4IQ0A

Crystal structure of oxidoreductase, gfo/idh/moca family from streptococcus pneumoniae with reductive methylated lysine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
324
structure length
305
Chain Sequence
NAMLKLGVIGTGAISHHFIEAAHTSGEYQLVAIYSRKLETAATFASRYQNIQLFDQLEVFFKSSFDLVYIASPNSLHFAQAKAALSAGKHVILEKPAVSQPQEWFDLIQTAEKNNCFIFEAARNYHEKAFTTINFLADQVLGADFNYAKYSSKAGGALMDLGIYPLYAAVRLFGKANDATYHAQQLDNSIDLNGDGILFYPDYQVHIKAGKNITSNLPCEIYTTDGTLTLNTIEHIRSAIFTDHQGNQVQLPIQQAPHTMTEEVAAFAHMIQQPDLNLYQTWLYDAGSVHELLYTMRQTAGIRFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of oxidoreductase, Gfo/Idh/MocA family from Streptococcus pneumoniae with reductive methylated Lysine
rcsb
source organism Streptococcus pneumoniae
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, Gfo/Idh/MocA family
total genus 98
structure length 305
sequence length 324
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4iq0A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4iq0A01
1D1TA 1WW8A 1ZW1A 2RHRA 5B4TA 5K6AA 3RVDA 1V3VA 3PLRA 3OJEA 2XPCA 5TT1A 1RWBA 1KY4A 1P1KA 1E0DA 4H16A 1SNYA 1WZIA 4J43A 1EZ4A 1KBZA 1W0CA 3NYWA 4KWIA 4W9NA 4EJ0A 2BKAA 1WNTA 1W6UA 1NBOA 3UOGA 1V0JA 1Q7BA 4BO3A 5I7FA 1J6UA 1PZGA 1Z82A 3F3SA 3F5SA 4OKNA 2FY8A 4CM7A 2ZTUA 1H9BA 3LC2O 1AHIA 4OIMA 2V6BA 4R9RA 2NTNA 1M75A 3V8BA 1VJTA 2VUUA 1HETA 3VH2A 3BZUA 4BNLA 4DMLA 5ITVA 3VZRA 4CQLA 4PFJA 4BGIA 2D5CA 1NASA 3DOOA 1PS9A 4IDEA 1C1XA 1LC3A 2FMUA 3GQVA 4XR4A 3E5RA 4YVFA 3DBVO 3INGA 4IJKA 3GRPA 3KBOA 1X1EA 1ZMTA 3PVZA 3WBFA 1KVUA 3GC6A 1GPDG 1TT5B 2PKRA 1GEEA 4DLBA 5JE8A 1JDJA 1EVYA 1P0CA 5KIAA 2DC1A 2VHYA 4B7XA 3PWZA 1OBFO 1V8BA 2X86A 3BMNB 5COQA 1P1FA 5JAZA 3A14A 3SX2A 3OBBA 3QQPA 4ZU3A 4JBGA 1LSJA 3WTBA 4GX2A 3S8MA 5G4KA 3NV9A 3ZN2A 1YO6A 1B8PA 3ZV3A 5AXBA 4AG3A 2JHFA 2XAAA 1X14A 4PZEA 4MVJI 2JFHA 4NFSA 5HS6A 4ZA2A 3F9IA 5ILGA 1P77A 3TSCA 3IMFA 3WSVA 3VTZA 2GLXA 4Q3AA 2A92A 4HFMA 3CUKA 4HNHA 3WICA 5GZ1A 2Q46A 4IINA 2WJPA 5EL0A 4L0QA 3RC1A 4ZICA 3K9QO 3DZIA 1K6JA 5T67A 2EP7A 4CL3A 1GYQA 1QR6A 1GV1A 4GGPA 4R01A 4KUEA 1WWKA 1RM0A 2PR2A 1UP6A 3NDRA 3K6JA 4YJHA 3WR5A 4FOOA 2PKQO 4K6FA 1VKNA 5C7IO 5CDGA 4ILKA 2BHLA 4XKJA 3U4HA 2JFFA 4I08A 1OC2A 4NJOA 3VKVA 4BNUA 3MWEB 2WYUA 4B7UA 3EHEA 3G3EA 2VT3A 4TROA 2E48A 3SXPA 1ZUD1 1Y8QB 4HUJA 3GZNA 3OIGA 1GZ6A 3VPFA 2Q1WA 4BNTA 4S1VA 3C3XA 3RU7A 4B4UA 4D45A 1HDYA 4HV4A 5CDTA 4E31A 1PGJA 1E5LA 5GZ3A 2I99A 4F45A 2VTEA 1HDRA 4IGFA 2OGUA 1NTOA 4MOWA 4R1UA 1WMBA 5IDXA 4ZD6A 2QRKA 4Z9XA 2IZ1A 4E13A 4MIOA 4Z6KA 4OQZA 4L73A 2D3TA 3QV1A 3GGPA 4U0JA 1ZBQA 1E3JA 2YHIA 2QYTA 3RASA 4B4OA 5JAIA 5IFLA 5ILOA 2ZQYA 2Y1CA 2YW9A 2D59A 3E48A 3JQ7A 5THQA 4LGVA 3FBGA 1JVBA 4AVYA 4GL4A 3EW7A 2HQ1A 3RCBA 2O3SA 3LU1A 1SPXA 1BXKA 3OA2A 4IIVA 4CUZA 2NADA 4WECA 3GZNB 2AEFA 3ROPA 1LX6A 2NACA 3FWZA 3L77A 4NDNE 4CR8A 1I3NA 2BFPA 2R6JA 5A05A 1LC0A 1IHYA 4XZ3A 3WYCA 3DBLB 4IGEA 2NVUB 2NVBA 4RPLA 1UZLA 5H83A 2CZCA 5T6BA 1O89A 2O3TA 4NFYA 2BF7A 4UUMA 2OHXA 2VZ0A 3D4NA 3OHSX 3DZKA 3JYQA 1B14A 1E7WA 5G4LA 4BNNA 1GZ3A 3JQ9A 3GT0A 4H3VA 2B4QA 2BLLA 4IPTA 1KEUA 4NK4A 3KRTA 4CLEA 4ZQEA 3WWZA 3U62A 1OFGA 1E3IA 1YRLA 2FPIA 5HRUA 1YQDA 5DCWA 5TGDA 2O7SA 5TX7A 1LJ8A 3JCZA 1GADO 1QP8A 2CMDA 1DJNA 3WS7A 1DC3A 2NLOA 1S7CA 1PZFA 5A5EA 3H5NA 2HMTA 1BW9A 4IJWA 4JBHA 1E3LA 5L4LA 2EKQA 5COAA 4J7UA 5F5NA 4XGNA 1NQOA 4ONEA 3N74A 4BNWA 2HMWA 3KHUA 5COBA 1T1SA 4DC0A 2JD0A 4CV3A 3U5TA 2P4QA 3R3JA 3QWFA 2EIHA 2Q50A 4KUHA 5JCJD 1T2EA 4BKPA 5G2OA 5ICSA 4KP7A 3AUTA 1TT7A 5L51A 1EFLA 2NM0A 5THKA 3DBLA 5L4SA 3OIFA 4AJJA 3IP3A 3JQBA 4UAGA 3Q9UA 4GSLA 1RYEA 4PVDA 1ZSYA 2GN6A 3R0IA 1ZJZA 2W2KB 5J23A 3GPIA 4E3ZA 2AEMA 2UUOA 3PYMA 4L74A 2BI8A 1RYDA 4CM5A 1H6DA 3NJ4A 1VM6A 5IN5A 1JAXA 3O8QA 4OL9A 1UAYA 3MOIA 3CEAA 3EVTA 1O5IA 3DHNA 4J16A 3EGOA 5DDIP 4R1TA 3KYCB 3NAQA 2PH5A 5JMWA 4QO8A 4JX8A 2Y05A 4UUOA 4FFOA 3KZVA 3L4BC 2OO5A 4D0RA 4CODB 3FF4A 4OKIA 5B37A 5F1PA 1EEHA 3WLFA 5BSEA 4Y6PA 4E5KA 5G0UA 1B16A 1HDCA 4Z9YA 2RBEA 1U7TA 2ZTLA 3KEOA 2B37A 1LUAA 1D3AA 1LDMA 1IE3A 1NWCA 3ZWCA 2CF6A 3ANLA 5DOZA 4M54A 3ZU4A 4TQGA 4WPGA 4R5MA 4GKBA 2GZ3A 4XCVA 2PKQP 4TRJA 4DLLA 1PGNA 2PD4A 2OZPA 5G4KB 1Q0QA 2DKNA 4F3YA 3COSA 4PRKA 1T4BA 4NBVA 3O03A 1P1HA 1CWUA 1R16A 4EUHA 1UXIA 3A06A 1M66A 2WE8A 4XDYA 4YAJA 2J3KA 5A9SA 1E1MA 2ZYGA 4LRSB 2V7PA 3CTMA 4RPKA 1PWXA 2OFPA 2YZ7A 4BNIA 3VDRA 1JVSA 4P8RA 1FJHA 3PJGA 4CLOB 3CINA 2P9EA 4WOJA 4R9SA 1YB4A 1E3WB 3DMTC 4IDFA 4BKOA 5JYDA 4NIMA 2GUGA 4GAEA 4BKUA 4RVDA 3OSUA 1TB4A 1N1EA 4D3FA 3MJTA 1DBVO 5TJHA 3MEQA 1U3WA 4YRBA 4P4NA 5BSFA 3TWOA 3KV3O 3E5MA 3MWDB 2NVWA 3AW9A 3G1UA 4RZHA 4BO2A 3JD3A 3H3FA 4ZQFA 3ADPA 4J7XA 4CR7A 3ZWXA 3BIOA 1HEUA 4ND5A 3V2HA 4XB2A 1FDWA 2GZ1A 2NQTA 3KSDO 3WIDA 1PJSA 3MOGA 4FFRA 2V65A 3GFBA 5IZCA 1Y1PA 1I30A 5JS6A 2CSUA 5KVVA 3I9KA 3BHMA 1HZZA 1AN9A 1UDAA 1V3TA 3VKUA 3KSZO 4AJ1A 3ZV5A 1GCUA 3IDSA 1A27A 2IZZA 4E6PA 5B4UA 5DCYA 3FRJA 4PLGA 3GMDA 4OXKA 1A4IA 3C7CB 5HTOA 3UGKA 5FI5A 4BB6A 4GPD1 1M2WA 3F4BA 1AE1A 3F1KA 5TIIA 1LEHA 2O4CA 1EK6A 2B5VA 5CP8A 3QLJA 4YT4A 3H5AA 1QYVA 2VHXA 3BXXA 3BTSA 3WJAA 1MX3A 4XB1A 1R4NB 