z6BA 1TWGH 1VQ7A 3A56A 3GQBA 1SE2A 1OXXK 1VQDA 2R92G 2DUDA 5M5YH 1EFID 1PYWD 1FNUA 4JI2Q 4IPDA 1P8LA 1X6OA 4JBJA 4DAVA 3TP8A 1LYLA 1VQKA 1HNWL 4NXML 5AJ3Q 4IUTA 3K59A 4C56C 1LTID 1DOKA 4YWKA 3PUZA 1EYCA 1CHQD 1YHAA 4DAYB 2NZOA 4HMIA 1V1PA 2F3VA 2K32A 5JVH3 3H94A 2ZXOA 3URYA 2FINB 2WKDA 2WIIB 1Y1VH 1IL2A 3MXNB 3PGZA 4GN3B 1FR3A 5FO7B 2EY2A 4Y52H 1BUVT 4WFN3 3M4PA 3PV0A 4E6IA 5D14A 1QZGA 2RHQB 1LLRD 1TY0A 4V0BA 3QIAA 4NPSA 1LACA 1CA6A 5DLQE 2CW0D 3W1GA 4R4CA 1GUTA 2BE5D 2TSSA 2VUMG 1AW7A 1ZXTA 4LFBL 2PQAB 1DGSA 3DM1A 1CUKA 1S40A 5JEAG 4CDCC 1ICWA 1PH2A 2UU9Q 3HOWB 4G7OC 4FF2A 3FDTA 3T56B 4BS9A 1N34L 5EKKA 1B2TA 1L0XB 1T9HA 5HURA 2R7ZG 3H3VH 1HH2P 4GN5A 2A6HC 2E2DC 2WACA 2IHFA 1SLJA 2E75C 4F87A 1JICA 1UWVA 5C44H 1S5CD 1BDOA 1PTOB 2ID0A 1EL0A 3A7AB 3VYSA 2QF7A 4DA2A 2UUAL 3BDCA 1X55A 1Y14B 1HNWQ 1N32L 4NXMQ 2VUMB 1Y8NB 2JN4A 3V96A 1W6JA 4RAUC 3PO3G 1ILPA 2XRSD 5E3FA 1PH1A 5FLXL 4B08A 4A4IA 5CV6A 2M00A 1F2YA 3K0XA 3NWTA 3QOLA 4K6DA 1EQRA 1X56A 4QQBX 2EYJA 3A5UA 5T1IA 1D5ZC 4X3KA 3R2TA 1QVCA 3DUZA 1MSHA 1SBBB 3GTLB 5CMDA 4C3JH 3BS1A 3CCMA 4BA1I 4JV5L 1QCBD 2HD3A 1A62A 3I4LA 5BR8Q 3GTJB 1VQMA 1NBWA 1CI3M 1YITA 3R93A 4ABNA 4LFAL 2NVTB 1JCKB 5CR3A 5JAVA 3Q0AA 1KL9A 1YNJD 5GADC 1ESRA 3TP5A 2F0EA 1I4RA 3AU7A 4A3EH 4LFBQ 1I94L 1TQOA 1OXVA 3T1HL 3W5OA 1XJVA 2B2YC 2BOSA 1UAPA 2QCPX 1ICFB 2F0SA 2N78A 5IWAQ 2ZXRA 1S5DD 2MQHA 3LNNA 2X6GA 3CCUA 1S5BD 4BBRB 3FPPA 2NBFA 2BCOA 1YIJA 1LTLA 4CHTB 4IO9A 2G5DA 3CF5A 5I6WA 3N52A 4QGUA 3PUVA 3E3XA 2JJQA 3CW2C 2KCMA 3GV6A 1SMYD 3SGIA 1XX8A 4OWWB 3CAMA 1K83H 4JI4Q 3VR6A 1YI2A 3ND9A 5IP7G 1SFOH 1CKOA 3AEVA 2K5DA 4RWSC 4NMZA 3UE1A 2JA5G 4RH6A 3BZKA 3U9OA 5KIXA 3S24A 3KDFB 5G3LF 5M9OA 4IUQA 5GAHC 2E2HH 3HOYG 3S17H 1S72A 3CCJA 5EKLA 4A3KH 2CH4W 5IYCH 2MNAA 3CQZB 2BA0A 4KN7C 2B2VA 4LNQA 1HRJA 4AYBE 4ZRZA 2K5HA 1A0IA 1BCPF 2RHSB 3MXGA 5C4XH 1PFNA 5LMNL 4P74A 5CV7A 2IX1A 1FGUA 4J1MA 4JV5Q 3C1FA 1QB5D 3IFDA 1EZ6A 1WTOA 1OTCA 1EU4A 1PRTB 3J7ZC 3J7A5 4H02A 1C9OA 3CC2A 1TKWB 2JA5B 3VA5A 4L5QA 1IBML 4RG1A 4LF4L 1SNPA 3CMAA 3HOYB 3DEOA 4EGVA 1STYA 2EQSA 3T1HQ 5GQOA 4K14A 3BU2A 4B3RL 1MGSA 2VQEL 1OXUA 1G2SA 1G8ZD 3CMEA 1SNQA 1CZGA 3E6ZX 1SN8A 4DK1A 1IYJB 3TMEA 5GROA 1NR4A 3TP6A 4KI0A 3H0GG 1VF7A 2NWGA 2RKSA 3GD7A 3S1NB 3T1YL 5IGDA 1M8AA 3ER0A 3Q6SA 1GM5A 3OOCA 3T51B 3R8BA 1DXMA 3MZ5A 1XNQL 3RZDB 1R4PB 3E0EA 4N9PA 2B2UA 3RNUA 1PLFA 2F0MA 2Z6KA 1GHKA 4A3LG 3OW2A 3EQLC 2YTXA 2F0TA 2R7FA 3IRBA 4BBSB 3KF8A 1L0YB 4P2CB 5I6YA 2B63H 3HOZH 3I55A 4FF4A 5ELEA 4B3TL 3M7GA 1O7IA 3G6EA 3UDFA 1M90C 2RDHA 1EWIA 3QB3A 3S15B 1HA6A 5D3IB 1FJGL 4LF6L 3K80C 3Q23A 4X64Q 1DM0B 4LW1A 5M5XH 3RLNA 4C3HG 3I90A 3VYUA 4NB3A 1TY2A 1AH9A 5LHY1 4OO1G 1EU3A 4H44C 3RZOH 2R93H 3HKZE 1U0LA 2UUBL 2CFMA 4JW0A 1MKHA 3MHBA 4JYAL 4KY5A 4A3CH 2L11A 5FLXc 5EBDA 3AYHB 4B3RQ 4HMJA 2B29A 1NMGA 5IYDH 4UAIA 1RIPA 1Y8PB 1TWFB 4RA8A 4TSSA 1GUGA 1YEZA 5FLXE 2DY7A 2X69A 4POGA 2L4NA 2Z4IA 3DWAA 3CD6A 2RF4A 4Y7NH 3KF6A 3P20A 3I4NH 3PMFA 4YIJA 3S1QB 1QOHA 2OF1A 4C3HB 4LJZC 1E1OA 1NR2A 2K5NA 4L5SA 1EY9A 4IPGA 3HOUB 1K9MC 4HN7A 2EIFA 4RGNA 1XNRQ 4LF7L 3I3CA 1XNQQ 5IY0A 1QWYA 3W3AA 1B3AA 1KTKA 4I65A 4ODGA 1JWSD 5I9OA 3OHXC 1K8MA 5C5LA 1JWMD 3D4DA 1C0AA 2HDLA 2JE6I 4DU9A 4PMWA 5JPNC 1EY0A 4WORA 3LX0A 2HQLA 5C3EG 2B8GA 1V1OA 2K6AA 1L1OA 4BXXG 1GO3E 3IKJA 4NW2A 3G4SA 2NZ1D 5C5MA 2UXDQ 5CV8A 2DY8A 1PTOC 3ULLA 4L63B 3SK8A 3HOWH 1LM0A 2Q2IA 5J22A 3EFXD 5ELBA 1O78A 1B70B 2CVRA 2ZJRA 3D0FA 4A3MB 4OGQC 1QG7A 2Q2TA 1QVFA 3LGJA 3TS2A 1NNXA 3ZYYX 1WFQA 1PTOH 1ZEQX 4DR5L 1ENFA 1S5ED 4YHHQ 2FHTA 3K7AB 3HOVB 1JJ2A 3L2PA 4DKAC 4A75A 4TKOB 4KJNA 1KRSA 4IUPA 5M3MB 2XVSA 1XMQL 4JI3L 3GO5A 4I7ZC 2ZJPA 4YCVA 4LF7Q 3FVQA 1KDCA 4FXKC 4ME3A 4P72A 4GLAC 3MFYA 2Z4HA 4IFDJ 4IALA 1A2TA 5IGGA 2WB1G 4FF3A 4RFBA 4DUYL 1JORA 4R4QA 1DJRD 2E76C 1N33L 1SE3A 3O13A 4F8MA 1SRUA 3KFUA 2PYKA 4A3FB 1SYFA 2KJXA 3OSOA 3FHWA 1PZJD 1SNOA 2CKZB 3E5SA 3GTJH 1TS3A 2FXQA 4GNXA 1PHJA 1JJGA 2F0OA 4ZYSA 1GVPA 4RKLA 1IW7C 4UPAA 4GOPA 3TEHB 4CJ2C 5IGFA 5D65A 3IFTA 4DV6L 5ELOA 3M3YB 1PYBA 4HTHA 4H7BA 3PF5A 4RGOS 4N9TA 3HRZC 5IGEA 5IP9G 3WOEA 1YNNC 2L0CA 2OQKA 1Q12A 1H9JA 5CBAE 2B3GA 3VR3A 4BBRH 4A3BB 3K7UC 2VQFL 1NJIC 1TT2A 2L5TA 4XYOA 1IW7D 3R3OA 4PQXA 1B53A 1LUZA 3C46A 2OTJA 1KNAA 4OHJA 1HZBA 1EY7A 1JC7A 2HIVA 4WJWA 2ICIA 2V4DA 5JPMC 4BA2I 1IYUA 5IIFA 1EIYB 4DR5Q 1AZPA 1W6KA 1ZKOA 2AMCB 2IY5B 1IXRA 1PMRA 4AIMA 3Q8DA 1CKNB 4LFCL 2Q8TA 5LL6S 2K05A 3L7ZC 5IYBG 1PH7A 2KECA 4DR1L 2X6LA 1PRTC 5L37A 3FP9A 1SE4A 2AHOB 4JI3Q 3PIOA 3CQZH 1UE7A 2EYOA 2DNCA 2KA7A 4S3SA 3NEMA 1A63A 1VQ8A 2QA4A 2BDOA 4DUYQ 3GTMB 3SEBA 1N33Q 2VS1A 1T5EA 3G6JB 2JEAI 5M5WB 1N36L 1GUOA 1CKMA 2KEDA 5C4JB 4IURA 2F0VA 2A8VA 4OO1I 3NELA 4X65Q 4IJHA 1JQYD 2NVXB 1RHPA 1E1TA 4A93G 5ELNA 5IE8A 4G7ZC 1ENAA 1A15A 2K5QA 2CH4A 3GV3A 4Q0FA 2C5CA 3L9AX 1VQ6A 4HAEA 1BBUA 1SJED 1UUPA 4DV2Q 1WTXA 1BOSA 3OIPA 1WTPA 1BO0A 3A5ZB 5LL6X 2IX3A 5IGBA 2NUCA 3C2PA 2VQFQ 2RVLA 5BN5A 1EEID 3BYTB 2AWNA 3W1BA 1Y8OB 3VR2A 1WTWA 3S1NH 1X3QA 1BBWA 4JI7L 3J81c 4GNXB 5FJ8G 4BY7B 4XDXA 1TWCB 3GTGB 4GOPB 4ZKCB 3J81E 4DR7Q 1MSGA 2PZUA 5A2QL 3EBEA 2JA7G 3DEPA 1E2ZA 5M3FG 3OPOA 4TRDA 2Q2UA 4LFCQ 5T1GA 2R61A 5C6AA 1XPOA 2DGYA 3MC0B 2KEEA 3D6WA 2EJGC 3TZDA 3EROA 4DR1Q 4B3ML 4BBSH 1D6EC 3J7AV 4QL5A 1VF5C 5COYA 2F03A 4APVA 4JI0L 4A3JG 1VQHA 2L1BA 5FO9B 3S2DB 1H9SA 1XTCD 2A5HA 1I4GA 3PUYA 3S1RB 4AYBB 1X3PA 1HTLD 1C48A 5I2YA 3OWFA 4DNTB 1O7YA 4QUFA 3ERQA 1SYDA 2JA6H 1N36Q 1SMXA 3STBC 2Z9HA 4AH6A 3J7YW 1F2LA 2JA7B 2XGTA 1PTOF 3NUCA 1G2TA 1Z9FA 1NUCA 2NZHA 3FKIH 2OQ0A 3M4YA 2N8NA 3NSWA 4KHPL 1HHVA 5EQ0A 5JJZA 5FLMG 2R92B 5EPKA 1EQVA 3NXWA 4PZ6A 1PV4A 1CZWA 1TWFH 4A3DG 3P7JA 4KKSA 1STNA 4V190 3GTPB 1M1KC 5IOCA 1F9SA 3H3VC 2B2WA 3Q22A 3S1QH 3U4VA 1EWCA 1TS5A 1STHA 4JI6L 1STAA 2HHHL 1STBA 3T4AC 1GUSA 1YBYA 5ELCA 3HOUH 4DV7L 2AQ1B 2CWAA 3NQTA 3U9SA 1N8RC 1K8AC 4HJAA 3KYHC 5EBCA 4IFDG 2WAQE 1AP0A 2K01A 3GTKB 2WB1E 3I4MH 2SEBD 3NHHA 2EY6A 1FL0A 2K04A 3KLRA 1UEAB 3C1EA 1PXUA 4K0KL 4QY7A 4FVMA 1A3UA 1JR0D 4B3MQ 3HKZG 2D0OA 2UXBL 5GAGC 4JI0Q 2O2LD 1AN8A 1I3QB 4TVAB 1PH5A 4CJ0B 2OXPA 1JMCA 4GKJL 2NVYB 1JB3A 4KD4A 1MD2D 1WCMG 1K3RA 1I4HA 1I6VC 3KK7A 4MHEA 5CV4A 5EGTA 2OWOA 3JAML 1GUWA 2B2TA 2AWOA 4LF8L 1Q1BA 2A6HD 3N6RA 3I8ZA 3AFPA 2R7ZB 2P5ZX 4XQJA 4A3MH 3HKZB 1N9WA 1VQGA 3KBGA 4A76A 1VMPA 4FO2A 3K5LA 4RGMA 4XT1B 4CBVA 2RDGA 4DV0L 3SVMA 5E7NA 4AQYL 2RCFA 2N49A 1SYCA 4A3IG 2MPMA 4OIKA 3RLOA 3S16H 1IBLL 2NYZD 1WCMB 2DJFC 3K7AH 1EY4A 1TWHB 3HOVH 3PO3B 1DD2A 4WRDA 4GZYC 5M3MH 1HNZL 3MFGA 4B3SL 2KCCA 2HHHQ 4A3GH 1GKHA 2K33A 3M9BA 4R4OA 2JA8H 1JT8A 2HT1A 4C2MB 3PO2G 3K58A 1STEA 1Q81C 2A74C 5E4XA 1V1PB 4RMFA 4CJ1B 3F2UA 4PNYA 1N34Q 2F1MA 5KNBA 2Q8RE 1KLUD 4A3FH 3OWEB 4Q5VA 2G9HD 2F0NA 5LMUL 2PMZE 4UP8A 2H4OA 3OYYA 5C0XI 3BVGA 2UXBQ 2XIWA 2H5XA 3FMCA 1PZID 3G71A 3IL8A 1HZ9A 1SNCA 3J81i 3OTOL 1UEBA 2EDGA 3BDOA 3EN2A 2UUAQ 4LAAA 1N32Q 3E0JA 5CBEE 1RJTA 3J80L 1CSQA 4C3IG 2AUJD 4A3BH 2NN6G 1JB7A 2JYOA 4DNRB 1ET9A 1I50B 4DR4L 4R4IA 1WVLA 4EQNA 4LUVA 3G48A 1NMFA 4NXNL 3RD4A 2B39A 2R7DA 4ME5A 1SYGA 5A2QE 4AQYQ 4J15A 3I70A 2JXMB 4BY1H 3CC7A 4F7XA 4HJ5A 1AEXA 3SHLA 1B1ZA 4RCOA 1HZCA 1EUJA 3OMCA 4LFAQ 1Y1WG 4MTKA 4JI5L 4KHVA 1JE4A 3HKSA 4JOIC 4IUNA 3MWYW 5A35A 1I94Q 1QILA 5C3XA 3D3RA 1LV9A 2FJ2A 4WJ4A 5KEEA 2OT2A 2ZTCA 4O2DA 5ELFA 5M5WH 5LMUQ 4JC0A 4ID6A 5C4JH 3EVQA 3H91A 1ONLA 2J0TD 2NVXH 1KLGD 3RN2A 1QVGA 4DAPA 2KCNA 1A6XA 2KHIA 4X66L 2ATWA 1H9KA 1P16A 3M85A 1E7ZA 2IL8A 1HJPA 2PW5A 1WYDA 1KD1C 5FO8B 4LF5L 1KC8C 5EAYA 2QEJC 2EY5A 2WP8J 3J7AF 1HNXL 1D2BA 2EJFC 2IPKD 2F0UA 2Z8LA 3GTQB 4GKKL 4GLXA 1G291 1JJCB 1MIUA 4DR4Q 5KYLA 3S14B 3H0GB 1R9TH 1IL8A 2F0QA 2ZXPA 4FP5D 2F0GA 4NXNQ 4BY7H 4IFDI 4G57A 4PMBA 5LMNQ 1TWCH 1K28A 4DR3L 5C0XH 2KBNA 2HUGA 1U9RA 5EKIA 4QUCA 1BCPB 4RGTA 3KLSA 5IODA 3ITPA 1TWAB 1NTGA 1J5EL 2ICEC 4KLKA 1ET6A 3HS0C 2EYFA 2F52A 5M5YB 4JI5Q 2WFWA 1Y1VG 1IBMQ 4DV4L 4LF4Q 1AE2A 1KDAA 4UDUC 3QG1A 1Y69U 5K36H 1EY5A 4MTNA 3TP7A 4YY3L 1EYAA 4X62L 3JAMc 3S2DH 2XN9C 1CQFA 4C1NK 1KNEA 2VQEQ 3S1RH 3JAME 2CHBD 3A54A 2YV5A 4KY7A 2I5LX 3D8GA 4HIOA 4FXDA 3RUZA 1L2FA 