4IQ1A

Crystal structure of glutathione s-transferase mha_0454 (target efi-507015) from mannheimia haemolytica, substrate-free
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
209
structure length
209
Chain Sequence
SMKLYGLTGACSFVPHVALEWVKLRANQDYAFQAVSREFIKSAEYLALNPRGNVPLLVDGDLALTQNQAIVHYLDELYPEAKLFGSKTARDKAKAARWLAFFNSDVHKSFVPLFRLPSYAEGNETLTKTIRQQSAEQILEQLAFANAHLENHIFFGEEISVADAYLYIMLNWCRLLGLDFSHLSQLSAFMQRVEADQGVDNVREQEGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione transferase
publication title Crystal structure of probable glutathione s-transferase MHA_0454 (TARGET EFI-507015) FROM Mannheimia haemolytica, Substrate-free
rcsb
source organism Mannheimia haemolytica phl213
molecule tags Transferase
total genus 75
structure length 209
sequence length 209
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4iq1A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4iq1A01
18GSA 4TKYA 4V2MA 1R5AA 2K9FA 3IC4A 2YV9A 2BTOT 2WULA 2V32A 3EINA 1TU7A 3GTUB 3FR9A 3MDKA 2PN8A 3DVXA 4N0ZA 4CDOA 1PSQA 1TJDA 4G0KA 5ECSA 1DE1A 3CBUA 1SYRA 1ACVA 1YEPA 3U6VA 4EO3A 1X5CA 2VUPA 3IV4A 4EXJA 4G10A 5D9WA 3LJRA 19GSA 1EOHA 1KEBA 1SD8A 3ZREA 4DSQA 2JACA 2GVPA 3M1GA 4XS4B 1YEXA 1G6YA 1M2DA 2UZ8A 4J57E 1YKAA 2H73A 5JCUA 4RUVA 3EURA 3IK9A 4K7IA 4MPFA 2PVQA 4G2EA 3ERGA 3GKKA 5AIXA 2V2GA 2DMMA 4ZB8A 4IW9A 2VLTA 4NXIA 1DE2A 4XCSA 4EL1A 5A5KA 4GCIA 2GQKA 2OE1A 2AHEA 6GSUA 1ILOA 4G9HA 5CREA 3IK7A 2QGVA 5G1LA 1XWGA 2QSIA 4KB3A 1KNGA 1XWAA 4MJAA 4Q5QA 4PXOA 1OVNA 4MA9A 3GV1A 4EE0A 2HRNA 3LWAA 3I9V2 2JADA 6GSXA 3TOUA 4KW6A 3HYPA 4V1Ag 2PUKC 1ZGNA 4FQUA 2IMDA 1HNBA 3CTGA 4ZL8A 3E9JB 3RPPA 3ISOA 2GT6A 1USBA 4BWQA 2P5QA 2GSSA 2FA8A 1K3OA 3QOUA 1K0AA 2C8UA 4N11A 2HLSA 2YWNA 3JCML 5DAKA 3VFIA 2HZEA 2R2JA 5JCWA 4WR4A 3LYPA 3ZMLA 3J7Yk 2R3XA 3ERFA 2H76A 5CRDA 1ZCPA 3SWLA 4ECJA 5IO0A 1SK1A 2VM2A 4I2TA 3VWXA 2DC5A 2ES7A 2H19A 1XWBA 3BBYA 2AB6A 2AJQB 4L8EA 1V2AA 2H1AA 1FHEA 2R6KA 3HJPA 3VPTA 1EGOA 5IPGA 4F03A 3KMNA 1GTIA 5KN2A 2IMEA 4EKZA 3LSZA 2C80A 4G19A 2LV3A 3CXGA 1UN2A 1VF3A 4KCAA 4HOJA 1TU8A 2CA8A 2JZRA 2LTKA 2HRAA 2ZNMA 1X0RA 5G30A 4OO4A 5H5QA 3WGDA 5HFIA 3TDGA 1J0FA 1K3YA 5JWOB 1V98A 2GQMA 1GSQA 2I81A 1GLQA 5JCGA 2CV4A 3TGZA 1GSFA 3CSHA 4NV2A 1U88A 4KDXA 1EGRA 2MMAA 5LNKe 3QD9A 4MJCA 1GTBA 1W89A 1Z6MA 3KCMA 2IMKA 2JZSA 4OFNA 12GSA 1EV4A 1Y25A 4LMVA 2FA4A 3R2QA 4QQ7A 3PH9A 2C0EA 2HZFA 2BJXA 1EP7A 1JLWA 3FR3A 2C0DA 4RI6A 4BL7A 1URMA 3GKNA 4F82A 4WETA 3UOMA 3N5OA 2RLIA 2VCQA 3CRTA 1PX7A 1Z9HA 6GSVA 1OYJA 3M9KA 1YQ1A 1K0OA 3FRCA 2IFQA 2HRFA 5EL8A 1K0CA 3BD2A 5J3RA 2HSYA 4BVXB 4QL9A 2CAIA 3TKPA 2L57A 5B8AA 1WE0A 4TXOA 3GH9A 2XBIA 1O8WA 1SD9A 1G7EA 1T00A 2EIOA 1XVWA 2X8HA 1O81A 4NHZA 5ECOB 4HS1A 5IMDA 5F07A 5A4WA 2B1KA 4TR3A 1FO5A 3GA4A 4I5QA 2HFDA 2VO4A 3M8NA 3EU3A 4MJBA 3UL3A 8GSSA 2HQTA 1GWCA 5CP1A 4PQIA 3EMXA 2L4QA 1FG4A 1A8YA 2MMOA 4FH8A 5CO3A 5IMZA 4GLTA 1SL1B 1GL8A 1M9BA 3VWWA 1PL2A 3F4SA 1Z7PA 4FYUA 1AW9A 2DIZA 3APOA 5CRWA 1QMVA 4BVYA 5AN1A 1SK0A 1V9WA 2D2ZA 4OO5A 1XXUA 3US3A 3WYWA 3EMPA 4WR5A 1T3BA 1ZOFA 4AJ7A 1ZL9A 4O5RA 5HR1A 2JSZA 3GNJA 1A8LA 1PX6A 2LRTA 2F8AA 4WBJA 1JLVA 4MCUA 4NAXA 2IL3A 4MLYA 3RDWA 2O8VB 5GAPD 1PGTA 4JZQA 2FWEA 4IHUA 4HZ2A 2I9HA 3TKSC 4BA7A 1EOGA 3HVSA 4FYBA 5ECRB 4PNGA 2PMTA 2AAWA 3C7MA 4FYCA 2O87A 3EWLA 2R4VA 3F6DA 1PA3A 4ZL7A 1OE7A 1VF2A 4EUYA 3D22A 4G0LA 4AJ6A 1W4VA 5KN1A 4TOPA 1XZOA 2FHEA 3FK8A 3TJFA 2H1GA 5EPFA 5DALB 5DDLA 1GP1A 5B7CA 1NM3A 3LORA 4OWYA 3BCKA 3I43A 2I4AA 5IO2A 1TP9A 5B6NA 2A2SA 2F3MA 1XOBA 3E0UA 3DRNA 4YQVA 4TXVA 2HRKA 2YWOA 4ZB9A 1B48A 1VGLA 4KCEA 2CQ9A 1T7PB 3FW2A 5GAND 1GSSA 4KDUA 1WIKA 3G9BA 4F9ZA 2L6CA 2G0FA 4Q5RA 3L9SA 2PU9C 1TKDB 1MD4A 2H8LA 1TW9A 1OC9B 2EIQA 5HFKA 2AV4A 1GUMA 2H1BA 1XIYA 1EEJA 3A2VA 2FY6A 4F2IA 3J7Yb 2HYXA 4MPGA 3UVHA 2JZTA 4TN8A 5J5NA 5A4VA 1TI3A 1YY7A 2V6KA 3TKSA 4WKWA 5D9TA 2B6MA 5D93A 1O8XA 2KLXA 4KH7A 3QAWA 3ZTLA 3HDCA 4XRAA 1AQWA 1TK5B 1TRVA 2C3NA 2IJYA 1XPVA 5ECQB 3GHAA 2DLXA 3LFLA 4PURA 3KH9A 4TVEA 3L0HA 4MK3A 2CVBA 1SU9A 3ED3A 4KA0A 1K0DA 2F9SA 1CQGA 1V40A 2K6VA 3QCPA 3KD0A 2XHFA 3HZ8A 3A2XA 1WPIA 2VCXA 2IN3A 3NZNA 2TRXA 3VK9A 3WT2A 5BMUA 1O73A 1SL0B 4XS1A 4OCFA 4WF4A 1V58A 3IBHA 1ABAA 4JRRA 3O6TA 2O85A 1VRSD 2YCDA 4BWSA 2ON7A 4MH2A 3MAKA 4POMA 4K6XA 2OE3A 1BX9A 3K8NA 3KJYA 4LL4B 3WGEA 5D9XA 3KZQA 3QDNA 2H70A 1ERVA 3EU4A 1ERWA 4ZBBA 1H4OA 3ZRDA 4EF0A 4CW9A 3WGXA 4PTSA 2GZPA 5ABRA 5D8IA 1HNCA 4K9ZA 3UVTA 1BYEA 3GX0A 1JZDA 1GUHA 4QL7A 2VL2A 3LEFA 1S3CA 4D73A 1T1VA 1TOFA 2FLSA 3C71A 5A4UA 2HSNB 1R5PA 4JEDA 1MDKA 3KEBA 1Q98A 4Z7XA 5AISA 4MH3A 2JL4A 2NDOA 6GSTA 1QXHA 2B5XA 3TJBA 5ID2B 5E59A 2VCWA 2HSMA 2NVLA 3GSTA 3P90A 5HR2A 3A5WA 3H8QA 5G2ZA 5DCHA 1S3AA 1NW2A 1AXDA 2CZ3A 4PUFC 2X99A 4KAEA 4ZL9A 2DMLA 5IM9A 3F4RA 2H6YA 3CSIA 1BJXA 4OFMA 5LD0A 2WCIA 3UBLA 1DSBA 3DEXA 3GH6A 2DIYA 3TJJA 5HR3A 2YPMA 4F0BA 2AUVA 3F6FA 1ZMAA 3GX8A 2IIYA 2HT9A 3RHCA 2B5EA 1QUWA 1EZKA 3HJOA 2P5RA 4KF9A 2RUEA 4N10A 4I6XA 5ECKB 1KTEA 4E8EA 4NWYA 3KXOA 2YWIA 4HUAA 4MMMA 1B4QA 3RBTA 5IOXA 1HYUA 1Z3EA 1OKTA 5ECPB 3ZVJA 3APQA 2F8FA 3GL5A 3F9UA 3BJ5A 3TKRA 3H1NA 1QFNA 1X9MB 1JZRA 5CRHA 4HQZA 2RIIA 3GL3A 1DBYA 1M9AA 4GSTA 1FOVA 1O6JA 4EDYA 2C1YA 4USSA 2VM1A 2IMIA 3KGKA 4TR1B 1UC7A 2H0HA 1ERTA 1GNWA 1JFUA 2F51A 3FYGA 2PGTA 5LCZA 1HD2A 1K0NA 1I5GA 2B1LA 4KDYA 3HY2A 2L4CA 3IXRA 1X9WB 1F6MC 1YKCA 5DQSA 5ECMB 1PRXA 4V2LA 2I3YA 2VL3A 4DSRA 3ZLPA 3F3RA 2M72A 1U87A 4MDCA 2YP6A 2MMNA 3HZ4A 9GSSA 1R7HA 4O32A 4Q5FA 3ZITA 4K7NA 4XHMA 2B5YA 1N8JA 1T8EB 3GRXA 1WJKA 2LNSA 2ON5A 3IOSA 5IPHA 2KHPA 5DJMA 4ULXA 1U6TA 4YAVA 2FUG2 5IOWA 5E4WA 2J23A 1MD3A 2H72A 3C8EA 1FAAA 4O7HA 4POLA 3GMFA 4ML1A 3L78A 3MSZA 2V41A 4DEJA 2AYTA 1HNAA 2CX3A 2O7KA 5ECLB 1PQNA 2ZUPA 4YQMA 1QK8A 3G7IA 4DSSB 3HHVA 1SJ6A 2KUCA 2WRTA 5GSSA 4NHWA 1F37A 2H01A 4EDZA 1R4WA 2MBSA 4OMVA 3L9VA 4ID0A 1ZYEA 5ECHB 5G5EA 3GTUA 3EE2A 1V57A 4IGJA 3DGQA 2VCVA 3UARA 3FEUA 2VIMA 3CTFA 3UJ1A 2NPBA 2TRCP 2CX4A 5J9CA 2X64A 4E8HA 4FIWA 4TR0A 2ZCTA 5INYA 1TK0B 1GUKA 2GSQA 1QQ2A 2GSTA 4ZBDA 4IVFA 2FGXA 3RHBA 3H93A 3IE3A 5J41A 3S9FA 1NHOA 4NPBA 4HI7A 3MNGA 4TR4A 4XS4A 2OJLA 2R37A 2M80A 1XW9A 2WDUA 3G7YA 1XW6A 5HR0A 3GIXA 1TRUA 4AF2A 4K0GA 2YJHA 3DD3A 2H71A 1NSWA 2VD0A 2C0FA 3C1SA 16GSA 3LG6A 3M0FA 2C4JA 5ID2A 2B7JA 3TJKA 4YQUA 2B3SA 5DJLA 4J56E 3GKXA 2G2QA 2R5GA 3TRQA 1GSDA 2FWGA 1C72A 1XFLA 22GSA 3D21A 4K0NA 1SKSB 4GSNA 4DVCA 4X1UA 3ZZXA 4PGTA 1F3AA 3UBKA 3MWHA 2VL9A 1YDKA 3APSA 3KH7A 3GSSA 2OE0A 4HU7A 4NV5A 2L6DA 1BEDA 2H0GA 1ZZYA 3ME7A 5CYYA 3TRXA 1M99A 1TTZA 1X5DA 3KM6A 5J4UA 5L71A 2C3TA 3AY8A 5IQYA 2RM6A 1KBNA 2NTOA 4IBPA 2V6OA 3TRPA 20GSA 1WMJA 3M9JA 2XBQA 2IPAA 4ISDA 3W8JA 2E2GA 2WFCA 2OACA 4ZB6A 3TJGA 2OBIA 5C04A 5DAKB 2QC7A 5AIVA 4IQAA 5G31A 11GSA 1A24A 4IJIA 2L5LA 2PPTA 1QGVA 1GTAA 2H6ZA 3GYKA 3TKSE 5HQPA 2LJRA 2GQLA 1SK2A 3A2WA 2O89A 5KN0A 4YAPA 1AAZA 2HXKA 3HA9A 3GURA 1AQVA 2A2RA 4HQSA 4MZWA 4L0UA 2K8SA 2YV7A 3BCIA 4LA1A 2H1DA 2GZYA 2YN1A 2EIRA 2GZZA 3DIEA 3CRUA 2FD3A 4KSOA 2TIRA 4GXZA 1GULA 1M7TA 3A3TA 3UEMA 1JZOA 2VL2C 3W6GA 4EVMA 3TOTA 1TI1A 1LBKA 2K18A 2WS2A 3QR6A 1NHYA 3P7XA 3DXBA 2LRNA 2LJAA 5DBQA 3IDVA 2XPDA 2E0QA 2LQOA 4K8MA 1VF4A 1TDIA 1PN9A 2VLUA 1R26A 1B4PA 4AGSA 3UAPA 1ON4A 5ECIB 1BAYA 1PD21 1Y6EA 5IMAA 1BG5A 3FZAA 2MBTA 2K8VA 3PGTA 2M46A 3HJMA 4BL7B 1A0RP 1XWKA 4PQHA 2E2MA 2LUSA 1AIUA 1XBSA 4K2DA 2DJJA 3GN3A 1G6WA 4XS6A 2OKAA 4BVXA 5IIZA 4GWRA 4NMUA 1BQ7A 4BPYA 1FW1A 3HKRA 5CAXA 1OC3A 2LEGA 4HDEA 5AGYA 2J9HA 1VF1A 2H66A 2IFQB 4I8BA 4GRFA 2FCHA 1GSYA 2GS3A 5IMCA 2DJ0A 5DVBA 3C1RA 4HJ2A 1GRXA 2A4VA 2CAQA 1UVZA 2LRCA 5EVOA 2LQQA 1DUGA 4WEYA 4TXOB 1FB0A 3HVXA 1G0TA 6GSYA 3LGCA 1A0FA 5D73A 5JWQB 3F0IA 3HD5A 4RQXA 1SENA 1AC1A 5H5SA 3F8UA 2MZCA 2JU5A 3KMOA 5G1KA 2Z9SA 2CVKA 4IN0A 3DMLA 1GSUA 2FWFA 2LJKA 1TRWA 3FZ4A 4MJEA 1THXA 4FO5A 3P8WA 4GF0A 3KIJA 2DSAA 4I2UA 3L4NA 1SYXA 5F05A 3QPMA 3E3EA 1OE8A 1XVQA 1PKWA 4Q5NA 1M2BA 3D0ZA 3IAS2 5F06A 2H6XA 3RPNA 4BVYB 4MZCA 5ELGA 2IWTA 4ECIA 2GTUA 2VD1A 1U3IA 3TUEA 1LJRA 3H4KA 1OKDA 4IP6A 3D4MA 4LL1B 3F4TA 2PWJA 1YF0A 1K0MA 1FVKA 1GH2A 2CVDA 3CMIA 2L59A 4HU9A 1S3DA 1A2MA 4TRXA 3KP9A 1EV9A 1WP0A 1GSEA 2DJ1A 1PKZA 4POBA 2X8CA 4RQRA 5COHA 5D96A 1Z6NA 1H75A 2H0IA 1K0BA 5JWRB 2H30A 4IKHA 5D9VA 2QKEA 3GUSA 4XRDA 4ZXGA 2HE3A 3FR6A 4OCEA 1J08A 3VI5A 3GFKA 4OD7A 4YH2A 3F3QA 2RM5A 2VCTA 3ERWA 3NOFA 4ECCA 2VLVA 2MMZA 1EEMA 3M3MA 4HZ4A 5DALA 1RK4A 1MDIA 3IA1A 1CQHA 1MTCA 2YNXA 1ZYQB 3GKMA 4N30A 3R3EA 2VOCA 2X8GA 1WOUA 3DVWA 4MABA 1O85A 1GLPA 1XWCA 4WBRD 7GSSA 2H74A 1JHBA 3FZ5A 6GSWA 1GTUA 4HJMA 1A23A 5H5RA 1JZWA 2PVOC 2XC2A 1XOAA 2HRKB 4GQCA 2P0GA 4OFTA 3ZMKA 2LNTA 1OC9A 4ML6A 3VURA 2FNOA 3TKQA 1YJ6A 1MDJA 1YZXA 4PQ1A 3NIVA 4IELA 2OA7A 2RUFA 3ZIJA 3FZ9A 1FB6A 5B8BA 4I97A 4O92A 1K3LA 4KSMA 3QMXA 4JR6A 2VCZA 17GSA 3HVVA 1SJZA 1YF1A 4XTSA 1T4ZA 3TB2A 2REMA 2GSRA 3UIWA 2PBJA 1Z7RA 2WJUA 3WT1A 2XPEA 4K1FA 4X0XA 2HSHA 2DJ2A 4GQFA 2C3QA 1IYHA 3I69A 5G5FA 1TRSA 2I1UA 3SBCA 2IMFA 2GLRA 2N5AA 3QFBC 3QFAC 4ECBA 5F0GA 4L5OA 2WGRA 1E2YA 4ZBAA 4JE1A 5GZZB 2B7KA 14GSA 5GSTA 3N9JA 4HEA2 4JR4A 4IQ1A 1E6BA 1X5EA 2P31A 1SKRB 2OBKA 2WB9A 5ELAA 2H75A 3HCZA 2JSYA 4H86A 1F9MA 4V2NA 6GSSA 3ME8A 1A2LA 4P3YB 1Z5YE 4IJ3A 2NBSA 3HXSA 1ML6A 4KNDA 2CZ2A 1G7OA 3F63A 2KOKA 1THOA 3I6AA 3DYRA 1SL2B 5FWGA 4KUNA 5KEJA 3FKFA 4GTUA 5F8BA 1HQOA 3BOAA 2V1MA 5IMVA 2VAFA 1EP8A 3ZL5A 5B6MA 3EYTA 3Q74A 4ZILA 1J9BA 2YOIA 3ZIVA 2C0GA 2LKUA 3LQ7A 2L5OA 2DJ3A 2MYGA 4LLRA 1XW5A 2WZ9A 5IMFA 4D73B 1A2JA 3W8SA 3VPQA 4MF6A 1F2EA 1GNEA 3RAZA 2DJKA 4F0CA 3VWVA 5FHIA 1M2AA 4RI7A 4KX4A 4G0IA 3CYNA 1TXXA 3PPUA 1Q4JA 3OR5A 4MF7A 2EC4A 2HSMB 3O76A 3IPZA 3IR4A 1WRYA 3UMAA 3IRAA 4TW5A 2ALBA 5FT3A 5J9BA 3ZFBA 1B8XA 5HFGA 4PX1A 1AQXA 1ERUA 4MP4A 3TCOA 4XIHA 4L5LA 1O7UA 1MEKA 4J2FA 3FHKA 3DKSA 2YJ7A 4AJ8A 3CSJA 3Q19A 1LU4A 2HI7A 1RW1A 5DQYA 1IYIA 3EC3A 3IAM2 5C00A 13GSA 1OC8A 3VWUA 3C73A 3EVIA 2PERA 2N5BA 4MZBA 4LMWA 2GGTA 4WF5A 3QAVA 5ECNB 2KP1A 5KN3A 4IS0A 4ACSA 4V1Ap 3PR8A 2HZEB 2OADA 3ZYWA 2CT6A 3VI7A 5CNWA 2FWHA 4CHSA 1I9DA 3D6IA 4TR1A 1SKWB 1TK8B 4IP1A 3G7JA 2GT5A 5ENUA 1M0UA 4WXTA 4PNFA 1ST9A 5EY6A 3Q18A 3D4TA 2YWMA 1B9XC 3LYKA 4K7OA 2YANA 2KP2A 3ZFLA 3L9UA 4EC0A 1RQMA 3Q6OA 2GDRA 3DWVA 1FVJA 3VLNA 1F3BA 1EWXA 3O3TA 4X43A 3LXZA 5CRGA 3QAGA 2HNLA 4ILFA 1UA5A 4MF5A 4L0WA 10GSA 3KTLA 1OAZA 3PINA 1XCCA 3P2AA 2BMXA 1WWJA 1AUCA 4KGIA 1X9SB 3FY7A 5DCGA 2YZHA 4JBBA 4PUAA 1T4YA 2E7PA 2DBCA 3LXTA 3IC8A 1PMTA 1SJIA 3KTBA 4POKA 3D5JA 2LS5A 3KP8A 1B9YC 4JU5A 4ZIJA 1N2AA 3IHQA 1U3AA 3ZVJD 1PL1A 4DSSA 4KE3A 4N0VA 3WD6A 2LSTA 2YZUA 4GSSA 2N5FA 3U5RE 3H79A 3V1WA