3WTCA 1VJ0A 5K9ZA 2PD6A 1B15A 4MVJG 4PVCA 4L4RA 1GUFA 4KDEA 1QV7A 3ST7A 1GZ4A 4DUPA 1CQJA 2BGKA 3INTA 2GPTA 4CMGA 2BFMA 3ITKA 4XDZA 1G6KA 2X9GA 1NP3A 3RKUA 3MTJA 5I9NA 3D1LA 1B3BA 2Q4EA 4UULA 3TZHA 1GY8A 1KC1A 4A27A 4IBOA 3GLQA 2C5EA 1PS8A 2Y1EA 5CHEA 1DIRA 2CF5A 2O4UX 3B1FA 3KOUA 3RSHA 4IIUA 1Z45A 1BG6A 5EERA 1ENYA 1YDWA 4YEDA 5JDCC 2JCXA 4U0KA 1X15A 1K89A 1RPNA 1W8DA 4Y67A 5LDGA 4GWGA 2X7HA 4DREA 2ZJ1A 2BH9A 4JP2A 4GH5A 1DC4A 1DFGA 3CSDA 4NPCA 1IUKA 4EBFA 1I2CA 3ZHXA 1E3SA 3WXBA 1YL6A 3EVNA 3TOZA 1SOWA 1O0SA 3QVTA 1E7SA 2BRUA 4BNJA 4IDGA 3ENNA 2AHRA 1U28A 1YGYA 4NBRA 3M1AA 5ER6A 3RFVA 4HP8A 1P3DA 2YFQA 3KM0A 2NU9A 2X9NA 3DBRA 3ON5A 1DEHA 3FTNA 4NG5A 3GFGA 4BO9A 4TRRA 4YDRA 1T1RA 3GNTA 3QVSA 2PD3A 1ZK2A 1KY5A 1ZK4A 4R16A 1YVEI 1DRUA 5TS3A 2YV3A 1J4AA 1V3UA 1T2CA 4ALJA 3S2EA 4I9HA 1JKFA 5DULA 4M89A 5CEJA 2I67A 2YUTA 5A9TA 1YE3A 1LDEA 4Q39A 2I65A 4RO0A 4DBZA 1UDCA 3ZHZA 2UVDA 1LRJA 3U49A 2WD8A 3ZWAA 3ETEA 4JP3A 4UUNA 1JN0A 4BMVA 1NR7A 4R5HA 3H7AA 3ZNQA 4A26A 4FSHA 4QECA 4EITA 1DHTA 4TVOA 4OJNA 3VH4A 2I3AA 3AI1A 1H94A 1K6IA 3DZGA 1FK8A 5IAAA 3UCFA 1B8UA 3E9QA 3BMCA 5DN9A 4MP6A 1NPDA 3OEWA 4URFA 4DQVA 4F6CA 1G0OA 3K8ZA 3AUUA 5A3VA 1N7GA 1L7EA 1LTHR 1U3TA 1ZNQO 1BHSA 4Z3DA 2VZ9A 2DBRA 4JLWA 1VSVA 3I9JA 4FDAA 1H93A 1T2DA 4QEDA 5L7YA 1XLTA 4E21A 3S2FA 4IMPA 4OH1A 4EZBA 4J9VA 3A9WA 4ALLA 3AWDA 1NFFA 3BMCB 3QE3A 1O8CA 4IM7A 4J7CA 3SJ7A 3UXYA 3PEFA 1O95A 1P33A 1X0XA 2AW5A 4RQTA 2IYOA 4RGBA 2JL1A 3AK4A 1PL6A 3FR8A 2NV6A 2Y68A 4U8GA 4QSMA 3F6YA 3DHEA 3DZJA 1UZMA 1ADBA 3ASUA 3P5SA 3LF1A 1XYGA 1IB6A 3PGJA 1I3MA 5TRTA 1Y8RA 5T64A 5I7EA 2Q1SA 4H15A 1HT0A 1DOHA 5C7LO 4ND3A 1H2HA 2J8ZA 3K73O 3GGOA 3ENKA 1XEAA 3RIHA 3WNQA 4DIOA 2QHXA 4BUCA 2DLDA 5F21A 3WDSA 2HO5A 3TFOA 3UUWA 4MJLA 2C0CA 1C1DB 4IXTA 4CMAA 1GQQA 7ADHA 1OI7A 3PJEA 4DL9A 1WDKA 1E92A 3WX0A 3BTUA 2W90A 4BQRA 1ISHA 2HDHA 4ND1A 5JCXA 1PIWA 3IKVA 4R3WA 1PR9A 4FS3A 1E3WA 2WWRA 4CM4B 3F4LA 3RUHA 2CNBA 5U1PA 4YAGA 3DBHB 4TSKA 5KOIA 4CMBA 3DAFA 1VL6A 5TT0A 4R69A 3LT1A 5BNFA 4C7JA 3LLVA 4CM8B 2VRBA 3ZU2A 1O9BA 3QP9A 1ZXLA 3GEDA 2W2LD 5CPFA 4IMRA 3VOSA 1E7YA 3R3SA 4I1IA 5IDWA 4AJLA 3ETGA 4KTTE 3M6IA 4MP8A 4BS9A 5AOVA 3PQDA 1UXKA 4FW8A 1TI7A 2J6IA 3A1NA 3IL2A 1GDHA 4D3DA 5G0SA 4KTVE 1P9LA 2EG9A 4DVJA 2I3GA 2VYVA 3WFIA 1QV6A 1KVQA 3U09A 2DQ4A 5BSHA 4RF4A 3JD2A 3KLMX 3S55A 5C37A 1LDBA 2AQHA 2DBQA 3H9QA 4B3HA 3M1LA 4YCAA 3ZHBA 2GGSA 3AJRA 2B36A 4PLZA 3C8MA 1XR3A 5ENDA 1U8XX 2P9GA 1XELA 1U9JA 3GDFA 4FJ1A 3FPCA 2NQ8A 3D3EA 4FR5A 4BQPA 4P22A 4DPLA 3FSRA 2H1SA 4TVBA 1A5ZA 1ML3A 4JGBA 2D2IA 4DIBA 1ZEJA 3ZWOA 4FQ8A 5JFOA 1ONNA 3QHAA 1CYDA 1NQ5A 3JYOA 4AL4A 2OOSA 4RF2A 3V1TC 2B4RO 1ZEMA 3W8EA 1EBUA 4F6LA 1P44A 1A7AA 1Z75A 3L4SO 4MIEA 1N9GA 3E1KA 2HJRA 5HS4A 1ARZA 2TMDA 2I6TA 4J6FA 2HSDA 1C3VA 8ADHA 1H6CA 1YKFA 2VHZA 1JKJA 4L4SA 3MCVA 2XOXA 1Y9AA 1FDTA 2DTXA 2JAHA 4OXNA 2EF1A 4ALMA 2E4AA 2ZJ0A 3DWFA 4Z9FA 5DBFA 9LDBA 1Y7TA 2CDBA 4AJHA 5CG1A 1I33A 4PLWA 1I8TA 1XCBA 2QRJA 2VRCA 3ASVA 3ZWNA 3HN7A 2X23A 4HADA 3SBOA 4DTIA 4RORA 2Z95A 2HJSA 4I9UA 4WCFB 2GASA 3W8FA 3JQEA 4L8VA 3V2UA 4R41A 2Q2VA 2HMSA 1DFIA 3FN4A 2X9VA 4D7AA 3NUGA 3V1YA 1LXCA 4J4HA 2YQ5A 2PZKA 4MIYA 5EIOA 1EDZA 2IZ0A 2ZTMA 3RAJA 2ET6A 2W98A 3ZDFA 1EUCA 1SO8A 1YOVA 1R4MA 2IDZA 4R54A 3JQ8B 4CMIB 3UCXA 2C7GA 1HE4A 4XQGA 5AXDA 2HUNA 3GOHA 1WMAA 1PJCA 1PS0A 3PQFA 1JQBA 2FHSA 5GZ6A 1KEVA 5TJ9A 4EUFA 2GSDA 3Q11A 1R4MB 3I9LA 3TZKA 4CMEC 4B7CA 1GV0A 1I24A 1CQIA 3ORFA 1F8GA 1LBEA 4J0FA 3SJUA 4W82A 1ZSNA 2A94A 4II2A 4EDFA 4Q3NA 3RJ9A 2FPGA 2O2SA 4GX5A 2HRZA 1YWGO 1N7HA 2EW2A 5MDHA 1YBVA 3MJEA 3NEPX 3LC7O 4YTEA 4CM8A 3GK3A 1YBMA 1HL3A 3B6ZA 2ILTA 2HLPA 4CLDA 5JSFA 1LQTA 1PQPA 1OC4A 4UVGA 2GN8A 2P5YA 2DBVO 4R68A 2NNLD 1BWSA 1UJMA 4BGEA 3P7MA 2FSSA 4MPDA 1E1NA 4D3SA 2LDXA 1LA2A 1I2BA 1F06A 1I36A 1E1LA 2O3JA 3GN2A 3H5RA 5AYVA 3TZCA 2OMEA 2H6EA 4PLPA 4KDFA 4A10A 2GDZA 5A9RA 3NTOA 3ZZNA 4JXKA 4YRDA 9LDTA 3LYLA 1EVZA 4RVUA 3TRIA 1HDXA 5ICMA 1C0PA 5FWNA 3PJDA 4BNKA 4R3NA 1F12A 1MV8A 3B70A 3ABIA 1T4DA 2UYYA 2C29D 1GAEO 4J3FA 1XQ1A 3C1OA 2FZEA 2RH8A 3U9LA 4JIGA 3JD0A 2ZQZA 4D42A 1GEGA 1PX0A 1U7HA 2X8LA 4KUGA 3SLGA 1D7OA 3L6DA 4F46A 1VSUA 3RD5A 2Z1NA 3MJCA 4N5NA 4E5YA 4MKZA 4X54A 3RBVA 1DSSG 4MKXA 2EP5A 2QIOA 1YH3A 3N58A 2AEJA 3PFWO 3GPDG 5FI3A 1IZ9A 1LQUA 1PGPA 1WXDA 4BNFA 4NQZA 5DT9A 4E32A 1RM5A 4II3A 3PZRA 3AY6A 2Y99A 1XGKA 3F46A 3H2SA 1HZJA 4CMJA 2DPHA 4OQYA 1VL0A 4ZGWA 5KVCA 5FYDA 4UVHA 5G0TA 1Q1NA 1UR5A 1YJQA 3M2PA 1SMKA 1VL8A 3U4DA 2EWMA 4PRLA 2Y1FA 4XQCA 4YJDA 1UAGA 1WDLA 1ZK3A 2BD0A 5I8WA 4JJIA 2PLAA 3L07A 1Q7CA 5KCZA 4BNZA 1D8AA 2FR8A 3WB9A 1YQXA 4CL8A 3FBTA 3GH3A 3GZ4A 4EJMA 4GBJA 3DOCA 1D4FA 2V6FA 3G79A 2VZ8A 3NKLA 5JW6A 2D4AA 3WQRA 2PA3A 1YQGA 2YYYA 4LSMA 5KJEA 4BV8A 4JCOA 4ZQBA 3LZ6A 5FEUA 3RUFA 1LLQA 1BTOA 3L6OO 3BMOA 4QO7A 1C1XB 1LLDA 4DYVA 1BXGB 4RQUA 2A35A 2C82A 1DIBA 1HTBA 5H81A 2NU8A 1G0NA 3UCEA 4BMNA 2ZB3A 1ZZEA 3PYXA 4LSWA 5L9AA 3DAGA 2ZKLA 3ROKA 1PJ4A 2CY0A 3JQ7B 4CM1A 4EI2A 4XQ9A 2FSVA 3JV7A 1YBAA 2AQKA 4QXMA 1WPQA 1KC3A 3HHPA 3SC6A 5FFFA 3D4PA 4BO1A 2PNFA 2XF8A 1VI2A 1E1KA 2QX7A 4CLHA 4UREA 5C7OO 