4HR7B 3NTIA 3T1YQ 3E9IA 3AFQA 4NP5A 3NK9A 4G7HC 1FYCA 4X66Q 2A68C 3TBIB 1Y1VB 3PUWA 1B4OA 4U673 4ZCKA 2H1EA 1H95A 2R92H 2PI2E 4L8JA 5CC4A 2B2YA 1WTQA 1QUQA 4LF5Q 4TQUS 3GTOB 3C3LA 5I2XA 4ZK9B 3ERSX 1HNXQ 1O7ZA 5C44G 5LMNW 3GTPH 3SDZA 3VA7A 2VB3X 4GKKQ 3VDYA 1PH8A 3F2CA 1GD7A 1ML0D 1OO9B 1Q8KA 4B3TQ 3LWUA 3MXUA 1T5XD 2QDBA 2KCTA 4L6TB 1CHPD 2GVBA 2L55A 1FJGQ 4LF6Q 1GUNA 1FNWA 1J5EQ 5H1SE 3CXCA 2DNEA 2K52A 4C3JG 1IBKL 4KMUC 4MIUA 2AKWB 5C44B 1AZQA 1ASYA 2UUBQ 4DV4Q 4JYAQ 1U4RA 2Z0SA 4YY3Q 5C3EB 3KF8B 5JJKA 5JJIA 1I3QH 4DAMA 2NVYH 2LSSA 1K0SA 1PTOD 5J1ZA 1J9OA 1SSOA 1A3TA 3TREA 1I6HB 2VUMH 1GJXA 1EOTA 4GN4B 2HDMA 5JEAH 4A3EG 1QJOA 4B9XA 4OIJA 2L15A 2N55A 1RCVD 3R2IA 2R7ZH 5CORA 4C3JB 1DOLA 3MEHA 3MAQA 5E1FA 1EIFA 4J6HA 3CC4A 2I07B 2WAQG 1MHWC 1K0RA 1VCIA 3GTLH 4JBMA 3UDGA 2YYZA 1BKBA 1MI2A 3V05A 1LTSD 1TXYA 4JI8L 2QEXA 1VQCA 1PDQA 2Q8IB 2UXCL 1XTDA 4GLVB 3U58A 1TWHH 4CKCA 3PO3H 2SDFA 2ALYB 1LO5D 3HFZB 2NVTH 1O80A 1G6ZA 1XPUA 2RA4A 4JK1C 2K14A 3A8IE 2EY1A 2OEOA 1KDBA 2DN8A 3W2DA 1I5FA 1U5KA 4OEMB 5JEAJ 3F2DA 3KF6B 1NE3A 1KAAA 2F0DA 3BYYB 1SXTA 3PIP3 1JOOA 4CKEA 3UDIA 3NWSA 2KQ3A 4A3KG 1VQEA 2VXWA 5IYCG 3EIVA 2WB1B 3CKIB 5BN4A 1WI5A 2F4VL 2E2IB 5C4XG 4ALPA 2ENBA 1UNSA 4H0LC 3CCVA 3TQYA 1CQVA 1Q8IA 2LFNA 4RHSA 1I4PA 1RTOA 4DV5L 1CTMA 2EOTA 2K5WA 3MVVA 1WD0A 3SK6A 1SFOB 4EQ5A 3KOJA 2R3ZA 1G51A 1YNND 1OXTA 4BWGB 2MO0A 2UUCL 3NBIA 1II3A 1L1OB 5IT9L 3I56A 2E2HB 1SYBA 3FPUB 2ZM6L 2MO1A 3MA2B 5JOBA 4X3SA 1I4XA 1ESFA 1GXDC 4DK0A 1W3SA 2IW3A 1XMQQ 4CDEC 4QCLA 1I50H 1D7QA 1PFBA 1D5XC 2V1CC 3CRKC 1DOMA 4DAYA 4IPCA 2IJ0A 4JI8Q 1TS4A 4FYDA 3CRLC 3VR5A 1XYIA 4XYQA 3CCQA 4X3TA 2UXCQ 5IP7H 3WWVA 1TR5A 1VQ9A 1PVOA 1PRTD 2RQXA 4FDBA 4K5VA 3T13A 3VYRA 4JVZA 2QILA 2JA5H 1LT3D 1BQQT 1HR0L 4DV6Q 2B8FA 1A3VA 3CCLA 3TRZA 3HOYH 3A0JA 3P1HA 3HGBA 1LT5D 5AJ3L 4DUZL 3CCRA 2SNMA 2B63G 1SAPA 1H9RA 1C7YA 3HOZG 2EXDA 3I73A 2PQAA 1QZHA 2I0QA 2PQEA 4QIWE 2F4VQ 2IT1A 3NENA 3DLLA 1VQJA 3I72A 3LWEA 5CGKA 2EPBA 3HZXA 1RKNA 2F0JA 2L12A 2NTSA 2QKIC 2F0HA 1HXYD 2PMZB 4OXPA 2RSOA 4KY6A 1B44D 1CM9A 2JP1A 3M4OB 4A93B 3DXJC 1Z47A 3NPPA 3RZDH 4RHRA 1BBXC 2SOBA 2R93G 1D1IA 1HPCA 1FD7D 2Z1CA 4XXEA 4A3CG 2ZM6Q 2HCCA 2AQ3B 2A73B 4EVOA 3HOZB 2VY3A 5IYDG 1B50A 1VS0A 3GTQH 3DWQA 4FNFA 5I4DA 3RR5A 3B6YA 4FXGC 3S14H 1B7YB 3H0GH 2J4XA 4IZ8A 4DXFA 2UU9L 4QB4A 3I4NG 1FVIA 4OWXB 3VYTA 3S15H 3NP8A 4QMGA 1EQQA 4IUUA 3RZOB 1J8IA 1TWAH 2B2VC 2E2JB 1KAWA 5M3FB 3KUPA 4YCWA 3CHBD 1FGBD 2FMCA 5CV5A 1ILQA 3NBHA 5FK9C 4A3LH 4UP7A 4DNIA 2HQEA 3S9WA 3QOJA 2VL6A 1HR0Q 1CK1A 4EX5A 3H09A 2PI2A 3ULPA 1X9NA 1TS2A 3K6OA 1TVXA 4A3JB 4DUZQ 4ZLTF 1Q7YC 1SEBD 4KKTA 1HFGA 4KJOA 4JCVE 4POFA 1HQMC 2I5MX 4Y7NB 3I4NB 3STBD 3ICEA 1PFSA 1RD9D 2K03A 2CW0C 1V1QA 2JSOA 1X3GA 4HIDA 1E3PA 4C3HH 3BDLA 4JI7Q 1IHZA 2BE5C 3HOWG 1PA6A 2E8GA 1HZAA 2LMCB 3DMUA 2A19A 2EVBA 4OO1H 2MP1A 1X32A 2K7VA 5BR8L 4MN3A 2HIXA 3MTSA 4NDXA 1F2ZA 3F8TA 2SNSA 3GTOH 4OONA 4HSVA 1YJ9A 2WKCA 1WTRA 3BVZA 4A3DB 3EA6A 1E2VA 1Q90A 1SE8A 2EYMA 3NE5B 2JEBI 1IKMA 3RMHA 2B2UC 1PH4A 1STGA 2KVMA 1OXSC 2LS01 4CDFC 3S2HB 2Z6KC 1K8OA 3KLWA 1O7LA 1VQ4A 2QGQA 4KV6A 3E9HA 1E24A 5IWAL 3KDFA 4RKBA 1RODA 3QJYA 4JBKA 3S1MB 1HR0W 1DONA 3BZCA 4P73A 1S3OA 1EY8A 4LUOA 2K50A 3PUXA 3OIQA 2F0KA 5TSSA 3MEFA 5I9PA 1QE6A 4DPGA 3DHQA 3H15A 1VQOA 4KHPQ 3D6CA 4JI4L 4M1UB 5IT9c 1B3QA 5C4ZA 4HEDA 5C3EH 3F2BA 1KXLA 2EJMA 2Y0SE 5IT9E 4BXXH 1WTHA 3HOXG 1H9SB 3L0OA 1I6HH 5DNFA 5AFWA 1U4LA 4O0AA 1YNJC 3PCOB 2OTLA 2MUYA 1QNKA 4JI1L 4JI6Q 1ZYRC 2ZT9C 3KJOA 2A6EC 1E2WA 3QWNA 4DV7Q 3U4ZA 4BBRG 2N88A 1EFWA 3NBHB 4KTAA 1PRTF 1NY4A 3K5NA 1RL2A 2ZTEA 3OMGA 2KHSA 2YTVA 4A3IB 4G4KA 1LT4D 3HOXB 4K0KQ 1CT1D 4HSPA 4K6LA 2VW9A 1K8GA 2D0PA 2PZTA 4HJ7A 1B9MA 1ZYRD 1SMYC 1PYSB 1XXGA 2A6ED 3ONAB 1IYVA 5DAUA 4JG2A 2MGSA 4GKJQ 1EWHA 3M3YH 4DK6C 2RBMA 1RTNA 3PO2B 1UE6A 3PSIA 1KABA 1TU2B 4MNOA 1HA5A 3PQIA 1PH3A 3K5MA 1VDZA 3T16A 1YJWA 1YNXA 2YU9B 4LF8Q 1L1OC 4ZUIA 2E2IH 3ND8A 2JA9A 1B8AA 3F1ZA 4ZQ3A 1D1KA 4DV1L 1DCZA 3G7LA 1HUMA 1H9MA 4PG3A 3Q24A 3I2ZA 2PNRC 1Z7TA 3ULJA 3A55A 4HJ9A 3BG3A 4DV0Q 2A1AA 1SDFA 2O5JC 3DM3A 1IBLQ 2ZTDA 3NTHA 1VQIA 5IP9H 4KK7A 3BJUA 1KQSA 1F9RA 2AQ2B 4KKUA 1YJNA 2A69C 3L3OC 4C3IB 1BXTA 3I91A 4JI1Q 5EPJA 1RDPD 4B9WA 2NVQB 1HNZQ 2NB0A 3TS0A 4B3SQ 4UY8C 1Q86C 2WV6D 5CYUA 3KBXA 5IGCA 2K1BA 4DR2L 4O42A 1J6QA 4QF4A 2PNHA 2Q2HA 4X64L 3K0YA 3EJIA 3GTMH 5KGUA 2E74C 4K5WA 4PMCA 4F88A 4XT3B 4LMQD 1UE5A 4CDDC 1G91A 5DEHA 5E4WC 2A69D 5HGQA 1VQAA 3NTKA 1ASZA 4P75A 3OW7A 1Y1WB 4K8IA 5IYBH 1HQRD 4Z9CB 2G9DA 1S4ZA 2F4IA 2QDLA 3OTOQ 5DM73 1JWUD 3PF4A 4GNXC 4BBSG 2ES2A 3TDQA 4IUVA 1Z6HA 5HGTA 4ZAIA 2XRQD 2PPBC 4HJ8A 2R6GA 4GOPC 2CWPA 1HFNA 1YVCA 1MJCA 3UE0A 4ULLA 2EE1A 3QO2A 1UE1A 4EQPA 5EPLA 1KRTA 2K4KA 4DV1Q 3TSSA 1SYEA 1XNRL 4ZUJA 1V8QA 4ILWA 1X54A 1D8LA 2JA6G 4DGZA 2TMPA 3GTGH 3M4OH 4A93H 3FKIG 1VQFA 1S5FD 4M8AA 1X65A 2EYHA 3H6MA 1TWGB 2OCEA 1Q46A 4DN4M 4K8JA 1ENCA 4H13C 5K5PA 4R1JA 3KJPA 1DYQA 1C4QA 2RDFA 3U50C 4OX9L 1I4QA 2XNAC 3FEWX 1PFMA 1BR9A 2EYPA 4IOCA 2CCZA 3M4QA 2UXDL 1FNVA 1VQLA 4DR2Q 3GP7A 2J7ZA 2LXKA 2JA6B 2O4XA 5FJ8H 4HCSA 1EYGA 2FMMA 4UP9A 2CQOA 2KHJA 1NCVA 1C8CA 3HOUG 4I7AA 1WJJA 3FKIB 4RCNA 1F9PA 4DR6L 2ZJQA 2E2JH 2JA7H 3D4RA 1KHIA 1VQPA 5JVG3 5C0XJ 3TZUA 5M3FH 2K5VA 2N3SA 3I4MG 1LTTD 1A8VA 3HP3A 3TN2A 1EY6A 3CP0A 2QW7A 3SK4A 4C1NI 1XPRA 1Q82C 1E22A 1XMOL 5EJWA 4YHHL 4GS3A 4A3JH 4XIGS 4DXGA 2BDNA 4LF9L 3VR4A 3J81j 4IJLA 2GN5A 2JK8A 4O1NA 5BN3A 1NSNS 1Q3LA 4YWMA 1EEFD 3FRPB 3V2TA 2AUKA 1EQTA 4R8NA 4QIWB 4HCEA 1KIXA
chains in the Genus database with same CATH topology
2HHHL 4LNQA 4AYBE 3M7NA 1I50H 1YBYA 4HIKA 3HOUH 4DV7L 2K5HA 1D7QA 1A0IA 2CWAA 2RHSB 5C4XH 1N8RC 1K8AC 5LMNL 4P74A 3KYHC 4HJAA 3AQQA 2V1CC 1W2BA 2IX1A 1FGUA 4IFDG 2WAQE 4JV5Q 4DR3Q 2WB1E 3I4MH 2VZAA 5FLMH 1FL0A 4IPCA 3GTKH 4JI8Q 1OTCA 4MZ9A 3J7ZC 3J7A5 4A3MG 1AE3A 2RCNA 4H02A 3CCQA 4K0KL 2UXCQ 1C9OA 1JE5A 3WWVA 4QY7A 5IP7H 3CC2A 1VQ9A 4B3MQ 1PVOA 4X6AH 4FDBA 3HKZG 4L5QA 1IBML 2D0OA 4A3DH 4OX9Q 4RG1A 4LF4L 2UXBL 5GAGC 1YZ6A 3CMAA 2JA5H 4JI0Q 1HR0L 4DV6Q 3J80c 4TVAB 2EQSA 1PH5A 1CKNA 3T1HQ 5GQOA 3CCLA 1JMCA 3HOYH 3A0JA 3BU2A 4P71A 3TRZA 4X62Q 3S2HH 3HOVG 4B3RL 4GKJL 4YWLA 5AJ3L 2VQEL 1OXUA 1WCMG 3CCRA 4DUZL 1EOVA 1VQ5A 3CMEA 2B63G 1C7YA 1K3RA 2E5LL 1SN8A 5M3MG 3S1MH 3HOZG 2OWOA 2EXDA 1IYJB 4A3GG 2PQAA 5GROA 1QZHA 2I0QA 4QIWE 2F4VQ 2AWOA 4KI0A 2JA8G 3H0GG 4LF8L 4XTCS 2NN6I 1Q1BA 2IT1A 3NENA 3GD7A 3DLLA 1VQJA 4DR6Q 3AFPA 3T1YL 1KIXA 1VQNA 3ER0A 1GM5A 3K8AA 4A3MH 1N9WA 1VQGA 4A76A 4OXPA 1XNQL 4L5RC 4A3FG 3E0EA 2MNAA 1IZ6A 5JJLA 5GAEC 3RNUA 1XMOQ 1Z47A 2D62A 4DV0L 3RZDH 4JOIA 5E7NA 4AQYL 2BH2A 2R93G 2Z6KA 2N49A 3UDXA 3OW2A 4A3IG 2YTXA 3RLOA 3S16H 4A3LG 1IBLL 4KHZA 1MJEA 4LF9Q 4HIMA 2R7FA 4A3CG 1YHBA 3IRBA 3K7AH 2ZM6Q 3HOVH 4DK3C 1WCMH 2VY3A 2B63H 5IYDG 1VS0A 3CPWA 4LUZA 5M3MH 3GTQH 3HOZH 3I55A 1HNZL 4B3SL 4A3GH 1WOCA 2HHHQ 4B3TL 1O7IA 1GKHA 3B6YA 3M9BA 4R4OA 3RR5A 3I4OA 3G6EA 2JA8H 1B7YB 3H0GH 3UDFA 2HT1A 1M90C 3S14H 3PO2G 4JV5L 2UU9L 1Q81C 1EWIA 4C2MH 4A3BG 3I4NG 1FVIA 4DV3L 4RMFA 3K80C 4OWXB 4X64Q 4LF6L 1FJGL 4LW1A 1N34Q 2BA1A 5M5XH 3S15H 3RLNA 4A3FH 1EQQA 4NB3A 1TWAH 1KAWA 1X3EA 4X65L 1AH9A 4IPHA 4OWTB 5LMUL 4YCWA 3CCSA 2PMZE 4UP8A 3RZOH 4OO1G 2R93H 3HKZE 1U0LA 1IBKQ 3OYYA 2CFMA 5C0XI 1QUQB 4UP7A 1MKHA 2JQOA 3HOXH 4A3IH 2GVAA 1PH6A 1SROA 4DNIA 4JYAL 3RN5A 2UXBQ 4BY1G 2H5XA 1L0WA 2VL6A 1HR0Q 5FLXc 4A3CH 4EX5A 3G71A 2PI2A 1HZ9A 3AYHB 3ULPA 1X9NA 4B3RQ 2B29A 3J81i 1K73C 1V9PA 1NMGA 3OTOL 5IYDH 1UEBA 1RIPA 3EN2A 2UUAQ 4DUZQ 1N32Q 1YEZA 4DV2L 1Q7YC 2Y0SG 2E5LQ 4L5TA 4JCVE 1VQPA 4POGA 4POFA 2I5MX 3PO2H 2IX0A 1PH9A 1CSQA 3CD6A 3STBD 2RF4A 1JT8A 3ICEA 1PFSA 4Y7NH 4A3BH 3KF6A 2NN6G 3I4NH 1JB7A 1E1OA 2K5NA 1V1QA 2YU9H 3JC66 4L5SA 1X3GA 4IPGA 4DR4L 4R4IA 4HIDA 1E3PA 4C3HH 1K9MC 4JI7Q 3HOWG 2BH8A 2EIFA 1XNRQ 4LUVA 3G48A 1PA6A 4LF7L 2E8GA 1NMFA 4NXNL 1XNQQ 4A3LH 1HZAA 5IY0A 2R7DA 2A19A 4DR7L 5BR8L 4AQYQ 4J15A 2HIXA 3JAMi 4BY1H 3CC7A 4HJ5A 1C0AA 3F8TA 3I7FA 2JE6I 3GTOH 4PMWA 1HZCA 4OONA 1EUJA 1YJ9A 2ASBA 4LFAQ 3K81C 1Y1WG 2HQLA 4JI5L 5HY6A 5C3EG 1SE8A 2JEBI 3CCEA 