chains in the Genus database with same CATH superfamily
18GSA 4TKYA 4V2MA 1R5AA 2K9FA 3IC4A 2YV9A 2BTOT 2WULA 2V32A 3EINA 1TU7A 3GTUB 3FR9A 3MDKA 2PN8A 3DVXA 4N0ZA 3MYDA 4CDOA 1PSQA 1TJDA 4G0KA 5ECSA 1DE1A 3CBUA 1SYRA 1ACVA 1YEPA 3U6VA 4EO3A 1X5CA 2VUPA 3IV4A 4EXJA 4G10A 5D9WA 3LJRA 19GSA 1EOHA 1KEBA 1SD8A 3ZREA 4DSQA 2JACA 2GVPA 3M1GA 4XS4B 1YEXA 1G6YA 1M2DA 2UZ8A 1PN0A 4J57E 1YKAA 2H73A 2EFCA 5JCUA 4RUVA 3EURA 3IK9A 4K7IA 4MPFA 2PVQA 4G2EA 3ERGA 3GKKA 5AIXA 2V2GA 2DMMA 4ZB8A 4IW9A 2VLTA 4NXIA 1S3RA 1DE2A 4XCSA 4EL1A 5A5KA 4GCIA 2GQKA 2OE1A 2AHEA 6GSUA 1ILOA 4G9HA 5CREA 3IK7A 2QGVA 5G1LA 1XWGA 4G01A 2QSIA 4KB3A 1KNGA 1XWAA 4MJAA 4Q5QA 2DKIA 4PXOA 1OVNA 4MA9A 3GV1A 4EE0A 2HRNA 3LWAA 3I9V2 2JADA 6GSXA 3TOUA 4KW6A 3HYPA 4V1Ag 2PUKC 1ZGNA 4FQUA 2IMDA 1HNBA 3CTGA 4ZL8A 3E9JB 3RPPA 3ISOA 2GT6A 1USBA 4BWQA 2P5QA 2GSSA 2FA8A 1K3OA 3QOUA 1K0AA 2C8UA 4N11A 2HLSA 2YWNA 3JCML 5DAKA 3VFIA 2WZSA 2HZEA 2R2JA 5JCWA 4WR4A 3LYPA 3ZMLA 3J7Yk 2R3XA 3ERFA 2H76A 5CRDA 1ZCPA 3SWLA 4ECJA 5IO0A 1SK1A 2VM2A 4I2TA 3VWXA 2DC5A 3IHGA 2ES7A 2H19A 1XWBA 3BBYA 2AB6A 2AJQB 4L8EA 1V2AA 2H1AA 1FHEA 2R6KA 3HJPA 4W66A 3VPTA 1EGOA 5IPGA 4F03A 3KMNA 1GTIA 5KN2A 2IMEA 4EKZA 3LSZA 4N3ZA 2C80A 4G19A 2LV3A 3CXGA 1UN2A 1VF3A 3LW9A 4KCAA 4HOJA 1TU8A 2CA8A 2JZRA 2LTKA 2HRAA 2ZNMA 1X0RA 5G30A 4OO4A 5H5QA 2QA2A 3WGDA 5HFIA 3TDGA 1J0FA 1K3YA 5JWOB 1V98A 2GQMA 1GSQA 2I81A 1GLQA 5JCGA 2CV4A 3TGZA 1GSFA 3CSHA 4NV2A 1U88A 4KDXA 1EGRA 2MMAA 5LNKe 3QD9A 4MJCA 1GTBA 1W89A 1Z6MA 3KCMA 2IMKA 2JZSA 4OFNA 2DKHA 12GSA 1EV4A 4PHZC 1Y25A 4LMVA 2FA4A 3R2QA 4QQ7A 3PH9A 2C0EA 2HZFA 2BJXA 1EP7A 1JLWA 3FR3A 2C0DA 4RI6A 3HVNA 4BL7A 1URMA 3GKNA 4F82A 4WETA 3UOMA 3N5OA 2RLIA 2VCQA 3CRTA 1PX7A 1Z9HA 6GSVA 1OYJA 3M9KA 1YQ1A 1K0OA 3FRCA 2IFQA 2HRFA 5EL8A 1K0CA 3BD2A 5J3RA 2HSYA 4BVXB 4QL9A 2CAIA 1SVLA 3TKPA 2L57A 5J4YA 5B8AA 1WE0A 4TXOA 3GH9A 2WW3A 2XBIA 1O8WA 1SD9A 2O5VA 1G7EA 1T00A 2EIOA 1XVWA 2X8HA 1O81A 4NHZA 5ECOB 4HS1A 5IMDA 5F07A 5A4WA 2B1KA 4TR3A 1FO5A 3GA4A 4I5QA 2HFDA 5J40A 2VO4A 3M8NA 3EU3A 4MJBA 4QMKA 3UL3A 8GSSA 2HQTA 1GWCA 5CP1A 5A5HB 4PQIA 3EMXA 2L4QA 1FG4A 1A8YA 2MMOA 4FH8A 5CO3A 5IMZA 4GLTA 1SL1B 1GL8A 1M9BA 3VWWA 1PL2A 3F4SA 1Z7PA 4FYUA 1AW9A 2DIZA 3APOA 5CRWA 1QMVA 4BVYA 5AN1A 1SK0A 1V9WA 2D2ZA 4OO5A 1XXUA 3US3A 3WYWA 3EMPA 4WR5A 1T3BA 1ZOFA 2EFHA 1BG1A 4AJ7A 2H1LA 4K2XA 1ZL9A 4O5RA 5HR1A 2JSZA 3GNJA 1A8LA 1PX6A 4YKFA 2LRTA 2F8AA 4WBJA 1JLVA 4MCUA 4NAXA 2IL3A 4MLYA 3RDWA 2O8VB 1YEWC 5GAPD 1PGTA 4JZQA 2FWEA 4IHUA 4HZ2A 2I9HA 3TKSC 4BA7A 1EOGA 2A4HA 3HVSA 4FYBA 5ECRB 4PNGA 2PMTA 2AAWA 3C7MA 4FYCA 2O87A 3EWLA 2R4VA 3F6DA 1PA3A 4ZL7A 1OE7A 1VF2A 4EUYA 5A1NA 3D22A 4G0LA 4AJ6A 1W4VA 5KN1A 4TOPA 1XZOA 2FHEA 3FK8A 3TJFA 2H1GA 5EPFA 5DALB 5DDLA 1GP1A 5B7CA 1NM3A 3LORA 4OWYA 3BCKA 3I43A 4ICYA 2I4AA 5IO2A 1TP9A 5B6NA 2A2SA 2F3MA 1XOBA 3E0UA 3DRNA 4YQVA 4TXVA 1M3IA 2HRKA 2YWOA 4ZB9A 4PI2C 1B48A 1VGLA 4KCEA 2CQ9A 1T7PB 3FW2A 5GAND 1GSSA 4KDUA 1WIKA 3G9BA 4F9ZA 2L6CA 2G0FA 4Q5RA 3L9SA 2PU9C 1TKDB 1MD4A 2H8LA 1TW9A 1OC9B 2EIQA 5HFKA 2AV4A 1GUMA 2H1BA 1XIYA 1EEJA 3A2VA 2FY6A 4F2IA 3J7Yb 2HYXA 4MPGA 3UVHA 2JZTA 4TN8A 5J5NA 5A4VA 1TI3A 1YY7A 2V6KA 3TKSA 4WKWA 5D9TA 2B6MA 5D93A 1O8XA 2KLXA 4KH7A 3QAWA 3ZTLA 3HDCA 4XRAA 1AQWA 1TK5B 1TRVA 2C3NA 2IJYA 1XPVA 5ECQB 3GHAA 2DLXA 3LFLA 4PURA 3KH9A 4TVEA 3L0HA 4MK3A 2CVBA 1SU9A 3ED3A 3TU3B 4KA0A 4BIKA 1TXUA 1K0DA 2F9SA 1CQGA 1V40A 1N25A 2K6VA 3QCPA 3KD0A 2O36A 2XHFA 3HZ8A 3A2XA 1WPIA 2VCXA 2WVXA 2IN3A 3NZNA 2TRXA 3VK9A 3WT2A 5BMUA 1O73A 1SL0B 4XS1A 4OCFA 4WF4A 1V58A 3IBHA 1ABAA 4JRRA 3O6TA 2O85A 1VRSD 2YCDA 4BWSA 2ON7A 4MH2A 1M3JA 3MAKA 4POMA 4K6XA 2OE3A 1BX9A 2R0CA 3K8NA 3KJYA 4LL4B 3WGEA 5D9XA 3KZQA 3QDNA 2H70A 1ERVA 3EU4A 1ERWA 4ZBBA 1H4OA 3ZRDA 4EF0A 4CW9A 5J47A 3WGXA 4PTSA 1PFOA 2GZPA 5ABRA 5D8IA 1HNCA 4K9ZA 3UVTA 1BYEA 3GX0A 1JZDA 1GUHA 4QL7A 2VL2A 3LEFA 1S3CA 4D73A 1T1VA 1TOFA 2FLSA 3C71A 5A4UA 2HSNB 1R5PA 4JEDA 1MDKA 3KEBA 1Q98A 4Z7XA 5AISA 4MH3A 2JL4A 2NDOA 6GSTA 1QXHA 2B5XA 3TJBA 5ID2B 5E59A 2VCWA 2HSMA 2NVLA 3GSTA 3P90A 5HR2A 4O5QA 3A5WA 3H8QA 5G2ZA 5DCHA 1S3AA 1NW2A 1AXDA 2CZ3A 4PUFC 4PI0C 2X99A 4KAEA 4ZL9A 2DMLA 5IM9A 3F4RA 2H6YA 3CSIA 1BJXA 4OFMA 5LD0A 2WCIA 5BRTA 3UBLA 1DSBA 3DEXA 3GH6A 2DIYA 3TJJA 5HR3A 2YPMA 4F0BA 2AUVA 4Z2UA 3F6FA 1ZMAA 3GX8A 2IIYA 2HT9A 3RHCA 2B5EA 1QUWA 1EZKA 3HJOA 2P5RA 4KF9A 2RUEA 4N10A 4I6XA 5ECKB 2UV8G 1KTEA 4E8EA 4NWYA 3KXOA 2YWIA 4HUAA 4MMMA 1B4QA 3RBTA 5A34B 1I1IP 5IOXA 1HYUA 1Z3EA 1OKTA 5ECPB 4E68A 3ZVJA 3APQA 2F8FA 3GL5A 3F9UA 3BJ5A 3TKRA 3H1NA 3RFRC 1QFNA 1X9MB 1JZRA 1XG8A 5CRHA 4HQZA 2RIIA 3GL3A 1DBYA 1M9AA 4GSTA 1FOVA 1O6JA 4EDYA 2C1YA 4USSA 2VM1A 2IMIA 3KGKA 4TR1B 1UC7A 2H0HA 1ERTA 1GNWA 1JFUA 1SVOA 3FYGA 2F51A 2PGTA 5LCZA 1HD2A 1K0NA 1I5GA 2B1LA 4KDYA 3HY2A 4CY6A 2L4CA 3IXRA 1X9WB 1F6MC 1YKCA 5DQSA 5ECMB 1PRXA 4V2LA 2I3YA 2VL3A 4DSRA 3ZLPA 4AKGA 3F3RA 2M72A 1U87A 4MDCA 2YP6A 2MMNA 3HZ4A 9GSSA 1R7HA 4O32A 4Q5FA 3ZITA 4K7NA 4XHMA 2B5YA 1N8JA 1T8EB 3GRXA 1WJKA 2LNSA 2ON5A 3IOSA 5IPHA 2WW0A 2KHPA 5DJMA 4ULXA 1U6TA 4YAVA 2FUG2 5IOWA 5E4WA 1ZYNA 2J23A 1MD3A 2H72A 3C8EA 1FAAA 4O7HA 4POLA 3GMFA 4ML1A 3L78A 3MSZA 4HSCX 2V41A 4DEJA 2AYTA 1HNAA 2CX3A 2O7KA 5ECLB 1PQNA 2ZUPA 3RGBC 4YQMA 1QK8A 3G7IA 4DSSB 3HHVA 1SJ6A 2KUCA 2WRTA 5GSSA 5KOWA 2A2PA 2OT3A 4NHWA 1F37A 2H01A 4Z2RA 4EDZA 1R4WA 2MBSA 4OMVA 3L9VA 4ID0A 1ZYEA 5ECHB 5G5EA 1S4BP 3GTUA 4O5UA 3EE2A 1V57A 4IGJA 3DGQA 2VCVA 3UARA 3FEUA 2VIMA 3CTFA 3UJ1A 2NPBA 2TRCP 2CX4A 5J9CA 2X64A 4E8HA 4FIWA 4TR0A 2ZCTA 5INYA 1TK0B 1GUKA 2GSQA 2X49A 1QQ2A 2GSTA 4ZBDA 4IVFA 2FGXA 3RHBA 2QA1A 3H93A 3IE3A 5J41A 3S9FA 1NHOA 4NPBA 4HI7A 3MNGA 4TR4A 4XS4A 2OJLA 2R37A 2M80A 1XW9A 2WDUA 3G7YA 1XW6A 5HR0A 3GIXA 1TRUA 4AF2A 4K0GA 2YJHA 3DD3A 2H71A 1NSWA 2VD0A 2C0FA 3C1SA 16GSA 3LG6A 3M0FA 2C4JA 5ID2A 2B7JA 3TJKA 4YQUA 2B3SA 5DJLA 4J56E 3GKXA 2G2QA 4AI6A 4EIQA 2R5GA 3TRQA 1GSDA 2FWGA 1FOHA 1C72A 1XFLA 22GSA 3D21A 4K0NA 4MNNA 1SKSB 4GSNA 4DVCA 1BF5A 4X1UA 3ZZXA 4PGTA 1F3AA 3UBKA 3MWHA 2VL9A 4GDFA 4Z2TA 1YDKA 3APSA 3KH7A 2WVZA 3GSSA 2OE0A 4HU7A 4NV5A 2L6DA 1BEDA 2H0GA 1ZZYA 3ME7A 5CYYA 3TRXA 1M99A 1TTZA 1X5DA 3KM6A 4ZB7A 5J4UA 5L71A 2C3TA 3AY8A 5IQYA 2RM6A 1KBNA 2NTOA 4IBPA 2V6OA 3TRPA 20GSA 1WMJA 3M9JA 2XBQA 4FXYP 2IPAA 4ISDA 3W8JA 2E2GA 2WFCA 2OACA 4ZB6A 3TJGA 2OBIA 5C04A 5DAKB 2X4AA 2QC7A 5AIVA 4IQAA 5G31A 11GSA 1A24A 4IJIA 2L5LA 2PPTA 1QGVA 1GTAA 2H6ZA 3GYKA 3TKSE 5HQPA 2LJRA 2GQLA 1SK2A 3A2WA 2O89A 5KN0A 4YAPA 1AAZA 2HXKA 3HA9A 1YVLA 3GURA 1AQVA 2A2RA 2WW2A 4HQSA 4MZWA 4L0UA 2K8SA 2YV7A 3BCIA 4LA1A 2H1DA 2GZYA 2YN1A 2EIRA 2GZZA 3DIEA 3CRUA 2FD3A 4KSOA 2TIRA 4GXZA 1GULA 1M7TA 3A3TA 3UEMA 1JZOA 2VL2C 3W6GA 4EVMA 3TOTA 1TI1A 1LBKA 4AKIA 2K18A 2WS2A 3QR6A 1NHYA 3P7XA 3DXBA 2LRNA 2LJAA 5DBQA 3IDVA 2XPDA 2E0QA 2LQOA 4K8MA 1VF4A 1TDIA 1PN9A 2VLUA 1R26A 1B4PA 4AGSA 3UAPA 1ON4A 2O3EA 4EIPA 5ECIB 1BAYA 1PD21 1Y6EA 3CHXC 5IMAA 1BG5A 3FZAA 2MBTA 2K8VA 3PGTA 2M46A 3HJMA 4BL7B 4CY8A 1A0RP 1XWKA 4PQHA 2E2MA 2LUSA 4X4JA 1AIUA 1XBSA 4K2DA 2DJJA 3GN3A 1G6WA 4XS6A 2OKAA 4BVXA 5IIZA 4GWRA 4NMUA 1BQ7A 4BPYA 1FW1A 3HKRA 5CAXA 1OC3A 2LEGA 4HDEA 5AGYA 2J9HA 1VF1A 2H66A 2IFQB 4I8BA 4GRFA 2FCHA 1GSYA 2GS3A 5IMCA 2DJ0A 5DVBA 3C1RA 4HJ2A 1GRXA 2EFDA 2A4VA 2CAQA 1UVZA 2LRCA 5EVOA 2LQQA 1DUGA 4WEYA 4TXOB 1FB0A 3HVXA 2R0GA 1G0TA 6GSYA 3LGCA 1A0FA 5D73A 2R0PA 5JWQB 3F0IA 5A5HA 3HD5A 4RQXA 1SENA 1AC1A 5H5SA 3F8UA 2MZCA 2JU5A 3KMOA 5G1KA 2Z9SA 2CVKA 4IN0A 3DMLA 1GSUA 2FWFA 2LJKA 1TRWA 3FZ4A 4MJEA 1THXA 4FO5A 3P8WA 4GF0A 3KIJA 2DSAA 4I2UA 3L4NA 1SYXA 5F05A 3QPMA 3E3EA 1OE8A 1XVQA 1PKWA 4AKHA 4Q5NA 1M2BA 3D0ZA 3IAS2 5F06A 2H6XA 3RPNA 4BVYB 4MZCA 5ELGA 2IWTA 4ECIA 2GTUA 2VD1A 1U3IA 3TUEA 1LJRA 3H4KA 4K5SA 1OKDA 4IP6A 3D4MA 4LL1B 3F4TA 2PWJA 1YF0A 1K0MA 1FVKA 1GH2A 2CVDA 3CMIA 2L59A 4HU9A 1S3DA 1A2MA 4TRXA 3KP9A 1EV9A 1WP0A 1GSEA 2DJ1A 1PKZA 4POBA 2X8CA 4RQRA 5COHA 5D96A 1Z6NA 1H75A 2H0IA 1K0BA 5JWRB 2H30A 4IKHA 5D9VA 2QKEA 3GUSA 4XRDA 4ZXGA 2HE3A 3FR6A 4OCEA 1J08A 3VI5A 3GFKA 4OD7A 4YH2A 3F3QA 2RM5A 2VCTA 3ERWA 3NOFA 4ECCA 2VLVA 2MMZA 1EEMA 3M3MA 4HZ4A 5DALA 1RK4A 5A1NB 1MDIA 2WW1A 3IA1A 1CQHA 1MTCA 2YNXA 1ZYQB 3GKMA 4N30A 3R3EA 2VOCA 2X8GA 3CQFA 1WOUA 3DVWA 4MABA 1O85A 1GLPA 1XWCA 4WBRD 7GSSA 2H74A 1JHBA 3FZ5A 6GSWA 4YKGA 1GTUA 4HJMA 1A23A 5H5RA 1JZWA 2PVOC 2XC2A 1XOAA 2HRKB 4GQCA 2P0GA 4OFTA 3ZMKA 2LNTA 1OC9A 4ML6A 3VURA 2FNOA 3TKQA 1YJ6A 1MDJA 1YZXA 4PQ1A 3NIVA 4IELA 2OA7A 2RUFA 3ZIJA 3FZ9A 1FB6A 3A5IA 5KOXA 5B8BA 4I97A 4O92A 1K3LA 1SVMA 4KSMA 