1U2GA 2Y0CA 3F5QA 4E5PA 1NYTA 1MXFA 5IDQA 1Y6JA 4PG7A 3EMKA 1GYPA 1JA9A 2WSBA 2VWPA 1JLLA 1ZFNA 2OORA 3G0OA 1KVTA 1LI4A 2AMFA 4ROSA 4UEOA 5IXSA 2G0TA 3IJPA 2AQ8A 4LRTB 1ULUA 3K5PA 3KUXA 5IJZA 4YPOA 3LF2A 3HQ4O 1R0SA 3CZRA 4P4LA 4RDIA 1I32A 3JQFC 1LLUA 1AGNA 4PZDA 1ZK1A 3TOXA 1HF3A 2EKLA 3FNGA 5CG2A 1MA0A 2DUWA 1A7KA 1G1AA 3DR3A 2DFVA 5U4QA 2EHDA 4NMHA 5U9CA 5JMPA 1R66A 2DBZA 2NVUA 4OMUA 3DL2A 1B8VA 2BELA 1QLJA 1NHGA 1W73A 1MGOA 3DMYA 2DUUA 2V6MA 4KQXA 3QWIA 1YXMA 1EDOA 3ADOA 3AUAA 2VOJA 3PIDA 1ZK0A 1I3LA 4XD2A 1QXSA 4BV9A 4CR6A 6ADHA 2BI7A 2AE1A 4MVJF 2G5CA 4NFHA 4W99A 4GLOA 3AU9A 4NHEA 4A7PA 3GA0A 4XGKA 3JQAB 4MVJM 2ZB7A 1J5PA 3RC7A 3FWNA 3VDQA 2C07A 4GGOA 3EUWA 4MVJH 2YV1A 3H3JA 1CERA 1ZVMA 3BMQA 4XYBA 2G76A 3TL2A 4LN1A 4RVFA 3QWHA 5JDCA 4J4BA 4HY3A 4XEHA 3VPGA 3RC9A 5T8KC 3E9NA 5I9MA 3RFTA 2HCTA 1K2WA 5EQFA 1OZAA 3PWSA 4FJ0A 3K30A 3PWKA 2GN4A 1I0ZA 2V6GA 2WTBA 1EUZA 4ITUA 4BO0A 4RZIA 2VYND 3OH8A 2PZMA 4WASA 1Y8QA 4MINA 4WLUA 1UZNA 3WBBA 3HZZA 4OOEA 4WLEA 2CVQA 3T7EA 3L4BA 1VKOA 4YAIA 4U6QA 1RKXA 2VCYA 4KQWA 1MFPA 1JKIA 4EUEA 5G0WA 1NXQA 1ISIA 3I3OA 4BMSA 5A5FA 1V9LA 3BMQB 4D43A 5JXWA 3VHRA 4J1SA 3DFUA 3VVBA 2A4KA 3AFMA 1DXYA 3V2GA 1R12A 3DFZA 1RM4A 4ZQHA 1BGVA 1U5AA 4CM3A 4KOAA 4ZRMA 1B0AA 1Z73A 3ZWMA 3EYWA 3I6IA 1ORRA 4G81A 3TNLA 3U3XA 1Q0HA 2EKPA 1CEQA 5BSGA 1LSSA 3TPCA 1U3UA 4OGWA 5L7WA 5IN4A 2CDCA 1VC2A 1DDOA 5L7TA 4MVJD 4FC7A 1YB5A 1SB8A 3DO5A 1AHHA 2PZJA 3HJAA 1X13A 3GG2A 3RBZA 4DXHA 1HE2A 1BDMA 3ZV6A 3K2EA 3PQEA 3NTQA 1Z74A 2VNAA 1H5QA 3AM5A 4FD3A 4ZRNA 5TLSA 1SB9A 5A03A 1K0UA 4R4JA 3MZ0A 1EMDA 4J1NA 4QFCA 3OQBA 1ULSA 2GNAA 2G1UA 4GVLA 1FDVA 1HDGO 4J91A 4N5LA 3T4EA 1YL5A 2Y1OA 5TNXA 3RKRA 5CDUA 2EJWA 1KIFA 5A3JA 1B7GO 4E2YA 4HKTA 3OM9A 1J49A 2YHUA 5ES3A 4ALIA 4BVAA 3H9JA 3MJVA 3GGGA 4BNGA 1YJ8A 2R00C 3TZQA 4A5OA 1PSDA 2X0IA 1AUPA 1ZCJA 3HDHA 5HM8A 4OM8A 4PLTA 4I9NA 1DIGA 3LVFO 4PG6A 3BYZA 3VZQA 2X6TA 4IZIA 3X2FA 2QZZA 1NR1A 4MDHA 5JNLA 3E82A 2WD7A 3C7AA 2X5OA 1DO8A 1KVSA 4B3IA 1I5RA 3ZWBA 2DTDA 4FIZA 1IOLA 3DBRB 3ZWPA 4BKRA 4K28A 1PU2A 2OBNA 2W2KA 1HXHA 5JY6A 5I9LA 3C85A 2C2YA 4I5EA 5AXAA 5GMOA 3CXRA 3JQAA 4J2OA 3K31A 3HDJA 3LT4A 3PK0A 1ZXBA 1YS4A 4I8XA 3VC7A 1MFZA 3DMTA 1HLDA 4L76A 1SEVA 3ICPA 4OAQA 1UDBA 2UAGA 2O3QA 4DYDA 2TMGA 1AXGA 4B79A 2Q49A 1JU9A 3H8VA 2AG5A 3QY9A 3NGXA 3WQQA 4MVJA 3GVCA 1R0LA 3PTZA 1QMGA 2JD2A 4E4YA 1DB3A 2GR9A 1KEWA 5DOVA 3ZNOA 1KERA 2C54A 5K0ZA 4HWKA 5T57A 1GFSA 3JTMA 3WMWA 4XGIA 4R1NA 2SCUA 4CM6A 1ISMA 1R4NA 5L3ZA 5BNTA 1ISGA 1R6DA 3GUCA 5DBIA 3QRWA 2POQX 4O59O 2WE7A 1ENOA 2GRAA 5CAEA 1EQ2A 4BIIA 2VUTA 4CV2A 2X1HA 4MO2A 3ZI0A 4RJTA 1DPGA 3OF2A 3AM4A 4XA8A 3RQSA 4D41A 4E5NA 1MP0A 3DAPA 2I5PO 3ZNNA 3GG9A 2P4HX 4QUKA 3JQGA 5EINA 3JSAA 4YJFA 3TQHA 3PIIA 1R37A 3JD1A 4YACA 2ZYAA 1EFKA 1NNUA 3C7DB 4BO4A 2AE2A 1A71A 4TRMA 5JDIC 2C7VA 3PRJA 1X1TA 2G82A 4OO3A 1PJLA 2IYPA 1XDWA 1N1GA 4N5MA 1WVGA 1N92A 5KWEA 1BSVA 3H65A 3WJ7A 5IZCC 1PJBA 4IDCA 4WNCA 2J3HA 3RWBA 1C1DA 2OUIA 2Q1TA 5DP2A 4BL5A 2JCYA 3NGLA 3WGYA 3UF0A 1E6WA 2RAFA 1GR0A 2Y93A 4L4XA 5DNAA 4BB5A 4BHTA 2XXJA 2OBYA 3DOJA 1MC5A 2FR1A 2B0JA 2RIRA 8LDHA 2O3UA 4IQGA 3OFSA 3FD8A 2O23A 4O5OA 5F3RA 3H9EO 3HFSA 2DM6A 3UN1A 2J5RA 3Q1LA 3RC2A 3D0OA 3NT2A 1NWHA 2H9IA 4WLNA 2HMVA 2FN7A 3EDMA 4TRNA 1C0KA 4TWRA 2IEDA 1GUZA 4L9RA 1D1SA 3BHJA 4AJNA 4CLXA 1E3EA 4O6VA 3U4CA 2B83A 5C3MA 3GRKA 3QWBA 3VVCA 1QKIA 3GVXA 2H5LA 1PGQA 2EXXA 4QX6A 4WCFA 3F1LA 1ONPA 1WDMA 1XSEA 4YQZA 1S6YA 5J9GA 2Z5LA 3MJSA 1ENPA 2EGHA 3KVOA 1HLPA 1Q0LA 4RVHA 3RFXA 1HYGA 1H6BA 1ONOA 3PHJA 2Y0EA 4NBUA 2P5UA 2IE0A 3PDUA 4MP3A 3QVXA 4IQ0A 2E6UX 4QFDA 3TFQA 4D0SA 5JO0A 5F1KA 1XU7A 4AJEA 1Y81A 1F8FA 1U4SA 1X7DA 3JYPA 2OL4A 1LNQA 3KTDA 2CFCA 5L45A 4XYLA 2CVOA 4Z0PA 2DAPA 1A9ZA 3WYEA 3FNFA 2OXIA 4ID9A 1IPFA 4RF3A 3QSGA 1XQ6A 3ETDA 3P2YA 4B8WA 1BVUA 5JCJA 4G2NA 4E30A 4YQYA 5KVQA 1FDUA 5CPBA 3ONEA 5CEFA 1U3VA 4DC1A 3UICA 3AM3A 1YDEA 5BT9A 4GVXA 4AJ2A 2D0IA 1UH5A 4ALKA 3CE6A 5GY7A 1PL8A 4YR9A 5LC1A 4QTZA 4PZCA 2P91A 3L0DA 3HSKA 4CQMB 4WK6A 2CDAA 4YBZA 5EN4A 4RVGA 4TMFA 3ZH2A 3Q6IA 1BXZA 1UXHA 4CQMD 1LRLA 1WZEA 1O94A 3DONA 2VYVD 1ZIDA 3JYLA 4N18A 2LDBA 5DZSA 1UXJA 4WE3A 5A4DA 3H9GA 1A4UA 3GY0A 3H9UA 2QYSA 3WG9A 1Y9EA 2HK8A 2GZ2A 4FC6A 3D5TA 3P2OA 2HK9A 4W7HA 3Q2IA 4AICA 4B8ZA 3CIFA 4HNGA 1FDSA 3WWYA 4WKGA 4E0BA 1N5DA 2ZK7A 1NVMB 4NU5A 5F5LA 3IC5A 4Y8VA 3HNPA 4LCJA 3WGHA 5JBIA 1EE9A 1I10A 1MLDA 4KWHA 3TL3A 2OP1A 3PP8A 3T7CA 4AJKA 2WYWA 2PY6A 4WLVA 1FF9A 3B20A 4PLVA 1YOVB 5AXCA 1DAPA 3R6DA 5B12A 3QA9A 1DFHA 2E49A 3HE3A 2Y67A 4IS3A 3WFJA 3KB6A 1QSGA 2VWGA 2ZIZA 1VPDA 4Q3DA 4LMRA 4M1QA 1QYCA 3GEGA 2Y0DA 1L7DA 3I9NA 3GNSA 1E77A 1NQTA 1GD1O 3HB4X 1LDGA 4PLHA 1EQUA 4N54A 2PGDA 4Y6SA 2X5JO 2FWMX 1C0LA 3G49A 3WQSB 5K6AC 4NNJA 3H2ZA 5KJCA 4PLFA 3E8XA 1MG5A 4BNXA 3AOEC 2EW8A 5EMHA 3NRCA 1Y8RB 3LC1O 3ZV4A 3DZFA 1EBFA 1GQYA 2QZ9A 3BMNA 3BTVA 1LDYA 4ND2A 1SCUA 1EVJA 4GMFA 2VRCD 3I83A 3DBHA 1BMDA 3WGQA 1I3KA 3Q9NA 5BR7A 2D1YA 5CEEA 2O2YA 4KMSA 4IS2A 5JC1A 4K1LA 3GVHA 6LDHA 2FOIA 4YT2A 2X0JA 3NX4A 2YDYA 2CVZA 4PGFA 2FZWA 4L75A 3AOEA 3JQGB 3INRA 3LDHA 4BNVA 2WYVA 2E82A 