1PH4A 4JI2L 2F3IA 2I5HA 1OXSC 1VQBA 1L1OA 3HKSA 4JOIC 1GO3E 4C3IH 2NVQH 2Z6KC 1I94Q 3KLWA 4BXXG 3G4SA 1VQ4A 2QGQA 3E9HA 1E24A 5IWAL 3KDFA 2UXDQ 4WJ4A 1SR3A 4JBKA 2KENA 4DV3Q 3ULLA 3HOWH 1LM0A 1HR0W 1BVSA 2Q2IA 3BZCA 1Q1EA 4JBWA 4P73A 4YCUA 1S3OA 4LUOA 2K50A 3PUXA 2ZTCA 4O2DA 5M5WH 3D31A 5LMUQ 4BY7G 1B70B 1V43A 4JC0A 3MEFA 5C4JH 4DPGA 2ZJRA 3D0FA 3H15A 5C0XG 2MFIA 1VQOA 4DV5Q 2NVXH 3A74A 4KHPQ 4PZ8A 3RN2A 1QVGA 2Q2TA 4JI4L 1QVFA 3LGJA 2KHIA 4X66L 3ZJYC 5IT9c 2ATWA 3TS2A 3H3VI 1WFQA 1P16A 2XTIA 4R4TA 1E7ZA 3M85A 1Y1WH 5C3EH 1HJPA 2C35B 3F2BA 1KXLA 3PIPA 1WYDA 4DR5L 1KD1C 4QJFA 2Y0SE 4LF5L 4LWCA 4YHHQ 5EAYA 1KC8C 4PZ7A 2UUCQ 4BXXH 3HOXG 1JJ2A 2LXJA 3L0OA 4DKAC 3L2PA 2WP8J 4A75A 1I6HH 5K36G 1HNXL 1CSPA 5J3BA 1KRSA 2IHEA 1G6PA 3CPFA 4O0AA 4IOAA 1X3FA 2OTLA 3PCOB 4GKKL 4GLXA 1XMQL 1G291 4JI3L 1JJCB 1MIUA 4DR4Q 4JI1L 4AYBG 2K75A 3GO5A 1R9TH 4JI6Q 3GDEA 1YHQA 2ZJPA 3KJOA 4YCVA 4LF7Q 4DV7Q 4NXNQ 4BY7H 4IFDI 4ME3A 3U4ZA 4P72A 2YTYA 4GLAC 4BBRG 1EFWA 5LMNQ 1TWCH 4IFDJ 3NBHB 2WB1G 3J80i 2KBNA 4DUYL 4DR3L 4R4QA 1N33L 1NY4A 3KFUA 1SRUA 4WJ3M 1RL2A 3FHWA 2CKZB 3GTJH 1NTGA 2FXQA 1J5EL 4GNXA 2ZTEA 3RLFA 4KLKA 2YTVA 1PHJA 1TWGH 1VQ7A 2F52A 4K0KQ 1JJGA 1GVPA 1OXXK 4UPAA 2VW9A 1VQDA 4GOPA 2D0PA 4HJ7A 2WFWA 2DUDA 1K8GA 1Y1VG 2R92G 1IBMQ 5M5YH 3TEHB 4DV4L 4LF4Q 1AE2A 4JI2Q 4DV6L 4MTNA 4IPDA 5ELOA 1PYSB 1P8LA 1X6OA 1PYBA 4JBJA 4YY3L 3PF5A 4X62L 3JAMc 3S2DH 4JG2A 1LYLA 1VQKA 4GKJQ 3M3YH 1HNWL 5IP9G 4NXML 5AJ3Q 4DK6C 3S1RH 2VQEQ 2OQKA 1Q12A 1UE6A 3PSIA 2B3GA 4MNOA 2YV5A 1PH3A 2I5LX 4BBRH 3K7UC 4YWKA 2VQFL 2VNUD 4HIOA 3PUZA 1NJIC 1YJWA 1YNXA 4LF8Q 1L1OC 2E2IH 1YHAA 1L2FA 4DAYB 2NZOA 2JA9A 1B8AA 3E9IA 3F1ZA 3T1YQ 1LUZA 4DV1L 2OTJA 3AFQA 1HZBA 4PG3A 3I2ZA 4X66Q 2HIVA 3PUWA 4BA2I 1H95A 1EIYB 2R92H 3ULJA 2PI2E 4HJ9A 1Y1VH 4DR5Q 1IL2A 3MXNB 2AMCB 3PGZA 2A1AA 4GN3B 4DV0Q 4LF5Q 2IY5B 1QUQA 4TQUS 1IXRA 4AIMA 3Q8DA 4Y52H 1QZGA 1CKNB 3DM3A 3M4PA 3ERSX 3PV0A 4LFCL 2RHQB 2ZTDA 1HNXQ 5C44G 1IBLQ 5LMNW 1VQIA 3L7ZC 5IP9H 5IYBG 4NPSA 2F4VL 3BJUA 1PH7A 3GTPH 4DR1L 5DLQE 3W1GA 1KQSA 4GKKQ 3VDYA 1PH8A 4R4CA 3FP9A 3F2CA 1YJNA 4JI3Q 2AHOB 1GD7A 4JI1Q 3PIOA 1HNZQ 3TS0A 4B3SQ 4UY8C 1Q86C 1Q8KA 3CQZH 1UE7A 1DGSA 2PQAB 1CUKA 4B3TQ 4LFBL 1S40A 3NEMA 1A63A 5JEAG 1VQ8A 2QA4A 1PH2A 2UU9Q 2KCTA 4DR2L 4DUYQ 1J6QA 1N33Q 2PNHA 2Q2HA 2VS1A 4X64L 2GVBA 1N34L 1FJGQ 4LF6Q 3GTMH 2JEAI 1T9HA 2R7ZG 3H3VH 1J5EQ 5H1SE 1N36L 1HH2P 1CKMA 3CXCA 2A8VA 4GN5A 3NELA 4OO1I 2K52A 1UE5A 4X65Q 4IJHA 1IBKL 2IHFA 1SLJA 2AKWB 5HGQA 1VQAA 1ASYA 2UUBQ 4DV4Q 1E1TA 4P75A 1ASZA 4A93G 5ELNA 4JYAQ 1UWVA 5IE8A 5C44H 2Z0SA 4YY3Q 2ID0A 5IYBH 3KF8B 5JJKA 2UUAL 5JJIA 1I3QH 1X55A 4DAMA 1Y14B 3OTOQ 1HNWQ 4NXMQ 1VQ6A 3PF4A 1N32L 4GNXC 2NVYH 2LSSA 3PO3G 4BBSG 1BBUA 4DV2Q 3TREA 2ES2A 1PH1A 2VUMH 3A5ZB 4GN4B 4HJ8A 2R6GA 4A4IA 4GOPC 2CWPA 4A3EG 2VQFQ 1YVCA 3K0XA 1MJCA 3UE0A 1EQRA 1X56A 4QQBX 2AWNA 3W1BA 1UE1A 3A5UA 2L15A 1KRTA 2K4KA 3S1NH 1BBWA 4DV1Q 4JI7L 3J81c 2R7ZH 4GNXB 1QVCA 5FJ8G 1XNRL 1EIFA 1X54A 4C3JH 1D8LA 2JA6G 3CCMA 3CC4A 4GOPB 2WAQG 4BA1I 1K0RA 1VCIA 3GTGH 3GTLH 4JBMA 4DR7Q 3M4OH 1A62A 3UDGA 4A93H 5BR8Q 3EBEA 2JA7G 2YYZA 1VQMA 1BKBA 3FKIG 1NBWA 5M3FG 1VQFA 1YITA 4JI5Q 1TXYA 1X65A 4JI8L 2QEXA 2Q2UA 4LFCQ 1VQCA 2VUMG 2OCEA 1XPOA 4LFAL 2DGYA 1Q46A 2UXCL 1XTDA 4GLVB 3U58A 1TWHH 1KL9A 3PO3H 4DR1Q 4B3ML 2ALYB 4BBSH 5GADC 3HFZB 4R1JA 4QL5A 3KJPA 2NVTH 3U50C 4OX9L 1XPUA 4APVA 4JI0L 4A3JG 2K14A 1VQHA 4A3EH 4IOCA 2UUBL 1I94L 4LFBQ 1I5FA 1OXVA 3T1HL 1U5KA 5JEAJ 3W5OA 3F2DA 1XJVA 2CCZA 3M4QA 1NE3A 3KF6B 3PUYA 2UXDL 2N78A 1VQLA 5IWAQ 4DR2Q 2MQHA 3UDIA 2LXKA 5FJ8H 4A3KG 1VQEA 3CCUA 1EYGA 5IYCG 3EIVA 4UP9A 2CQOA 2KHJA 2JA6H 1WI5A 1SMXA 3STBC 1YIJA 4AH6A 1LTLA 1N36Q 1WJJA 2XGTA 4IO9A 3HOUG 5C4XG 4ALPA 3CF5A 2ZJQA 4DR6L 3CCVA 3TQYA 2E2JH 2JA7H 4QGUA 1Z9FA 1KHIA 2NZHA 3FKIH 3PUVA 5C0XJ 2OQ0A 2JJQA 2K5VA 2N8NA 3CW2C 5M3FH 2KCMA 4DV5L 2N3SA 3I4MG 4KHPL 3SGIA 4OWWB 3CAMA 1K83H 1A8VA 5FLMG 4JI4Q 3CP0A 4EQ5A 3KOJA 1YI2A 1G51A 1XPRA 1Q82C 1E22A 1XMOL 5IP7G 1OXTA 4PZ6A 1PV4A 2MO0A 4YHHL 1SFOH 4GS3A 1TWFH 4XIGS 1CKOA 4A3JH 2UUCL 4A3DG 3AEVA 1L1OB 3UE1A 2JA5G 3I56A 4LF9L 3BZKA 3J81j 4IJLA 2ZM6L 1M1KC 2MO1A 3S24A 2GN5A 2JK8A 3KDFB 5GAHC 2E2HH 3HOYG 3S17H 4YWMA 1S72A 3CCJA 1W3SA 4A3KH 3S1QH 3U4VA 4JI6L 5IYCH 2BA0A 1XMQQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH L;  4LNQ A;  4AYB E;  3M7N A;  1I50 H;  1YBY A;  4HIK A;  3HOU H;  4DV7 L;  2K5H A;  1D7Q A;  1A0I A;  2CWA A;  2RHS B;  5C4X H;  1N8R C;  1K8A C;  5LMN L;  4P74 A;  3KYH C;  4HJA A;  3AQQ A;  2V1C C;  1W2B A;  2IX1 A;  1FGU A;  4IFD G;  2WAQ E;  4JV5 Q;  4DR3 Q;  2WB1 E;  3I4M H;  2VZA A;  5FLM H;  1FL0 A;  4IPC A;  3GTK H;  4JI8 Q;  1OTC A;  4MZ9 A;  3J7Z C;  3J7A 5;  4A3M G;  1AE3 A;  2RCN A;  4H02 A;  3CCQ A;  4K0K L;  2UXC Q;  1C9O A;  1JE5 A;  3WWV A;  4QY7 A;  5IP7 H;  3CC2 A;  1VQ9 A;  4B3M Q;  1PVO A;  4X6A H;  4FDB A;  3HKZ G;  4L5Q A;  1IBM L;  2D0O A;  4A3D H;  4OX9 Q;  4RG1 A;  4LF4 L;  2UXB L;  5GAG C;  1YZ6 A;  3CMA A;  2JA5 H;  4JI0 Q;  1HR0 L;  4DV6 Q;  3J80 c;  4TVA B;  2EQS A;  1PH5 A;  1CKN A;  3T1H Q;  5GQO A;  3CCL A;  1JMC A;  3HOY H;  3A0J A;  3BU2 A;  4P71 A;  3TRZ A;  4X62 Q;  3S2H H;  3HOV G;  4B3R L;  4GKJ L;  4YWL A;  5AJ3 L;  2VQE L;  1OXU A;  1WCM G;  3CCR A;  4DUZ L;  1EOV A;  1VQ5 A;  3CME A;  2B63 G;  1C7Y A;  1K3R A;  2E5L L;  1SN8 A;  5M3M G;  3S1M H;  3HOZ G;  2OWO A;  2EXD A;  1IYJ B;  4A3G G;  2PQA A;  5GRO A;  1QZH A;  2I0Q A;  4QIW E;  2F4V Q;  2AWO A;  4KI0 A;  2JA8 G;  3H0G G;  4LF8 L;  4XTC S;  2NN6 I;  1Q1B A;  2IT1 A;  3NEN A;  3GD7 A;  3DLL A;  1VQJ A;  4DR6 Q;  3AFP A;  3T1Y L;  1KIX A;  1VQN A;  3ER0 A;  1GM5 A;  3K8A A;  4A3M H;  1N9W A;  1VQG A;  4A76 A;  4OXP A;  1XNQ L;  4L5R C;  4A3F G;  3E0E A;  2MNA A;  1IZ6 A;  5JJL A;  5GAE C;  3RNU A;  1XMO Q;  1Z47 A;  2D62 A;  4DV0 L;  3RZD H;  4JOI A;  5E7N A;  4AQY L;  2BH2 A;  2R93 G;  2Z6K A;  2N49 A;  3UDX A;  3OW2 A;  4A3I G;  2YTX A;  3RLO A;  3S16 H;  4A3L G;  1IBL L;  4KHZ A;  1MJE A;  4LF9 Q;  4HIM A;  2R7F A;  4A3C G;  1YHB A;  3IRB A;  3K7A H;  2ZM6 Q;  3HOV H;  4DK3 C;  1WCM H;  2VY3 A;  2B63 H;  5IYD G;  1VS0 A;  3CPW A;  4LUZ A;  5M3M H;  3GTQ H;  3HOZ H;  3I55 A;  1HNZ L;  4B3S L;  4A3G H;  1WOC A;  2HHH Q;  4B3T L;  1O7I A;  1GKH A;  3B6Y A;  3M9B A;  4R4O A;  3RR5 A;  3I4O A;  3G6E A;  2JA8 H;  1B7Y B;  3H0G H;  3UDF A;  2HT1 A;  1M90 C;  3S14 H;  3PO2 G;  4JV5 L;  2UU9 L;  1Q81 C;  1EWI A;  4C2M H;  4A3B G;  3I4N G;  1FVI A;  4DV3 L;  4RMF A;  3K80 C;  4OWX B;  4X64 Q;  4LF6 L;  1FJG L;  4LW1 A;  1N34 Q;  2BA1 A;  5M5X H;  3S15 H;  3RLN A;  4A3F H;  1EQQ A;  4NB3 A;  1TWA H;  1KAW A;  1X3E A;  4X65 L;  1AH9 A;  4IPH A;  4OWT B;  5LMU L;  4YCW A;  3CCS A;  2PMZ E;  4UP8 A;  3RZO H;  4OO1 G;  2R93 H;  3HKZ E;  1U0L A;  1IBK Q;  3OYY A;  2CFM A;  5C0X I;  1QUQ B;  4UP7 A;  1MKH A;  2JQO A;  3HOX H;  4A3I H;  2GVA A;  1PH6 A;  1SRO A;  4DNI A;  4JYA L;  3RN5 A;  2UXB Q;  4BY1 G;  2H5X A;  1L0W A;  2VL6 A;  1HR0 Q;  5FLX c;  4A3C H;  4EX5 A;  3G71 A;  2PI2 A;  1HZ9 A;  3AYH B;  3ULP A;  1X9N A;  4B3R Q;  2B29 A;  3J81 i;  1K73 C;  1V9P A;  1NMG A;  3OTO L;  5IYD H;  1UEB A;  1RIP A;  3EN2 A;  2UUA Q;  4DUZ Q;  1N32 Q;  1YEZ A;  4DV2 L;  1Q7Y C;  2Y0S G;  2E5L Q;  4L5T A;  4JCV E;  1VQP A;  4POG A;  4POF A;  2I5M X;  3PO2 H;  2IX0 A;  1PH9 A;  1CSQ A;  3CD6 A;  3STB D;  2RF4 A;  1JT8 A;  3ICE A;  1PFS A;  4Y7N H;  4A3B H;  3KF6 A;  2NN6 G;  3I4N H;  1JB7 A;  1E1O A;  2K5N A;  1V1Q A;  2YU9 H;  3JC6 6;  4L5S A;  1X3G A;  4IPG A;  4DR4 L;  4R4I A;  4HID A;  1E3P A;  4C3H H;  1K9M C;  4JI7 Q;  3HOW G;  2BH8 A;  2EIF A;  1XNR Q;  4LUV A;  3G48 A;  1PA6 A;  4LF7 L;  2E8G A;  1NMF A;  4NXN L;  1XNQ Q;  4A3L H;  1HZA A;  5IY0 A;  2R7D A;  2A19 A;  4DR7 L;  5BR8 L;  4AQY Q;  4J15 A;  2HIX A;  3JAM i;  4BY1 H;  3CC7 A;  4HJ5 A;  1C0A A;  3F8T A;  3I7F A;  2JE6 I;  3GTO H;  4PMW A;  1HZC A;  4OON A;  1EUJ A;  1YJ9 A;  2ASB A;  4LFA Q;  3K81 C;  1Y1W G;  2HQL A;  4JI5 L;  5HY6 A;  5C3E G;  1SE8 A;  2JEB I;  