3QMXA 4JR6A 2VCZA 17GSA 3HVVA 1SJZA 1YF1A 4XTSA 1T4ZA 3TB2A 2REMA 2GSRA 3UIWA 2PBJA 4K5RA 2WVYA 1Z7RA 2WJUA 3WT1A 2XPEA 4K1FA 4X0XA 1Y1UA 2HSHA 2DJ2A 4GQFA 2C3QA 1IYHA 3I69A 5G5FA 1TRSA 2I1UA 3SBCA 2IMFA 2GLRA 2N5AA 3QFAC 3QFBC 4ECBA 5F0GA 4L5OA 2WGRA 1E2YA 4ZBAA 4JE1A 5GZZB 3FMWA 2B7KA 14GSA 5GSTA 3N9JA 4HEA2 4JR4A 4IQ1A 1E6BA 1X5EA 2P31A 1SKRB 2OBKA 2WB9A 5ELAA 2WVXB 2H75A 3HCZA 2JSYA 4H86A 1F9MA 4V2NA 6GSSA 3ME8A 5BMUB 1A2LA 4P3YB 1Z5YE 4IJ3A 2NBSA 4AKXB 3HXSA 1ML6A 4KNDA 2CZ2A 1G7OA 3F63A 2KOKA 1THOA 3I6AA 3DYRA 1SL2B 4A5PA 5FWGA 4KUNA 5KEJA 3FKFA 4GTUA 5F8BA 1HQOA 3BOAA 2V1MA 5IMVA 2VAFA 1EP8A 3ZL5A 5B6MA 2VKZG 3EYTA 3Q74A 2HSNA 4ZILA 1J9BA 2YOIA 3ZIVA 2C0GA 2LKUA 3LQ7A 2L5OA 2DJ3A 2MYGA 4LLRA 1XW5A 3CWGA 2WZ9A 5IMFA 4D73B 1A2JA 3W8SA 3VPQA 4MF6A 1F2EA 1GNEA 3RAZA 2DJKA 4F0CA 3VWVA 5FHIA 1M2AA 4RI7A 4KX4A 4G0IA 3CYNA 1TXXA 3PPUA 1Q4JA 3OR5A 4MF7A 2EC4A 2HSMB 3O76A 3IPZA 3IR4A 1WRYA 3UMAA 3IRAA 4TW5A 2ALBA 5FT3A 5J9BA 3ZFBA 1B8XA 5HFGA 4PX1A 1AQXA 1ERUA 4MP4A 3TCOA 4XIHA 4L5LA 1O7UA 1MEKA 4J2FA 3FHKA 3HMJG 2YJ7A 3DKSA 4AJ8A 3CSJA 3Q19A 1LU4A 2HI7A 1RW1A 5DQYA 1IYIA 3EC3A 3IAM2 5C00A 13GSA 1OC8A 3VWUA 3C73A 5J4VA 3EVIA 2EFEA 5A34A 2PERA 2N5BA 4MZBA 4LMWA 2GGTA 4WF5A 3QAVA 5ECNB 2KP1A 5KN3A 3EPTA 4IS0A 4ACSA 4V1Ap 3PR8A 2HZEB 2OADA 3ZYWA 2CT6A 3VI7A 5CNWA 2FWHA 4CHSA 1I9DA 3D6IA 4TR1A 1SKWB 1TK8B 4IP1A 3G7JA 2GT5A 5ENUA 1M0UA 1ZYPA 4WXTA 4PNFA 1ST9A 5EY6A 3Q18A 3D4TA 2YWMA 1B9XC 3LYKA 4K7OA 2YANA 2KP2A 3ZFLA 3L9UA 4EC0A 1RQMA 3Q6OA 2GDRA 3DWVA 1FVJA 3VLNA 1F3BA 1EWXA 3O3TA 4X43A 3LXZA 5CRGA 3QAGA 2HNLA 4ILFA 1UA5A 4MF5A 4L0WA 10GSA 3KTLA 1OAZA 3PINA 1XCCA 3P2AA 2BMXA 1WWJA 1AUCA 4KGIA 3MIXA 1X9SB 3FY7A 5DCGA 2YZHA 4JBBA 4PUAA 1T4YA 2E7PA 2DBCA 3LXTA 3IC8A 1PMTA 1SJIA 3KTBA 4POKA 3D5JA 2LS5A 3KP8A 1B9YC 4JU5A 4ZIJA 1N2AA 3IHQA 1U3AA 3ZVJD 1PL1A 4DSSA 4KE3A 4N0VA 3WD6A 2LSTA 2YZUA 4GSSA 2N5FA 3U5RE 3H79A 3V1WA
chains in the Genus database with same CATH topology
18GSA 4TKYA 4V2MA 1R5AA 2K9FA 3IC4A 2YV9A 2BTOT 2WULA 2V32A 3EINA 1TU7A 3GTUB 3FR9A 3MDKA 2PN8A 3DVXA 4N0ZA 3MYDA 4CDOA 1PSQA 1TJDA 4G0KA 5ECSA 1DE1A 3CBUA 1SYRA 1ACVA 1YEPA 3U6VA 4EO3A 1X5CA 2VUPA 3IV4A 4EXJA 4G10A 5D9WA 3LJRA 19GSA 1EOHA 1KEBA 1SD8A 3ZREA 4DSQA 2JACA 2GVPA 3M1GA 4XS4B 1YEXA 1G6YA 1M2DA 2UZ8A 1PN0A 4J57E 1YKAA 2H73A 2EFCA 5JCUA 4RUVA 3EURA 3IK9A 4K7IA 4MPFA 2PVQA 4G2EA 3ERGA 3GKKA 5AIXA 2V2GA 2DMMA 4ZB8A 4IW9A 2VLTA 4NXIA 1DE2A 4XCSA 4EL1A 5A5KA 4GCIA 2GQKA 2OE1A 2AHEA 6GSUA 1ILOA 4G9HA 5CREA 3IK7A 2QGVA 5G1LA 1XWGA 4G01A 2QSIA 4KB3A 1KNGA 1XWAA 4MJAA 4Q5QA 2DKIA 4PXOA 1OVNA 4MA9A 3GV1A 4EE0A 2HRNA 3LWAA 3I9V2 2JADA 6GSXA 3TOUA 4KW6A 3HYPA 4V1Ag 2PUKC 1ZGNA 4FQUA 2IMDA 1HNBA 3CTGA 4ZL8A 3E9JB 3RPPA 3ISOA 2GT6A 1USBA 4BWQA 2P5QA 2GSSA 2FA8A 1K3OA 3QOUA 1K0AA 2C8UA 4N11A 2HLSA 2YWNA 3JCML 5DAKA 3VFIA 2HZEA 2R2JA 5JCWA 4WR4A 3LYPA 3ZMLA 3J7Yk 2R3XA 3ERFA 2H76A 5CRDA 1ZCPA 3SWLA 4ECJA 5IO0A 1SK1A 2VM2A 4I2TA 3VWXA 2DC5A 3IHGA 2ES7A 2H19A 1XWBA 3BBYA 2AB6A 2AJQB 4L8EA 1V2AA 2H1AA 1FHEA 2R6KA 3HJPA 4W66A 3VPTA 1EGOA 5IPGA 4F03A 3KMNA 1GTIA 5KN2A 2IMEA 4EKZA 3LSZA 4N3ZA 2C80A 4G19A 2LV3A 3CXGA 1UN2A 1VF3A 3LW9A 4KCAA 4HOJA 1TU8A 2CA8A 2JZRA 2LTKA 2HRAA 2ZNMA 1X0RA 5G30A 4OO4A 5H5QA 2QA2A 3WGDA 5HFIA 3TDGA 1J0FA 1K3YA 5JWOB 1V98A 2GQMA 1GSQA 2I81A 1GLQA 5JCGA 2CV4A 3TGZA 1GSFA 3CSHA 4NV2A 1U88A 4KDXA 1EGRA 2MMAA 5LNKe 3QD9A 4MJCA 1GTBA 1W89A 1Z6MA 3KCMA 2IMKA 2JZSA 4OFNA 2DKHA 12GSA 1EV4A 1Y25A 4LMVA 2FA4A 3R2QA 4QQ7A 3PH9A 2C0EA 2HZFA 2BJXA 1EP7A 1JLWA 3FR3A 2C0DA 4RI6A 4BL7A 1URMA 3GKNA 4F82A 4WETA 3UOMA 3N5OA 2RLIA 2VCQA 3CRTA 1PX7A 1Z9HA 6GSVA 1OYJA 3M9KA 1YQ1A 1K0OA 3FRCA 2IFQA 2HRFA 5EL8A 1K0CA 3BD2A 5J3RA 2HSYA 4BVXB 4QL9A 2CAIA 1SVLA 3TKPA 2L57A 5J4YA 5B8AA 1WE0A 4TXOA 3GH9A 2XBIA 1O8WA 1SD9A 2O5VA 1G7EA 1T00A 2EIOA 1XVWA 2X8HA 1O81A 4NHZA 5ECOB 4HS1A 5IMDA 5F07A 5A4WA 2B1KA 4TR3A 1FO5A 3GA4A 4I5QA 2HFDA 5J40A 2VO4A 3M8NA 3EU3A 4MJBA 4QMKA 3UL3A 8GSSA 2HQTA 1GWCA 5CP1A 5A5HB 4PQIA 3EMXA 2L4QA 1FG4A 1A8YA 2MMOA 4FH8A 5CO3A 5IMZA 4GLTA 1SL1B 1GL8A 1M9BA 3VWWA 1PL2A 3F4SA 1Z7PA 4FYUA 1AW9A 2DIZA 3APOA 5CRWA 1QMVA 4BVYA 5AN1A 1SK0A 1V9WA 2D2ZA 4OO5A 1XXUA 3US3A 3WYWA 3EMPA 4WR5A 1T3BA 1ZOFA 2EFHA 1BG1A 4AJ7A 2H1LA 4K2XA 1ZL9A 4O5RA 5HR1A 2JSZA 3GNJA 1A8LA 1PX6A 4YKFA 2LRTA 2F8AA 4WBJA 1JLVA 4MCUA 4NAXA 2IL3A 4MLYA 3RDWA 2O8VB 5GAPD 1PGTA 4JZQA 2FWEA 4IHUA 4HZ2A 2I9HA 3TKSC 4BA7A 1EOGA 2A4HA 3HVSA 4FYBA 5ECRB 4PNGA 2PMTA 2AAWA 3C7MA 4FYCA 2O87A 3EWLA 2R4VA 3F6DA 1PA3A 4ZL7A 1OE7A 1VF2A 4EUYA 5A1NA 3D22A 4G0LA 4AJ6A 1W4VA 5KN1A 4TOPA 1XZOA 2FHEA 3FK8A 3TJFA 2H1GA 5EPFA 5DALB 5DDLA 1GP1A 5B7CA 1NM3A 3LORA 4OWYA 3BCKA 3I43A 4ICYA 2I4AA 5IO2A 1TP9A 5B6NA 2A2SA 2F3MA 1XOBA 3E0UA 3DRNA 4YQVA 4TXVA 2HRKA 2YWOA 4ZB9A 1B48A 1VGLA 4KCEA 2CQ9A 1T7PB 3FW2A 5GAND 1GSSA 4KDUA 1WIKA 3G9BA 4F9ZA 2L6CA 2G0FA 4Q5RA 3L9SA 2PU9C 1TKDB 1MD4A 2H8LA 1TW9A 1OC9B 2EIQA 5HFKA 2AV4A 1GUMA 2H1BA 1XIYA 1EEJA 3A2VA 2FY6A 4F2IA 3J7Yb 2HYXA 4MPGA 3UVHA 2JZTA 4TN8A 5J5NA 5A4VA 1TI3A 1YY7A 2V6KA 3TKSA 4WKWA 5D9TA 2B6MA 5D93A 1O8XA 2KLXA 4KH7A 3QAWA 3ZTLA 3HDCA 4XRAA 1AQWA 1TK5B 1TRVA 2C3NA 2IJYA 1XPVA 5ECQB 3GHAA 2DLXA 3LFLA 4PURA 3KH9A 4TVEA 3L0HA 4MK3A 2CVBA 1SU9A 3ED3A 3TU3B 4KA0A 1TXUA 1K0DA 2F9SA 1CQGA 1V40A 1N25A 2K6VA 3QCPA 3KD0A 2XHFA 3HZ8A 3A2XA 1WPIA 2VCXA 2IN3A 3NZNA 2TRXA 3VK9A 3WT2A 5BMUA 1O73A 1SL0B 4XS1A 4OCFA 4WF4A 1V58A 3IBHA 1ABAA 4JRRA 3O6TA 2O85A 1VRSD 2YCDA 4BWSA 2ON7A 4MH2A 3MAKA 4POMA 4K6XA 2OE3A 1BX9A 2R0CA 3K8NA 3KJYA 4LL4B 3WGEA 5D9XA 3KZQA 3QDNA 2H70A 1ERVA 3EU4A 1ERWA 4ZBBA 1H4OA 3ZRDA 4EF0A 4CW9A 5J47A 3WGXA 4PTSA 2GZPA 5ABRA 5D8IA 1HNCA 4K9ZA 3UVTA 1BYEA 3GX0A 1JZDA 1GUHA 4QL7A 2VL2A 3LEFA 1S3CA 4D73A 1T1VA 1TOFA 2FLSA 3C71A 5A4UA 2HSNB 1R5PA 4JEDA 1MDKA 3KEBA 1Q98A 4Z7XA 5AISA 4MH3A 2JL4A 2NDOA 6GSTA 1QXHA 2B5XA 3TJBA 5ID2B 5E59A 2VCWA 2HSMA 2NVLA 3GSTA 3P90A 5HR2A 4O5QA 3A5WA 3H8QA 5G2ZA 5DCHA 1S3AA 1NW2A 1AXDA 2CZ3A 4PUFC 2X99A 4KAEA 4ZL9A 2DMLA 5IM9A 3F4RA 2H6YA 3CSIA 1BJXA 4OFMA 5LD0A 2WCIA 5BRTA 3UBLA 1DSBA 3DEXA 3GH6A 2DIYA 3TJJA 5HR3A 2YPMA 4F0BA 2AUVA 4Z2UA 3F6FA 1ZMAA 3GX8A 2IIYA 2HT9A 3RHCA 2B5EA 1QUWA 1EZKA 3HJOA 2P5RA 4KF9A 2RUEA 4N10A 4I6XA 5ECKB 2UV8G 1KTEA 4E8EA 4NWYA 3KXOA 2YWIA 4HUAA 4MMMA 1B4QA 3RBTA 5A34B 5IOXA 1HYUA 1Z3EA 1OKTA 5ECPB 4E68A 3ZVJA 3APQA 2F8FA 3GL5A 3F9UA 3BJ5A 3TKRA 3H1NA 1QFNA 1X9MB 1JZRA 5CRHA 4HQZA 2RIIA 3GL3A 1DBYA 1M9AA 4GSTA 1FOVA 1O6JA 4EDYA 2C1YA 4USSA 2VM1A 2IMIA 3KGKA 4TR1B 1UC7A 2H0HA 1ERTA 1GNWA 1JFUA 1SVOA 3FYGA 2F51A 2PGTA 5LCZA 1HD2A 1K0NA 1I5GA 2B1LA 4KDYA 3HY2A 4CY6A 2L4CA 3IXRA 1X9WB 1F6MC 1YKCA 5DQSA 5ECMB 1PRXA 4V2LA 2I3YA 2VL3A 4DSRA 3ZLPA 4AKGA 3F3RA 2M72A 1U87A 4MDCA 2YP6A 2MMNA 3HZ4A 9GSSA 1R7HA 4O32A 4Q5FA 3ZITA 4K7NA 4XHMA 2B5YA 1N8JA 1T8EB 3GRXA 1WJKA 2LNSA 2ON5A 3IOSA 5IPHA 2KHPA 5DJMA 4ULXA 1U6TA 4YAVA 2FUG2 5IOWA 5E4WA 1ZYNA 2J23A 1MD3A 2H72A 3C8EA 1FAAA 4O7HA 4POLA 3GMFA 4ML1A 3L78A 3MSZA 2V41A 4DEJA 2AYTA 1HNAA 2CX3A 2O7KA 5ECLB 1PQNA 2ZUPA 4YQMA 1QK8A 3G7IA 4DSSB 3HHVA 1SJ6A 2KUCA 2WRTA 5GSSA 5KOWA 2A2PA 2OT3A 4NHWA 1F37A 2H01A 4Z2RA 4EDZA 1R4WA 2MBSA 4OMVA 3L9VA 4ID0A 1ZYEA 5ECHB 5G5EA 3GTUA 4O5UA 3EE2A 1V57A 4IGJA 3DGQA 2VCVA 3UARA 3FEUA 2VIMA 3CTFA 3UJ1A 2NPBA 2TRCP 2CX4A 5J9CA 2X64A 4E8HA 4FIWA 4TR0A 2ZCTA 5INYA 1TK0B 1GUKA 2GSQA 2X49A 1QQ2A 2GSTA 4ZBDA 4IVFA 2FGXA 3RHBA 2QA1A 3H93A 3IE3A 5J41A 3S9FA 1NHOA 4NPBA 4HI7A 3MNGA 4TR4A 4XS4A 2OJLA 2R37A 2M80A 1XW9A 2WDUA 3G7YA 1XW6A 5HR0A 3GIXA 1TRUA 4AF2A 4K0GA 2YJHA 3DD3A 2H71A 1NSWA 2VD0A 2C0FA 3C1SA 16GSA 3LG6A 3M0FA 2C4JA 5ID2A 2B7JA 3TJKA 4YQUA 2B3SA 5DJLA 4J56E 3GKXA 2G2QA 4AI6A 4EIQA 2R5GA 3TRQA 1GSDA 2FWGA 1FOHA 1C72A 1XFLA 22GSA 3D21A 4K0NA 4MNNA 1SKSB 4GSNA 4DVCA 1BF5A 4X1UA 3ZZXA 4PGTA 1F3AA 3UBKA 3MWHA 2VL9A 4GDFA 4Z2TA 1YDKA 3APSA 3KH7A 3GSSA 2OE0A 4HU7A 4NV5A 2L6DA 1BEDA 2H0GA 1ZZYA 3ME7A 5CYYA 3TRXA 1M99A 1TTZA 1X5DA 3KM6A 4ZB7A 5J4UA 5L71A 2C3TA 3AY8A 5IQYA 2RM6A 1KBNA 2NTOA 4IBPA 2V6OA 3TRPA 20GSA 1WMJA 3M9JA 2XBQA 2IPAA 4ISDA 3W8JA 2E2GA 2WFCA 2OACA 4ZB6A 3TJGA 2OBIA 5C04A 5DAKB 2X4AA 2QC7A 5AIVA 4IQAA 5G31A 11GSA 1A24A 4IJIA 2L5LA 2PPTA 1QGVA 1GTAA 2H6ZA 3GYKA 3TKSE 5HQPA 2LJRA 2GQLA 1SK2A 3A2WA 2O89A 5KN0A 4YAPA 1AAZA 2HXKA 3HA9A 1YVLA 3GURA 1AQVA 2A2RA 4HQSA 4MZWA 4L0UA 2K8SA 2YV7A 3BCIA 4LA1A 2H1DA 2GZYA 2YN1A 2EIRA 2GZZA 3DIEA 3CRUA 2FD3A 4KSOA 2TIRA 4GXZA 1GULA 1M7TA 3A3TA 3UEMA 1JZOA 2VL2C 3W6GA 4EVMA 3TOTA 1TI1A 1LBKA 4AKIA 2K18A 2WS2A 3QR6A 1NHYA 3P7XA 3DXBA 2LRNA 2LJAA 5DBQA 3IDVA 2XPDA 2E0QA 2LQOA 4K8MA 1VF4A 1TDIA 1PN9A 2VLUA 1R26A 1B4PA 4AGSA 3UAPA 1ON4A 4EIPA 5ECIB 1BAYA 1PD21 1Y6EA 5IMAA 1BG5A 3FZAA 2MBTA 2K8VA 3PGTA 2M46A 3HJMA 4BL7B 4CY8A 1A0RP 1XWKA 4PQHA 2E2MA 2LUSA 4X4JA 1AIUA 1XBSA 4K2DA 2DJJA 3GN3A 1G6WA 4XS6A 2OKAA 4BVXA 5IIZA 4GWRA 4NMUA 1BQ7A 4BPYA 1FW1A 3HKRA 5CAXA 1OC3A 2LEGA 4HDEA 5AGYA 2J9HA 1VF1A 2H66A 2IFQB 4I8BA 4GRFA 2FCHA 1GSYA 2GS3A 5IMCA 2DJ0A 5DVBA 3C1RA 4HJ2A 1GRXA 2EFDA 2A4VA 2CAQA 1UVZA 2LRCA 5EVOA 2LQQA 1DUGA 4WEYA 4TXOB 1FB0A 3HVXA 2R0GA 1G0TA 6GSYA 3LGCA 1A0FA 5D73A 2R0PA 5JWQB 3F0IA 5A5HA 3HD5A 4RQXA 1SENA 1AC1A 5H5SA 3F8UA 2MZCA 2JU5A 3KMOA 5G1KA 2Z9SA 2CVKA 4IN0A 3DMLA 1GSUA 2FWFA 2LJKA 1TRWA 3FZ4A 4MJEA 1THXA 4FO5A 3P8WA 4GF0A 3KIJA 2DSAA 4I2UA 3L4NA 1SYXA 5F05A 3QPMA 3E3EA 1OE8A 1XVQA 1PKWA 4AKHA 4Q5NA 1M2BA 3D0ZA 3IAS2 5F06A 2H6XA 3RPNA 4BVYB 4MZCA 5ELGA 2IWTA 4ECIA 2GTUA 2VD1A 1U3IA 3TUEA 1LJRA 3H4KA 4K5SA 1OKDA 4IP6A 3D4MA 4LL1B 3F4TA 2PWJA 1YF0A 1K0MA 1FVKA 1GH2A 2CVDA 3CMIA 2L59A 4HU9A 1S3DA 1A2MA 4TRXA 3KP9A 1EV9A 1WP0A 1GSEA 2DJ1A 1PKZA 4POBA 2X8CA 4RQRA 5COHA 5D96A 1Z6NA 1H75A 2H0IA 1K0BA 5JWRB 2H30A 4IKHA 5D9VA 2QKEA 3GUSA 4XRDA 4ZXGA 2HE3A 3FR6A 4OCEA 1J08A 3VI5A 3GFKA 4OD7A 4YH2A 3F3QA 2RM5A 2VCTA 3ERWA 3NOFA 4ECCA 2VLVA 2MMZA 1EEMA 3M3MA 4HZ4A 5DALA 1RK4A 5A1NB 1MDIA 3IA1A 1CQHA 1MTCA 2YNXA 1ZYQB 3GKMA 4N30A 3R3EA 2VOCA 2X8GA 1WOUA 3DVWA 4MABA 1O85A 1GLPA 1XWCA 4WBRD 7GSSA 2H74A 1JHBA 3FZ5A 6GSWA 4YKGA 1GTUA 4HJMA 1A23A 5H5RA 1JZWA 2PVOC 2XC2A 1XOAA 2HRKB 4GQCA 2P0GA 4OFTA 3ZMKA 2LNTA 1OC9A 4ML6A 3VURA 2FNOA 3TKQA 1YJ6A 1MDJA 1YZXA 4PQ1A 3NIVA 4IELA 2OA7A 2RUFA 3ZIJA 3FZ9A 1FB6A 3A5IA 5KOXA 5B8BA 4I97A 4O92A 1K3LA 1SVMA 4KSMA 3QMXA 4JR6A 2VCZA 17GSA 3HVVA 1SJZA 1YF1A 4XTSA 1T4ZA 3TB2A 2REMA 2GSRA 3UIWA 2PBJA 4K5RA 1Z7RA 2WJUA 3WT1A 2XPEA 4K1FA 4X0XA 1Y1UA 2HSHA 2DJ2A 4GQFA 2C3QA 1IYHA 3I69A 5G5FA 1TRSA 2I1UA 3SBCA 2IMFA 2GLRA 2N5AA 3QFAC 3QFBC 4ECBA 5F0GA 4L5OA 2WGRA 1E2YA 4ZBAA 4JE1A 5GZZB 3FMWA 2B7KA 14GSA 5GSTA 3N9JA 4HEA2 4JR4A 4IQ1A 1E6BA 1X5EA 2P31A 1SKRB 2OBKA 2WB9A 5ELAA 2H75A 3HCZA 2JSYA 4H86A 1F9MA 4V2NA 6GSSA 3ME8A 5BMUB 1A2LA 4P3YB 1Z5YE 4IJ3A 2NBSA 4AKXB 3HXSA 1ML6A 4KNDA 2CZ2A 1G7OA 3F63A 2KOKA 1THOA 3I6AA 3DYRA 1SL2B 4A5PA 5FWGA 4KUNA 5KEJA 3FKFA 4GTUA 5F8BA 1HQOA 3BOAA 2V1MA 5IMVA 2VAFA 1EP8A 3ZL5A 5B6MA 2VKZG 3EYTA 3Q74A 2HSNA 4ZILA 1J9BA 2YOIA 3ZIVA 2C0GA 2LKUA 3LQ7A 2L5OA 2DJ3A 2MYGA 4LLRA 1XW5A 3CWGA 2WZ9A 5IMFA 4D73B 1A2JA 3W8SA 3VPQA 4MF6A 1F2EA 1GNEA 3RAZA 2DJKA 4F0CA 3VWVA 5FHIA 1M2AA 4RI7A 4KX4A 4G0IA 3CYNA 1TXXA 3PPUA 1Q4JA 3OR5A 4MF7A 2EC4A 2HSMB 3O76A 3IPZA 3IR4A 1WRYA 3UMAA 3IRAA 4TW5A 2ALBA 5FT3A 5J9BA 3ZFBA 1B8XA 5HFGA 4PX1A 1AQXA 1ERUA 4MP4A 3TCOA 4XIHA 4L5LA 1O7UA 1MEKA 4J2FA 3FHKA 3HMJG 2YJ7A 3DKSA 4AJ8A 3CSJA 3Q19A 1LU4A 2HI7A 1RW1A 5DQYA 1IYIA 3EC3A 3IAM2 5C00A 13GSA 1OC8A 3VWUA 3C73A 5J4VA 3EVIA 2EFEA 5A34A 2PERA 2N5BA 4MZBA 4LMWA 2GGTA 4WF5A 3QAVA 5ECNB 2KP1A 5KN3A 3EPTA 4IS0A 4ACSA 4V1Ap 3PR8A 2HZEB 2OADA 3ZYWA 2CT6A 3VI7A 5CNWA 2FWHA 4CHSA 1I9DA 3D6IA 4TR1A 1SKWB 1TK8B 4IP1A 3G7JA 2GT5A 5ENUA 1M0UA 1ZYPA 4WXTA 4PNFA 1ST9A 5EY6A 3Q18A 3D4TA 2YWMA 1B9XC 3LYKA 4K7OA 2YANA 2KP2A 3ZFLA 3L9UA 4EC0A 1RQMA 3Q6OA 2GDRA 3DWVA 1FVJA 3VLNA 1F3BA 1EWXA 3O3TA 4X43A 3LXZA 5CRGA 3QAGA 2HNLA 4ILFA 1UA5A 4MF5A 4L0WA 10GSA 3KTLA 1OAZA 3PINA 1XCCA 3P2AA 2BMXA 1WWJA 1AUCA 4KGIA 3MIXA 1X9SB 3FY7A 5DCGA 2YZHA 4JBBA 4PUAA 1T4YA 2E7PA 2DBCA 3LXTA 3IC8A 1PMTA 1SJIA 3KTBA 4POKA 3D5JA 2LS5A 3KP8A 1B9YC 4JU5A 4ZIJA 1N2AA 3IHQA 1U3AA 3ZVJD 1PL1A 4DSSA 4KE3A 4N0VA 3WD6A 2LSTA 2YZUA 4GSSA 2N5FA 3U5RE 3H79A 3V1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 18GS A;  4TKY A;  4V2M A;  1R5A A;  2K9F A;  3IC4 A;  2YV9 A;  2BTO T;  2WUL A;  2V32 A;  3EIN A;  1TU7 A;  3GTU B;  3FR9 A;  3MDK A;  2PN8 A;  3DVX A;  4N0Z A;  4CDO A;  1PSQ A;  1TJD A;  4G0K A;  5ECS A;  1DE1 A;  3CBU A;  1SYR A;  1ACV A;  1YEP A;  3U6V A;  4EO3 A;  1X5C A;  2VUP A;  3IV4 A;  4EXJ A;  4G10 A;  5D9W A;  3LJR A;  19GS A;  1EOH A;  1KEB A;  1SD8 A;  3ZRE A;  4DSQ A;  2JAC A;  2GVP A;  3M1G A;  4XS4 B;  1YEX A;  1G6Y A;  1M2D A;  2UZ8 A;  4J57 E;  1YKA A;  2H73 A;  5JCU A;  4RUV A;  3EUR A;  3IK9 A;  4K7I A;  4MPF A;  2PVQ A;  4G2E A;  3ERG A;  3GKK A;  5AIX A;  2V2G A;  2DMM A;  4ZB8 A;  4IW9 A;  2VLT A;  4NXI A;  1DE2 A;  4XCS A;  4EL1 A;  5A5K A;  4GCI A;  2GQK A;  2OE1 A;  2AHE A;  6GSU A;  1ILO A;  4G9H A;  5CRE A;  3IK7 A;  2QGV A;  5G1L A;  1XWG A;  2QSI A;  4KB3 A;  1KNG A;  1XWA A;  4MJA A;  4Q5Q A;  4PXO A;  1OVN A;  4MA9 A;  3GV1 A;  4EE0 A;  2HRN A;  3LWA A;  3I9V 2;  2JAD A;  6GSX A;  3TOU A;  4KW6 A;  3HYP A;  4V1A g;  2PUK C;  1ZGN A;  4FQU A;  2IMD A;  1HNB A;  3CTG A;  4ZL8 A;  3E9J B;  3RPP A;  3ISO A;  2GT6 A;  1USB A;  4BWQ A;  2P5Q A;  2GSS A;  2FA8 A;  1K3O A;  3QOU A;  1K0A A;  2C8U A;  4N11 A;  2HLS A;  2YWN A;  3JCM L;  5DAK A;  3VFI A;  2HZE A;  2R2J A;  5JCW A;  4WR4 A;  3LYP A;  3ZML A;  3J7Y k;  2R3X A;  3ERF A;  2H76 A;  5CRD A;  1ZCP A;  3SWL A;  4ECJ A;  5IO0 A;  1SK1 A;  2VM2 A;  4I2T A;  3VWX A;  2DC5 A;  2ES7 A;  2H19 A;  1XWB A;  3BBY A;  2AB6 A;  2AJQ B;  4L8E A;  1V2A A;  2H1A A;  1FHE A;  2R6K A;  3HJP A;  3VPT A;  1EGO A;  5IPG A;  4F03 A;  3KMN A;  1GTI A;  5KN2 A;  2IME A;  4EKZ A;  3LSZ A;  2C80 A;  4G19 A;  2LV3 A;  3CXG A;  1UN2 A;  1VF3 A;  4KCA A;  4HOJ A;  1TU8 A;  2CA8 A;  2JZR A;  2LTK A;  2HRA A;  2ZNM A;  1X0R A;  5G30 A;  4OO4 A;  5H5Q A;  3WGD A;  5HFI A;  3TDG A;  1J0F A;  1K3Y A;  5JWO B;  1V98 A;  2GQM A;  1GSQ A;  2I81 A;  1GLQ A;  5JCG A;  2CV4 A;  3TGZ A;  1GSF A;  3CSH A;  4NV2 A;  1U88 A;  4KDX A;  1EGR A;  2MMA A;  5LNK e;  3QD9 A;  4MJC A;  1GTB A;  1W89 A;  1Z6M A;  3KCM A;  2IMK A;  2JZS A;  4OFN A;  12GS A;  1EV4 A;  1Y25 A;  4LMV A;  2FA4 A;  3R2Q A;  4QQ7 A;  3PH9 A;  2C0E A;  2HZF A;  2BJX A;  1EP7 A;  1JLW A;  3FR3 A;  2C0D A;  4RI6 A;  4BL7 A;  1URM A;  3GKN A;  4F82 A;  4WET A;  3UOM A;  3N5O A;  2RLI A;  2VCQ A;  3CRT A;  1PX7 A;  1Z9H A;  6GSV A;  1OYJ A;  3M9K A;  1YQ1 A;  1K0O A;  3FRC A;  2IFQ A;  2HRF A;  5EL8 A;  1K0C A;  3BD2 A;  5J3R A;  2HSY A;  4BVX B;  4QL9 A;  2CAI A;  3TKP A;  2L57 A;  5B8A A;  1WE0 A;  4TXO A;  3GH9 A;  2XBI A;  1O8W A;  1SD9 A;  1G7E A;  1T00 A;  2EIO A;  1XVW A;  2X8H A;  1O81 A;  4NHZ A;  5ECO B;  4HS1 A;  5IMD A;  5F07 A;  5A4W A;  2B1K A;  4TR3 A;  1FO5 A;  3GA4 A;  4I5Q A;  2HFD A;  2VO4 A;  3M8N A;  3EU3 A;  4MJB A;  3UL3 A;  8GSS A;  2HQT A;  1GWC A;  5CP1 A;  4PQI A;  3EMX A;  2L4Q A;  1FG4 A;  1A8Y A;  2MMO A;  4FH8 A;  5CO3 A;  5IMZ A;  4GLT A;  1SL1 B;  1GL8 A;  1M9B A;  3VWW A;  1PL2 A;  3F4S A;  1Z7P A;  4FYU A;  1AW9 A;  2DIZ A;  3APO A;  5CRW A;  1QMV A;  4BVY A;  5AN1 A;  1SK0 A;  1V9W A;  2D2Z A;  4OO5 A;  1XXU A;  3US3 A;  3WYW A;  3EMP A;  4WR5 A;  1T3B A;  1ZOF A;  4AJ7 A;  1ZL9 A;  4O5R A;  5HR1 A;  2JSZ A;  3GNJ A;  1A8L A;  1PX6 A;  2LRT A;  2F8A A;  4WBJ A;  1JLV A;  4MCU A;  4NAX A;  2IL3 A;  4MLY A;  3RDW A;  2O8V B;  5GAP D;  1PGT A;  4JZQ A;  2FWE A;  4IHU A;  4HZ2 A;  2I9H A;  3TKS C;  4BA7 A;  1EOG A;  3HVS A;  4FYB A;  5ECR B;  4PNG A;  2PMT A;  2AAW A;  3C7M A;  4FYC A;  2O87 A;  3EWL A;  2R4V A;  3F6D A;  1PA3 A;  4ZL7 A;  1OE7 A;  1VF2 A;  4EUY A;  3D22 A;  4G0L A;  4AJ6 A;  1W4V A;  5KN1 A;  4TOP A;  1XZO A;  2FHE A;  3FK8 A;  3TJF A;  2H1G A;  5EPF A;  5DAL B;  5DDL A;  1GP1 A;  5B7C A;  1NM3 A;  3LOR A;  4OWY A;  3BCK A;  3I43 A;  2I4A A;  5IO2 A;  1TP9 A;  5B6N A;  2A2S A;  2F3M A;  1XOB A;  3E0U A;  3DRN A;  4YQV A;  4TXV A;  2HRK A;  2YWO A;  4ZB9 A;  1B48 A;  1VGL A;  4KCE A;  2CQ9 A;  1T7P B;  3FW2 A;  5GAN D;  1GSS A;  4KDU A;  1WIK A;  3G9B A;  4F9Z A;  2L6C A;  2G0F A;  4Q5R A;  3L9S A;  2PU9 C;  1TKD B;  1MD4 A;  2H8L A;  1TW9 A;  1OC9 B;  2EIQ A;  5HFK A;  2AV4 A;  1GUM A;  2H1B A;  1XIY A;  1EEJ A;  3A2V A;  2FY6 A;  4F2I A;  3J7Y b;  2HYX A;  4MPG A;  3UVH A;  2JZT A;  4TN8 A;  5J5N A;  5A4V A;  1TI3 A;  1YY7 A;  2V6K A;  3TKS A;  4WKW A;  5D9T A;  2B6M A;  5D93 A;  1O8X A;  2KLX A;  4KH7 A;  3QAW A;  3ZTL A;  3HDC A;  4XRA A;  1AQW A;  1TK5 B;  1TRV A;  2C3N A;  2IJY A;  1XPV A;  5ECQ B;  3GHA A;  2DLX A;  3LFL A;  4PUR A;  3KH9 A;  4TVE A;  3L0H A;  4MK3 A;  2CVB A;  1SU9 A;  3ED3 A;  4KA0 A;  1K0D A;  2F9S A;  1CQG A;  1V40 A;  2K6V A;  3QCP A;  3KD0 A;  2XHF A;  3HZ8 A;  3A2X A;  1WPI A;  2VCX A;  2IN3 A;  3NZN A;  2TRX A;  3VK9 A;  3WT2 A;  5BMU A;  1O73 A;  1SL0 B;  4XS1 A;  4OCF A;  4WF4 A;  1V58 A;  3IBH A;  1ABA A;  4JRR A;  3O6T A;  2O85 A;  1VRS D;  2YCD A;  4BWS A;  2ON7 A;  4MH2 A;  3MAK A;  4POM A;  4K6X A;  2OE3 A;  1BX9 A;  3K8N A;  3KJY A;  4LL4 B;  3WGE A;  5D9X A;  3KZQ A;  3QDN A;  2H70 A;  1ERV A;  3EU4 A;  1ERW A;  4ZBB A;  1H4O A;  3ZRD A;  4EF0 A;  4CW9 A;  3WGX A;  4PTS A;  2GZP A;  5ABR A;  5D8I A;  1HNC A;  4K9Z A;  3UVT A;  1BYE A;  3GX0 A;  1JZD A;  1GUH A;  4QL7 A;  2VL2 A;  3LEF A;  1S3C A;  4D73 A;  1T1V A;  1TOF A;  2FLS A;  3C71 A;  5A4U A;  2HSN B;  1R5P A;  4JED A;  1MDK A;  3KEB A;  1Q98 A;  4Z7X A;  5AIS A;  4MH3 A;  2JL4 A;  2NDO A;  6GST A;  1QXH A;  2B5X A;  3TJB A;  5ID2 B;  5E59 A;  2VCW A;  2HSM A;  2NVL A;  3GST A;  3P90 A;  5HR2 A;  3A5W A;  3H8Q A;  5G2Z A;  5DCH A;  1S3A A;  1NW2 A;  1AXD A;  2CZ3 A;  4PUF C;  2X99 A;  4KAE A;  4ZL9 A;  2DML A;  5IM9 A;  3F4R A;  2H6Y A;  3CSI A;  1BJX A;  4OFM A;  5LD0 A;  2WCI A;  3UBL A;  1DSB A;  3DEX A;  3GH6 A;  2DIY A;  3TJJ A;  5HR3 A;  2YPM A;  4F0B A;  2AUV A;  3F6F A;  1ZMA A;  3GX8 A;  2IIY A;  2HT9 A;  3RHC A;  2B5E A;  1QUW A;  1EZK A;  3HJO A;  2P5R A;  4KF9 A;  2RUE A;  4N10 A;  4I6X A;  5ECK B;  1KTE A;  4E8E A;  4NWY A;  3KXO A;  2YWI A;  4HUA A;  4MMM A;  1B4Q A;  3RBT A;  5IOX A;  1HYU A;  1Z3E A;  1OKT A;  5ECP B;  3ZVJ A;  3APQ A;  2F8F A;  3GL5 A;  3F9U A;  3BJ5 A;  3TKR A;  3H1N A;  1QFN A;  1X9M B;  1JZR A;  5CRH A;  4HQZ A;  2RII A;  3GL3 A;  1DBY A;  1M9A A;  4GST A;  1FOV A;  1O6J A;  4EDY A;  2C1Y A;  4USS A;  2VM1 A;  2IMI A;  3KGK A;  4TR1 B;  1UC7 A;  2H0H A;  1ERT A;  1GNW A;  1JFU A;  2F51 A;  3FYG A;  2PGT A;  5LCZ A;  1HD2 A;  1K0N A;  1I5G A;  2B1L A;  4KDY A;  3HY2 A;  2L4C A;  3IXR A;  1X9W B;  1F6M C;  1YKC A;  5DQS A;  5ECM B;  1PRX A;  4V2L A;  2I3Y A;  2VL3 A;  4DSR A;  3ZLP A;  3F3R A;  2M72 A;  1U87 A;  4MDC A;  2YP6 A;  2MMN A;  3HZ4 A;  9GSS A;  1R7H A;  4O32 A;  4Q5F A;  3ZIT A;  4K7N A;  4XHM A;  2B5Y A;  1N8J