3SLKA 3O38A 5IZ4A 2IXAA 2FRDA 2OP0A 1TEHA 1R15A 2ZATA 4FFNA 4JJGA 3TF5A 1N8KA 3CKYA 1FMCA 4DGSA 3ROQA 3LLSA 5JDIA 3ZGYA 5JAMA 2Z1MA 1C14A 4XWYA 4HFRA 4CV1A 2GYYA 1E7RA 2XXBA 4BO8A 1MB4A 1T25A 4YJGA 3L6EA 2D5AA 5HA5A 1HYHA 4BO7A 4RVSA 3UHAA 1IZ0A 3OICA 3I9OA 3AY3A 1UP7A 3IOYA 3VH1A 5TQVA 1XWFA 3HUDA 5A1TA 2BGLA 5KJ6A 4WEQA 4WLFA 2GERA 3M2TA 3VZSA 3IP1A 1Q2XA 1SOVA 3VPSA 1C0IA 3TN7A 1QYWA 3QJ5A 1B3RA 3FHLA 4IJUA 4OHUA 5TSDA 2JCVA 3DQPA 4FCCA 2PGJA 4D79A 2C59A 4CM9D 1U1IA 5JC8A 4YJGB 1A72A 3PZBA 2YHIB 4EEZA 2PV7A 3CMCO 4JBIA 3DTTA 4YAEA 3ICCA 3LT2A 3VZPA 2WMDA 3ZW9A 4HFJA 4C4OA 1GQ2A 1QRRA 2DT5A 1XA0A 4K6CA 4XIYA 1OMOA 4A03A 2YV2A 2BFAA 1SZJG 2VOEA 4FFMA 5JY1A 1I01A 3LT0A 5BNIA 4IZHA 2JD1A 4RV9A 4QT0A 5JYAA 1H0KA 3D7LA 4AFNA 2YFHA 4S3MA 4R1SA 1IPEA 3GDGA 3I4CA 1ZJYA 3D5QA 4PLYA 1TT5A 4J4TA 4Y98A 4YB8A 4J9UE 4YT5A 1PEDA 4HX5A 1V6AA 3W4KA 5TF4A 4GX1A 2NUAA 5M6DA 3W8DA 2AXQA 5FF9A 3UH1A 4IY1A 3ITDA 4WOKA 1GPJA 4BNMA 1QORA 1IL0A 2X0RA 2AG8A 2X4GA 4NBWA 2HK7A 2Q4BA 3I52A 1M6HA 3GMSA 4FB5A 4RPGA 5EJ2A 2ZYDA 4E12A 3AOGA 4XYEA 1X0VA 3PPIA 3K2BA 1SC6A 3NDIA 2WM3A 4GQAA 1PWZA 1ADFA 5IDYA 3UW3A 1H9AA 3GHYA 5IG2A 3DB2A 1P31A 3AI3A 1DC6A 4ZHSA 3I23A 5CDSA 1P45A 4IDDA 4OSPA 5HWSA 4JQCA 3KYDA 1XU9A 3C1TA 2EV9A 3JQ8A 1PR3A 3RUCA 1PQUA 4IUYA 1ISFA 4NBTA 3FNHA 4U5QA 4RPJA 1T2AA 5IXYA 3PHHA 5JYFA 4B4VA 1B26A 1VRWA 5I7VA 1IY8A 3GAZA 4WCDA 4XYMA 4IJVA 1MXHA 2O3RA 4NH4A 4CQMA 4GMGA 4CLOA 1GUYA 4DIFA 1Y5RA 3BA1A 4M8SA 5HBRA 4JJFA 3HG7A 4YWJA 2VUSA 4CM9A 3X2EA 4RLHA 3IJRA 2DTEA 5L40A 4AJ4A 1JTVA 4MVJE 3KEQA 3GR6A 3V5NA 1DAOA 3DXFA 3HDQA 4U7WA 1LSOA 1E5QA 4NU6A 4E2XA 2I76A 3BMOB 3JQBC 4CLRA 4NJMA 3OA0A 2UUPA 5JAQA 5T8KA 3V1UA 3ZNPA 4AJOA 4CQLB 3E18A 4CMCA 1XG5A 2PWZA 1T24A 3QWAA 3IUPA 4NI5A 3W4JA 4DQUA 4FGSA 4UEKA 4NK5A 2FP4A 3L9XA 5BQFA 4KZPA 2W2LA 1N9GB 3AY7A 4RPHA 3WGOA 3RU9A 3RUDA 4E2ZA 3GVIA 3JYNA 3ZU3A 1QYDA 1NPTO 1NVTA 2EEZA 3FR7A 2IRWA 3MTGA 4H7PA 1E7MA 3SEFA 2B35A 3DTYA 3EZYA 3SC4A 4DBVO 1L1FA 2C20A 5EPOA 3W6UA 4BO6A 3IIEA 4A73A 2DFDA 2EGGA 3RUEA 2JFGA 1E7QA 4E33A 4O63O 4ZVVA 4QQRA 2IEBA 1RM3A 5B4VA 2YY7A 4UVIA 4J2HA 4EEXA 4CV0A 2RH4A 3ZWVA 5DCUA 3FTPA 1HDZA 1PJTA 3RBXA 3MJ4A 2C2XA 2PTGA 2Q2WA 3A28A 4B3JA 3PJFA 5L53A 3NTRA 4FFPA 1X7HA 4PG4A 1M76A 4WEOA 3CPSA 5I8ZA 4Z0HO 5A04A 5KNLA 1GTMA 2Y66A 4JROA 3RJ5A 4E2WA 3W1VA 4ESOA 2DVMA 5DBGA 3GNQA 2B4TO 4GKVA 2BFOA 3C1AA 4HFNA 1R0KA 1DIHA 3AUSA 3IAHA 2GO1A 3JQDA 4ZN6A 3OJFA 4RDHA 3DEYX 3W4IA 1I2ZA 4XJTA 1WAMA 1M6WA 2CD9A 1CJCA 2FPPA 3W6ZA 4C7KA 1KYQA 2BGMA 4UUPA 1P0FA 2R2GA 4W7IA 3N7UA 2VYNA 3WGZA 1KVRA 4WUVA 1NPYA 1MC4A 1EUDA 1Z7EA 4YXFA 3ANMA 4DPMA 5LDHA 4BOYA 4CUKA 1VE9A 3S1LA 4D44A 1K6XA 2VQ3A 1LSUA 4CMHA 3PYLA 3RI3A 3PHLA 1LLCA 2NTVA 1E6UA 4GWKA 3KYCA 1KETA 3BHIA 4J1QA 3QW2A 5LCXA 4XX0A 3CZMA 3KLPX 5H82A 1BVRA 1V35A 5EQDA 1LU9A 1ID1A 3NT4A 2ZB4A 4JNKA 3EY4A 3I1JA 3OP4A 4UVDA 2RHCA 2C5AA 1P1JA 2NWQA 3WYBA 4MKRA 4RL6A 1Z6ZA 4Z0TA 3S2IA 1ZSVA 1YL7A 4N7RA 3O4RA 4PG8A 1PJ2A 3I4FA 3I5MA 2X5KO 3HADA 4O0LA 4GLLA 5KKAA 3H4VA 3RUIA 1SAYA 1CDOA 2O48X 3TZ6A 3GN1A 3JQ6A 4CPDA 4G5HA 3D4OA 4LVCA 3KXDA 1U5CA 1P1IA 4LCEA 5KVSA 1HDOA 3ONDA 3WGGA 1Q7GA 1T2FA 2VHVA 3ONFA 1CRWG 1QYXA 4FBGA 1U8FO 1F17A 3S2GA 3WGIA 1VLLA 2VWHA 1PGOA 3HN2A 3NT5A 2HKIA 5KKCA 1P74A 2W4QA 4GI2A 4UEJA 2G17A 2PH3A 5B1YA 5ER9A 2P68A 1JAYA 1YB1A 4AJPA 2D8AA 3JD4A 1UUFA 1DLJA 1N2SA 5I7SA 3VTFA 3OJOA 1GU7A 3IS3A 4BNHA 2PGLA 4PN3A 3DC2A 1NFRA 3PI7A 1KS9A 1XHLA 3JQCA 3L9WA 3D3WB 3KSUA 5T5QA 4OOFA 3EC7A 5ITWA 1PZEA 1NQAO 4ZQGA 1NAIA 1T26A 1HWYA 2WEKA 4DQXA 2Q22A 4FFLA 3KO8A 3UKOA 3WNVA 1DHRA 5AQ1A 1DLIA 3WLEA 3QVWA 1EVIA 2Q2QA 3OECA 1EK5A 5CDYA 1ADCA 1PL7A 4OXYA 1PTJA 4TKLA 3OEYA 3LQFA 1XKQA 3D64A 4Q3BA 2JJYA 3O8QB 5KJ1A 4INAA 3ANNA 3PXXA 4YT8A 5AVOA 3I6QA 3UAGA 4ALNA 1HKUA 4HXYA 2NTJA 3IKTA 4EYEA 3BAZA 3LSYA 1WP4A 4IDBA 5T73A 4DRYA 4LVUA 4M49A 4CLRB 4O1MA 3HFGA 4LISA 3PLNA 4BNYA 2P2SA 5EESA 3KYBA 3ZWWA 4WNIA 3UFXA 1WLYA 2IXBA 1U4OA 3H6KA 1DRVA 2W8ZA 1J0XO 1K3TA 1NFQA 2Q3EA 4FGWA 4XIJA 4YRAA 3K92A 4Q9NA 3IQDB 4XJSA 2JHGA 2J3JA 2PK3A 4K9DA 1HSOA 1UXGA 2QG4A 2ZCUA 4AJIA 5DP1A 4A0SA 3OIDA 2Q45A 3VH3A 4PIVA 3IUSA 1Y5MA 4FN4A 4J0EA 5ADHA 1ENZA 1DRWA 3WSWA 4PCVA 1NX6A 2R00A 4J90A 4J1TA 4EW6A 2VWQA 5ENVA 2Y1DA 3ULKA 2X0NA 3ZCXA 4Q3CA 1DIAA 1K5HA 3B1JA 1U2DA 3E9MA 4WCFC 1H2BA 1F14A 1NM5A 2VNSA 4I5FA 1DC5A 1BW9B 4I5DA 2GCGA 1JWBB 2Y1GA 4HBGA 4NZ9A 5KJFA 2UV8A 3AU8A 2NSDA 4IXWA 4RF5A 1XIVA 1TLTA 1MUUA 3RUAA 3UVEA 4LW8A 3E03A 2BMAA 1BRMA 5JPIA 4BKQA 3OJ0A 2QRLA 2QQ5A 3DZHA 4TZKA 3GF4A 4W6ZA 1CETA 1AXEA 2I66A 3TDKA 3DDNA 3K96A 2O50A 3LK7A 1JW9B 3HDYA 3WGTA 2EJVA 3PDJA 3R1IA 4YAKA 1Z7BA 3GEMA 2QW8A 3GUYA 1UP4A 4IQ8A 3QVOA 2YQ4A 3GAFA 4M87A 3QIVA 4A2CA 4EGFA 4XRGA 4EJ6A 5JO9A 4B4WA 3OMLA 1SEPA 3ZU5A 3FNEA 1BDBA 1EE2A 5MGBA 2B5WA 2YDXA 5JYEA 4DPKA 1E6EA 5A06A 1DJQA 4IDAA 4W9NC 5JLAA 1HSZA 1ZH8A 3EK2A 4Y6RA 5CFZA 1NVGA 4TKMA 4U6SA 3I9MA 2B69A 1VJ1A 3A4VA 2Q99A 1BXGA 1ISJA 5L95A 4FPXA 1PJ3A 3JQFA 2JKVA 3STHA 3U0BA 4DWVA 3F47A 1CF2O 4DMMA 4XQEA 1W4ZA 2HMUA 3OETA 1ZMOA 4WLOA 3Q0EA 3FI9A 5A9SB 3NJ8A 3GVPA 3Q3CA 3JQAD 