3CCE A;  1PH4 A;  4JI2 L;  2F3I A;  2I5H A;  1OXS C;  1VQB A;  1L1O A;  3HKS A;  4JOI C;  1GO3 E;  4C3I H;  2NVQ H;  2Z6K C;  1I94 Q;  3KLW A;  4BXX G;  3G4S A;  1VQ4 A;  2QGQ A;  3E9H A;  1E24 A;  5IWA L;  3KDF A;  2UXD Q;  4WJ4 A;  1SR3 A;  4JBK A;  2KEN A;  4DV3 Q;  3ULL A;  3HOW H;  1LM0 A;  1HR0 W;  1BVS A;  2Q2I A;  3BZC A;  1Q1E A;  4JBW A;  4P73 A;  4YCU A;  1S3O A;  4LUO A;  2K50 A;  3PUX A;  2ZTC A;  4O2D A;  5M5W H;  3D31 A;  5LMU Q;  4BY7 G;  1B70 B;  1V43 A;  4JC0 A;  3MEF A;  5C4J H;  4DPG A;  2ZJR A;  3D0F A;  3H15 A;  5C0X G;  2MFI A;  1VQO A;  4DV5 Q;  2NVX H;  3A74 A;  4KHP Q;  4PZ8 A;  3RN2 A;  1QVG A;  2Q2T A;  4JI4 L;  1QVF A;  3LGJ A;  2KHI A;  4X66 L;  3ZJY C;  5IT9 c;  2ATW A;  3TS2 A;  3H3V I;  1WFQ A;  1P16 A;  2XTI A;  4R4T A;  1E7Z A;  3M85 A;  1Y1W H;  5C3E H;  1HJP A;  2C35 B;  3F2B A;  1KXL A;  3PIP A;  1WYD A;  4DR5 L;  1KD1 C;  4QJF A;  2Y0S E;  4LF5 L;  4LWC A;  4YHH Q;  5EAY A;  1KC8 C;  4PZ7 A;  2UUC Q;  4BXX H;  3HOX G;  1JJ2 A;  2LXJ A;  3L0O A;  4DKA C;  3L2P A;  2WP8 J;  4A75 A;  1I6H H;  5K36 G;  1HNX L;  1CSP A;  5J3B A;  1KRS A;  2IHE A;  1G6P A;  3CPF A;  4O0A A;  4IOA A;  1X3F A;  2OTL A;  3PCO B;  4GKK L;  4GLX A;  1XMQ L;  1G29 1;  4JI3 L;  1JJC B;  1MIU A;  4DR4 Q;  4JI1 L;  4AYB G;  2K75 A;  3GO5 A;  1R9T H;  4JI6 Q;  3GDE A;  1YHQ A;  2ZJP A;  3KJO A;  4YCV A;  4LF7 Q;  4DV7 Q;  4NXN Q;  4BY7 H;  4IFD I;  4ME3 A;  3U4Z A;  4P72 A;  2YTY A;  4GLA C;  4BBR G;  1EFW A;  5LMN Q;  1TWC H;  4IFD J;  3NBH B;  2WB1 G;  3J80 i;  2KBN A;  4DUY L;  4DR3 L;  4R4Q A;  1N33 L;  1NY4 A;  3KFU A;  1SRU A;  4WJ3 M;  1RL2 A;  3FHW A;  2CKZ B;  3GTJ H;  1NTG A;  2FXQ A;  1J5E L;  4GNX A;  2ZTE A;  3RLF A;  4KLK A;  2YTV A;  1PHJ A;  1TWG H;  1VQ7 A;  2F52 A;  4K0K Q;  1JJG A;  1GVP A;  1OXX K;  4UPA A;  2VW9 A;  1VQD A;  4GOP A;  2D0P A;  4HJ7 A;  2WFW A;  2DUD A;  1K8G A;  1Y1V G;  2R92 G;  1IBM Q;  5M5Y H;  3TEH B;  4DV4 L;  4LF4 Q;  1AE2 A;  4JI2 Q;  4DV6 L;  4MTN A;  4IPD A;  5ELO A;  1PYS B;  1P8L A;  1X6O A;  1PYB A;  4JBJ A;  4YY3 L;  3PF5 A;  4X62 L;  3JAM c;  3S2D H;  4JG2 A;  1LYL A;  1VQK A;  4GKJ Q;  3M3Y H;  1HNW L;  5IP9 G;  4NXM L;  5AJ3 Q;  4DK6 C;  3S1R H;  2VQE Q;  2OQK A;  1Q12 A;  1UE6 A;  3PSI A;  2B3G A;  4MNO A;  2YV5 A;  1PH3 A;  2I5L X;  4BBR H;  3K7U C;  4YWK A;  2VQF L;  2VNU D;  4HIO A;  3PUZ A;  1NJI C;  1YJW A;  1YNX A;  4LF8 Q;  1L1O C;  2E2I H;  1YHA A;  1L2F A;  4DAY B;  2NZO A;  2JA9 A;  1B8A A;  3E9I A;  3F1Z A;  3T1Y Q;  1LUZ A;  4DV1 L;  2OTJ A;  3AFQ A;  1HZB A;  4PG3 A;  3I2Z A;  4X66 Q;  2HIV A;  3PUW A;  4BA2 I;  1H95 A;  1EIY B;  2R92 H;  3ULJ A;  2PI2 E;  4HJ9 A;  1Y1V H;  4DR5 Q;  1IL2 A;  3MXN B;  2AMC B;  3PGZ A;  2A1A A;  4GN3 B;  4DV0 Q;  4LF5 Q;  2IY5 B;  1QUQ A;  4TQU S;  1IXR A;  4AIM A;  3Q8D A;  4Y52 H;  1QZG A;  1CKN B;  3DM3 A;  3M4P A;  3ERS X;  3PV0 A;  4LFC L;  2RHQ B;  2ZTD A;  1HNX Q;  5C44 G;  1IBL Q;  5LMN W;  1VQI A;  3L7Z C;  5IP9 H;  5IYB G;  4NPS A;  2F4V L;  3BJU A;  1PH7 A;  3GTP H;  4DR1 L;  5DLQ E;  3W1G A;  1KQS A;  4GKK Q;  3VDY A;  1PH8 A;  4R4C A;  3FP9 A;  3F2C A;  1YJN A;  4JI3 Q;  2AHO B;  1GD7 A;  4JI1 Q;  3PIO A;  1HNZ Q;  3TS0 A;  4B3S Q;  4UY8 C;  1Q86 C;  1Q8K A;  3CQZ H;  1UE7 A;  1DGS A;  2PQA B;  1CUK A;  4B3T Q;  4LFB L;  1S40 A;  3NEM A;  1A63 A;  5JEA G;  1VQ8 A;  2QA4 A;  1PH2 A;  2UU9 Q;  2KCT A;  4DR2 L;  4DUY Q;  1J6Q A;  1N33 Q;  2PNH A;  2Q2H A;  2VS1 A;  4X64 L;  2GVB A;  1N34 L;  1FJG Q;  4LF6 Q;  3GTM H;  2JEA I;  1T9H A;  2R7Z G;  3H3V H;  1J5E Q;  5H1S E;  1N36 L;  1HH2 P;  1CKM A;  3CXC A;  2A8V A;  4GN5 A;  3NEL A;  4OO1 I;  2K52 A;  1UE5 A;  4X65 Q;  4IJH A;  1IBK L;  2IHF A;  1SLJ A;  2AKW B;  5HGQ A;  1VQA A;  1ASY A;  2UUB Q;  4DV4 Q;  1E1T A;  4P75 A;  1ASZ A;  4A93 G;  5ELN A;  4JYA Q;  1UWV A;  5IE8 A;  5C44 H;  2Z0S A;  4YY3 Q;  2ID0 A;  5IYB H;  3KF8 B;  5JJK A;  2UUA L;  5JJI A;  1I3Q H;  1X55 A;  4DAM A;  1Y14 B;  3OTO Q;  1HNW Q;  4NXM Q;  1VQ6 A;  3PF4 A;  1N32 L;  4GNX C;  2NVY H;  2LSS A;  3PO3 G;  4BBS G;  1BBU A;  4DV2 Q;  3TRE A;  2ES2 A;  1PH1 A;  2VUM H;  3A5Z B;  4GN4 B;  4HJ8 A;  2R6G A;  4A4I A;  4GOP C;  2CWP A;  4A3E G;  2VQF Q;  1YVC A;  3K0X A;  1MJC A;  3UE0 A;  1EQR A;  1X56 A;  4QQB X;  2AWN A;  3W1B A;  1UE1 A;  3A5U A;  2L15 A;  1KRT A;  2K4K A;  3S1N H;  1BBW A;  4DV1 Q;  4JI7 L;  3J81 c;  2R7Z H;  4GNX B;  1QVC A;  5FJ8 G;  1XNR L;  1EIF A;  1X54 A;  4C3J H;  1D8L A;  2JA6 G;  3CCM A;  3CC4 A;  4GOP B;  2WAQ G;  4BA1 I;  1K0R A;  1VCI A;  3GTG H;  3GTL H;  4JBM A;  4DR7 Q;  3M4O H;  1A62 A;  3UDG A;  4A93 H;  5BR8 Q;  3EBE A;  2JA7 G;  2YYZ A;  1VQM A;  1BKB A;  3FKI G;  1NBW A;  5M3F G;  1VQF A;  1YIT A;  4JI5 Q;  1TXY A;  1X65 A;  4JI8 L;  2QEX A;  2Q2U A;  4LFC Q;  1VQC A;  2VUM G;  2OCE A;  1XPO A;  4LFA L;  2DGY A;  1Q46 A;  2UXC L;  1XTD A;  4GLV B;  3U58 A;  1TWH H;  1KL9 A;  3PO3 H;  4DR1 Q;  4B3M L;  2ALY B;  4BBS H;  5GAD C;  3HFZ B;  4R1J A;  4QL5 A;  3KJP A;  2NVT H;  3U50 C;  4OX9 L;  1XPU A;  4APV A;  4JI0 L;  4A3J G;  2K14 A;  1VQH A;  4A3E H;  4IOC A;  2UUB L;  1I94 L;  4LFB Q;  1I5F A;  1OXV A;  3T1H L;  1U5K A;  5JEA J;  3W5O A;  3F2D A;  1XJV A;  2CCZ A;  3M4Q A;  1NE3 A;  3KF6 B;  3PUY A;  2UXD L;  2N78 A;  1VQL A;  5IWA Q;  4DR2 Q;  2MQH A;  3UDI A;  2LXK A;  5FJ8 H;  4A3K G;  1VQE A;  3CCU A;  1EYG A;  5IYC G;  3EIV A;  4UP9 A;  2CQO A;  2KHJ A;  2JA6 H;  1WI5 A;  1SMX A;  3STB C;  1YIJ A;  4AH6 A;  1LTL A;  1N36 Q;  1WJJ A;  2XGT A;  4IO9 A;  3HOU G;  5C4X G;  4ALP A;  3CF5 A;  2ZJQ A;  4DR6 L;  3CCV A;  3TQY A;  2E2J H;  2JA7 H;  4QGU A;  1Z9F A;  1KHI A;  2NZH A;  3FKI H;  3PUV A;  5C0X J;  2OQ0 A;  2JJQ A;  2K5V A;  2N8N A;  3CW2 C;  5M3F H;  2KCM A;  4DV5 L;  2N3S A;  3I4M G;  4KHP L;  3SGI A;  4OWW B;  3CAM A;  1K83 H;  1A8V A;  5FLM G;  4JI4 Q;  3CP0 A;  4EQ5 A;  3KOJ A;  1YI2 A;  1G51 A;  1XPR A;  1Q82 C;  1E22 A;  1XMO L;  5IP7 G;  1OXT A;  4PZ6 A;  1PV4 A;  2MO0 A;  4YHH L;  1SFO H;  4GS3 A;  1TWF H;  4XIG S;  1CKO A;  4A3J H;  2UUC L;  4A3D G;  3AEV A;  1L1O B;  3UE1 A;  2JA5 G;  3I56 A;  4LF9 L;  3BZK A;  3J81 j;  4IJL A;  2ZM6 L;  1M1K C;  2MO1 A;  3S24 A;  2GN5 A;  2JK8 A;  3KDF B;  5GAH C;  2E2H H;  3HOY G;  3S17 H;  4YWM A;  1S72 A;  3CCJ A;  1W3S A;  4A3K H;  3S1Q H;  3U4V A;  4JI6 L;  5IYC H;  2BA0 A;  1XMQ Q; 
#chains in the Genus database with same CATH topology
 4NKL A;  3M7N A;  1U4M A;  4HIK A;  2A68 D;  3AB9 A;  4R9W A;  3I4M B;  3AQQ A;  1W2B A;  3J81 L;  4DR3 Q;  2MJ8 A;  2PZW A;  2VZA A;  1VMC A;  2D2C C;  5FLM H;  2FFK B;  3GTK H;  3UI2 A;  4MZ9 A;  5KND A;  2LKV A;  4A3M G;  1AE3 A;  2RCN A;  1JE5 A;  1A2U A;  4OEL B;  3K5O A;  4X6A H;  2K28 A;  2IWH A;  4K2K A;  4OX9 Q;  4A3D H;  1YZ6 A;  4UHV A;  3J80 c;  1CKN A;  4CKB A;  4P71 A;  2WIN B;  1GOZ A;  4X62 Q;  3S2H H;  3HOV G;  4YWL A;  2F0W A;  1VQ5 A;  1EOV A;  5J39 A;  4K5X A;  3J80 E;  2E5L L;  4N8X 1;  1LTG D;  5M3M G;  3S1M H;  2MHV A;  4A3G G;  5KYI A;  1R4Q B;  4IFD H;  2JA8 G;  4CGY B;  4IN3 A;  5FKA C;  4XTC S;  2NN6 I;  3HEJ A;  4DR6 Q;  1TII D;  1VQN A;  4EQO A;  1HCZ A;  3PIO 3;  5KRU A;  3K8A A;  4X3U A;  2L9H A;  4L5R C;  4A3F G;  1F77 A;  1NAP A;  3T53 B;  1IZ6 A;  5JJL A;  5GAE C;  1XMO Q;  3SK5 A;  3S16 B;  2D62 A;  4JOI A;  2BH2 A;  3UDX A;  4KHZ A;  1MJE A;  5FOB B;  4LF9 Q;  4HIM A;  1YHB A;  4DK3 C;  2XWJ B;  1WCM H;  3SE0 A;  1IKL A;  1PZK D;  4A3G B;  3CPW A;  1CA5 A;  4LUZ A;  4A3E B;  2JA8 B;  1WOC A;  4PV1 C;  4XQQ A;  3I4O A;  2KUM A;  1F9Q A;  1XWE A;  4C2M H;  4A3B G;  4DV3 L;  2PCF B;  3IAY A;  1LTR D;  2KOL A;  2BA1 A;  2B2W C;  2WAQ B;  5KNC A;  3X3N A;  3WDN A;  2F0P A;  1X3E A;  1EIG A;  5CV9 A;  4IPH A;  4OWT B;  4X65 L;  2I46 A;  3CCS A;  1D5M C;  1E0B A;  5F2D A;  3HOX H;  4A3I H;  2CQA A;  1QUQ B;  1IBK Q;  2VNU D;  2JQO A;  1PH6 A;  2D5D A;  2GVA A;  3SR1 A;  1K83 B;  1SRO A;  3RN5 A;  4BY1 G;  3P75 A;  1L0W A;  4XQN A;  4OL7 A;  3A8K E;  2EYL A;  1GHJ A;  3NQI A;  2DJG C;  1K73 C;  1V9P A;  3QR8 A;  1DZ1 A;  2NTT A;  4DV2 L;  1HTP A;  2Y0S G;  2E5L Q;  4L5T A;  5D3D A;  1MBY A;  2M9V A;  1LAB A;  3K57 A;  3PO2 H;  2IX0 A;  1M4V A;  2PW7 A;  1PH9 A;  3S17 B;  1JOQ A;  4DFA A;  3MXP A;  4R8I A;  2O5I C;  4A3K B;  5C4H A;  2YU9 H;  3JC6 6;  5DM6 3;  1U4P A;  1EZ8 A;  5C4X B;  2BH8 A;  4KD3 A;  2GA4 B;  4KN4 C;  2PO4 A;  4BY1 B;  1SND A;  3KLS X;  4DR7 L;  2B2T C;  2VB2 X;  1WD1 A;  3JAM i;  2M2L A;  1WTV A;  3CU7 A;  3I7F A;  1AFP A;  3BZD B;  2F0F A;  2Y0S B;  1BNZ A;  2ASB A;  3DWP A;  3K81 C;  4IQZ A;  2D9U A;  1BF4 A;  5HY6 A;  3CCE A;  3MXN A;  1HUN A;  4JI2 L;  2F3I A;  2I5H A;  1B9N A;  1VQB A;  4C3I H;  2NVQ H;  4N8F A;  2NN6 H;  3HG9 A;  2F0L A;  1SJH D;  1SR3 A;  2RSN A;  2KEN A;  4DV3 Q;  2C9O A;  1BVS A;  1LTB D;  1LTA D;  1Q1E A;  4JBW A;  3A8J E;  4YCU A;  1F2M A;  2HCI A;  3D31 A;  4BY7 G;  5C3W A;  1V43 A;  5C0X G;  2MFI A;  4ZKB B;  4DV5 Q;  3A74 A;  4K2L A;  4PZ8 A;  3BVM A;  1CFM A;  3ZJY C;  1JOK A;  3AMU A;  3H3V I;  5ELD A;  4LK1 C;  2XTI A;  4R4T A;  5NUC A;  3A7L A;  1Y1W H;  4J8Q A;  2C35 B;  2F0I A;  3PIP A;  4DF7 A;  4QJF A;  1K3B C;  4LWC A;  2EZV A;  4PZ7 A;  2UUC Q;  4JPB W;  2LXJ A;  4U68 A;  1QNU A;  3WOF A;  5K36 G;  3SXH A;  1CSP A;  5J3B A;  2B63 B;  5ISR A;  2IHE A;  1BCP C;  1G6P A;  3CPF A;  3D4W A;  4IOA A;  1X3F A;  2EXZ A;  1R9T B;  4FF1 A;  1SNM A;  1RF2 D;  4AYB G;  2K75 A;  3GDE A;  1YHQ A;  2F3W A;  2YTY A;  3X3M A;  5G3L D;  1EIH A;  3J80 i;  5M5X B;  4WJ3 M;  1LT6 D;  2XWB B;  1EYD A;  2LY7 A;  1BCP D;  3RLF A;  2XSC A;  2R93 B;  2Z6B A;  1TWG H;  1VQ7 A;  3A56 A;  3GQB A;  1SE2 A;  1OXX K;  1VQD A;  2R92 G;  2DUD A;  5M5Y H;  1EFI D;  1PYW D;  1FNU A;  4JI2 Q;  4IPD A;  1P8L A;  1X6O A;  4JBJ A;  4DAV A;  3TP8 A;  1LYL A;  1VQK A;  1HNW L;  4NXM L;  5AJ3 Q;  4IUT A;  3K59 A;  4C56 C;  1LTI D;  1DOK A;  4YWK A;  3PUZ A;  1EYC A;  1CHQ D;  1YHA A;  4DAY B;  2NZO A;  4HMI A;  1V1P A;  2F3V A;  2K32 A;  5JVH 3;  3H94 A;  2ZXO A;  3URY A;  2FIN B;  2WKD A;  2WII B;  1Y1V H;  1IL2 A;  3MXN B;  3PGZ A;  4GN3 B;  1FR3 A;  5FO7 B;  2EY2 A;  4Y52 H;  1BUV T;  4WFN 3;  3M4P A;  3PV0 A;  4E6I A;  5D14 A;  1QZG A;  2RHQ B;  1LLR D;  1TY0 A;  4V0B A;  3QIA A;  4NPS A;  1LAC A;  1CA6 A;  5DLQ E;  2CW0 D;  3W1G A;  4R4C A;  1GUT A;  2BE5 D;  2TSS A;  2VUM G;  1AW7 A;  1ZXT A;  4LFB L;  2PQA B;  1DGS A;  3DM1 A;  1CUK A;  1S40 A;  5JEA G;  4CDC C;  1ICW A;  1PH2 A;  2UU9 Q;  3HOW B;  4G7O C;  4FF2 A;  3FDT A;  3T56 B;  4BS9 A;  1N34 L;  5EKK A;  1B2T A;  1L0X B;  1T9H A;  5HUR A;  2R7Z G;  3H3V H;  1HH2 P;  4GN5 A;  2A6H C;  2E2D C;  2WAC A;  2IHF A;  1SLJ A;  2E75 C;  4F87 A;  1JIC A;  1UWV A;  5C44 H;  1S5C D;  1BDO A;  1PTO B;  2ID0 A;  1EL0 A;  3A7A B;  3VYS A;  2QF7 A;  4DA2 A;  2UUA L;  3BDC A;  1X55 A;  1Y14 B;  1HNW Q;  1N32 L;  4NXM Q;  2VUM B;  1Y8N B;  2JN4 A;  3V96 A;  1W6J A;  4RAU C;  3PO3 G;  1ILP A;  2XRS D;  5E3F A;  1PH1 A;  5FLX L;  4B08 A;  4A4I A;  5CV6 A;  2M00 A;  1F2Y A;  3K0X A;  3NWT A;  3QOL A;  4K6D A;  1EQR A;  1X56 A;  4QQB X;  2EYJ A;  3A5U A;  5T1I A;  1D5Z C;  4X3K A;  3R2T A;  1QVC A;  3DUZ A;  1MSH A;  1SBB B;  3GTL B;  5CMD A;  4C3J H;  3BS1 A;  3CCM A;  4BA1 I;  4JV5 L;  1QCB D;  2HD3 A;  1A62 A;  3I4L A;  5BR8 Q;  3GTJ B;  1VQM A;  1NBW A;  1CI3 M;  1YIT A;  3R93 A;  4ABN A;  4LFA L;  2NVT B;  1JCK B;  5CR3 A;  5JAV A;  3Q0A A;  1KL9 A;  1YNJ D;  5GAD C;  1ESR A;  3TP5 A;  2F0E A;  1I4R A;  3AU7 A;  4A3E H;  4LFB Q;  1I94 L;  1TQO A;  1OXV A;  3T1H L;  3W5O A;  1XJV A;  2B2Y C;  2BOS A;  1UAP A;  2QCP X;  1ICF B;  2F0S A;  2N78 A;  5IWA Q;  2ZXR A;  1S5D D;  2MQH A;  3LNN A;  2X6G A;  3CCU A;  1S5B D;  4BBR B;  3FPP A;  2NBF A;  2BCO A;  1YIJ A;  1LTL A;  4CHT B;  4IO9 A;  2G5D A;  3CF5 A;  5I6W A;  3N52 A;  4QGU A;  3PUV A;  3E3X A;  2JJQ A;  3CW2 C;  2KCM A;  3GV6 A;  1SMY D;  3SGI A;  1XX8 A;  4OWW B;  3CAM A;  1K83 H;  4JI4 Q;  3VR6 A;  1YI2 A;  3ND9 A;  5IP7 G;  1SFO H;  1CKO A;  3AEV A;  2K5D A;  4RWS C;  4NMZ A;  3UE1 A;  2JA5 G;  4RH6 A;  3BZK A;  3U9O A;  5KIX A;  3S24 A;  3KDF B;  5G3L F;  5M9O A;  4IUQ A;  5GAH C;  2E2H H;  3HOY G;  3S17 H;  1S72 A;  3CCJ A;  5EKL A;  4A3K H;  2CH4 W;  5IYC H;  2MNA A;  3CQZ B;  2BA0 A;  4KN7 C;  2B2V A;  4LNQ A;  1HRJ A;  4AYB E;  4ZRZ A;  2K5H A;  1A0I A;  1BCP F;  2RHS B;  3MXG A;  5C4X H;  1PFN A;  5LMN L;  4P74 A;  5CV7 A;  2IX1 A;  1FGU A;  4J1M A;  4JV5 Q;  3C1F A;  1QB5 D;  3IFD A;  1EZ6 A;  1WTO A;  1OTC A;  1EU4 A;  1PRT B;  3J7Z C;  3J7A 5;  4H02 A;  1C9O A;  3CC2 A;  1TKW B;  2JA5 B;  3VA5 A;  4L5Q A;  1IBM L;  4RG1 A;  4LF4 L;  1SNP A;  3CMA A;  3HOY B;  3DEO A;  4EGV A;  1STY A;  2EQS A;  3T1H Q;  5GQO A;  4K14 A;  3BU2 A;  4B3R L;  1MGS A;  2VQE L;  1OXU A;  1G2S A;  1G8Z D;  3CME A;  1SNQ A;  1CZG A;  3E6Z X;  1SN8 A;  4DK1 A;  1IYJ B;  3TME A;  5GRO A;  1NR4 A;  3TP6 A;  4KI0 A;  3H0G G;  1VF7 A;  2NWG A;  2RKS A;  3GD7 A;  3S1N B;  3T1Y L;  5IGD A;  1M8A A;  3ER0 A;  3Q6S A;  1GM5 A;  3OOC A;  3T51 B;  3R8B A;  1DXM A;  3MZ5 A;  1XNQ L;  3RZD B;  1R4P B;  3E0E A;  4N9P A;  2B2U A;  3RNU A;  1PLF A;  2F0M A;  2Z6K A;  1GHK A;  4A3L G;  3OW2 A;  3EQL C;  2YTX A;  2F0T A;  2R7F A;  3IRB A;  4BBS B;  3KF8 A;  1L0Y B;  4P2C B;  5I6Y A;  2B63 H;  3HOZ H;  3I55 A;  4FF4 A;  5ELE A;  4B3T L;  3M7G A;  1O7I A;  3G6E A;  3UDF A;  1M90 C;  2RDH A;  1EWI A;  3QB3 A;  3S15 B;  1HA6 A;  5D3I B;  1FJG L;  4LF6 L;  3K80 C;  3Q23 A;  4X64 Q;  1DM0 B;  4LW1 A;  5M5X H;  3RLN A;  4C3H G;  3I90 A;  3VYU A;  4NB3 A;  1TY2 A;  1AH9 A;  5LHY 1;  4OO1 G;  1EU3 A;  4H44 C;  3RZO H;  2R93 H;  3HKZ E;  1U0L A;  2UUB L;  2CFM A;  4JW0 A;  1MKH A;  3MHB A;  4JYA L;  4KY5 A;  4A3C H;  2L11 A;  5FLX c;  5EBD A;  3AYH B;  4B3R Q;  4HMJ A;  2B29 A;  1NMG A;  5IYD H;  4UAI A;  1RIP A;  1Y8P B;  1TWF B;  4RA8 A;  4TSS A;  1GUG A;  1YEZ A;  5FLX E;  2DY7 A;  2X69 A;  4POG A;  2L4N A;  2Z4I A;  3DWA A;  3CD6 A;  2RF4 A;  4Y7N H;  3KF6 A;  3P20 A;  3I4N H;  3PMF A;  4YIJ A;  3S1Q B;  1QOH A;  2OF1 A;  4C3H B;  4LJZ C;  1E1O A;  1NR2 A;  2K5N A;  4L5S A;  1EY9 A;  4IPG A;  3HOU B;  1K9M C;  4HN7 A;  2EIF A;  4RGN A;  1XNR Q;  4LF7 L;  3I3C A;  1XNQ Q;  5IY0 A;  1QWY A;  3W3A A;  1B3A A;  1KTK A;  4I65 A;  4ODG A;  1JWS D;  5I9O A;  3OHX C;  1K8M A;  5C5L A;  1JWM D;  3D4D A;  1C0A A;  2HDL A;  2JE6 I;  4DU9 A;  4PMW A;  5JPN C;  1EY0 A;  4WOR A;  3LX0 A;  2HQL A;  5C3E G;  2B8G A;  1V1O A;  2K6A A;  1L1O A;  4BXX G;  1GO3 E;  3IKJ A;  4NW2 A;  3G4S A;  2NZ1 D;  5C5M A;  2UXD Q;  5CV8 A;  2DY8 A;  1PTO C;  3ULL A;  4L63 B;  3SK8 A;  3HOW H;  1LM0 A;  2Q2I A;  5J22 A;  3EFX D;  5ELB A;  1O78 A;  1B70 B;  2CVR A;  2ZJR A;  3D0F A;  4A3M B;  4OGQ C;  1QG7 A;  2Q2T A;  1QVF A;  3LGJ A;  3TS2 A;  1NNX A;  3ZYY X;  1WFQ A;  1PTO H;  1ZEQ X;  4DR5 L;  1ENF A;  1S5E D;  4YHH Q;  2FHT A;  3K7A B;  3HOV B;  1JJ2 A;  3L2P A;  4DKA C;  4A75 A;  4TKO B;  4KJN A;  1KRS A;  4IUP A;  5M3M B;  2XVS A;  1XMQ L;  4JI3 L;  3GO5 A;  4I7Z C;  2ZJP A;  4YCV A;  4LF7 Q;  3FVQ A;  1KDC A;  4FXK C;  4ME3 A;  4P72 A;  4GLA C;  3MFY A;  2Z4H A;  4IFD J;  4IAL A;  1A2T A;  5IGG A;  2WB1 G;  4FF3 A;  4RFB A;  4DUY L;  1JOR A;  4R4Q A;  1DJR D;  2E76 C;  1N33 L;  1SE3 A;  3O13 A;  4F8M A;  1SRU A;  3KFU A;  2PYK A;  4A3F B;  1SYF A;  2KJX A;  3OSO A;  3FHW A;  1PZJ D;  1SNO A;  2CKZ B;  3E5S A;  3GTJ H;  1TS3 A;  2FXQ A;  4GNX A;  1PHJ A;  1JJG A;  2F0O A;  4ZYS A;  1GVP A;  4RKL A;  1IW7 C;  4UPA A;  4GOP A;  3TEH B;  4CJ2 C;  5IGF A;  5D65 A;  3IFT A;  4DV6 L;  5ELO A;  3M3Y B;  1PYB A;  4HTH A;  4H7B A;  3PF5 A;  4RGO S;  4N9T A;  3HRZ C;  5IGE A;  5IP9 G;  3WOE A;  1YNN C;  2L0C A;  2OQK A;  1Q12 A;  1H9J A;  5CBA E;  2B3G A;  3VR3 A;  4BBR H;  4A3B B;  3K7U C;  2VQF L;  1NJI C;  1TT2 A;  2L5T A;  4XYO A;  1IW7 D;  3R3O A;  4PQX A;  1B53 A;  1LUZ A;  3C46 A;  2OTJ A;  1KNA A;  4OHJ A;  1HZB A;  1EY7 A;  1JC7 A;  2HIV A;  4WJW A;  2ICI A;  