A;  1T8E B;  3GRX A;  1WJK A;  2LNS A;  2ON5 A;  3IOS A;  5IPH A;  2KHP A;  5DJM A;  4ULX A;  1U6T A;  4YAV A;  2FUG 2;  5IOW A;  5E4W A;  2J23 A;  1MD3 A;  2H72 A;  3C8E A;  1FAA A;  4O7H A;  4POL A;  3GMF A;  4ML1 A;  3L78 A;  3MSZ A;  2V41 A;  4DEJ A;  2AYT A;  1HNA A;  2CX3 A;  2O7K A;  5ECL B;  1PQN A;  2ZUP A;  4YQM A;  1QK8 A;  3G7I A;  4DSS B;  3HHV A;  1SJ6 A;  2KUC A;  2WRT A;  5GSS A;  4NHW A;  1F37 A;  2H01 A;  4EDZ A;  1R4W A;  2MBS A;  4OMV A;  3L9V A;  4ID0 A;  1ZYE A;  5ECH B;  5G5E A;  3GTU A;  3EE2 A;  1V57 A;  4IGJ A;  3DGQ A;  2VCV A;  3UAR A;  3FEU A;  2VIM A;  3CTF A;  3UJ1 A;  2NPB A;  2TRC P;  2CX4 A;  5J9C A;  2X64 A;  4E8H A;  4FIW A;  4TR0 A;  2ZCT A;  5INY A;  1TK0 B;  1GUK A;  2GSQ A;  1QQ2 A;  2GST A;  4ZBD A;  4IVF A;  2FGX A;  3RHB A;  3H93 A;  3IE3 A;  5J41 A;  3S9F A;  1NHO A;  4NPB A;  4HI7 A;  3MNG A;  4TR4 A;  4XS4 A;  2OJL A;  2R37 A;  2M80 A;  1XW9 A;  2WDU A;  3G7Y A;  1XW6 A;  5HR0 A;  3GIX A;  1TRU A;  4AF2 A;  4K0G A;  2YJH A;  3DD3 A;  2H71 A;  1NSW A;  2VD0 A;  2C0F A;  3C1S A;  16GS A;  3LG6 A;  3M0F A;  2C4J A;  5ID2 A;  2B7J A;  3TJK A;  4YQU A;  2B3S A;  5DJL A;  4J56 E;  3GKX A;  2G2Q A;  2R5G A;  3TRQ A;  1GSD A;  2FWG A;  1C72 A;  1XFL A;  22GS A;  3D21 A;  4K0N A;  1SKS B;  4GSN A;  4DVC A;  4X1U A;  3ZZX A;  4PGT A;  1F3A A;  3UBK A;  3MWH A;  2VL9 A;  1YDK A;  3APS A;  3KH7 A;  3GSS A;  2OE0 A;  4HU7 A;  4NV5 A;  2L6D A;  1BED A;  2H0G A;  1ZZY A;  3ME7 A;  5CYY A;  3TRX A;  1M99 A;  1TTZ A;  1X5D A;  3KM6 A;  5J4U A;  5L71 A;  2C3T A;  3AY8 A;  5IQY A;  2RM6 A;  1KBN A;  2NTO A;  4IBP A;  2V6O A;  3TRP A;  20GS A;  1WMJ A;  3M9J A;  2XBQ A;  2IPA A;  4ISD A;  3W8J A;  2E2G A;  2WFC A;  2OAC A;  4ZB6 A;  3TJG A;  2OBI A;  5C04 A;  5DAK B;  2QC7 A;  5AIV A;  4IQA A;  5G31 A;  11GS A;  1A24 A;  4IJI A;  2L5L A;  2PPT A;  1QGV A;  1GTA A;  2H6Z A;  3GYK A;  3TKS E;  5HQP A;  2LJR A;  2GQL A;  1SK2 A;  3A2W A;  2O89 A;  5KN0 A;  4YAP A;  1AAZ A;  2HXK A;  3HA9 A;  3GUR A;  1AQV A;  2A2R A;  4HQS A;  4MZW A;  4L0U A;  2K8S A;  2YV7 A;  3BCI A;  4LA1 A;  2H1D A;  2GZY A;  2YN1 A;  2EIR A;  2GZZ A;  3DIE A;  3CRU A;  2FD3 A;  4KSO A;  2TIR A;  4GXZ A;  1GUL A;  1M7T A;  3A3T A;  3UEM A;  1JZO A;  2VL2 C;  3W6G A;  4EVM A;  3TOT A;  1TI1 A;  1LBK A;  2K18 A;  2WS2 A;  3QR6 A;  1NHY A;  3P7X A;  3DXB A;  2LRN A;  2LJA A;  5DBQ A;  3IDV A;  2XPD A;  2E0Q A;  2LQO A;  4K8M A;  1VF4 A;  1TDI A;  1PN9 A;  2VLU A;  1R26 A;  1B4P A;  4AGS A;  3UAP A;  1ON4 A;  5ECI B;  1BAY A;  1PD2 1;  1Y6E A;  5IMA A;  1BG5 A;  3FZA A;  2MBT A;  2K8V A;  3PGT A;  2M46 A;  3HJM A;  4BL7 B;  1A0R P;  1XWK A;  4PQH A;  2E2M A;  2LUS A;  1AIU A;  1XBS A;  4K2D A;  2DJJ A;  3GN3 A;  1G6W A;  4XS6 A;  2OKA A;  4BVX A;  5IIZ A;  4GWR A;  4NMU A;  1BQ7 A;  4BPY A;  1FW1 A;  3HKR A;  5CAX A;  1OC3 A;  2LEG A;  4HDE A;  5AGY A;  2J9H A;  1VF1 A;  2H66 A;  2IFQ B;  4I8B A;  4GRF A;  2FCH A;  1GSY A;  2GS3 A;  5IMC A;  2DJ0 A;  5DVB A;  3C1R A;  4HJ2 A;  1GRX A;  2A4V A;  2CAQ A;  1UVZ A;  2LRC A;  5EVO A;  2LQQ A;  1DUG A;  4WEY A;  4TXO B;  1FB0 A;  3HVX A;  1G0T A;  6GSY A;  3LGC A;  1A0F A;  5D73 A;  5JWQ B;  3F0I A;  3HD5 A;  4RQX A;  1SEN A;  1AC1 A;  5H5S A;  3F8U A;  2MZC A;  2JU5 A;  3KMO A;  5G1K A;  2Z9S A;  2CVK A;  4IN0 A;  3DML A;  1GSU A;  2FWF A;  2LJK A;  1TRW A;  3FZ4 A;  4MJE A;  1THX A;  4FO5 A;  3P8W A;  4GF0 A;  3KIJ A;  2DSA A;  4I2U A;  3L4N A;  1SYX A;  5F05 A;  3QPM A;  3E3E A;  1OE8 A;  1XVQ A;  1PKW A;  4Q5N A;  1M2B A;  3D0Z A;  3IAS 2;  5F06 A;  2H6X A;  3RPN A;  4BVY B;  4MZC A;  5ELG A;  2IWT A;  4ECI A;  2GTU A;  2VD1 A;  1U3I A;  3TUE A;  1LJR A;  3H4K A;  1OKD A;  4IP6 A;  3D4M A;  4LL1 B;  3F4T A;  2PWJ A;  1YF0 A;  1K0M A;  1FVK A;  1GH2 A;  2CVD A;  3CMI A;  2L59 A;  4HU9 A;  1S3D A;  1A2M A;  4TRX A;  3KP9 A;  1EV9 A;  1WP0 A;  1GSE A;  2DJ1 A;  1PKZ A;  4POB A;  2X8C A;  4RQR A;  5COH A;  5D96 A;  1Z6N A;  1H75 A;  2H0I A;  1K0B A;  5JWR B;  2H30 A;  4IKH A;  5D9V A;  2QKE A;  3GUS A;  4XRD A;  4ZXG A;  2HE3 A;  3FR6 A;  4OCE A;  1J08 A;  3VI5 A;  3GFK A;  4OD7 A;  4YH2 A;  3F3Q A;  2RM5 A;  2VCT A;  3ERW A;  3NOF A;  4ECC A;  2VLV A;  2MMZ A;  1EEM A;  3M3M A;  4HZ4 A;  5DAL A;  1RK4 A;  1MDI A;  3IA1 A;  1CQH A;  1MTC A;  2YNX A;  1ZYQ B;  3GKM A;  4N30 A;  3R3E A;  2VOC A;  2X8G A;  1WOU A;  3DVW A;  4MAB A;  1O85 A;  1GLP A;  1XWC A;  4WBR D;  7GSS A;  2H74 A;  1JHB A;  3FZ5 A;  6GSW A;  1GTU A;  4HJM A;  1A23 A;  5H5R A;  1JZW A;  2PVO C;  2XC2 A;  1XOA A;  2HRK B;  4GQC A;  2P0G A;  4OFT A;  3ZMK A;  2LNT A;  1OC9 A;  4ML6 A;  3VUR A;  2FNO A;  3TKQ A;  1YJ6 A;  1MDJ A;  1YZX A;  4PQ1 A;  3NIV A;  4IEL A;  2OA7 A;  2RUF A;  3ZIJ A;  3FZ9 A;  1FB6 A;  5B8B A;  4I97 A;  4O92 A;  1K3L A;  4KSM A;  3QMX A;  4JR6 A;  2VCZ A;  17GS A;  3HVV A;  1SJZ A;  1YF1 A;  4XTS A;  1T4Z A;  3TB2 A;  2REM A;  2GSR A;  3UIW A;  2PBJ A;  1Z7R A;  2WJU A;  3WT1 A;  2XPE A;  4K1F A;  4X0X A;  2HSH A;  2DJ2 A;  4GQF A;  2C3Q A;  1IYH A;  3I69 A;  5G5F A;  1TRS A;  2I1U A;  3SBC A;  2IMF A;  2GLR A;  2N5A A;  3QFB C;  3QFA C;  4ECB A;  5F0G A;  4L5O A;  2WGR A;  1E2Y A;  4ZBA A;  4JE1 A;  5GZZ B;  2B7K A;  14GS A;  5GST A;  3N9J A;  4HEA 2;  4JR4 A;  4IQ1 A;  1E6B A;  1X5E A;  2P31 A;  1SKR B;  2OBK A;  2WB9 A;  5ELA A;  2H75 A;  3HCZ A;  2JSY A;  4H86 A;  1F9M A;  4V2N A;  6GSS A;  3ME8 A;  1A2L A;  4P3Y B;  1Z5Y E;  4IJ3 A;  2NBS A;  3HXS A;  1ML6 A;  4KND A;  2CZ2 A;  1G7O A;  3F63 A;  2KOK A;  1THO A;  3I6A A;  3DYR A;  1SL2 B;  5FWG A;  4KUN A;  5KEJ A;  3FKF A;  4GTU A;  5F8B A;  1HQO A;  3BOA A;  2V1M A;  5IMV A;  2VAF A;  1EP8 A;  3ZL5 A;  5B6M A;  3EYT A;  3Q74 A;  4ZIL A;  1J9B A;  2YOI A;  3ZIV A;  2C0G A;  2LKU A;  3LQ7 A;  2L5O A;  2DJ3 A;  2MYG A;  4LLR A;  1XW5 A;  2WZ9 A;  5IMF A;  4D73 B;  1A2J A;  3W8S A;  3VPQ A;  4MF6 A;  1F2E A;  1GNE A;  3RAZ A;  2DJK A;  4F0C A;  3VWV A;  5FHI A;  1M2A A;  4RI7 A;  4KX4 A;  4G0I A;  3CYN A;  1TXX A;  3PPU A;  1Q4J A;  3OR5 A;  4MF7 A;  2EC4 A;  2HSM B;  3O76 A;  3IPZ A;  3IR4 A;  1WRY A;  3UMA A;  3IRA A;  4TW5 A;  2ALB A;  5FT3 A;  5J9B A;  3ZFB A;  1B8X A;  5HFG A;  4PX1 A;  1AQX A;  1ERU A;  4MP4 A;  3TCO A;  4XIH A;  4L5L A;  1O7U A;  1MEK A;  4J2F A;  3FHK A;  3DKS A;  2YJ7 A;  4AJ8 A;  3CSJ A;  3Q19 A;  1LU4 A;  2HI7 A;  1RW1 A;  5DQY A;  1IYI A;  3EC3 A;  3IAM 2;  5C00 A;  13GS A;  1OC8 A;  3VWU A;  3C73 A;  3EVI A;  2PER A;  2N5B A;  4MZB A;  4LMW A;  2GGT A;  4WF5 A;  3QAV A;  5ECN B;  2KP1 A;  5KN3 A;  4IS0 A;  4ACS A;  4V1A p;  3PR8 A;  2HZE B;  2OAD A;  3ZYW A;  2CT6 A;  3VI7 A;  5CNW A;  2FWH A;  4CHS A;  1I9D A;  3D6I A;  4TR1 A;  1SKW B;  1TK8 B;  4IP1 A;  3G7J A;  2GT5 A;  5ENU A;  1M0U A;  4WXT A;  4PNF A;  1ST9 A;  5EY6 A;  3Q18 A;  3D4T A;  2YWM A;  1B9X C;  3LYK A;  4K7O A;  2YAN A;  2KP2 A;  3ZFL A;  3L9U A;  4EC0 A;  1RQM A;  3Q6O A;  2GDR A;  3DWV A;  1FVJ A;  3VLN A;  1F3B A;  1EWX A;  3O3T A;  4X43 A;  3LXZ A;  5CRG A;  3QAG A;  2HNL A;  4ILF A;  1UA5 A;  4MF5 A;  4L0W A;  10GS A;  3KTL A;  1OAZ A;  3PIN A;  1XCC A;  3P2A A;  2BMX A;  1WWJ A;  1AUC A;  4KGI A;  1X9S B;  3FY7 A;  5DCG A;  2YZH A;  4JBB A;  4PUA A;  1T4Y A;  2E7P A;  2DBC A;  3LXT A;  3IC8 A;  1PMT A;  1SJI A;  3KTB A;  4POK A;  3D5J A;  2LS5 A;  3KP8 A;  1B9Y C;  4JU5 A;  4ZIJ A;  1N2A A;  3IHQ A;  1U3A A;  3ZVJ D;  1PL1 A;  4DSS A;  4KE3 A;  4N0V A;  3WD6 A;  2LST A;  2YZU A;  4GSS A;  2N5F A;  3U5R E;  3H79 A;  3V1W A; 
#chains in the Genus database with same CATH topology
 18GS A;  4TKY A;  4V2M A;  1R5A A;  2K9F A;  3IC4 A;  2YV9 A;  2BTO T;  2WUL A;  2V32 A;  3EIN A;  1TU7 A;  3GTU B;  3FR9 A;  3MDK A;  2PN8 A;  3DVX A;  4N0Z A;  3MYD A;  4CDO A;  1PSQ A;  1TJD A;  4G0K A;  5ECS A;  1DE1 A;  3CBU A;  1SYR A;  1ACV A;  1YEP A;  3U6V A;  4EO3 A;  1X5C A;  2VUP A;  3IV4 A;  4EXJ A;  4G10 A;  5D9W A;  3LJR A;  19GS A;  1EOH A;  1KEB A;  1SD8 A;  3ZRE A;  4DSQ A;  2JAC A;  2GVP A;  3M1G A;  4XS4 B;  1YEX A;  1G6Y A;  1M2D A;  2UZ8 A;  1PN0 A;  4J57 E;  1YKA A;  2H73 A;  2EFC A;  5JCU A;  4RUV A;  3EUR A;  3IK9 A;  4K7I A;  4MPF A;  2PVQ A;  4G2E A;  3ERG A;  3GKK A;  5AIX A;  2V2G A;  2DMM A;  4ZB8 A;  4IW9 A;  2VLT A;  4NXI A;  1S3R A;  1DE2 A;  4XCS A;  4EL1 A;  5A5K A;  4GCI A;  2GQK A;  2OE1 A;  2AHE A;  6GSU A;  1ILO A;  4G9H A;  5CRE A;  3IK7 A;  2QGV A;  5G1L A;  1XWG A;  4G01 A;  2QSI A;  4KB3 A;  1KNG A;  1XWA A;  4MJA A;  4Q5Q A;  2DKI A;  4PXO A;  1OVN A;  4MA9 A;  3GV1 A;  4EE0 A;  2HRN A;  3LWA A;  3I9V 2;  2JAD A;  6GSX A;  3TOU A;  4KW6 A;  3HYP A;  4V1A g;  2PUK C;  1ZGN A;  4FQU A;  2IMD A;  1HNB A;  3CTG A;  4ZL8 A;  3E9J B;  3RPP A;  3ISO A;  2GT6 A;  1USB A;  4BWQ A;  2P5Q A;  2GSS A;  2FA8 A;  1K3O A;  3QOU A;  1K0A A;  2C8U A;  4N11 A;  2HLS A;  2YWN A;  3JCM L;  5DAK A;  3VFI A;  2WZS A;  2HZE A;  2R2J A;  5JCW A;  4WR4 A;  3LYP A;  3ZML A;  3J7Y k;  2R3X A;  3ERF A;  2H76 A;  5CRD A;  1ZCP A;  3SWL A;  4ECJ A;  5IO0 A;  1SK1 A;  2VM2 A;  4I2T A;  3VWX A;  2DC5 A;  3IHG A;  2ES7 A;  2H19 A;  1XWB A;  3BBY A;  2AB6 A;  2AJQ B;  4L8E A;  1V2A A;  2H1A A;  1FHE A;  2R6K A;  3HJP A;  4W66 A;  3VPT A;  1EGO A;  5IPG A;  4F03 A;  3KMN A;  1GTI A;  5KN2 A;  2IME A;  4EKZ A;  3LSZ A;  4N3Z A;  2C80 A;  4G19 A;  2LV3 A;  3CXG A;  1UN2 A;  1VF3 A;  3LW9 A;  4KCA A;  4HOJ A;  1TU8 A;  2CA8 A;  2JZR A;  2LTK A;  2HRA A;  2ZNM