4XR9A 3ROMA 1HE3A 2ZB8A 4P4GA 4NJMB 2NU7A 3C24A 3PHIA 4WJZA 4YA6A 2A9FA 2CUKA 3DHYA 3ZW8A 4R51A 4MVJP 2DU8A 2VN8A 3D3WA 4LMPA 3BTOA 2GN9A 5IF3A 3DZBA 4E5MA 4M86A 4CMIA 2O7QA 3FCOA 2X22A 4FJ2A 5TC4A 1ADGA 3OQ6A 3O9ZA 1B2LA 3OQ1A 1X7GA 1SBYA 2WDZA 4UVEA 1FXSA 3VPHA 4DA9A 1OAAA 4CUJA 1LDNA 1QLHA 3WIEA 1F0YA 2PFGA 1GL3A 4JN6B 1MG0A 2I9PA 3KYDB 4TZTA 4W4TA 4CJXA 3U4IA 3PGXA 2F1KA 3G1TA 1P1RA 2AA3A 3NDJA 4BO5A 3PHGA 1GCOA 2HU2A 2VTDA 1JWAB 1TXGA 3EZLA 2P9CA 1HE5A 2EERA 2JAPA 4Z3KA 1IULA 1TA4A 5A02A 1GYRA 1HRDA 4JK3A 1OOEA 2RCYA 1LRKA 2E37A 4FOSA 5C5IA 3HWRA 4OSOA 3G17A 3VAZA 3JQ9C 3HB5X 4BGUA 1QG6A 2IODA 3VPXA 3WOHA 3PFFA 3SVTA 1YONA 5L4NA 4Y9DA 2ZTVA 2Q1UA 1NAHA 1ZO8A 3E6AA 1O6ZA 5KTKA 3B1KA 4GX0A 1H6AA 2X58A 4OYRA 4YJFB 3CH6A 3ZWYA 3Q2KA 1PQWA 5F1OA 1ZKMA 5G0VA 4Q3EA 3P19A 4CM4A 2YJZA 4ND4A 3KETA 2J5QA 3WMXA 1CIVA 4M55A 2AQIA 3TJRA 2WD7B 4RCVA 2DPGA 2HRBA 2VT2A 1IHXA 5DF1A 3CMMA 3EAGA 4YJHB 1NHWA 3O26A 2HAEA 1PZHA 2PZLA 2F00A 2GF2A 4WGGA 4YYZA 3T4XA 2VHWA 3GDOA 2H63A 1KEPA 2FR0A 3AFNA 2UDPA 4DLAA 1A9YA 2J3IA 2J5KA 1TVEA 1RJWA 4P38A 1IYZA 2NU6A 3OJLA 4XYGA 4CMKA 3FPLA 3GHHA 1PJQA 4LK3A 1KOLA 4K26A 2ZCVA 4PG5A 4G65A 1M67A 4NR0A 4RLSA 7MDHA 4J49A 2GD1O 4ZJUA 4I5GA 3RROA 4BGVA 3ZHYA 4PLCA 4GSKA 1HYEA 3AI2A 4CMEA 4D46A 4XRRA
chains in the Genus database with same CATH superfamily
4DYHA 1FLDA 1CZHA 5JJLA 3P2EA 4E03A 5B4TA 1YA6A 2ZB2A 1CRPA 1Z4NA 2HSJA 5EIAA 3ZLVA 5JVDB 3SZ3A 1E0DA 3TNDA 3E27A 4C0LA 3KKPA 1SNYA 5C5EA 1SXJB 2XZPA 5CU7A 4ITRC 1OROA 3TOVA 4BFSA 1V0JA 4ENPA 3ZWDA 1RQXA 2MINB 4BJ3A 4PYJA 5BUSA 1J6UA 2PSJA 1RBYA 2XCIA 2WRZA 2A6PA 5KI6A 2FY8A 1GDTA 1JLRA 5E0OA 4QG7A 3SJCA 3LC2O 3WFZA 1E2PA 2V6BA 4FI3F 1P6QA 2QAGC 1FFHA 2II6A 3WBKA 3FZYA 3K9HA 2WB4A 2Y3IA 3QX9A 3ZZMA 3CZAA 4JR1A 1EU1A 5IYZF 5JAOA 3ZHCA 1Z2DA 1VJTA 3VH2A 2RK4A 3FKSD 4PNHA 1DQPA 3SC2A 721PA 2O5VA 1X80A 4L27A 1XZ8A 4PFJA 3RIXA 3DOOA 4BGIA 5HKAA 3RYHA 1C1XA 3D5EA 1TVKB 4HJXA 4ASUD 5ALJA 3U4GA 2DP4E 4YVFA 2GT1A 1PZNA 4IJKA 5DLPA 2O8FA 3LAWA 2J3DA 4W6QA 5EJ8A 3JR7A 3WLKX 4RHXA 2MSEB 5AOCA 3ZLJA 3J81A 2PKRA 2BGIA 2QP9X 1U0GA 4IDOA 4N0PA 1UBMS 1SZPA 3VZBA 3PXCX 1CUHA 3T3EA 3ZCRA 1Y3CE 4ZT4A 3PWZA 1X74A 2PVPA 1IHUA 1DJOA 3GUZA 5COQA 5JAZA 3MGCA 2AVDA 1W5EA 3OBBA 4ESHA 4ZU3A 1YTLA 3FTQA 4KFUA 5G4KA 3VAYA 3ZN2A 5I5EA 5KPJA 2PX0A 4OGLA 1T29A 5C35A 5AD1A 2JHFA 1GRVA 1T0JB 3CX7A 2AZMA 4E1AA 3ZUGA 2JFHA 4LWOA 5JMTA 4ZA2A 4WESA 4MGYR 4MKHA 1XUOA 1P77A 5ILGA 5LNK6 2JAQA 1AURA 3C16C 4Z8YA 3IMFA 4UE3S 2GLXA 5JWRA 3QYFA 5MN5A 4HXEB 4HNHA 3V34A 4QTYA 1X6VA 3P26A 3CO0S 1XA3A 4ETWA 2IUFA 4I6EA 1WXQA 4TM8A 3VYWA 1D5CA 3DVRX 3DZIA 2NZJA 2EP7A 4CL3A 4Z4GA 1QR6A 5ALDA 1EVLA 5J4KA 4DWVA 3K6KA 4OLBA 3SZLA 4KUEA 1L8AA 2PU7A 4AP5A 1C9NA 4U5XA 4BPBA 1RM0A 4L3WA 4U2FA 3EQ6A 2PR2A 4RULA 1QWOA 2XMGA 3K6JA 4UUAA 4DV7B 5IS2A 4D74A 1XEXA 1JAZA 4JUDX 3LPAA 4DCGA 4QREA 2RK6A 1G4HA 1VG8A 3HV0A 2IEAA 3UXHA 5C1IA 1X1DA 4B3FX 4XKJA 5P21A 1OC2A 2Z5VA 3MWEB 3FVWA 2WYUA 4YRRA 4JLDA 3EGXA 1SHZA 2VT3A 4TROA 1R8XA 4O2LA 1YS7A 3OX3A 3DOEA 3PQ5A 4OBBA 1LBQA 3D2AA 5DN6D 3C3XA 2Q8NA 1G9TA 3RU7A 3KR2A 1HA3A 4DWJA 3ANTA 4HV4A 2FMFA 2YZKA 1VPLA 4MW6A 3LSTA 3RYFB 3L6CA 5DO9A 3LE8A 3AEKB 1Z06A 5LB4A 2V9CA 2MU1A 1P6UA 2RHJA 3P32A 2AG0A 1MIOA 2HD4A 1XEWY 3M6MD 4N3AA 1Z5OA 3N6XA 2ECKA 2JEYA 2QRKA 3IVCA 4G0YA 4MLDA 3ECAA 1YE8A 1B23P 2FPKA 4OQZA 2Z3ZA 3IPRA 3EBOA 1JLMA 1EHIA 1UC9A 3VNUA 1ZBQA 4Q1EA 5E8RA 3RASA 3WLHA 2OCPA 4CCAA 4GVPA 1WZCA 3E3MA 3A7DA 1SD5A 1MX1A 3I76A 4IG4A 4PZPA 1RRKA 2GM9A 3FG9A 1GSOA 5IEBA 2HF9A 3EF1A 1M2JA 1MQ8B 1O08A 2QL9A 1SPXA 5ALMA 3OA2A 1C9YA 1T0UA 2JCBA 2NN3C 5EGSA 2NADA 3W2EA 3GZNB 4OK3A 4HX9A 3HCPA 5CM9C 3GFTA 4PBTA 2IS4A 5LJIA 1ID8A 4CR8A 1FRVA 1YIAA 1I3NA 1QGDA 3PPYA 3QNMA 5JD5A 1IG0A 1N2CB 1FJGB 3G2QA 1DE0A 5EYPB 2QAGA 3WYCA 1KZ6A 1QRAA 4IGEA 4PPGA 5LXTA 5BN3B 1O89A 2O3TA 2P2CA 4MPTA 1W36C 2IOQA 4JI3B 3I5XA 1DWOA 4WFJA 1T9ZA 2OHXA 8MHTA 3EP5B 2JFOA 3RRBA 1B14A 1E7WA 5CCBA 3M6LA 2GDJA 1EPUA 3TTTA 4US1R 2W6OA 4H3VA 1JYEA 2VPQA 3MFYA 1GTSA 5T4FA 4OHYA 1KEUA 4ZAZA 3LXMA 3NC0C 2UUCB 5AICA 4ZQEA 5HRUA 3U62A 1OFGA 5CVJA 1Z0IA 9ABPA 1OBCA 3U9SA 2O7SA 3IQWA 3K8QA 2RHWA 3GRZA 1LI5A 1DJNA 1Q1GA 2VP6A 2XNJA 3THWA 3WK4A 2UVQA 3I53A 4RS3A 2XKJE 2M2IA 3P8ZA 1VPVA 4FDVA 1KZHA 1WCIA 4XGNA 2HRQA 4S0ZA 4QEKA 4W63A 2BL4A 2VH1A 1IM2A 5ECGC 3N74A 3AH8A 1YJAA 2ZJ2A 4BNWA 5COBA 4QKQA 1T1SA 4CV3A 2H65A 2JI6A 3QWFA 2JDIA 5B6IA 4M9XA 2IEZA 3RSOA 5KDOA 4RGQA 4YRNA 3LQRA 1F4LA 1NN1A 2A14A 2F3SA 1P2FA 4HEJA 3OQHA 3ZS9A 4F1KA 4YV7A 5FWDA 5ICSA 1L5KA 5THKA 1W4AA 1RKVA 2XWBF 2D5IA 3OIFA 4MYHA 2FSIA 1FP2A 3K1YA 4AJJA 5L4SA 2F6RA 1I3CA 3Q9UA 2BWJA 3M5DA 3IOCA 4GL2A 4GSLA 4EB0A 5AM3A 3WAJA 3GJXC 4PVDA 5G41A 4CKBA 2GN6A 2AXEA 1ZJZA 1WO8A 3GPIA 4L50A 5ALHA 2XBLA 4KH0A 3PYMA 1KJWA 2XDQA 3LD9A 2BI8A 4HDKB 3QXXA 4CM5A 1H6DA 1C8KA 1DKOA 2XMDA 4HNSA 4JCCA 3OCUA 2ZJFA 4OLAA 1FSPA 1JAXA 3TBHA 2W42A 3TX2A 1WU7A 2J3MA 3DHNA 1AG9A 1NQVA 5FI1B 4MRMA 4R1TA 3KYCB 3NAQA 4QPDA 3D8NA 2ACEA 1XL0A 3BOSA 3MINA 1VG9B 1Z39A 2Q4RA 3LW8A 4JT4A 4YALA 1SBHA 2YNMA 3SI7A 2OVBA 3MT0A 2QY6A 1QFZA 4IRUB 4OKIA 5B37A 