2V4D A;  5JPM C;  4BA2 I;  1IYU A;  5IIF A;  1EIY B;  4DR5 Q;  1AZP A;  1W6K A;  1ZKO A;  2AMC B;  2IY5 B;  1IXR A;  1PMR A;  4AIM A;  3Q8D A;  1CKN B;  4LFC L;  2Q8T A;  5LL6 S;  2K05 A;  3L7Z C;  5IYB G;  1PH7 A;  2KEC A;  4DR1 L;  2X6L A;  1PRT C;  5L37 A;  3FP9 A;  1SE4 A;  2AHO B;  4JI3 Q;  3PIO A;  3CQZ H;  1UE7 A;  2EYO A;  2DNC A;  2KA7 A;  4S3S A;  3NEM A;  1A63 A;  1VQ8 A;  2QA4 A;  2BDO A;  4DUY Q;  3GTM B;  3SEB A;  1N33 Q;  2VS1 A;  1T5E A;  3G6J B;  2JEA I;  5M5W B;  1N36 L;  1GUO A;  1CKM A;  2KED A;  5C4J B;  4IUR A;  2F0V A;  2A8V A;  4OO1 I;  3NEL A;  4X65 Q;  4IJH A;  1JQY D;  2NVX B;  1RHP A;  1E1T A;  4A93 G;  5ELN A;  5IE8 A;  4G7Z C;  1ENA A;  1A15 A;  2K5Q A;  2CH4 A;  3GV3 A;  4Q0F A;  2C5C A;  3L9A X;  1VQ6 A;  4HAE A;  1BBU A;  1SJE D;  1UUP A;  4DV2 Q;  1WTX A;  1BOS A;  3OIP A;  1WTP A;  1BO0 A;  3A5Z B;  5LL6 X;  2IX3 A;  5IGB A;  2NUC A;  3C2P A;  2VQF Q;  2RVL A;  5BN5 A;  1EEI D;  3BYT B;  2AWN A;  3W1B A;  1Y8O B;  3VR2 A;  1WTW A;  3S1N H;  1X3Q A;  1BBW A;  4JI7 L;  3J81 c;  4GNX B;  5FJ8 G;  4BY7 B;  4XDX A;  1TWC B;  3GTG B;  4GOP B;  4ZKC B;  3J81 E;  4DR7 Q;  1MSG A;  2PZU A;  5A2Q L;  3EBE A;  2JA7 G;  3DEP A;  1E2Z A;  5M3F G;  3OPO A;  4TRD A;  2Q2U A;  4LFC Q;  5T1G A;  2R61 A;  5C6A A;  1XPO A;  2DGY A;  3MC0 B;  2KEE A;  3D6W A;  2EJG C;  3TZD A;  3ERO A;  4DR1 Q;  4B3M L;  4BBS H;  1D6E C;  3J7A V;  4QL5 A;  1VF5 C;  5COY A;  2F03 A;  4APV A;  4JI0 L;  4A3J G;  1VQH A;  2L1B A;  5FO9 B;  3S2D B;  1H9S A;  1XTC D;  2A5H A;  1I4G A;  3PUY A;  3S1R B;  4AYB B;  1X3P A;  1HTL D;  1C48 A;  5I2Y A;  3OWF A;  4DNT B;  1O7Y A;  4QUF A;  3ERQ A;  1SYD A;  2JA6 H;  1N36 Q;  1SMX A;  3STB C;  2Z9H A;  4AH6 A;  3J7Y W;  1F2L A;  2JA7 B;  2XGT A;  1PTO F;  3NUC A;  1G2T A;  1Z9F A;  1NUC A;  2NZH A;  3FKI H;  2OQ0 A;  3M4Y A;  2N8N A;  3NSW A;  4KHP L;  1HHV A;  5EQ0 A;  5JJZ A;  5FLM G;  2R92 B;  5EPK A;  1EQV A;  3NXW A;  4PZ6 A;  1PV4 A;  1CZW A;  1TWF H;  4A3D G;  3P7J A;  4KKS A;  1STN A;  4V19 0;  3GTP B;  1M1K C;  5IOC A;  1F9S A;  3H3V C;  2B2W A;  3Q22 A;  3S1Q H;  3U4V A;  1EWC A;  1TS5 A;  1STH A;  4JI6 L;  1STA A;  2HHH L;  1STB A;  3T4A C;  1GUS A;  1YBY A;  5ELC A;  3HOU H;  4DV7 L;  2AQ1 B;  2CWA A;  3NQT A;  3U9S A;  1N8R C;  1K8A C;  4HJA A;  3KYH C;  5EBC A;  4IFD G;  2WAQ E;  1AP0 A;  2K01 A;  3GTK B;  2WB1 E;  3I4M H;  2SEB D;  3NHH A;  2EY6 A;  1FL0 A;  2K04 A;  3KLR A;  1UEA B;  3C1E A;  1PXU A;  4K0K L;  4QY7 A;  4FVM A;  1A3U A;  1JR0 D;  4B3M Q;  3HKZ G;  2D0O A;  2UXB L;  5GAG C;  4JI0 Q;  2O2L D;  1AN8 A;  1I3Q B;  4TVA B;  1PH5 A;  4CJ0 B;  2OXP A;  1JMC A;  4GKJ L;  2NVY B;  1JB3 A;  4KD4 A;  1MD2 D;  1WCM G;  1K3R A;  1I4H A;  1I6V C;  3KK7 A;  4MHE A;  5CV4 A;  5EGT A;  2OWO A;  3JAM L;  1GUW A;  2B2T A;  2AWO A;  4LF8 L;  1Q1B A;  2A6H D;  3N6R A;  3I8Z A;  3AFP A;  2R7Z B;  2P5Z X;  4XQJ A;  4A3M H;  3HKZ B;  1N9W A;  1VQG A;  3KBG A;  4A76 A;  1VMP A;  4FO2 A;  3K5L A;  4RGM A;  4XT1 B;  4CBV A;  2RDG A;  4DV0 L;  3SVM A;  5E7N A;  4AQY L;  2RCF A;  2N49 A;  1SYC A;  4A3I G;  2MPM A;  4OIK A;  3RLO A;  3S16 H;  1IBL L;  2NYZ D;  1WCM B;  2DJF C;  3K7A H;  1EY4 A;  1TWH B;  3HOV H;  3PO3 B;  1DD2 A;  4WRD A;  4GZY C;  5M3M H;  1HNZ L;  3MFG A;  4B3S L;  2KCC A;  2HHH Q;  4A3G H;  1GKH A;  2K33 A;  3M9B A;  4R4O A;  2JA8 H;  1JT8 A;  2HT1 A;  4C2M B;  3PO2 G;  3K58 A;  1STE A;  1Q81 C;  2A74 C;  5E4X A;  1V1P B;  4RMF A;  4CJ1 B;  3F2U A;  4PNY A;  1N34 Q;  2F1M A;  5KNB A;  2Q8R E;  1KLU D;  4A3F H;  3OWE B;  4Q5V A;  2G9H D;  2F0N A;  5LMU L;  2PMZ E;  4UP8 A;  2H4O A;  3OYY A;  5C0X I;  3BVG A;  2UXB Q;  2XIW A;  2H5X A;  3FMC A;  1PZI D;  3G71 A;  3IL8 A;  1HZ9 A;  1SNC A;  3J81 i;  3OTO L;  1UEB A;  2EDG A;  3BDO A;  3EN2 A;  2UUA Q;  4LAA A;  1N32 Q;  3E0J A;  5CBE E;  1RJT A;  3J80 L;  1CSQ A;  4C3I G;  2AUJ D;  4A3B H;  2NN6 G;  1JB7 A;  2JYO A;  4DNR B;  1ET9 A;  1I50 B;  4DR4 L;  4R4I A;  1WVL A;  4EQN A;  4LUV A;  3G48 A;  1NMF A;  4NXN L;  3RD4 A;  2B39 A;  2R7D A;  4ME5 A;  1SYG A;  5A2Q E;  4AQY Q;  4J15 A;  3I70 A;  2JXM B;  4BY1 H;  3CC7 A;  4F7X A;  4HJ5 A;  1AEX A;  3SHL A;  1B1Z A;  4RCO A;  1HZC A;  1EUJ A;  3OMC A;  4LFA Q;  1Y1W G;  4MTK A;  4JI5 L;  4KHV A;  1JE4 A;  3HKS A;  4JOI C;  4IUN A;  3MWY W;  5A35 A;  1I94 Q;  1QIL A;  5C3X A;  3D3R A;  1LV9 A;  2FJ2 A;  4WJ4 A;  5KEE A;  2OT2 A;  2ZTC A;  4O2D A;  5ELF A;  5M5W H;  5LMU Q;  4JC0 A;  4ID6 A;  5C4J H;  3EVQ A;  3H91 A;  1ONL A;  2J0T D;  2NVX H;  1KLG D;  3RN2 A;  1QVG A;  4DAP A;  2KCN A;  1A6X A;  2KHI A;  4X66 L;  2ATW A;  1H9K A;  1P16 A;  3M85 A;  1E7Z A;  2IL8 A;  1HJP A;  2PW5 A;  1WYD A;  1KD1 C;  5FO8 B;  4LF5 L;  1KC8 C;  5EAY A;  2QEJ C;  2EY5 A;  2WP8 J;  3J7A F;  1HNX L;  1D2B A;  2EJF C;  2IPK D;  2F0U A;  2Z8L A;  3GTQ B;  4GKK L;  4GLX A;  1G29 1;  1JJC B;  1MIU A;  4DR4 Q;  5KYL A;  3S14 B;  3H0G B;  1R9T H;  1IL8 A;  2F0Q A;  2ZXP A;  4FP5 D;  2F0G A;  4NXN Q;  4BY7 H;  4IFD I;  4G57 A;  4PMB A;  5LMN Q;  1TWC H;  1K28 A;  4DR3 L;  5C0X H;  2KBN A;  2HUG A;  1U9R A;  5EKI A;  4QUC A;  1BCP B;  4RGT A;  3KLS A;  5IOD A;  3ITP A;  1TWA B;  1NTG A;  1J5E L;  2ICE C;  4KLK A;  1ET6 A;  3HS0 C;  2EYF A;  2F52 A;  5M5Y B;  4JI5 Q;  2WFW A;  1Y1V G;  1IBM Q;  4DV4 L;  4LF4 Q;  1AE2 A;  1KDA A;  4UDU C;  3QG1 A;  1Y69 U;  5K36 H;  1EY5 A;  4MTN A;  3TP7 A;  4YY3 L;  1EYA A;  4X62 L;  3JAM c;  3S2D H;  2XN9 C;  1CQF A;  4C1N K;  1KNE A;  2VQE Q;  3S1R H;  3JAM E;  2CHB D;  3A54 A;  2YV5 A;  4KY7 A;  2I5L X;  3D8G A;  4HIO A;  4FXD A;  3RUZ A;  1L2F A;  4HR7 B;  3NTI A;  3T1Y Q;  3E9I A;  3AFQ A;  4NP5 A;  3NK9 A;  4G7H C;  1FYC A;  4X66 Q;  2A68 C;  3TBI B;  1Y1V B;  3PUW A;  1B4O A;  4U67 3;  4ZCK A;  2H1E A;  1H95 A;  2R92 H;  2PI2 E;  4L8J A;  5CC4 A;  2B2Y A;  1WTQ A;  1QUQ A;  4LF5 Q;  4TQU S;  3GTO B;  3C3L A;  5I2X A;  4ZK9 B;  3ERS X;  1HNX Q;  1O7Z A;  5C44 G;  5LMN W;  3GTP H;  3SDZ A;  3VA7 A;  2VB3 X;  4GKK Q;  3VDY A;  1PH8 A;  3F2C A;  1GD7 A;  1ML0 D;  1OO9 B;  1Q8K A;  4B3T Q;  3LWU A;  3MXU A;  1T5X D;  2QDB A;  2KCT A;  4L6T B;  1CHP D;  2GVB A;  2L55 A;  1FJG Q;  4LF6 Q;  1GUN A;  1FNW A;  1J5E Q;  5H1S E;  3CXC A;  2DNE A;  2K52 A;  4C3J G;  1IBK L;  4KMU C;  4MIU A;  2AKW B;  5C44 B;  1AZQ A;  1ASY A;  2UUB Q;  4DV4 Q;  4JYA Q;  1U4R A;  2Z0S A;  4YY3 Q;  5C3E B;  3KF8 B;  5JJK A;  5JJI A;  1I3Q H;  4DAM A;  2NVY H;  2LSS A;  1K0S A;  1PTO D;  5J1Z A;  1J9O A;  1SSO A;  1A3T A;  3TRE A;  1I6H B;  2VUM H;  1GJX A;  1EOT A;  4GN4 B;  2HDM A;  5JEA H;  4A3E G;  1QJO A;  4B9X A;  4OIJ A;  2L15 A;  2N55 A;  1RCV D;  3R2I A;  2R7Z H;  5COR A;  4C3J B;  1DOL A;  3MEH A;  3MAQ A;  5E1F A;  1EIF A;  4J6H A;  3CC4 A;  2I07 B;  2WAQ G;  1MHW C;  1K0R A;  1VCI A;  3GTL H;  4JBM A;  3UDG A;  2YYZ A;  1BKB A;  1MI2 A;  3V05 A;  1LTS D;  1TXY A;  4JI8 L;  2QEX A;  1VQC A;  1PDQ A;  2Q8I B;  2UXC L;  1XTD A;  4GLV B;  3U58 A;  1TWH H;  4CKC A;  3PO3 H;  2SDF A;  2ALY B;  1LO5 D;  3HFZ B;  2NVT H;  1O80 A;  1G6Z A;  1XPU A;  2RA4 A;  4JK1 C;  2K14 A;  3A8I E;  2EY1 A;  2OEO A;  1KDB A;  2DN8 A;  3W2D A;  1I5F A;  1U5K A;  4OEM B;  5JEA J;  3F2D A;  3KF6 B;  1NE3 A;  1KAA A;  2F0D A;  3BYY B;  1SXT A;  3PIP 3;  1JOO A;  4CKE A;  3UDI A;  3NWS A;  2KQ3 A;  4A3K G;  1VQE A;  2VXW A;  5IYC G;  3EIV A;  2WB1 B;  3CKI B;  5BN4 A;  1WI5 A;  2F4V L;  2E2I B;  5C4X G;  4ALP A;  2ENB A;  1UNS A;  4H0L C;  3CCV A;  3TQY A;  1CQV A;  1Q8I A;  2LFN A;  4RHS A;  1I4P A;  1RTO A;  4DV5 L;  1CTM A;  2EOT A;  2K5W A;  3MVV A;  1WD0 A;  3SK6 A;  1SFO B;  4EQ5 A;  3KOJ A;  2R3Z A;  1G51 A;  1YNN D;  1OXT A;  4BWG B;  2MO0 A;  2UUC L;  3NBI A;  1II3 A;  1L1O B;  5IT9 L;  3I56 A;  2E2H B;  1SYB A;  3FPU B;  2ZM6 L;  2MO1 A;  3MA2 B;  5JOB A;  4X3S A;  1I4X A;  1ESF A;  1GXD C;  4DK0 A;  1W3S A;  2IW3 A;  1XMQ Q;  4CDE C;  4QCL A;  1I50 H;  1D7Q A;  1PFB A;  1D5X C;  2V1C C;  3CRK C;  1DOM A;  4DAY A;  4IPC A;  2IJ0 