A;  1X0R A;  5G30 A;  4OO4 A;  5H5Q A;  2QA2 A;  3WGD A;  5HFI A;  3TDG A;  1J0F A;  1K3Y A;  5JWO B;  1V98 A;  2GQM A;  1GSQ A;  2I81 A;  1GLQ A;  5JCG A;  2CV4 A;  3TGZ A;  1GSF A;  3CSH A;  4NV2 A;  1U88 A;  4KDX A;  1EGR A;  2MMA A;  5LNK e;  3QD9 A;  4MJC A;  1GTB A;  1W89 A;  1Z6M A;  3KCM A;  2IMK A;  2JZS A;  4OFN A;  2DKH A;  12GS A;  1EV4 A;  4PHZ C;  1Y25 A;  4LMV A;  2FA4 A;  3R2Q A;  4QQ7 A;  3PH9 A;  2C0E A;  2HZF A;  2BJX A;  1EP7 A;  1JLW A;  3FR3 A;  2C0D A;  4RI6 A;  3HVN A;  4BL7 A;  1URM A;  3GKN A;  4F82 A;  4WET A;  3UOM A;  3N5O A;  2RLI A;  2VCQ A;  3CRT A;  1PX7 A;  1Z9H A;  6GSV A;  1OYJ A;  3M9K A;  1YQ1 A;  1K0O A;  3FRC A;  2IFQ A;  2HRF A;  5EL8 A;  1K0C A;  3BD2 A;  5J3R A;  2HSY A;  4BVX B;  4QL9 A;  2CAI A;  1SVL A;  3TKP A;  2L57 A;  5J4Y A;  5B8A A;  1WE0 A;  4TXO A;  3GH9 A;  2WW3 A;  2XBI A;  1O8W A;  1SD9 A;  2O5V A;  1G7E A;  1T00 A;  2EIO A;  1XVW A;  2X8H A;  1O81 A;  4NHZ A;  5ECO B;  4HS1 A;  5IMD A;  5F07 A;  5A4W A;  2B1K A;  4TR3 A;  1FO5 A;  3GA4 A;  4I5Q A;  2HFD A;  5J40 A;  2VO4 A;  3M8N A;  3EU3 A;  4MJB A;  4QMK A;  3UL3 A;  8GSS A;  2HQT A;  1GWC A;  5CP1 A;  5A5H B;  4PQI A;  3EMX A;  2L4Q A;  1FG4 A;  1A8Y A;  2MMO A;  4FH8 A;  5CO3 A;  5IMZ A;  4GLT A;  1SL1 B;  1GL8 A;  1M9B A;  3VWW A;  1PL2 A;  3F4S A;  1Z7P A;  4FYU A;  1AW9 A;  2DIZ A;  3APO A;  5CRW A;  1QMV A;  4BVY A;  5AN1 A;  1SK0 A;  1V9W A;  2D2Z A;  4OO5 A;  1XXU A;  3US3 A;  3WYW A;  3EMP A;  4WR5 A;  1T3B A;  1ZOF A;  2EFH A;  1BG1 A;  4AJ7 A;  2H1L A;  4K2X A;  1ZL9 A;  4O5R A;  5HR1 A;  2JSZ A;  3GNJ A;  1A8L A;  1PX6 A;  4YKF A;  2LRT A;  2F8A A;  4WBJ A;  1JLV A;  4MCU A;  4NAX A;  2IL3 A;  4MLY A;  3RDW A;  2O8V B;  1YEW C;  5GAP D;  1PGT A;  4JZQ A;  2FWE A;  4IHU A;  4HZ2 A;  2I9H A;  3TKS C;  4BA7 A;  1EOG A;  2A4H A;  3HVS A;  4FYB A;  5ECR B;  4PNG A;  2PMT A;  2AAW A;  3C7M A;  4FYC A;  2O87 A;  3EWL A;  2R4V A;  3F6D A;  1PA3 A;  4ZL7 A;  1OE7 A;  1VF2 A;  4EUY A;  5A1N A;  3D22 A;  4G0L A;  4AJ6 A;  1W4V A;  5KN1 A;  4TOP A;  1XZO A;  2FHE A;  3FK8 A;  3TJF A;  2H1G A;  5EPF A;  5DAL B;  5DDL A;  1GP1 A;  5B7C A;  1NM3 A;  3LOR A;  4OWY A;  3BCK A;  3I43 A;  4ICY A;  2I4A A;  5IO2 A;  1TP9 A;  5B6N A;  2A2S A;  2F3M A;  1XOB A;  3E0U A;  3DRN A;  4YQV A;  4TXV A;  1M3I A;  2HRK A;  2YWO A;  4ZB9 A;  4PI2 C;  1B48 A;  1VGL A;  4KCE A;  2CQ9 A;  1T7P B;  3FW2 A;  5GAN D;  1GSS A;  4KDU A;  1WIK A;  3G9B A;  4F9Z A;  2L6C A;  2G0F A;  4Q5R A;  3L9S A;  2PU9 C;  1TKD B;  1MD4 A;  2H8L A;  1TW9 A;  1OC9 B;  2EIQ A;  5HFK A;  2AV4 A;  1GUM A;  2H1B A;  1XIY A;  1EEJ A;  3A2V A;  2FY6 A;  4F2I A;  3J7Y b;  2HYX A;  4MPG A;  3UVH A;  2JZT A;  4TN8 A;  5J5N A;  5A4V A;  1TI3 A;  1YY7 A;  2V6K A;  3TKS A;  4WKW A;  5D9T A;  2B6M A;  5D93 A;  1O8X A;  2KLX A;  4KH7 A;  3QAW A;  3ZTL A;  3HDC A;  4XRA A;  1AQW A;  1TK5 B;  1TRV A;  2C3N A;  2IJY A;  1XPV A;  5ECQ B;  3GHA A;  2DLX A;  3LFL A;  4PUR A;  3KH9 A;  4TVE A;  3L0H A;  4MK3 A;  2CVB A;  1SU9 A;  3ED3 A;  3TU3 B;  4KA0 A;  4BIK A;  1TXU A;  1K0D A;  2F9S A;  1CQG A;  1V40 A;  1N25 A;  2K6V A;  3QCP A;  3KD0 A;  2O36 A;  2XHF A;  3HZ8 A;  3A2X A;  1WPI A;  2VCX A;  2WVX A;  2IN3 A;  3NZN A;  2TRX A;  3VK9 A;  3WT2 A;  5BMU A;  1O73 A;  1SL0 B;  4XS1 A;  4OCF A;  4WF4 A;  1V58 A;  3IBH A;  1ABA A;  4JRR A;  3O6T A;  2O85 A;  1VRS D;  2YCD A;  4BWS A;  2ON7 A;  4MH2 A;  1M3J A;  3MAK A;  4POM A;  4K6X A;  2OE3 A;  1BX9 A;  2R0C A;  3K8N A;  3KJY A;  4LL4 B;  3WGE A;  5D9X A;  3KZQ A;  3QDN A;  2H70 A;  1ERV A;  3EU4 A;  1ERW A;  4ZBB A;  1H4O A;  3ZRD A;  4EF0 A;  4CW9 A;  5J47 A;  3WGX A;  4PTS A;  1PFO A;  2GZP A;  5ABR A;  5D8I A;  1HNC A;  4K9Z A;  3UVT A;  1BYE A;  3GX0 A;  1JZD A;  1GUH A;  4QL7 A;  2VL2 A;  3LEF A;  1S3C A;  4D73 A;  1T1V A;  1TOF A;  2FLS A;  3C71 A;  5A4U A;  2HSN B;  1R5P A;  4JED A;  1MDK A;  3KEB A;  1Q98 A;  4Z7X A;  5AIS A;  4MH3 A;  2JL4 A;  2NDO A;  6GST A;  1QXH A;  2B5X A;  3TJB A;  5ID2 B;  5E59 A;  2VCW A;  2HSM A;  2NVL A;  3GST A;  3P90 A;  5HR2 A;  4O5Q A;  3A5W A;  3H8Q A;  5G2Z A;  5DCH A;  1S3A A;  1NW2 A;  1AXD A;  2CZ3 A;  4PUF C;  4PI0 C;  2X99 A;  4KAE A;  4ZL9 A;  2DML A;  5IM9 A;  3F4R A;  2H6Y A;  3CSI A;  1BJX A;  4OFM A;  5LD0 A;  2WCI A;  5BRT A;  3UBL A;  1DSB A;  3DEX A;  3GH6 A;  2DIY A;  3TJJ A;  5HR3 A;  2YPM A;  4F0B A;  2AUV A;  4Z2U A;  3F6F A;  1ZMA A;  3GX8 A;  2IIY A;  2HT9 A;  3RHC A;  2B5E A;  1QUW A;  1EZK A;  3HJO A;  2P5R A;  4KF9 A;  2RUE A;  4N10 A;  4I6X A;  5ECK B;  2UV8 G;  1KTE A;  4E8E A;  4NWY A;  3KXO A;  2YWI A;  4HUA A;  4MMM A;  1B4Q A;  3RBT A;  5A34 B;  1I1I P;  5IOX A;  1HYU A;  1Z3E A;  1OKT A;  5ECP B;  4E68 A;  3ZVJ A;  3APQ A;  2F8F A;  3GL5 A;  3F9U A;  3BJ5 A;  3TKR A;  3H1N A;  3RFR C;  1QFN A;  1X9M B;  1JZR A;  1XG8 A;  5CRH A;  4HQZ A;  2RII A;  3GL3 A;  1DBY A;  1M9A A;  4GST A;  1FOV A;  1O6J A;  4EDY A;  2C1Y A;  4USS A;  2VM1 A;  2IMI A;  3KGK A;  4TR1 B;  1UC7 A;  2H0H A;  1ERT A;  1GNW A;  1JFU A;  1SVO A;  3FYG A;  2F51 A;  2PGT A;  5LCZ A;  1HD2 A;  1K0N A;  1I5G A;  2B1L A;  4KDY A;  3HY2 A;  4CY6 A;  2L4C A;  3IXR A;  1X9W B;  1F6M C;  1YKC A;  5DQS A;  5ECM B;  1PRX A;  4V2L A;  2I3Y A;  2VL3 A;  4DSR A;  3ZLP A;  4AKG A;  3F3R A;  2M72 A;  1U87 A;  4MDC A;  2YP6 A;  2MMN A;  3HZ4 A;  9GSS A;  1R7H A;  4O32 A;  4Q5F A;  3ZIT A;  4K7N A;  4XHM A;  2B5Y A;  1N8J A;  1T8E B;  3GRX A;  1WJK A;  2LNS A;  2ON5 A;  3IOS A;  5IPH A;  2WW0 A;  2KHP A;  5DJM A;  4ULX A;  1U6T A;  4YAV A;  2FUG 2;  5IOW A;  5E4W A;  1ZYN A;  2J23 A;  1MD3 A;  2H72 A;  3C8E A;  1FAA A;  4O7H A;  4POL A;  3GMF A;  4ML1 A;  3L78 A;  3MSZ A;  4HSC X;  2V41 A;  4DEJ A;  2AYT A;  1HNA A;  2CX3 A;  2O7K A;  5ECL B;  1PQN A;  2ZUP A;  3RGB C;  4YQM A;  1QK8 A;  3G7I A;  4DSS B;  3HHV A;  1SJ6 A;  2KUC A;  2WRT A;  5GSS A;  5KOW A;  2A2P A;  2OT3 A;  4NHW A;  1F37 A;  2H01 A;  4Z2R A;  4EDZ A;  1R4W A;  2MBS A;  4OMV A;  3L9V A;  4ID0 A;  1ZYE A;  5ECH B;  5G5E A;  1S4B P;  3GTU A;  4O5U A;  3EE2 A;  1V57 A;  4IGJ A;  3DGQ A;  2VCV A;  3UAR A;  3FEU A;  2VIM A;  3CTF A;  3UJ1 A;  2NPB A;  2TRC P;  2CX4 A;  5J9C A;  2X64 A;  4E8H A;  4FIW A;  4TR0 A;  2ZCT A;  5INY A;  1TK0 B;  1GUK A;  2GSQ A;  2X49 A;  1QQ2 A;  2GST A;  4ZBD A;  4IVF A;  2FGX A;  3RHB A;  2QA1 A;  3H93 A;  3IE3 A;  5J41 A;  3S9F A;  1NHO A;  4NPB A;  4HI7 A;  3MNG A;  4TR4 A;  4XS4 A;  2OJL A;  2R37 A;  2M80 A;  1XW9 A;  2WDU A;  3G7Y A;  1XW6 A;  5HR0 A;  3GIX A;  1TRU A;  4AF2 A;  4K0G A;  2YJH A;  3DD3 A;  2H71 A;  1NSW A;  2VD0 A;  2C0F A;  3C1S A;  16GS A;  3LG6 A;  3M0F A;  2C4J A;  5ID2 A;  2B7J A;  3TJK A;  4YQU A;  2B3S A;  5DJL A;  4J56 E;  3GKX A;  2G2Q A;  4AI6 A;  4EIQ A;  2R5G A;  3TRQ A;  1GSD A;  2FWG A;  1FOH A;  1C72 A;  1XFL A;  22GS A;  3D21 A;  4K0N A;  4MNN A;  1SKS B;  4GSN A;  4DVC A;  1BF5 A;  4X1U A;  3ZZX A;  4PGT A;  1F3A A;  3UBK A;  3MWH A;  2VL9 A;  4GDF A;  4Z2T A;  1YDK A;  3APS A;  3KH7 A;  2WVZ A;  3GSS A;  2OE0 A;  4HU7 A;  4NV5 A;  2L6D A;  1BED A;  2H0G A;  1ZZY A;  3ME7 A;  5CYY A;  3TRX A;  1M99 A;  1TTZ A;  1X5D A;  3KM6 A;  4ZB7 A;  5J4U A;  5L71 A;  2C3T A;  3AY8 A;  5IQY A;  2RM6 A;  1KBN A;  2NTO A;  4IBP A;  2V6O A;  3TRP A;  20GS A;  1WMJ A;  3M9J A;  2XBQ A;  4FXY P;  2IPA A;  4ISD A;  3W8J A;  2E2G A;  2WFC A;  2OAC A;  4ZB6 A;  3TJG A;  2OBI A;  5C04 A;  5DAK B;  2X4A A;  2QC7 A;  5AIV A;  4IQA A;  5G31 A;  11GS A;  1A24 A;  4IJI A;  2L5L A;  2PPT A;  1QGV A;  1GTA A;  2H6Z A;  3GYK A;  3TKS E;  5HQP A;  2LJR A;  2GQL A;  1SK2 A;  3A2W A;  2O89 A;  5KN0 A;  4YAP A;  1AAZ A;  2HXK A;  3HA9 A;  1YVL A;  3GUR A;  1AQV A;  2A2R A;  2WW2 A;  4HQS A;  4MZW A;  4L0U A;  2K8S A;  2YV7 A;  3BCI A;  4LA1 A;  2H1D A;  2GZY A;  2YN1 A;  2EIR A;  2GZZ A;  3DIE A;  3CRU A;  2FD3 A;  4KSO A;  2TIR A;  4GXZ A;  1GUL A;  1M7T A;  3A3T A;  3UEM A;  1JZO A;  2VL2 C;  3W6G A;  4EVM A;  3TOT A;  1TI1 A;  1LBK A;  4AKI A;  2K18 A;  2WS2 A;  3QR6 A;  1NHY A;  3P7X A;  3DXB A;  2LRN A;  2LJA A;  5DBQ A;  3IDV A;  2XPD A;  2E0Q A;  2LQO A;  4K8M A;  1VF4 A;  1TDI A;  1PN9 A;  2VLU A;  1R26 A;  1B4P A;  4AGS A;  3UAP A;  1ON4 A;  2O3E A;  4EIP A;  5ECI B;  1BAY A;  1PD2 1;  1Y6E A;  3CHX C;  5IMA A;  1BG5 A;  3FZA A;  2MBT A;  2K8V A;  3PGT A;  2M46 A;  3HJM A;  4BL7 B;  4CY8 A;  1A0R P;  1XWK A;  4PQH A;  2E2M A;  2LUS A;  4X4J A;  1AIU A;  1XBS A;  4K2D A;  2DJJ A;  3GN3 A;  1G6W A;  4XS6 A;  2OKA A;  4BVX A;  5IIZ A;  4GWR A;  4NMU A;  1BQ7 A;  4BPY A;  1FW1 A;  3HKR A;  5CAX A;  1OC3 A;  2LEG A;  4HDE A;  5AGY A;  2J9H A;  1VF1 A;  2H66 A;  2IFQ B;  4I8B A;  4GRF A;  2FCH A;  1GSY A;  2GS3 A;  5IMC A;  2DJ0 A;  5DVB A;  3C1R A;  4HJ2 A;  1GRX A;  2EFD A;  2A4V A;  2CAQ A;  1UVZ A;  2LRC A;  5EVO A;  2LQQ A;  1DUG A;  4WEY A;  4TXO B;  1FB0 A;  3HVX A;  2R0G A;  1G0T A;  6GSY A;  3LGC A;  1A0F A;  5D73 A;  2R0P A;  5JWQ B;  3F0I A;  5A5H A;  3HD5 A;  4RQX A;  1SEN A;  1AC1 A;  5H5S A;  3F8U A;  2MZC A;  2JU5 A;  3KMO A;  5G1K A;  2Z9S A;  2CVK A;  4IN0 A;  3DML A;  1GSU A;  2FWF A;  2LJK A;  1TRW A;  3FZ4 A;  4MJE A;  1THX A;  4FO5 A;  3P8W A;  4GF0 A;  3KIJ A;  2DSA A;  4I2U A;  3L4N A;  1SYX A;  5F05 A;  3QPM A;  3E3E A;  1OE8 A;  1XVQ A;  1PKW A;  4AKH A;  4Q5N A;  1M2B A;  3D0Z A;  3IAS 2;  5F06 A;  2H6X A;  3RPN A;  4BVY B;  4MZC A;  5ELG A;  2IWT A;  4ECI A;  2GTU A;  2VD1 