2W4MA 3G0HA 1QQ7A 5EJ9A 1N0IA 3K0FB 1QJ4A 4Y6PA 5BSEA 2HOQA 2CNOA 3MB5A 3MT9A 1B16A 2FMXA 2OSVA 2XZTA 3MMPA 4ICIA 2VHUA 4QPJC 5G0UA 4YREA 4G4GA 4I1UA 1U7TA 2JJ2D 2WQZA 3KEOA 4OHCA 4TKUA 4UZFA 2Z08A 1LUAA 4KXUA 1LDMA 5LLSA 1IE3A 3REGA 1G2PA 4Z9BA 4M54A 3ZU4A 4KAJA 2E5FA 2XB2A 4GI3A 4GNRA 4GKBA 2SKEA 2NXJA 2GZ3A 5GINE 5I51A 4CL0A 1JHDA 2BHRA 1PGNA 4TYMA 2PD4A 2OZPA 4JC4A 1Q0QA 2DKNA 5FB3A 1P17A 3COSA 2XTAA 3GLHA 3EPKA 4KYTA 1T6BY 4L3OA 4OQPA 4Q1BA 4RPIA 3O03A 1CWUA 4D1YA 3L4EA 1M66A 1KTIA 2NAPA 5A9SA 1H4VB 4KITB 4N39A 3O8LA 4X94A 1PWXA 2FSUA 4C7BA 4G89A 3VDRA 4B45A 1A50B 3OE7D 2WAAA 3TBKA 1JDBB 1VBFA 3WLSA 4F4JA 1IRIA 3TLJA 5JSZB 1J1UA 2C5FA 3DZ8A 2GVZC 4B6JA 3PHCA 3E8MA 5C32A 1H85A 1YK1A 4N0EA 1JA1A 3OSUA 1N1EA 4IHJB 3N7TA 2FW1A 4IIEA 5B5SA 3KQHA 2ZJ6A 4JELA 1DBVO 4MLCA 1AVTA 3D1JA 4H35A 1KFKB 4YRBA 1S2MA 5FUQA 1KAOA 2JGJA 1X42A 1E2IA 3SOZA 3B3GA 2HQRA 4R9NA 3R2JA 3ZY3A 2FEKA 2VXOA 5I45A 4PHGA 3E22B 2GCEA 1FUKA 3IAAA 4LJ8A 4RGYA 4Q5IA 2TS1A 3WL5A 5EUQB 4ECAA 1FW8A 1R4ZA 4B2LA 4OX9Y 2IELA 1VJ5A 1E58A 1JZQA 1QO7A 3KSDO 1M8FA 2ZDGA 4RM2A 3AKZA 3CWCA 2Y27A 3PENA 2V65A 2E1PA 2TYSB 5JS6A 5KVVA 4LDQA 2Q0HA 1ANKA 1XVAA 1XCMA 1PUJA 3UC5A 3QPWA 1BN7A 1WD5A 4QAJA 5FLEX 4G0ZA 1R5BA 3OZAA 4MQ6A 2IZZA 4PONA 4PLGA 4P86A 4BLOA 1A4IA 4F8JA 1DKMA 1XP8A 4U6NA 4A6XA 1T36A 4GP6A 2WJ3A 3C0KA 4YQFA 3S81A 1M2WA 1CEEA 1AE1A 3F1KA 5TIIA 5H4HA 1M9NA 1OBOA 4F6RB 2ZCJA 1G6HA 5CP8A 5CW1A 5F4ZA 5FUMA 1SKMA 3ZJVA 4YT4A 2WICA 3A3OA 3H5AA 3NHJA 4P80A 1QYVA 2VHXA 3BTSA 2CV1A 3R7SA 2GM5A 3ZLBA 1FA9A 1I6LA 2YQZA 4OX9B 3ZCUA 4RY9A 2YMMA 1T0BA 3Q3GE 4FMDF 4PVCA 1DX4A 3FWYA 1TQ6A 1NMXA 4LNHA 4MUJA 3OE7A 4Y0NA 5EIXA 1WMEA 4XB6B 4MAAA 2BGKA 2QYHA 2GPTA 3M3DA 4CMGA 3ITKA 3OVMA 2D5LA 2X9GA 4I1PA 4NCBA 2XQVA 3EP4B 1CR0A 3OUZA 4MCHA 2V7UA 3CT6A 2G07A 5I9NA 1W35A 2OCBA 2Q4EA 4GZLA 5DHRA 5DIZA 1OLSB 1GY8A 4POAA 1VMIA 1FBNA 2IYAA 5BURA 5JS8A 3GLQA 2ZT5A 4FEAA 2PGAA 3FLAA 5AM1A 2CF5A 2P5SA 1B93A 1CF9A 2KSQA 3R4VA 1OTYA 4WDRA 1RPNA 3AJ8A 3N2YA 3Q2OA 1VSQA 5LDGA 4DREA 2A8YA 2ZJ1A 3N3AC 4JP2A 1MOPA 1KAMA 1DFGA 1OLSA 2ZSHA 3CSDA 3CZQA 3GT3A 4GH5A 4XFJA 3RTCA 4EBFA 1VHDA 1CJKC 2KQUA 5DM2A 2SHKA 1IUNA 1YL6A 3N59A 3QM1A 4XUDA 5CK4A 4Z53A 4A6PA 5EHGA 3I6ZA 5FBQB 4Z4HA 5LXTF 1SN7A 3BS4A 3NCTA 1U28A 1MTOA 1YGYA 2A3RA 2AOTB 5E9JA 3RFVA 2CCKA 3ZCVA 2WSLA 5EXPA 4V2UA 4FMDB 1A9TA 3KM0A 2NXCA 1VMEA 4KNWA 5MFPA 2BCGY 5A4JA 2Q9UA 3GLHE 2YHBA 3RIEA 4NG5A 4DJJA 4Z7NB 1B2RA 1RZ3A 1C4KA 2AJ8A 3PC8C 1QHIA 4MS1B 4M9ZA 5E7JA 2IYUA 3H16A 5B7GA 4TRRA 4WXHA 2GTHA 2OVFA 5HXAA 2FX3A 2WG2A 3AILA 4YCCA 4R16A 3PD0A 5FV7A 2EFCB 1J1ZA 4N82A 3RVMA 2G4LA 4MX8A 3V6MA 3NH9A 2ST1A 4GRAA 1OYVA 1M1YB 4QJIA 3NHMA 1O97C 2KW5A 1J4AA 2G8LA 2PR7A 5IJ0A 1V3UA 3OQIB 2WFZA 1UKVY 2WLSA 4PW0A 4XPZA 3ZY6A 4ALJA 1LH0A 4GP9A 4I9HA 4L9SA 3RGGA 4C3VA 4YY3B 1XMSA 3PITA 2MYPA 4IEIA 5DNEA 4BFXA 3CCFA 2VKQA 1BCSB 2XDQB 2ZTSA 4HDKA 4M0PA 1LDEA 2AUMA 3C41J 2IY8A 4DBZA 5C81A 3ZHZA 3FJOA 5AVWA 2OM2A 3K9LA 3SJZA 3K6SB 2UVDA 1LRJA 2V7QD 2GZMA 1P1BA 3U49A 1BROA 1DBWA 1KH3A 2H7VA 3EUAA 3QZUA 4X7BA 1KQNA 1E96A 3T3DA 4C4YA 3W3ZB 1SBQA 3IA7A 2V3WA 1U0HC 2FJUA 4GIBA 3KSRA 1E2UA 1VLMA 2AJDA 5H9WA 4M0LA 2JZNA 1FYVA 4DDHA 1G7CA 5HZGA 1XTPA 1CFJA 2Z56A 3E2PA 1KSGA 4P54A 4D0LB 5JQGB 3N0XA 3AI1A 1R2QA 3RVPA 5BRAA 3R9XA 3WLRA 5IAAA 1KJIA 3ISVA 3GIDA 3MWKA 1TMKA 5IABA 1UFRA 4MP6A 3H2BA 1FRFS 3OEWA 3BL8A 1LK5A 3INNA 4ZOLA 4PR3A 1M74A 1G0OA 1O9HA 1OWMA 1N7GA 1L7EA 2R66A 2C61A 5ALLA 5HKOA 1TUBB 3I9JA 2Q7OE 3O2NA 1H93A 1A9XB 1T2DA 3I04A 2Y4NA 4G8DA 5L7YA 3UWOA 3AFHA 4N0MA 1QR2A 2JIRA 3F6SA 3QI2A 4F2GA 1XQYA 3ZI7A 3G5TA 2ATXA 1Q1QA 2P3QA 3UC9A 3ZJUA 4M0CA 3SJ7A 1SXJC 1A9RA 3MCZA 1LVHA 3Q8MA 3WIUA 1MOQA 1RLMA 1X0XA 4RQTA 2AG1A 4CIYA 4P9NA 1ZD2P 4HGQA 1RTKA 4RGBA 5J40A 5K3FA 5IAOA 3CR7A 1M6EX 1PL6A 2YCBA 4KQJA 1W4CA 2X9QA 2O2EA 3VR4H 3ASUA 5ALIA 1XYGA 1FSSA 5IH3A 1I3MA 5TRTA 1VZ2A 2GX6A 5T64A 5I7EA 2D1QA 2MYUA 3GFFA 4H15A 4TTJA 4B48A 2XT6A 3UEOA 4Y2TA 3GLFA 4YAOA 2XGJA 4OGKA 4LZPA 4YMIA 2BOVA 3WWOA 3L82B 4M8KA 4ZVKA 3LX4A 3LP8A 4KIWA 1H2HA 2GBLA 5FTWA 1YGPA 4BJHB 1Z0SA 3K73O 2B1GA 3ESXA 4HB4A 2XAUA 4ZDJA 3WNQA 3EDRA 3IRUA 5I4BA 2WIKA 5LYJF 2QHXA 4WKPA 1KR2A 5F21A 3WDSA 1BE8A 1HL7A 2VI5A 4G1CA 1A4XA 4GQBA 3P0RA 4PSUA 3TFOA 4MJLA 4QHTA 3ZOZA 2OBLA 1C1DB 2H3EA 5CLJA 3FYSA 5FOQA 4JP5A 2EJBA 3LRXA 5KTYA 1OI7A 3PJEA 4DL9A 3WNDA 5TY0A 4RJLA 5D84A 3ZC3A 1N5OX 1SUCA 3O4GA 1QO0A 2I33A 1F51E 1I7LA 3QUQA 3PI6A 1TYDE 4MGHA 4L6CA 1GZDA 5B7PA 3AKEA 2FH5B 3DM9B 4KI0A 2RBGA 4CM4B 2OC4A 3FLMA 4KR7A 3IUNA 3N3BC 3K15A 4M37A 1JFVA 3WB2A 4ZHQA 4RESA 1BU8A 5U1PA 4TSKA 2QAJA 4DOMA 2QQ0A 4CMBA 1W9MA 4Z2YA 5TT0A 4R69A 5DLYA 4UTZA 2A0XA 3LT1A 1N5LA 4KWTA 1QIEA 2Y1WA 1E2MA 2V7WA 3HSSA 1O9BA 1Q20A 3QP9A 4JX9A 2H31A 1A95A 4OB7A 4RZXA 1ELOA 1P60A 4KFTA 4ETIA 1IU9A 1Q19A 1Z13A 2HJWA 3DXYA 4W5WA 2DETA 1L1QA 3B7PA 5LIPA 4DDMA 2GARA 3T5MA 1U7PA 2WZDA 4M0EA 2HSWA 4BS9A 2I78A 1UXKA 3AHIA 1VOTA 3G2PA 3GPBA 5IANA 5ALYA 1P61B 5EIWA 5G3YA 4D3DA 4QRHA 4LJSA 1P9LA 2C99A 2WHEA 3KEGA 1QV6A 3OY2A 1XZEA 2I6FA 2BMVA 5BSHA 3KLMX 3NIGB 1LDBA 2DBQA 2F55A 3H9QA 