A;  4JI8 Q;  1TS4 A;  4FYD A;  3CRL C;  3VR5 A;  1XYI A;  4XYQ A;  3CCQ A;  4X3T A;  2UXC Q;  5IP7 H;  3WWV A;  1TR5 A;  1VQ9 A;  1PVO A;  1PRT D;  2RQX A;  4FDB A;  4K5V A;  3T13 A;  3VYR A;  4JVZ A;  2QIL A;  2JA5 H;  1LT3 D;  1BQQ T;  1HR0 L;  4DV6 Q;  2B8F A;  1A3V A;  3CCL A;  3TRZ A;  3HOY H;  3A0J A;  3P1H A;  3HGB A;  1LT5 D;  5AJ3 L;  4DUZ L;  3CCR A;  2SNM A;  2B63 G;  1SAP A;  1H9R A;  1C7Y A;  3HOZ G;  2EXD A;  3I73 A;  2PQA A;  1QZH A;  2I0Q A;  2PQE A;  4QIW E;  2F4V Q;  2IT1 A;  3NEN A;  3DLL A;  1VQJ A;  3I72 A;  3LWE A;  5CGK A;  2EPB A;  3HZX A;  1RKN A;  2F0J A;  2L12 A;  2NTS A;  2QKI C;  2F0H A;  1HXY D;  2PMZ B;  4OXP A;  2RSO A;  4KY6 A;  1B44 D;  1CM9 A;  2JP1 A;  3M4O B;  4A93 B;  3DXJ C;  1Z47 A;  3NPP A;  3RZD H;  4RHR A;  1BBX C;  2SOB A;  2R93 G;  1D1I A;  1HPC A;  1FD7 D;  2Z1C A;  4XXE A;  4A3C G;  2ZM6 Q;  2HCC A;  2AQ3 B;  2A73 B;  4EVO A;  3HOZ B;  2VY3 A;  5IYD G;  1B50 A;  1VS0 A;  3GTQ H;  3DWQ A;  4FNF A;  5I4D A;  3RR5 A;  3B6Y A;  4FXG C;  3S14 H;  1B7Y B;  3H0G H;  2J4X A;  4IZ8 A;  4DXF A;  2UU9 L;  4QB4 A;  3I4N G;  1FVI A;  4OWX B;  3VYT A;  3S15 H;  3NP8 A;  4QMG A;  1EQQ A;  4IUU A;  3RZO B;  1J8I A;  1TWA H;  2B2V C;  2E2J B;  1KAW A;  5M3F B;  3KUP A;  4YCW A;  3CHB D;  1FGB D;  2FMC A;  5CV5 A;  1ILQ A;  3NBH A;  5FK9 C;  4A3L H;  4UP7 A;  4DNI A;  2HQE A;  3S9W A;  3QOJ A;  2VL6 A;  1HR0 Q;  1CK1 A;  4EX5 A;  3H09 A;  2PI2 A;  3ULP A;  1X9N A;  1TS2 A;  3K6O A;  1TVX A;  4A3J B;  4DUZ Q;  4ZLT F;  1Q7Y C;  1SEB D;  4KKT A;  1HFG A;  4KJO A;  4JCV E;  4POF A;  1HQM C;  2I5M X;  4Y7N B;  3I4N B;  3STB D;  3ICE A;  1PFS A;  1RD9 D;  2K03 A;  2CW0 C;  1V1Q A;  2JSO A;  1X3G A;  4HID A;  1E3P A;  4C3H H;  3BDL A;  4JI7 Q;  1IHZ A;  2BE5 C;  3HOW G;  1PA6 A;  2E8G A;  1HZA A;  2LMC B;  3DMU A;  2A19 A;  2EVB A;  4OO1 H;  2MP1 A;  1X32 A;  2K7V A;  5BR8 L;  4MN3 A;  2HIX A;  3MTS A;  4NDX A;  1F2Z A;  3F8T A;  2SNS A;  3GTO H;  4OON A;  4HSV A;  1YJ9 A;  2WKC A;  1WTR A;  3BVZ A;  4A3D B;  3EA6 A;  1E2V A;  1Q90 A;  1SE8 A;  2EYM A;  3NE5 B;  2JEB I;  1IKM A;  3RMH A;  2B2U C;  1PH4 A;  1STG A;  2KVM A;  1OXS C;  2LS0 1;  4CDF C;  3S2H B;  2Z6K C;  1K8O A;  3KLW A;  1O7L A;  1VQ4 A;  2QGQ A;  4KV6 A;  3E9H A;  1E24 A;  5IWA L;  3KDF A;  4RKB A;  1ROD A;  3QJY A;  4JBK A;  3S1M B;  1HR0 W;  1DON A;  3BZC A;  4P73 A;  1S3O A;  1EY8 A;  4LUO A;  2K50 A;  3PUX A;  3OIQ A;  2F0K A;  5TSS A;  3MEF A;  5I9P A;  1QE6 A;  4DPG A;  3DHQ A;  3H15 A;  1VQO A;  4KHP Q;  3D6C A;  4JI4 L;  4M1U B;  5IT9 c;  1B3Q A;  5C4Z A;  4HED A;  5C3E H;  3F2B A;  1KXL A;  2EJM A;  2Y0S E;  5IT9 E;  4BXX H;  1WTH A;  3HOX G;  1H9S B;  3L0O A;  1I6H H;  5DNF A;  5AFW A;  1U4L A;  4O0A A;  1YNJ C;  3PCO B;  2OTL A;  2MUY A;  1QNK A;  4JI1 L;  4JI6 Q;  1ZYR C;  2ZT9 C;  3KJO A;  2A6E C;  1E2W A;  3QWN A;  4DV7 Q;  3U4Z A;  4BBR G;  2N88 A;  1EFW A;  3NBH B;  4KTA A;  1PRT F;  1NY4 A;  3K5N A;  1RL2 A;  2ZTE A;  3OMG A;  2KHS A;  2YTV A;  4A3I B;  4G4K A;  1LT4 D;  3HOX B;  4K0K Q;  1CT1 D;  4HSP A;  4K6L A;  2VW9 A;  1K8G A;  2D0P A;  2PZT A;  4HJ7 A;  1B9M A;  1ZYR D;  1SMY C;  1PYS B;  1XXG A;  2A6E D;  3ONA B;  1IYV A;  5DAU A;  4JG2 A;  2MGS A;  4GKJ Q;  1EWH A;  3M3Y H;  4DK6 C;  2RBM A;  1RTN A;  3PO2 B;  1UE6 A;  3PSI A;  1KAB A;  1TU2 B;  4MNO A;  1HA5 A;  3PQI A;  1PH3 A;  3K5M A;  1VDZ A;  3T16 A;  1YJW A;  1YNX A;  2YU9 B;  4LF8 Q;  1L1O C;  4ZUI A;  2E2I H;  3ND8 A;  2JA9 A;  1B8A A;  3F1Z A;  4ZQ3 A;  1D1K A;  4DV1 L;  1DCZ A;  3G7L A;  1HUM A;  1H9M A;  4PG3 A;  3Q24 A;  3I2Z A;  2PNR C;  1Z7T A;  3ULJ A;  3A55 A;  4HJ9 A;  3BG3 A;  4DV0 Q;  2A1A A;  1SDF A;  2O5J C;  3DM3 A;  1IBL Q;  2ZTD A;  3NTH A;  1VQI A;  5IP9 H;  4KK7 A;  3BJU A;  1KQS A;  1F9R A;  2AQ2 B;  4KKU A;  1YJN A;  2A69 C;  3L3O C;  4C3I B;  1BXT A;  3I91 A;  4JI1 Q;  5EPJ A;  1RDP D;  4B9W A;  2NVQ B;  1HNZ Q;  2NB0 A;  3TS0 A;  4B3S Q;  4UY8 C;  1Q86 C;  2WV6 D;  5CYU A;  3KBX A;  5IGC A;  2K1B A;  4DR2 L;  4O42 A;  1J6Q A;  4QF4 A;  2PNH A;  2Q2H A;  4X64 L;  3K0Y A;  3EJI A;  3GTM H;  5KGU A;  2E74 C;  4K5W A;  4PMC A;  4F88 A;  4XT3 B;  4LMQ D;  1UE5 A;  4CDD C;  1G91 A;  5DEH A;  5E4W C;  2A69 D;  5HGQ A;  1VQA A;  3NTK A;  1ASZ A;  4P75 A;  3OW7 A;  1Y1W B;  4K8I A;  5IYB H;  1HQR D;  4Z9C B;  2G9D A;  1S4Z A;  2F4I A;  2QDL A;  3OTO Q;  5DM7 3;  1JWU D;  3PF4 A;  4GNX C;  4BBS G;  2ES2 A;  3TDQ A;  4IUV A;  1Z6H A;  5HGT A;  4ZAI A;  2XRQ D;  2PPB C;  4HJ8 A;  2R6G A;  4GOP C;  2CWP A;  1HFN A;  1YVC A;  1MJC A;  3UE0 A;  4ULL A;  2EE1 A;  3QO2 A;  1UE1 A;  4EQP A;  5EPL A;  1KRT A;  2K4K A;  4DV1 Q;  3TSS A;  1SYE A;  1XNR L;  4ZUJ A;  1V8Q A;  4ILW A;  1X54 A;  1D8L A;  2JA6 G;  4DGZ A;  2TMP A;  3GTG H;  3M4O H;  4A93 H;  3FKI G;  1VQF A;  1S5F D;  4M8A A;  1X65 A;  2EYH A;  3H6M A;  1TWG B;  2OCE A;  1Q46 A;  4DN4 M;  4K8J A;  1ENC A;  4H13 C;  5K5P A;  4R1J A;  3KJP A;  1DYQ A;  1C4Q A;  2RDF A;  3U50 C;  4OX9 L;  1I4Q A;  2XNA C;  3FEW X;  1PFM A;  1BR9 A;  2EYP A;  4IOC A;  2CCZ A;  3M4Q A;  2UXD L;  1FNV A;  1VQL A;  4DR2 Q;  3GP7 A;  2J7Z A;  2LXK A;  2JA6 B;  2O4X A;  5FJ8 H;  4HCS A;  1EYG A;  2FMM A;  4UP9 A;  2CQO A;  2KHJ A;  1NCV A;  1C8C A;  3HOU G;  4I7A A;  1WJJ A;  3FKI B;  4RCN A;  1F9P A;  4DR6 L;  2ZJQ A;  2E2J H;  2JA7 H;  3D4R A;  1KHI A;  1VQP A;  5JVG 3;  5C0X J;  3TZU A;  5M3F H;  2K5V A;  2N3S A;  3I4M G;  1LTT D;  1A8V A;  3HP3 A;  3TN2 A;  1EY6 A;  3CP0 A;  2QW7 A;  3SK4 A;  4C1N I;  1XPR A;  1Q82 C;  1E22 A;  1XMO L;  5EJW A;  4YHH L;  4GS3 A;  4A3J H;  4XIG S;  4DXG A;  2BDN A;  4LF9 L;  3VR4 A;  3J81 j;  4IJL A;  2GN5 A;  2JK8 A;  4O1N A;  5BN3 A;  1NSN S;  1Q3L A;  4YWM A;  1EEF D;  3FRP B;  3V2T A;  2AUK A;  1EQT A;  4R8N A;  4QIW B;  4HCE A;  1KIX A; 
#chains in the Genus database with same CATH homology
 2HHH L;  4LNQ A;  4AYB E;  3M7N A;  1I50 H;  1YBY A;  4HIK A;  3HOU H;  4DV7 L;  2K5H A;  1D7Q A;  1A0I A;  2CWA A;  2RHS B;  5C4X H;  1N8R C;  1K8A C;  5LMN L;  4P74 A;  3KYH C;  4HJA A;  3AQQ A;  2V1C C;  1W2B A;  2IX1 A;  1FGU A;  4IFD G;  2WAQ E;  4JV5 Q;  4DR3 Q;  2WB1 E;  3I4M H;  2VZA A;  5FLM H;  1FL0 A;  4IPC A;  3GTK H;  4JI8 Q;  1OTC A;  4MZ9 A;  3J7Z C;  3J7A 5;  4A3M G;  1AE3 A;  2RCN A;  4H02 A;  3CCQ A;  4K0K L;  2UXC Q;  1C9O A;  1JE5 A;  3WWV A;  4QY7 A;  5IP7 H;  3CC2 A;  1VQ9 A;  4B3M Q;  1PVO A;  4X6A H;  4FDB A;  3HKZ G;  4L5Q A;  1IBM L;  2D0O A;  4A3D H;  4OX9 Q;  4RG1 A;  4LF4 L;  2UXB L;  5GAG C;  1YZ6 A;  3CMA A;  2JA5 H;  4JI0 Q;  1HR0 L;  4DV6 Q;  3J80 c;  4TVA B;  2EQS A;  1PH5 A;  1CKN A;  3T1H Q;  5GQO A;  3CCL A;  1JMC A;  3HOY H;  3A0J A;  3BU2 A;  4P71 A;  3TRZ A;  4X62 Q;  3S2H H;  3HOV G;  4B3R L;  4GKJ L;  4YWL A;  5AJ3 L;  2VQE L;  1OXU A;  1WCM G;  3CCR A;  4DUZ L;  1EOV A;  1VQ5 A;  3CME A;  2B63 G;  1C7Y A;  1K3R A;  2E5L L;  1SN8 A;  5M3M G;  3S1M H;  3HOZ G;  2OWO A;  2EXD A;  1IYJ B;  4A3G G;  2PQA A;  5GRO A;  1QZH A;  2I0Q A;  4QIW E;  2F4V Q;  2AWO A;  4KI0 A;  2JA8 G;  3H0G G;  4LF8 L;  4XTC S;  2NN6 I;  1Q1B A;  2IT1 A;  3NEN A;  3GD7 A;  3DLL A;  1VQJ A;  4DR6 Q;  3AFP A;  3T1Y L;  1KIX A;  1VQN A;  3ER0 A;  1GM5 A;  3K8A A;  4A3M H;  1N9W A;  1VQG A;  4A76 A;  4OXP A;  1XNQ L;  4L5R C;  4A3F G;  3E0E A;  2MNA A;  1IZ6 A;  5JJL A;  5GAE C;  3RNU A;  1XMO Q;  1Z47 A;  2D62 A;  4DV0 L;  3RZD H;  4JOI A;  5E7N A;  4AQY L;  2BH2 A;  2R93 G;  2Z6K A;  2N49 A;  3UDX A;  3OW2 A;  4A3I G;  2YTX A;  3RLO A;  3S16 H;  4A3L G;  1IBL L;  4KHZ A;  1MJE A;  4LF9 Q;  4HIM A;  2R7F A;  4A3C G;  1YHB A;  3IRB A;  3K7A H;  2ZM6 Q;  3HOV H;  4DK3 C;  1WCM H;  2VY3 A;  2B63 H;  5IYD G;  1VS0 A;  3CPW A;  4LUZ A;  5M3M H;  3GTQ H;  3HOZ H;  3I55 A;  1HNZ L;  4B3S L;  4A3G H;  1WOC A;  2HHH Q;  4B3T L;  1O7I A;  1GKH A;  3B6Y A;  3M9B A;  4R4O A;  3RR5 A;  3I4O A;  3G6E A;  2JA8 H;  1B7Y B;  3H0G H;  3UDF A;  2HT1 A;  1M90 C;  3S14 H;  3PO2 G;  4JV5 L;  2UU9 L;  1Q81 C;  1EWI A;  4C2M H;  