A;  1U3I A;  3TUE A;  1LJR A;  3H4K A;  4K5S A;  1OKD A;  4IP6 A;  3D4M A;  4LL1 B;  3F4T A;  2PWJ A;  1YF0 A;  1K0M A;  1FVK A;  1GH2 A;  2CVD A;  3CMI A;  2L59 A;  4HU9 A;  1S3D A;  1A2M A;  4TRX A;  3KP9 A;  1EV9 A;  1WP0 A;  1GSE A;  2DJ1 A;  1PKZ A;  4POB A;  2X8C A;  4RQR A;  5COH A;  5D96 A;  1Z6N A;  1H75 A;  2H0I A;  1K0B A;  5JWR B;  2H30 A;  4IKH A;  5D9V A;  2QKE A;  3GUS A;  4XRD A;  4ZXG A;  2HE3 A;  3FR6 A;  4OCE A;  1J08 A;  3VI5 A;  3GFK A;  4OD7 A;  4YH2 A;  3F3Q A;  2RM5 A;  2VCT A;  3ERW A;  3NOF A;  4ECC A;  2VLV A;  2MMZ A;  1EEM A;  3M3M A;  4HZ4 A;  5DAL A;  1RK4 A;  5A1N B;  1MDI A;  2WW1 A;  3IA1 A;  1CQH A;  1MTC A;  2YNX A;  1ZYQ B;  3GKM A;  4N30 A;  3R3E A;  2VOC A;  2X8G A;  3CQF A;  1WOU A;  3DVW A;  4MAB A;  1O85 A;  1GLP A;  1XWC A;  4WBR D;  7GSS A;  2H74 A;  1JHB A;  3FZ5 A;  6GSW A;  4YKG A;  1GTU A;  4HJM A;  1A23 A;  5H5R A;  1JZW A;  2PVO C;  2XC2 A;  1XOA A;  2HRK B;  4GQC A;  2P0G A;  4OFT A;  3ZMK A;  2LNT A;  1OC9 A;  4ML6 A;  3VUR A;  2FNO A;  3TKQ A;  1YJ6 A;  1MDJ A;  1YZX A;  4PQ1 A;  3NIV A;  4IEL A;  2OA7 A;  2RUF A;  3ZIJ A;  3FZ9 A;  1FB6 A;  3A5I A;  5KOX A;  5B8B A;  4I97 A;  4O92 A;  1K3L A;  1SVM A;  4KSM A;  3QMX A;  4JR6 A;  2VCZ A;  17GS A;  3HVV A;  1SJZ A;  1YF1 A;  4XTS A;  1T4Z A;  3TB2 A;  2REM A;  2GSR A;  3UIW A;  2PBJ A;  4K5R A;  2WVY A;  1Z7R A;  2WJU A;  3WT1 A;  2XPE A;  4K1F A;  4X0X A;  1Y1U A;  2HSH A;  2DJ2 A;  4GQF A;  2C3Q A;  1IYH A;  3I69 A;  5G5F A;  1TRS A;  2I1U A;  3SBC A;  2IMF A;  2GLR A;  2N5A A;  3QFA C;  3QFB C;  4ECB A;  5F0G A;  4L5O A;  2WGR A;  1E2Y A;  4ZBA A;  4JE1 A;  5GZZ B;  3FMW A;  2B7K A;  14GS A;  5GST A;  3N9J A;  4HEA 2;  4JR4 A;  4IQ1 A;  1E6B A;  1X5E A;  2P31 A;  1SKR B;  2OBK A;  2WB9 A;  5ELA A;  2WVX B;  2H75 A;  3HCZ A;  2JSY A;  4H86 A;  1F9M A;  4V2N A;  6GSS A;  3ME8 A;  5BMU B;  1A2L A;  4P3Y B;  1Z5Y E;  4IJ3 A;  2NBS A;  4AKX B;  3HXS A;  1ML6 A;  4KND A;  2CZ2 A;  1G7O A;  3F63 A;  2KOK A;  1THO A;  3I6A A;  3DYR A;  1SL2 B;  4A5P A;  5FWG A;  4KUN A;  5KEJ A;  3FKF A;  4GTU A;  5F8B A;  1HQO A;  3BOA A;  2V1M A;  5IMV A;  2VAF A;  1EP8 A;  3ZL5 A;  5B6M A;  2VKZ G;  3EYT A;  3Q74 A;  2HSN A;  4ZIL A;  1J9B A;  2YOI A;  3ZIV A;  2C0G A;  2LKU A;  3LQ7 A;  2L5O A;  2DJ3 A;  2MYG A;  4LLR A;  1XW5 A;  3CWG A;  2WZ9 A;  5IMF A;  4D73 B;  1A2J A;  3W8S A;  3VPQ A;  4MF6 A;  1F2E A;  1GNE A;  3RAZ A;  2DJK A;  4F0C A;  3VWV A;  5FHI A;  1M2A A;  4RI7 A;  4KX4 A;  4G0I A;  3CYN A;  1TXX A;  3PPU A;  1Q4J A;  3OR5 A;  4MF7 A;  2EC4 A;  2HSM B;  3O76 A;  3IPZ A;  3IR4 A;  1WRY A;  3UMA A;  3IRA A;  4TW5 A;  2ALB A;  5FT3 A;  5J9B A;  3ZFB A;  1B8X A;  5HFG A;  4PX1 A;  1AQX A;  1ERU A;  4MP4 A;  3TCO A;  4XIH A;  4L5L A;  1O7U A;  1MEK A;  4J2F A;  3FHK A;  3HMJ G;  2YJ7 A;  3DKS A;  4AJ8 A;  3CSJ A;  3Q19 A;  1LU4 A;  2HI7 A;  1RW1 A;  5DQY A;  1IYI A;  3EC3 A;  3IAM 2;  5C00 A;  13GS A;  1OC8 A;  3VWU A;  3C73 A;  5J4V A;  3EVI A;  2EFE A;  5A34 A;  2PER A;  2N5B A;  4MZB A;  4LMW A;  2GGT A;  4WF5 A;  3QAV A;  5ECN B;  2KP1 A;  5KN3 A;  3EPT A;  4IS0 A;  4ACS A;  4V1A p;  3PR8 A;  2HZE B;  2OAD A;  3ZYW A;  2CT6 A;  3VI7 A;  5CNW A;  2FWH A;  4CHS A;  1I9D A;  3D6I A;  4TR1 A;  1SKW B;  1TK8 B;  4IP1 A;  3G7J A;  2GT5 A;  5ENU A;  1M0U A;  1ZYP A;  4WXT A;  4PNF A;  1ST9 A;  5EY6 A;  3Q18 A;  3D4T A;  2YWM A;  1B9X C;  3LYK A;  4K7O A;  2YAN A;  2KP2 A;  3ZFL A;  3L9U A;  4EC0 A;  1RQM A;  3Q6O A;  2GDR A;  3DWV A;  1FVJ A;  3VLN A;  1F3B A;  1EWX A;  3O3T A;  4X43 A;  3LXZ A;  5CRG A;  3QAG A;  2HNL A;  4ILF A;  1UA5 A;  4MF5 A;  4L0W A;  10GS A;  3KTL A;  1OAZ A;  3PIN A;  1XCC A;  3P2A A;  2BMX A;  1WWJ A;  1AUC A;  4KGI A;  3MIX A;  1X9S B;  3FY7 A;  5DCG A;  2YZH A;  4JBB A;  4PUA A;  1T4Y A;  2E7P A;  2DBC A;  3LXT A;  3IC8 A;  1PMT A;  1SJI A;  3KTB A;  4POK A;  3D5J A;  2LS5 A;  3KP8 A;  1B9Y C;  4JU5 A;  4ZIJ A;  1N2A A;  3IHQ A;  1U3A A;  3ZVJ D;  1PL1 A;  4DSS A;  4KE3 A;  4N0V A;  3WD6 A;  2LST A;  2YZU A;  4GSS A;  2N5F A;  3U5R E;  3H79 A;  3V1W A; 
#chains in the Genus database with same CATH homology
 18GS A;  4TKY A;  4V2M A;  1R5A A;  2K9F A;  3IC4 A;  2YV9 A;  2BTO T;  2WUL A;  2V32 A;  3EIN A;  1TU7 A;  3GTU B;  3FR9 A;  3MDK A;  2PN8 A;  3DVX A;  4N0Z A;  3MYD A;  4CDO A;  1PSQ A;  1TJD A;  4G0K A;  5ECS A;  1DE1 A;  3CBU A;  1SYR A;  1ACV A;  1YEP A;  3U6V A;  4EO3 A;  1X5C A;  2VUP A;  3IV4 A;  4EXJ A;  4G10 A;  5D9W A;  3LJR A;  19GS A;  1EOH A;  1KEB A;  1SD8 A;  3ZRE A;  4DSQ A;  2JAC A;  2GVP A;  3M1G A;  4XS4 B;  1YEX A;  1G6Y A;  1M2D A;  2UZ8 A;  1PN0 A;  4J57 E;  1YKA A;  2H73 A;  2EFC A;  5JCU A;  4RUV A;  3EUR A;  3IK9 A;  4K7I A;  4MPF A;  2PVQ A;  4G2E A;  3ERG A;  3GKK A;  5AIX A;  2V2G A;  2DMM A;  4ZB8 A;  4IW9 A;  2VLT A;  4NXI A;  1DE2 A;  4XCS A;  4EL1 A;  5A5K A;  4GCI A;  2GQK A;  2OE1 A;  2AHE A;  6GSU A;  1ILO A;  4G9H A;  5CRE A;  3IK7 A;  2QGV A;  5G1L A;  1XWG A;  4G01 A;  2QSI A;  4KB3 A;  1KNG A;  1XWA A;  4MJA A;  4Q5Q A;  2DKI A;  4PXO A;  1OVN A;  4MA9 A;  3GV1 A;  4EE0 A;  2HRN A;  3LWA A;  3I9V 2;  2JAD A;  6GSX A;  3TOU A;  4KW6 A;  3HYP A;  4V1A g;  2PUK C;  1ZGN A;  4FQU A;  2IMD A;  1HNB A;  3CTG A;  4ZL8 A;  3E9J B;  3RPP A;  3ISO A;  2GT6 A;  1USB A;  4BWQ A;  2P5Q A;  2GSS A;  2FA8 A;  1K3O A;  3QOU A;  1K0A A;  2C8U A;  4N11 A;  2HLS A;  2YWN A;  3JCM L;  5DAK A;  3VFI A;  2HZE A;  2R2J A;  5JCW A;  4WR4 A;  3LYP A;  3ZML A;  3J7Y k;  2R3X A;  3ERF A;  2H76 A;  5CRD A;  1ZCP A;  3SWL A;  4ECJ A;  5IO0 A;  1SK1 A;  2VM2 A;  4I2T A;  3VWX A;  2DC5 A;  3IHG A;  2ES7 A;  2H19 A;  1XWB A;  3BBY A;  2AB6 A;  2AJQ B;  4L8E A;  1V2A A;  2H1A A;  1FHE A;  2R6K A;  3HJP A;  4W66 A;  3VPT A;  1EGO A;  5IPG A;  4F03 A;  3KMN A;  1GTI A;  5KN2 A;  2IME A;  4EKZ A;  3LSZ A;  4N3Z A;  2C80 A;  4G19 A;  2LV3 A;  3CXG A;  1UN2 A;  1VF3 A;  3LW9 A;  4KCA A;  4HOJ A;  1TU8 A;  2CA8 A;  2JZR A;  2LTK A;  2HRA A;  2ZNM A;  1X0R A;  5G30 A;  4OO4 A;  5H5Q A;  2QA2 A;  3WGD A;  5HFI A;  3TDG A;  1J0F A;  1K3Y A;  5JWO B;  1V98 A;  2GQM A;  1GSQ A;  2I81 A;  1GLQ A;  5JCG A;  2CV4 A;  3TGZ A;  1GSF A;  3CSH A;  4NV2 A;  1U88 A;  4KDX A;  1EGR A;  2MMA A;  5LNK e;  3QD9 A;  4MJC A;  1GTB A;  1W89 A;  1Z6M A;  3KCM A;  2IMK A;  2JZS A;  4OFN A;  2DKH A;  12GS A;  1EV4 A;  1Y25 A;  4LMV A;  2FA4 A;  3R2Q A;  4QQ7 A;  3PH9 A;  2C0E A;  2HZF A;  2BJX A;  1EP7 A;  1JLW A;  3FR3 A;  2C0D A;  4RI6 A;  4BL7 A;  1URM A;  3GKN A;  4F82 A;  4WET A;  3UOM A;  3N5O A;  2RLI A;  2VCQ A;  3CRT A;  1PX7 A;  1Z9H A;  6GSV A;  1OYJ A;  3M9K A;  1YQ1 A;  1K0O A;  3FRC A;  2IFQ A;  2HRF A;  5EL8 A;  1K0C A;  3BD2 A;  5J3R A;  2HSY A;  4BVX B;  4QL9 A;  2CAI A;  1SVL A;  3TKP A;  2L57 A;  5J4Y A;  5B8A A;  1WE0 A;  4TXO A;  3GH9 A;  2XBI A;  1O8W A;  1SD9 A;  2O5V A;  1G7E A;  1T00 A;  2EIO A;  1XVW A;  2X8H A;  1O81 A;  4NHZ A;  5ECO B;  4HS1 A;  5IMD A;  5F07 A;  5A4W A;  2B1K A;  4TR3 A;  1FO5 A;  3GA4 A;  4I5Q A;  2HFD A;  5J40 A;  2VO4 A;  3M8N A;  3EU3 A;  4MJB A;  4QMK A;  3UL3 A;  8GSS A;  2HQT A;  1GWC A;  5CP1 A;  5A5H B;  4PQI A;  3EMX A;  2L4Q A;  1FG4 A;  1A8Y A;  2MMO A;  4FH8 A;  5CO3 A;  5IMZ A;  4GLT A;  1SL1 B;  1GL8 A;  1M9B A;  3VWW A;  1PL2 A;  3F4S A;  1Z7P A;  4FYU A;  1AW9 A;  2DIZ A;  3APO A;  5CRW A;  1QMV A;  4BVY A;  5AN1 A;  1SK0 A;  1V9W A;  2D2Z A;  4OO5 A;  1XXU A;  3US3 A;  3WYW A;  3EMP A;  4WR5 A;  1T3B A;  1ZOF A;  2EFH A;  1BG1 A;  4AJ7 A;  2H1L A;  4K2X A;  1ZL9 A;  4O5R A;  5HR1 A;  2JSZ A;  3GNJ A;  1A8L A;  1PX6 A;  4YKF A;  2LRT A;  2F8A A;  4WBJ A;  1JLV A;  4MCU A;  4NAX A;  2IL3 A;  4MLY A;  3RDW A;  2O8V B;  5GAP D;  1PGT A;  4JZQ A;  2FWE A;  4IHU A;  4HZ2 A;  2I9H A;  3TKS C;  4BA7 A;  1EOG A;  2A4H A;  3HVS A;  4FYB A;  5ECR B;  4PNG A;  2PMT A;  2AAW A;  3C7M A;  4FYC A;  2O87 A;  3EWL A;  2R4V A;  3F6D A;  1PA3 A;  4ZL7 A;  1OE7 A;  1VF2 A;  4EUY A;  5A1N A;  3D22 A;  4G0L A;  4AJ6 A;  1W4V A;  5KN1 A;  4TOP A;  1XZO A;  2FHE A;  3FK8 A;  3TJF A;  2H1G A;  5EPF A;  5DAL B;  5DDL A;  1GP1 A;  5B7C A;  1NM3 A;  3LOR A;  4OWY A;  3BCK A;  3I43 A;  4ICY A;  2I4A A;  5IO2 A;  1TP9 A;  5B6N A;  2A2S A;  2F3M A;  1XOB A;  3E0U A;  3DRN A;  4YQV A;  4TXV A;  2HRK A;  2YWO A;  4ZB9 A;  1B48 A;  1VGL A;  4KCE A;  2CQ9 A;  1T7P B;  3FW2 A;  5GAN D;  1GSS A;  4KDU A;  1WIK A;  3G9B A;  4F9Z A;  2L6C A;  2G0F A;  4Q5R A;  3L9S A;  2PU9 C;  1TKD B;  1MD4 A;  2H8L A;  1TW9 A;  1OC9 B;  2EIQ A;  5HFK A;  2AV4 A;  1GUM A;  2H1B A;  1XIY A;  1EEJ A;  3A2V A;  2FY6 A;  4F2I A;  3J7Y b;  2HYX A;  4MPG A;  3UVH A;  2JZT A;  4TN8 A;  5J5N A;  5A4V A;  1TI3 A;  1YY7 A;  2V6K A;  3TKS A;  4WKW A;  5D9T A;  2B6M A;  5D93 A;  1O8X A;  2KLX A;  4KH7 A;  3QAW A;  3ZTL A;  3HDC A;  4XRA A;  1AQW A;  1TK5 B;  1TRV A;  2C3N A;  2IJY A;  1XPV A;  5ECQ B;  3GHA A;  2DLX A;  3LFL A;  4PUR A;  3KH9 A;  4TVE A;  3L0H A;  4MK3 A;  2CVB A;  1SU9 A;  3ED3 A;  3TU3 B;  4KA0 A;  1TXU A;  1K0D A;  2F9S A;  1CQG A;  1V40 A;  1N25 A;  2K6V A;  3QCP A;  3KD0 A;  2XHF A;  3HZ8 A;  3A2X A;  1WPI A;  2VCX A;  2IN3 A;  3NZN A;  2TRX A;  3VK9 A;  3WT2 A;  5BMU A;  1O73 A;  1SL0 B;  4XS1 A;  4OCF A;  4WF4 A;  1V58 A;  3IBH A;  1ABA A;  4JRR A;  3O6T A;  2O85 A;  1VRS D;  2YCD A;  4BWS A;  2ON7 A;  4MH2 A;  3MAK A;  4POM A;  4K6X A;  2OE3 A;  1BX9 A;  2R0C A;  3K8N A;  3KJY A;  4LL4 B;  3WGE