3T7SA 4B3HA 3ZTWA 5KX5B 5FX2A 3M1LA 3T1YB 4E07A 3ZHBA 2CFTA 1ZNXA 3GGSA 3FHCB 3QF4A 1BH6A 1YDHA 1JE0A 2EW1A 1HM5A 2JGMA 2J9GA 4OVKA 3OZSA 4QM7A 4QBIA 4BCDA 5H4GA 1U9JA 2ZLBA 3LCRA 5A3SA 3FPCA 4AC9A 3D3EA 3PGA1 4LFBB 4BLRA 1QFXA 4TVBA 1A5ZA 3G2NA 1TE2A 1YZQA 3GZTB 2BTOA 3QKSA 3QVKA 4G63A 4P83A 1AK1A 1SG9A 3W5JA 5BPHA 1E1RD 4P5DA 3GLIE 3KD2A 4X64B 1ONNA 3DF9A 1XVLA 2HU8A 3O8DA 3QHAA 1DQNA 4AL4A 4OFBA 1C81A 4MQ5A 5FBZA 2V7GA 1EFDN 2J9FB 3EE6A 2H2HA 3CTPA 2GN0A 1JBEA 4TL6A 1EBUA 4F6LA 1MX9A 2I4NA 3AEYA 1JV2B 5GOTA 3WP1B 2FF7A 1TAHA 2J1LA 2I9KA 1N9GA 2HJRA 3OE5A 5HS4A 7MHTA 1ARZA 3QOWA 1IXRC 2I6TA 1NR5A 3WNBA 1ULBA 2X40A 1C3VA 2PFKA 3ZHQA 4H3SA 3VDNB 1D2NA 4JVOA 1DCFA 2VR1A 3MCVA 1Y82A 5GADl 2AH5A 2BIFA 2CZGA 4DCNA 3Q8WA 4OXNA 3QEMB 4KOEC 4ALMA 2OXCA 2DCUA 3DL7A 3IIKA 2ZQ5A 1B8OA 4JUIA 1QTNA 4TWJA 1Q5PA 1T4GA 2IP4A 4UPDA 1CNEA 1W36D 3RFUA 1M0EA 5KYGA 3QKSB 2MDTA 3OJXA 4PLWA 3ETHA 2H3HA 2VRCA 3NWJA 3R3WA 4MRSA 1K4KA 4XVCA 2HQOA 2OBMA 2X23A 2XJ9A 3HN7A 3SBOA 5CNIA 4AWXA 4DTIA 4IIJA 1J0BA 2Z95A 5CT8A 1F9EA 4RA6B 3UB4A 3B3FA 1AUOA 5D51S 4L8VA 4R41A 1ZM2A 2HMSA 1WD7A 4TV9B 1J8QA 2R1UA 4Q9IA 3TRHA 2ODEA 4ZJZA 2RE8A 2ZWPA 4RMHA 4QOHA 1KIMA 1KMQA 3PQ6A 3RAGA 2NUPA 5LA6F 4AO7A 4AMYA 1I2DA 1KPHA 4P3PA 1KZGB 1Z0KA 2HL6A 2W98A 2WF5A 3P94A 2A5GA 2HDWA 5DWVA 5AVQA 1V7CA 1QZTA 2CN1A 2YJNA 3DSRA 3P45A 1RAAA 3HB0A 5EMKA 4CF5A 4Y1GA 2C7GA 3OTIA 4XQGA 5L3RA 1J0EA 4QM6A 3GOHA 4LJRA 1ZA1A 4NV3A 4GXQA 1N1MA 4BQQA 3KB8A 3PQFA 1IZ7A 5LOVB 2FHSA 2BSQA 4PXAA 4OUDB 2B8TA 1E1RA 3W05A 5TJ9A 1YJCA 4PQEA 4EELA 2F1HA 2X2EA 4E94A 4NXMB 1YI1A 4KGDA 3VO2A 3MWGA 1E60A 3I9LA 3TZKA 3Q7SA 4EX7A 5B30A 2OZVA 4F96A 2Q6KA 3FYDA 4G0XA 1JFFB 1F8GA 2DEUA 2GN2A 4MYTA 1W87A 5HKKA 3DFKA 2A94A 4QUIA 1AS3A 3ET5A 1UBSB 4W5HA 4N1AA 4B47A 1RBMA 4BC1A 4K81B 1UOEA 2YRWA 3ZE6A 5MDHA 3NEPX 1Y80A 2CVHA 4Q6BA 3TGWA 4CM8A 3A11A 3PKIA 4KQHA 1JA0A 2HLPA 3WK5A 1LQTA 1IZYA 4PXYA 5CFPA 3PLAE 2HHJA 2A5JA 2QD3A 4XWTA 421PA 4OFZA 4R68A 1BWSA 1G8KA 4C1BA 1UJMA 5CUQA 4BGEA 2BY4A 2O52A 2FSSA 4IUCS 2Q3BA 1AQLA 1E1NA 5JARA 4J94A 3GLFE 1UT6A 3A9RA 1I2BA 3AJEA 1K75A 5BW6B 4EJSA 4CKCB 3MRXA 2ZR8A 4F5DA 2OMEA 4BCBA 2VBGA 5G1OA 1FFXA 4JS0A 3BD9A 4XIFA 2BC9A 4F7WA 4HTFB 1UT5A 3T8YA 1EVZA 1MO5A 2QT1A 2ZETA 4KLAA 3TRIA 2K5UA 5DKFA 1Z15A 1EFHA 5TR9A 3ZDZB 5HQTA 3IEVA 4FNOA 1X7WB 1MV8A 1X7XA 5AW1A 1JHXA 1BEZA 1OIXA 1XZDA 4B40A 2OXEA 2PIDA 3IR7A 4YASA 4WADA 4DMCA 4DWOA 2I8AA 2A9KA 3U7GA 4J3FA 1DPFA 5KOJB 1BYUA 1G20A 2FZEA 2GKGA 3F6BX 5JI3E 3UGJA 3JD0A 3Q87B 3AHGA 7AT1A 1T8SA 4D9IA 1AV6A 1VSTA 4HTFA 3TLKA 2X8LA 1XZCA 3E9CA 4KUGA 3KPWA 2VH2A 4UC0A 4OJYA 3RD5A 4A0GA 4F60A 3FKJA 1CUIA 1UJBA 4MKZA 1AQ6A 4DV5B 3BK2A 1Z3CA 3KKNA 4Y2QA 3SHVA 2GLTA 4MKXA 5LP6B 3DYBA 1JVNA 1NM5C 3C48A 3F67A 3MQ4A 4JH0A 3A6LA 2IYZA 1YH3A 2HQSA 1E4EB 5J2TB 4FD2A 5DMXA 1TCVA 3JZAA 4Q7EA 4YUXA 3EX7C 3VBEA 4WZBB 4JNCA 1QS0A 5FI3A 4XWWA 1IZ9A 1LQUA 1WXDA 4I2NA 3H5TA 5IC5A 3MWFA 4E32A 1S8OA 5JR3A 1TADA 3KOZA 5DXJA 4IIJF 1M3SA 3WE7A 3GLIB 4AUKA 2YMPA 4RPCA 2AX3A 2FU5C 1P72A 4IVRA 4E1VA 3IAFA 2BW0A 1ZR4A 3EG9A 5FFMA 2DPHA 4QUAA 1VL0A 2D4HA 5KVCA 2I7CA 2I03A 4KW7A 3M2PA 3TLXA 1GGEA 3VYRB 1VGRA 1PVVA 5IP5A 3U4DA 3HFJA 4F3TA 3B6KA 4H7JA 2EWMA 3S99A 2W2QA 4KN8A 5ALOA 3IXLA 4YJDA 2PRJA 3OBIA 2HBZA 4CHTA 4E46A 2TECE 3HXPA 4MTLA 4JJIA 4DB4A 4TTTS 2JBAA 1QS0B 1JJ7A 3PTLA 3G2HA 4DSZA 5EE3A 5A4KA 1RW4A 1YQXA 4ENWA 1E3QA 2ONJA 2GAJA 1GAXA 3FI0A 3GZ4A 3CVWA 4JZKA 4GBJA 3DOCA 3G79A 4U02A 4ZZ2A 2IV3A 4AM8A 2ZVPX 1ZVQA 4KQ1A 1MQSA 5I9TA 1J8DA 4TN5A 5T7BA 2OXRA 1HT2E 2FP4B 4KXLA 1YQGA 4LSMA 1PYOA 3KSMA 2UXBB 1ZLXA 4QO7A 1BTOA 5SY9A 2Z2YA 3MGGA 2ZUEA 3GQBA 2FG6C 4FNAA 6REQA 2G88A 3KJZA 3LYUA 5CVVA 1LLDA 3V4VB 4DYVA 5LLTA 4EK9A 4ZVMA 1UEXC 3L92A 1JL3A 5H81A 1BXRA 4NOLA 1G0NA 1LBSA 3UCEA 4BMNA 4FGLA 1CZKA 3PYXA 1GA1A 1K9VF 1UINA 1ESNA 2BJVA 4YLYA 4DCPA 1DTWA 1N6NA 3WB1A 1RI1A 2W2VA 4KQ9A 1KC3A 3HHPA 4Y9RA 3SC6A 5L3QA 2HJ9A 2ZT8A 3L8EA 2M32A 5IHXA 2LCIA 1VI2A 4UREA 3RTAA 4ZZ0A 1UKBA 1U2GA 2Y0CA 4XH9B 2W37A 1YZVA 5TMBA 4YYEA 3EMKA 1JA9A 1WSWA 4BTLA 5BN4A 4FKMA 1WQ3A 1OYOA 2OORA 4EHDA 1KVTA 4PEVA 3HJGA 2AQ8A 3BJIC 3EG5A 2WBLC 4LRTB 5IJZA 1PYDA 1QOPB 3VOAA 4AO6A 4H4DA 3HQ4O 4YPOA 4P4LA 3JQFC 4R9UC 1FNDA 1FLAA 1Z22A 4HUTA 3O73A 2XMQA 3TOXA 5JQGA 2QN8A 4QXAA 5CG2A 2QUJA 1NONA 3LL4A 3D2LA 1A7KA 4IZ6A 2G9QA 4AKGA 3DR3A 1TTPB 3KKQA 5FUWA 4KEAA 3CJRA 1B6GA 1MENA 2QKYA 2DERA 2Q4TA 1EUCB 2DBZA 1NLYA 3IT1A 1SC4A 5ITSA 3E9YA 4D4LA 1MGOA 3AFGA 1H0SA 2DUUA 2QX8A 4HWTA 4FYPA 3D6VA 4TUYA 1XD2B 3AUAA 4XD2A 1EX9A 6ADHA 3OX1A 2OQ2A 3MB8A 4BFTA 4NHEA 1O9GA 2REBA 3GA0A 3JQAB 1FJ2A 3FYUB 2QDKA 1XCGB 5FWAA 3V32A 5BMOA 4MVJM 5K4GA 3WA7A 1WJGA 5TQ0B 3DYIA 3T06B 3DZ7B 1P5FA 5AJWA 1ZAYA 3H3JA 4S0XA 3MF4A 3VU9A 1I7NA 3HZRA 2H1LA 2HSZA 1C9MA 4TUYF 5A6SB 1P7PA 1ETUA 3D6TB 2HK6A 5JDCA 3TEJA 2JVJA 4JJ6A 4BKMA 1XF9A 3TKLA 4CIWA 5AW3A 5T8KC 1GAJA 2QU8A 4B6PA 3M6AA 2ZS8A 4J29A 3X43A 3DZ3B 3AVOA 3PWSA 1LX7A 5KNBH 4RKYA 4EQ6B 1QP0A 3PWKA 4YROA 5CVEA 1EDDA 4DS3A 3P9YA 2V6GA 2WTBA 1EUZA 4BO0A 4ENUA 3BH7A 3LQKA 4CEIB 4HDMA 3WGKA 2JLCA 4WASA 1Y8QA 2GHIA 4OHRA 4WLUA 