4A3B G;  3I4N G;  1FVI A;  4DV3 L;  4RMF A;  3K80 C;  4OWX B;  4X64 Q;  4LF6 L;  1FJG L;  4LW1 A;  1N34 Q;  2BA1 A;  5M5X H;  3S15 H;  3RLN A;  4A3F H;  1EQQ A;  4NB3 A;  1TWA H;  1KAW A;  1X3E A;  4X65 L;  1AH9 A;  4IPH A;  4OWT B;  5LMU L;  4YCW A;  3CCS A;  2PMZ E;  4UP8 A;  3RZO H;  4OO1 G;  2R93 H;  3HKZ E;  1U0L A;  1IBK Q;  3OYY A;  2CFM A;  5C0X I;  1QUQ B;  4UP7 A;  1MKH A;  2JQO A;  3HOX H;  4A3I H;  2GVA A;  1PH6 A;  1SRO A;  4DNI A;  4JYA L;  3RN5 A;  2UXB Q;  4BY1 G;  2H5X A;  1L0W A;  2VL6 A;  1HR0 Q;  5FLX c;  4A3C H;  4EX5 A;  3G71 A;  2PI2 A;  1HZ9 A;  3AYH B;  3ULP A;  1X9N A;  4B3R Q;  2B29 A;  3J81 i;  1K73 C;  1V9P A;  1NMG A;  3OTO L;  5IYD H;  1UEB A;  1RIP A;  3EN2 A;  2UUA Q;  4DUZ Q;  1N32 Q;  1YEZ A;  4DV2 L;  1Q7Y C;  2Y0S G;  2E5L Q;  4L5T A;  4JCV E;  1VQP A;  4POG A;  4POF A;  2I5M X;  3PO2 H;  2IX0 A;  1PH9 A;  1CSQ A;  3CD6 A;  3STB D;  2RF4 A;  1JT8 A;  3ICE A;  1PFS A;  4Y7N H;  4A3B H;  3KF6 A;  2NN6 G;  3I4N H;  1JB7 A;  1E1O A;  2K5N A;  1V1Q A;  2YU9 H;  3JC6 6;  4L5S A;  1X3G A;  4IPG A;  4DR4 L;  4R4I A;  4HID A;  1E3P A;  4C3H H;  1K9M C;  4JI7 Q;  3HOW G;  2BH8 A;  2EIF A;  1XNR Q;  4LUV A;  3G48 A;  1PA6 A;  4LF7 L;  2E8G A;  1NMF A;  4NXN L;  1XNQ Q;  4A3L H;  1HZA A;  5IY0 A;  2R7D A;  2A19 A;  4DR7 L;  5BR8 L;  4AQY Q;  4J15 A;  2HIX A;  3JAM i;  4BY1 H;  3CC7 A;  4HJ5 A;  1C0A A;  3F8T A;  3I7F A;  2JE6 I;  3GTO H;  4PMW A;  1HZC A;  4OON A;  1EUJ A;  1YJ9 A;  2ASB A;  4LFA Q;  3K81 C;  1Y1W G;  2HQL A;  4JI5 L;  5HY6 A;  5C3E G;  1SE8 A;  2JEB I;  3CCE A;  1PH4 A;  4JI2 L;  2F3I A;  2I5H A;  1OXS C;  1VQB A;  1L1O A;  3HKS A;  4JOI C;  1GO3 E;  4C3I H;  2NVQ H;  2Z6K C;  1I94 Q;  3KLW A;  4BXX G;  3G4S A;  1VQ4 A;  2QGQ A;  3E9H A;  1E24 A;  5IWA L;  3KDF A;  2UXD Q;  4WJ4 A;  1SR3 A;  4JBK A;  2KEN A;  4DV3 Q;  3ULL A;  3HOW H;  1LM0 A;  1HR0 W;  1BVS A;  2Q2I A;  3BZC A;  1Q1E A;  4JBW A;  4P73 A;  4YCU A;  1S3O A;  4LUO A;  2K50 A;  3PUX A;  2ZTC A;  4O2D A;  5M5W H;  3D31 A;  5LMU Q;  4BY7 G;  1B70 B;  1V43 A;  4JC0 A;  3MEF A;  5C4J H;  4DPG A;  2ZJR A;  3D0F A;  3H15 A;  5C0X G;  2MFI A;  1VQO A;  4DV5 Q;  2NVX H;  3A74 A;  4KHP Q;  4PZ8 A;  3RN2 A;  1QVG A;  2Q2T A;  4JI4 L;  1QVF A;  3LGJ A;  2KHI A;  4X66 L;  3ZJY C;  5IT9 c;  2ATW A;  3TS2 A;  3H3V I;  1WFQ A;  1P16 A;  2XTI A;  4R4T A;  1E7Z A;  3M85 A;  1Y1W H;  5C3E H;  1HJP A;  2C35 B;  3F2B A;  1KXL A;  3PIP A;  1WYD A;  4DR5 L;  1KD1 C;  4QJF A;  2Y0S E;  4LF5 L;  4LWC A;  4YHH Q;  5EAY A;  1KC8 C;  4PZ7 A;  2UUC Q;  4BXX H;  3HOX G;  1JJ2 A;  2LXJ A;  3L0O A;  4DKA C;  3L2P A;  2WP8 J;  4A75 A;  1I6H H;  5K36 G;  1HNX L;  1CSP A;  5J3B A;  1KRS A;  2IHE A;  1G6P A;  3CPF A;  4O0A A;  4IOA A;  1X3F A;  2OTL A;  3PCO B;  4GKK L;  4GLX A;  1XMQ L;  1G29 1;  4JI3 L;  1JJC B;  1MIU A;  4DR4 Q;  4JI1 L;  4AYB G;  2K75 A;  3GO5 A;  1R9T H;  4JI6 Q;  3GDE A;  1YHQ A;  2ZJP A;  3KJO A;  4YCV A;  4LF7 Q;  4DV7 Q;  4NXN Q;  4BY7 H;  4IFD I;  4ME3 A;  3U4Z A;  4P72 A;  2YTY A;  4GLA C;  4BBR G;  1EFW A;  5LMN Q;  1TWC H;  4IFD J;  3NBH B;  2WB1 G;  3J80 i;  2KBN A;  4DUY L;  4DR3 L;  4R4Q A;  1N33 L;  1NY4 A;  3KFU A;  1SRU A;  4WJ3 M;  1RL2 A;  3FHW A;  2CKZ B;  3GTJ H;  1NTG A;  2FXQ A;  1J5E L;  4GNX A;  2ZTE A;  3RLF A;  4KLK A;  2YTV A;  1PHJ A;  1TWG H;  1VQ7 A;  2F52 A;  4K0K Q;  1JJG A;  1GVP A;  1OXX K;  4UPA A;  2VW9 A;  1VQD A;  4GOP A;  2D0P A;  4HJ7 A;  2WFW A;  2DUD A;  1K8G A;  1Y1V G;  2R92 G;  1IBM Q;  5M5Y H;  3TEH B;  4DV4 L;  4LF4 Q;  1AE2 A;  4JI2 Q;  4DV6 L;  4MTN A;  4IPD A;  5ELO A;  1PYS B;  1P8L A;  1X6O A;  1PYB A;  4JBJ A;  4YY3 L;  3PF5 A;  4X62 L;  3JAM c;  3S2D H;  4JG2 A;  1LYL A;  1VQK A;  4GKJ Q;  3M3Y H;  1HNW L;  5IP9 G;  4NXM L;  5AJ3 Q;  4DK6 C;  3S1R H;  2VQE Q;  2OQK A;  1Q12 A;  1UE6 A;  3PSI A;  2B3G A;  4MNO A;  2YV5 A;  1PH3 A;  2I5L X;  4BBR H;  3K7U C;  4YWK A;  2VQF L;  2VNU D;  4HIO A;  3PUZ A;  1NJI C;  1YJW A;  1YNX A;  4LF8 Q;  1L1O C;  2E2I H;  1YHA A;  1L2F A;  4DAY B;  2NZO A;  2JA9 A;  1B8A A;  3E9I A;  3F1Z A;  3T1Y Q;  1LUZ A;  4DV1 L;  2OTJ A;  3AFQ A;  1HZB A;  4PG3 A;  3I2Z A;  4X66 Q;  2HIV A;  3PUW A;  4BA2 I;  1H95 A;  1EIY B;  2R92 H;  3ULJ A;  2PI2 E;  4HJ9 A;  1Y1V H;  4DR5 Q;  1IL2 A;  3MXN B;  2AMC B;  3PGZ A;  2A1A A;  4GN3 B;  4DV0 Q;  4LF5 Q;  2IY5 B;  1QUQ A;  4TQU S;  1IXR A;  4AIM A;  3Q8D A;  4Y52 H;  1QZG A;  1CKN B;  3DM3 A;  3M4P A;  3ERS X;  3PV0 A;  4LFC L;  2RHQ B;  2ZTD A;  1HNX Q;  5C44 G;  1IBL Q;  5LMN W;  1VQI A;  3L7Z C;  5IP9 H;  5IYB G;  4NPS A;  2F4V L;  3BJU A;  1PH7 A;  3GTP H;  4DR1 L;  5DLQ E;  3W1G A;  1KQS A;  4GKK Q;  3VDY A;  1PH8 A;  4R4C A;  3FP9 A;  3F2C A;  1YJN A;  4JI3 Q;  2AHO B;  1GD7 A;  4JI1 Q;  3PIO A;  1HNZ Q;  3TS0 A;  4B3S Q;  4UY8 C;  1Q86 C;  1Q8K A;  3CQZ H;  1UE7 A;  1DGS A;  2PQA B;  1CUK A;  4B3T Q;  4LFB L;  1S40 A;  3NEM A;  1A63 A;  5JEA G;  1VQ8 A;  2QA4 A;  1PH2 A;  2UU9 Q;  2KCT A;  4DR2 L;  4DUY Q;  1J6Q A;  1N33 Q;  2PNH A;  2Q2H A;  2VS1 A;  4X64 L;  2GVB A;  1N34 L;  1FJG Q;  4LF6 Q;  3GTM H;  2JEA I;  1T9H A;  2R7Z G;  3H3V H;  1J5E Q;  5H1S E;  1N36 L;  1HH2 P;  1CKM A;  3CXC A;  2A8V A;  4GN5 A;  3NEL A;  4OO1 I;  2K52 A;  1UE5 A;  4X65 Q;  4IJH A;  1IBK L;  2IHF A;  1SLJ A;  2AKW B;  5HGQ A;  1VQA A;  1ASY A;  2UUB Q;  4DV4 Q;  1E1T A;  4P75 A;  1ASZ A;  4A93 G;  5ELN A;  4JYA Q;  1UWV A;  5IE8 A;  5C44 H;  2Z0S A;  4YY3 Q;  2ID0 A;  5IYB H;  3KF8 B;  5JJK A;  2UUA L;  5JJI A;  1I3Q H;  1X55 A;  4DAM A;  1Y14 B;  3OTO Q;  1HNW Q;  4NXM Q;  1VQ6 A;  3PF4 A;  1N32 L;  4GNX C;  2NVY H;  2LSS A;  3PO3 G;  4BBS G;  1BBU A;  4DV2 Q;  3TRE A;  2ES2 A;  1PH1 A;  2VUM H;  3A5Z B;  4GN4 B;  4HJ8 A;  2R6G A;  4A4I A;  4GOP C;  2CWP A;  4A3E G;  2VQF Q;  1YVC A;  3K0X A;  1MJC A;  3UE0 A;  1EQR A;  1X56 A;  4QQB X;  2AWN A;  3W1B A;  1UE1 A;  3A5U A;  2L15 A;  1KRT A;  2K4K A;  3S1N H;  1BBW A;  4DV1 Q;  4JI7 L;  3J81 c;  2R7Z H;  4GNX B;  1QVC A;  5FJ8 G;  1XNR L;  1EIF A;  1X54 A;  4C3J H;  1D8L A;  2JA6 G;  3CCM A;  3CC4 A;  4GOP B;  2WAQ G;  4BA1 I;  1K0R A;  1VCI A;  3GTG H;  3GTL H;  4JBM A;  4DR7 Q;  3M4O H;  1A62 A;  3UDG A;  4A93 H;  5BR8 Q;  3EBE A;  2JA7 G;  2YYZ A;  1VQM A;  1BKB A;  3FKI G;  1NBW A;  5M3F G;  1VQF A;  1YIT A;  4JI5 Q;  1TXY A;  1X65 A;  4JI8 L;  2QEX A;  2Q2U A;  4LFC Q;  1VQC A;  2VUM G;  2OCE A;  1XPO A;  4LFA L;  2DGY A;  1Q46 A;  2UXC L;  1XTD A;  4GLV B;  3U58 A;  1TWH H;  1KL9 A;  3PO3 H;  4DR1 Q;  4B3M L;  2ALY B;  4BBS H;  5GAD C;  3HFZ B;  4R1J A;  4QL5 A;  3KJP A;  2NVT H;  3U50 C;  4OX9 L;  1XPU A;  4APV A;  4JI0 L;  4A3J G;  2K14 A;  1VQH A;  4A3E H;  4IOC A;  2UUB L;  1I94 L;  4LFB Q;  1I5F A;  1OXV A;  3T1H L;  1U5K A;  5JEA J;  3W5O A;  3F2D A;  1XJV A;  2CCZ A;  3M4Q A;  1NE3 A;  3KF6 B;  3PUY A;  2UXD L;  2N78 A;  1VQL A;  5IWA Q;  4DR2 Q;  2MQH A;  3UDI A;  2LXK A;  5FJ8 H;  4A3K G;  1VQE A;  3CCU A;  1EYG A;  5IYC G;  3EIV A;  4UP9 A;  2CQO A;  2KHJ A;  2JA6 H;  1WI5 A;  1SMX A;  3STB C;  1YIJ A;  4AH6 A;  1LTL A;  1N36 Q;  1WJJ A;  2XGT A;  4IO9 A;  3HOU G;  5C4X G;  4ALP A;  3CF5 A;  2ZJQ A;  4DR6 L;  3CCV A;  3TQY A;  2E2J H;  2JA7 H;  4QGU A;  1Z9F A;  1KHI A;  2NZH A;  3FKI H;  3PUV A;  5C0X J;  2OQ0 A;  2JJQ A;  2K5V A;  2N8N A;  3CW2 C;  5M3F H;  2KCM A;  4DV5 L;  2N3S A;  3I4M G;  4KHP L;  3SGI A;  4OWW B;  3CAM A;  1K83 H;  1A8V A;  5FLM G;  4JI4 Q;  3CP0 A;  4EQ5 A;  3KOJ A;  1YI2 A;  1G51 A;  1XPR A;  1Q82 C;  1E22 A;  1XMO L;  5IP7 G;  1OXT A;  4PZ6 A;  1PV4 A;  2MO0 A;  4YHH L;  1SFO H;  4GS3 A;  1TWF H;  4XIG S;  1CKO A;  4A3J H;  2UUC L;  4A3D G;  3AEV A;  1L1O B;  3UE1 A;  2JA5 G;  3I56 A;  4LF9 L;  3BZK A;  3J81 j;  4IJL A;  2ZM6 L;  1M1K C;  2MO1 A;  3S24 A;  2GN5 A;  2JK8 A;  3KDF B;  5GAH C;  2E2H H;  3HOY G;  3S17 H;  4YWM A;  1S72 A;  3CCJ A;  1W3S A;  4A3K H;  3S1Q H;  3U4V A;  4JI6 L;  5IYC H;  2BA0 A;  1XMQ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...