5BNZA 3LI2A 3EBPA 4H6VA 2M98A 4W1PA 4EJSB 3K9FC 4I4CA 1IEXA 4JLVA 1EFVB 4URYR 4ER0A 3DWEX 3T5AA 2GJ4A 3DWGA 1KDYA 3L4BA 5A5VA 4YAIA 3DPSA 4U6QA 2Q21A 3DQZA 4OBEA 4RHUA 2GZAA 4KQWA 1OH7A 5JRDS 5G0WA 1NXQA 3KKZA 4H7FA 4UDXX 1NXPA 1G5TA 2OHOA 3D4BA 1KI2A 3OOSA 5JXWA 4NEQA 4QGHA 4DSAA 2NZWA 1W8IA 1QK3A 2A4KA 5AKLA 3WL6A 5BP7A 1EP3B 1ACMA 3CURA 2IWRA 3V2GA 1R12A 4QDKA 2RHBA 2OV3A 5KZMB 3PUIA 3TRKA 3JALA 2HJVA 4CM3A 4KOAA 2ODNA 4ZV4A 4ZRMA 3P9IA 1U90A 3T35A 4EOGA 1AZSC 5FLXA 4FLFA 3I6IA 2WJYA 5FQOA 4K8RB 3U1TA 4G81A 4ZCMA 3U3XA 5JCOA 3K9NA 5BSUA 3O8OB 5IHPA 4XGRA 2FFBA 3A0UA 3G85A 3L06A 4RTQA 3WKEA 3I0MA 4Y6OA 4Q18A 4AJ9A 2R85A 5IAEA 4DBLE 4ZYZA 5L7WA 3AIMA 3ZDDA 5IN4A 2CDCA 1DDOA 4AKHA 2XE8A 2R6AA 4QVKA 3I6MA 4MVJD 4DEVA 1YB5A 2GVNA 3EXHA 4J3NA 1AHHA 3K53A 1DG1G 4IOJA 4D9BA 3KOXA 3MYRA 1H65A 3PFCA 1HE2A 2H2IA 3NP9A 1LNSA 3NTQA 1Z74A 1H5QA 5TLSA 4I0WB 2C98A 1SB9A 2J9ZB 4R4JA 4M7RA 3MZ0A 4OREX 1ULSA 1VPTA 4V0MA 2PPVA 2DULA 4IKOA 4PTLA 4ARCA 1G55A 1W5SA 5TNXA 4MHTA 3U3MA 2EJWA 1O95D 2C2OA 3FDIA 1B7GO 3E22A 2VJYA 2MYTA 3KQUA 4HKTA 1SBIA 1QB7A 2O7RA 2YHUA 3OM9A 4NARA 4ALIA 13PKA 3C3KA 3H9JA 2RHTA 3GGGA 3M4NA 3MJVA 3TVDA 1YJ8A 2IGTA 3K32A 2VDUE 3AX6A 3OT4A 2X0IA 3JAWA 4K03A 4QU5A 5JAUA 4PAOA 2HR1A 3ZD9A 1TM7E 3U44A 3ZZ1A 1KI4A 5K2OA 1JENB 2DUMA 3NO4A 3ZLTA 2X6TA 1J2TA 3O1IC 4LOHA 4FGUA 1C41A 1H8HD 3OOEA 2F3TA 3EGWA 5U4XA 1P4GA 1Z17A 3RIYA 2X5OA 3MS4A 4AQDA 4HDQB 4QBHA 5GJCA 1QX4A 1FFGA 1XMPA 4J03A 5BW5A 1NVKA 4Q48A 5HF8A 4PNPA 1A69A 5EVCA 1ILWA 2OAQ1 3ENZA 1USGA 4NMXB 1SUSA 1ZKDA 1L5HA 3A6FA 1FX1A 3C85A 3MTEA 2AOTA 4ZREA 3CXRA 5GMOA 4DY4A 2QUHA 3ORQA 1GVNB 1IEVA 2YJ4A 2R5NA 3C5WP 1BMQA 4P98A 4RCZA 3QPVA 4GZ5A 1MFZA 3WAKA 2CWWA 4RAQA 2FUG6 4QBTA 2JI8A 1M0SA 4CN8A 4UBJA 4LQDA 1V47A 1V9SA 4MS1A 3UM9A 4UTVA 1KZ4A 1N9KA 1WX1A 2UAGA 1RMTA 1RI4A 4KYVA 4U2DA 5CNJA 1C0EA 2YYAA 3KJEA 3WZLA 4CL2A 3S1SA 4QGGA 1GZUA 3FLEA 1M2OB 2F3UA 5DRYA 3QY9A 3U6BA 5HW0A 4YV2A 1QPGA 2QS9A 3WQQA 4MVJA 4YX9A 2IHUA 3PNYA 1RXCA 4OI0A 1N6LA 3ONNA 4OHMA 2IPLA 2VF4X 1DB3A 2GR9A 4NY1A 3W9YA 3PUVA 3X1WA 3HCRA 4FBLA 121PA 1IUPA 4NC9A 4XE5A 3SJAA 4HWKA 4TKUB 4DARA 3O4JA 4E15A 5K0ZA 1GFSA 1R9MA 3MMNA 5A0VA 3ZOKA 3OQVA 1R9JA 3QPCA 1JR3E 4R1NA 5KBYA 2DFLA 4B4DA 4MGEA 4OI2A 1ISMA 1JF8A 1R4NA 2RHOA 5BNTA 3PD1A 4D56A 4I66A 1R6DA 1X1BA 2VQ6A 1B42A 4YCBA 1ENOA 5AK5A 4RHCA 2BR3A 4BIIA 2VUTA 5DLDA 1PLKA 4DN6A 3FVVA 3LXRA 2X1HA 3ZI0A 3KFXA 4RJTA 3AIIA 4L5CA 4JYMA 5IH7A 3GJ6A 3FHOA 1ICEA 2C2HA 2ABWA 4IXNA 3MRVA 2AWNA 4PGGA 3HVRA 4B3GA 5DVZA 5FHRA 1AHNA 4EGFA 1DV2A 1YQ9A 2QJFA 4QUKA 4S1NA 3ZNNA 4CKXA 4AURA 2JH3A 4EFNA 3W5UA 2VHQA 1DEXA 3HWX1 3I45A 1L4BA 3TQHA 3PIIA 1CC1S 1E79D 4OHOA 1R37A 4TTSA 2HGSA 2IYSA 5H68A 2Z6VA 1NNUA 4BO4A 1AZLA 2Z8XA 1VBKA 1UMBB 1VDMA 1JNXX 3ME5A 1GRRA 1JHPA 2C7VA 2OBXA 3EEYA 4FHDA 3PRJA 1X1TA 4OCZA 5D1HA 1TW2A 5E4YA 3N8IA 3AF6A 1GKIA 1ABBA 1YF3A 1NBAA 1N1GA 2W6IA 1WVGA 3ZHTA 2GEDA 1JZTA 2UVPA 3EZNA 2ACWA 4YUYA 1BSVA 2CMGA 4E08A 5KWEA 3COPA 2GXAA 5IT9A 1BX3A 1C1DA 2Q1TA 3C3EA 3IHTA 1K5DA 2JCYA 3NGLA 4KR9A 3UF0A 3MYYA 3F98A 1IMJA 4L0MA 4AN4A 1R88A 2RAFA 4AKTA 4BB5A 4NBLA 3JWHA 3W1WA 4RTKA 3ZGOA 3CZ9A 3DOJA 4BQFA 1MC5A 1BH2A 2CXOA 2B0JA 2FR1A 3T52A 1XXHE 8LDHA 2LD4A 2DPXA 4G8CA 3WKAA 2F1OA 2O3UA 2REOA 1YHYA 3W5AA 3DHVA 1QCCA 1RCFA 2GBFA 1TUIA 2I6GA 2UVPB 3KQYA 1FC0A 4K5QA 4LRUA 2H7CA 3W3AH 2HA0A 3D7SA 3S5JA 1CUZA 1Z08A 1GQSA 4E14A 4Z7QB 3QW4B 3TJZA 1Y4UA 1UODA 1QH1A 3Q1LA 2AZDA 3NHZA 1X1CA 3RK4A 1ZCZA 4WLNA 2HMVA 2FN7A 2OTCA 2XTZA 3RRMA 1UMBA 4OFXA 2AJBA 4DAOA 1CY0A 4AJNA 4N8EA 4CCYA 3UXMA 1IQRA 5AW5A 2B83A 4ZO6A 2Q0XA 1N36B 1NJ8A 1P7CA 5IVIA 4F9FA 4QT4A 4LPSA 1IXYA 1JEYA 1P5RA 5DGCA 3A31A 2JCSA 1SK9A 2YASA 2H5LA 3N8DA 2Z9BA 4QX6A 4OQ4A 4MMYB 1JX6A 1MJGA 3F1LA 4LRWA 4O2BB 1RKUA 1WDMA 4CGYA 5JYBA 3LJKA 3RV4A 4HQOA 3FMOB 4EHAA 1HLPA 3HGTA 2UYHA 2PM8A 4RVHA 1X1SA 3A1DA 3JW8A 4TMWA 3UJ7A 1ONOA 4MWSA 5TQ2A 2RB4A 4ZYUA 3TFQA 1IXKA 5JSUA 2OCGA 5F1KA 4C7XA 4WW0A 1F8FA 1XMQB 2J7KA 1SUBA 1E79A 1LNQA 4DCSA 3KTDA 1BGWA 4RY0A 2FJ0A 3IAXA 4HPWA 2CVOA 4Z0PA 5AKEA 1A9ZA 2O2XA 3O9VA 3FNFA 2OXIA 3TNFA 2QG9A 4IMJB 1C9EA 1FU7A 4ZT5A 3SQWA 2MSLA 3UG6A 3HRKA 3RS9A 3LT5A 4B75A 1A82A 5EIHA 3F7TA 5HEKA 1VHWA 1XHEA 2PUBA 2QT0A 1TJNA 1Y1RA 1WZ2A 3QVUA 5JCJA 1Q1AA 5BSRA 2GKOA 2AOUB 2HRRA 4BECA 3IBSA 1DXHA 2ENWA 4RU1A 2C4WA 5IEJA 3BT7A 2IDKA 3AM3A 2O14A 3OWOA 5ALFA 4N7MA 5BT9A 1V2GA 2D00A 3FUUA 4CKBB 4DCTA 1VL1A 1TO1E 2GJKA 1K86A 1MAVA 4G0OA 5D87A 3ROGA 4LOLA 2IYLD 3BD8A 1Y4SA 1I4LD 5LC1A 3FOFC 2I3BA 5EE0A 1KXJA 2P91A 3L0DA 1HG0A 1KO1A 2XCOA 4MVYA 3E61A 2QSUA 2BPOA 4WK6A 2LBPA 4ETMA 1HG1A 1NDUA 4RVGA 2VP3A 4TMFA 4R05A 2ZRHA 3ZH2A 1GVHA 2JARA 4COKA 4D9JA 1L5MA 2ECOA 3G88A 4M8LA 2XGOA 4FX2A 1WF6A 1Y1QA 2VYVD 4ODIA 4D8WA 4N18A 1EJ2A 2FK8A 5FA5A 4ZHQF 1FNMA 3P4YA 5A4DA 2O8EA 1A4UA 3GY0A 1JQAA 1USVA 2XRFA 3BBLA 1KEEA 4MAMA 2W11A 3B85A 3P2OA 4G1MB 3Q2IA 1DBSA 4MRAA 3SQDA 2CLEB 4C6TA 4N7BA 2PL5A 1FDSA 2JLRA 3N53A 3ZE1B 2J87A 4Z51A 4N65A 2DLCX 1NVMB 4NU5A 4ISBA 2W4IA 3KBBA 3RSZA 4MS4B 3HNPA 4LCJA 3RSGA 3DLPX 2FMIA 2V1UA 2NX2A 2O2GA 2CHQA 3KKKA 1R0WA 1QGZA