A;  5D9X A;  3KZQ A;  3QDN A;  2H70 A;  1ERV A;  3EU4 A;  1ERW A;  4ZBB A;  1H4O A;  3ZRD A;  4EF0 A;  4CW9 A;  5J47 A;  3WGX A;  4PTS A;  2GZP A;  5ABR A;  5D8I A;  1HNC A;  4K9Z A;  3UVT A;  1BYE A;  3GX0 A;  1JZD A;  1GUH A;  4QL7 A;  2VL2 A;  3LEF A;  1S3C A;  4D73 A;  1T1V A;  1TOF A;  2FLS A;  3C71 A;  5A4U A;  2HSN B;  1R5P A;  4JED A;  1MDK A;  3KEB A;  1Q98 A;  4Z7X A;  5AIS A;  4MH3 A;  2JL4 A;  2NDO A;  6GST A;  1QXH A;  2B5X A;  3TJB A;  5ID2 B;  5E59 A;  2VCW A;  2HSM A;  2NVL A;  3GST A;  3P90 A;  5HR2 A;  4O5Q A;  3A5W A;  3H8Q A;  5G2Z A;  5DCH A;  1S3A A;  1NW2 A;  1AXD A;  2CZ3 A;  4PUF C;  2X99 A;  4KAE A;  4ZL9 A;  2DML A;  5IM9 A;  3F4R A;  2H6Y A;  3CSI A;  1BJX A;  4OFM A;  5LD0 A;  2WCI A;  5BRT A;  3UBL A;  1DSB A;  3DEX A;  3GH6 A;  2DIY A;  3TJJ A;  5HR3 A;  2YPM A;  4F0B A;  2AUV A;  4Z2U A;  3F6F A;  1ZMA A;  3GX8 A;  2IIY A;  2HT9 A;  3RHC A;  2B5E A;  1QUW A;  1EZK A;  3HJO A;  2P5R A;  4KF9 A;  2RUE A;  4N10 A;  4I6X A;  5ECK B;  2UV8 G;  1KTE A;  4E8E A;  4NWY A;  3KXO A;  2YWI A;  4HUA A;  4MMM A;  1B4Q A;  3RBT A;  5A34 B;  5IOX A;  1HYU A;  1Z3E A;  1OKT A;  5ECP B;  4E68 A;  3ZVJ A;  3APQ A;  2F8F A;  3GL5 A;  3F9U A;  3BJ5 A;  3TKR A;  3H1N A;  1QFN A;  1X9M B;  1JZR A;  5CRH A;  4HQZ A;  2RII A;  3GL3 A;  1DBY A;  1M9A A;  4GST A;  1FOV A;  1O6J A;  4EDY A;  2C1Y A;  4USS A;  2VM1 A;  2IMI A;  3KGK A;  4TR1 B;  1UC7 A;  2H0H A;  1ERT A;  1GNW A;  1JFU A;  1SVO A;  3FYG A;  2F51 A;  2PGT A;  5LCZ A;  1HD2 A;  1K0N A;  1I5G A;  2B1L A;  4KDY A;  3HY2 A;  4CY6 A;  2L4C A;  3IXR A;  1X9W B;  1F6M C;  1YKC A;  5DQS A;  5ECM B;  1PRX A;  4V2L A;  2I3Y A;  2VL3 A;  4DSR A;  3ZLP A;  4AKG A;  3F3R A;  2M72 A;  1U87 A;  4MDC A;  2YP6 A;  2MMN A;  3HZ4 A;  9GSS A;  1R7H A;  4O32 A;  4Q5F A;  3ZIT A;  4K7N A;  4XHM A;  2B5Y A;  1N8J A;  1T8E B;  3GRX A;  1WJK A;  2LNS A;  2ON5 A;  3IOS A;  5IPH A;  2KHP A;  5DJM A;  4ULX A;  1U6T A;  4YAV A;  2FUG 2;  5IOW A;  5E4W A;  1ZYN A;  2J23 A;  1MD3 A;  2H72 A;  3C8E A;  1FAA A;  4O7H A;  4POL A;  3GMF A;  4ML1 A;  3L78 A;  3MSZ A;  2V41 A;  4DEJ A;  2AYT A;  1HNA A;  2CX3 A;  2O7K A;  5ECL B;  1PQN A;  2ZUP A;  4YQM A;  1QK8 A;  3G7I A;  4DSS B;  3HHV A;  1SJ6 A;  2KUC A;  2WRT A;  5GSS A;  5KOW A;  2A2P A;  2OT3 A;  4NHW A;  1F37 A;  2H01 A;  4Z2R A;  4EDZ A;  1R4W A;  2MBS A;  4OMV A;  3L9V A;  4ID0 A;  1ZYE A;  5ECH B;  5G5E A;  3GTU A;  4O5U A;  3EE2 A;  1V57 A;  4IGJ A;  3DGQ A;  2VCV A;  3UAR A;  3FEU A;  2VIM A;  3CTF A;  3UJ1 A;  2NPB A;  2TRC P;  2CX4 A;  5J9C A;  2X64 A;  4E8H A;  4FIW A;  4TR0 A;  2ZCT A;  5INY A;  1TK0 B;  1GUK A;  2GSQ A;  2X49 A;  1QQ2 A;  2GST A;  4ZBD A;  4IVF A;  2FGX A;  3RHB A;  2QA1 A;  3H93 A;  3IE3 A;  5J41 A;  3S9F A;  1NHO A;  4NPB A;  4HI7 A;  3MNG A;  4TR4 A;  4XS4 A;  2OJL A;  2R37 A;  2M80 A;  1XW9 A;  2WDU A;  3G7Y A;  1XW6 A;  5HR0 A;  3GIX A;  1TRU A;  4AF2 A;  4K0G A;  2YJH A;  3DD3 A;  2H71 A;  1NSW A;  2VD0 A;  2C0F A;  3C1S A;  16GS A;  3LG6 A;  3M0F A;  2C4J A;  5ID2 A;  2B7J A;  3TJK A;  4YQU A;  2B3S A;  5DJL A;  4J56 E;  3GKX A;  2G2Q A;  4AI6 A;  4EIQ A;  2R5G A;  3TRQ A;  1GSD A;  2FWG A;  1FOH A;  1C72 A;  1XFL A;  22GS A;  3D21 A;  4K0N A;  4MNN A;  1SKS B;  4GSN A;  4DVC A;  1BF5 A;  4X1U A;  3ZZX A;  4PGT A;  1F3A A;  3UBK A;  3MWH A;  2VL9 A;  4GDF A;  4Z2T A;  1YDK A;  3APS A;  3KH7 A;  3GSS A;  2OE0 A;  4HU7 A;  4NV5 A;  2L6D A;  1BED A;  2H0G A;  1ZZY A;  3ME7 A;  5CYY A;  3TRX A;  1M99 A;  1TTZ A;  1X5D A;  3KM6 A;  4ZB7 A;  5J4U A;  5L71 A;  2C3T A;  3AY8 A;  5IQY A;  2RM6 A;  1KBN A;  2NTO A;  4IBP A;  2V6O A;  3TRP A;  20GS A;  1WMJ A;  3M9J A;  2XBQ A;  2IPA A;  4ISD A;  3W8J A;  2E2G A;  2WFC A;  2OAC A;  4ZB6 A;  3TJG A;  2OBI A;  5C04 A;  5DAK B;  2X4A A;  2QC7 A;  5AIV A;  4IQA A;  5G31 A;  11GS A;  1A24 A;  4IJI A;  2L5L A;  2PPT A;  1QGV A;  1GTA A;  2H6Z A;  3GYK A;  3TKS E;  5HQP A;  2LJR A;  2GQL A;  1SK2 A;  3A2W A;  2O89 A;  5KN0 A;  4YAP A;  1AAZ A;  2HXK A;  3HA9 A;  1YVL A;  3GUR A;  1AQV A;  2A2R A;  4HQS A;  4MZW A;  4L0U A;  2K8S A;  2YV7 A;  3BCI A;  4LA1 A;  2H1D A;  2GZY A;  2YN1 A;  2EIR A;  2GZZ A;  3DIE A;  3CRU A;  2FD3 A;  4KSO A;  2TIR A;  4GXZ A;  1GUL A;  1M7T A;  3A3T A;  3UEM A;  1JZO A;  2VL2 C;  3W6G A;  4EVM A;  3TOT A;  1TI1 A;  1LBK A;  4AKI A;  2K18 A;  2WS2 A;  3QR6 A;  1NHY A;  3P7X A;  3DXB A;  2LRN A;  2LJA A;  5DBQ A;  3IDV A;  2XPD A;  2E0Q A;  2LQO A;  4K8M A;  1VF4 A;  1TDI A;  1PN9 A;  2VLU A;  1R26 A;  1B4P A;  4AGS A;  3UAP A;  1ON4 A;  4EIP A;  5ECI B;  1BAY A;  1PD2 1;  1Y6E A;  5IMA A;  1BG5 A;  3FZA A;  2MBT A;  2K8V A;  3PGT A;  2M46 A;  3HJM A;  4BL7 B;  4CY8 A;  1A0R P;  1XWK A;  4PQH A;  2E2M A;  2LUS A;  4X4J A;  1AIU A;  1XBS A;  4K2D A;  2DJJ A;  3GN3 A;  1G6W A;  4XS6 A;  2OKA A;  4BVX A;  5IIZ A;  4GWR A;  4NMU A;  1BQ7 A;  4BPY A;  1FW1 A;  3HKR A;  5CAX A;  1OC3 A;  2LEG A;  4HDE A;  5AGY A;  2J9H A;  1VF1 A;  2H66 A;  2IFQ B;  4I8B A;  4GRF A;  2FCH A;  1GSY A;  2GS3 A;  5IMC A;  2DJ0 A;  5DVB A;  3C1R A;  4HJ2 A;  1GRX A;  2EFD A;  2A4V A;  2CAQ A;  1UVZ A;  2LRC A;  5EVO A;  2LQQ A;  1DUG A;  4WEY A;  4TXO B;  1FB0 A;  3HVX A;  2R0G A;  1G0T A;  6GSY A;  3LGC A;  1A0F A;  5D73 A;  2R0P A;  5JWQ B;  3F0I A;  5A5H A;  3HD5 A;  4RQX A;  1SEN A;  1AC1 A;  5H5S A;  3F8U A;  2MZC A;  2JU5 A;  3KMO A;  5G1K A;  2Z9S A;  2CVK A;  4IN0 A;  3DML A;  1GSU A;  2FWF A;  2LJK A;  1TRW A;  3FZ4 A;  4MJE A;  1THX A;  4FO5 A;  3P8W A;  4GF0 A;  3KIJ A;  2DSA A;  4I2U A;  3L4N A;  1SYX A;  5F05 A;  3QPM A;  3E3E A;  1OE8 A;  1XVQ A;  1PKW A;  4AKH A;  4Q5N A;  1M2B A;  3D0Z A;  3IAS 2;  5F06 A;  2H6X A;  3RPN A;  4BVY B;  4MZC A;  5ELG A;  2IWT A;  4ECI A;  2GTU A;  2VD1 A;  1U3I A;  3TUE A;  1LJR A;  3H4K A;  4K5S A;  1OKD A;  4IP6 A;  3D4M A;  4LL1 B;  3F4T A;  2PWJ A;  1YF0 A;  1K0M A;  1FVK A;  1GH2 A;  2CVD A;  3CMI A;  2L59 A;  4HU9 A;  1S3D A;  1A2M A;  4TRX A;  3KP9 A;  1EV9 A;  1WP0 A;  1GSE A;  2DJ1 A;  1PKZ A;  4POB A;  2X8C A;  4RQR A;  5COH A;  5D96 A;  1Z6N A;  1H75 A;  2H0I A;  1K0B A;  5JWR B;  2H30 A;  4IKH A;  5D9V A;  2QKE A;  3GUS A;  4XRD A;  4ZXG A;  2HE3 A;  3FR6 A;  4OCE A;  1J08 A;  3VI5 A;  3GFK A;  4OD7 A;  4YH2 A;  3F3Q A;  2RM5 A;  2VCT A;  3ERW A;  3NOF A;  4ECC A;  2VLV A;  2MMZ A;  1EEM A;  3M3M A;  4HZ4 A;  5DAL A;  1RK4 A;  5A1N B;  1MDI A;  3IA1 A;  1CQH A;  1MTC A;  2YNX A;  1ZYQ B;  3GKM A;  4N30 A;  3R3E A;  2VOC A;  2X8G A;  1WOU A;  3DVW A;  4MAB A;  1O85 A;  1GLP A;  1XWC A;  4WBR D;  7GSS A;  2H74 A;  1JHB A;  3FZ5 A;  6GSW A;  4YKG A;  1GTU A;  4HJM A;  1A23 A;  5H5R A;  1JZW A;  2PVO C;  2XC2 A;  1XOA A;  2HRK B;  4GQC A;  2P0G A;  4OFT A;  3ZMK A;  2LNT A;  1OC9 A;  4ML6 A;  3VUR A;  2FNO A;  3TKQ A;  1YJ6 A;  1MDJ A;  1YZX A;  4PQ1 A;  3NIV A;  4IEL A;  2OA7 A;  2RUF A;  3ZIJ A;  3FZ9 A;  1FB6 A;  3A5I A;  5KOX A;  5B8B A;  4I97 A;  4O92 A;  1K3L A;  1SVM A;  4KSM A;  3QMX A;  4JR6 A;  2VCZ A;  17GS A;  3HVV A;  1SJZ A;  1YF1 A;  4XTS A;  1T4Z A;  3TB2 A;  2REM A;  2GSR A;  3UIW A;  2PBJ A;  4K5R A;  1Z7R A;  2WJU A;  3WT1 A;  2XPE A;  4K1F A;  4X0X A;  1Y1U A;  2HSH A;  2DJ2 A;  4GQF A;  2C3Q A;  1IYH A;  3I69 A;  5G5F A;  1TRS A;  2I1U A;  3SBC A;  2IMF A;  2GLR A;  2N5A A;  3QFA C;  3QFB C;  4ECB A;  5F0G A;  4L5O A;  2WGR A;  1E2Y A;  4ZBA A;  4JE1 A;  5GZZ B;  3FMW A;  2B7K A;  14GS A;  5GST A;  3N9J A;  4HEA 2;  4JR4 A;  4IQ1 A;  1E6B A;  1X5E A;  2P31 A;  1SKR B;  2OBK A;  2WB9 A;  5ELA A;  2H75 A;  3HCZ A;  2JSY A;  4H86 A;  1F9M A;  4V2N A;  6GSS A;  3ME8 A;  5BMU B;  1A2L A;  4P3Y B;  1Z5Y E;  4IJ3 A;  2NBS A;  4AKX B;  3HXS A;  1ML6 A;  4KND A;  2CZ2 A;  1G7O A;  3F63 A;  2KOK A;  1THO A;  3I6A A;  3DYR A;  1SL2 B;  4A5P A;  5FWG A;  4KUN A;  5KEJ A;  3FKF A;  4GTU A;  5F8B A;  1HQO A;  3BOA A;  2V1M A;  5IMV A;  2VAF A;  1EP8 A;  3ZL5 A;  5B6M A;  2VKZ G;  3EYT A;  3Q74 A;  2HSN A;  4ZIL A;  1J9B A;  2YOI A;  3ZIV A;  2C0G A;  2LKU A;  3LQ7 A;  2L5O A;  2DJ3 A;  2MYG A;  4LLR A;  1XW5 A;  3CWG A;  2WZ9 A;  5IMF A;  4D73 B;  1A2J A;  3W8S A;  3VPQ A;  4MF6 A;  1F2E A;  1GNE A;  3RAZ A;  2DJK A;  4F0C A;  3VWV A;  5FHI A;  1M2A A;  4RI7 A;  4KX4 A;  4G0I A;  3CYN A;  1TXX A;  3PPU A;  1Q4J A;  3OR5 A;  4MF7 A;  2EC4 A;  2HSM B;  3O76 A;  3IPZ A;  3IR4 A;  1WRY A;  3UMA A;  3IRA A;  4TW5 A;  2ALB A;  5FT3 A;  5J9B A;  3ZFB A;  1B8X A;  5HFG A;  4PX1 A;  1AQX A;  1ERU A;  4MP4 A;  3TCO A;  4XIH A;  4L5L A;  1O7U A;  1MEK A;  4J2F A;  3FHK A;  3HMJ G;  2YJ7 A;  3DKS A;  4AJ8 A;  3CSJ A;  3Q19 A;  1LU4 A;  2HI7 A;  1RW1 A;  5DQY A;  1IYI A;  3EC3 A;  3IAM 2;  5C00 A;  13GS A;  1OC8 A;  3VWU A;  3C73 A;  5J4V A;  3EVI A;  2EFE A;  5A34 A;  2PER A;  2N5B A;  4MZB A;  4LMW A;  2GGT A;  4WF5 A;  3QAV A;  5ECN B;  2KP1 A;  5KN3 A;  3EPT A;  4IS0 A;  4ACS A;  4V1A p;  3PR8 A;  2HZE B;  2OAD A;  3ZYW A;  2CT6 A;  3VI7 A;  5CNW A;  2FWH A;  4CHS A;  1I9D A;  3D6I A;  4TR1 A;  1SKW B;  1TK8 B;  4IP1 A;  3G7J A;  2GT5 A;  5ENU A;  1M0U A;  1ZYP A;  4WXT A;  4PNF A;  1ST9 A;  5EY6 A;  3Q18 A;  3D4T A;  2YWM A;  1B9X C;  3LYK A;  4K7O A;  2YAN A;  2KP2 A;  3ZFL A;  3L9U A;  4EC0 A;  1RQM A;  3Q6O A;  2GDR A;  3DWV A;  1FVJ A;  3VLN A;  1F3B A;  1EWX A;  3O3T A;  4X43 A;  3LXZ A;  5CRG A;  3QAG A;  2HNL A;  4ILF A;  1UA5 A;  4MF5 A;  4L0W A;  10GS A;  3KTL A;  1OAZ A;  3PIN A;  1XCC A;  3P2A A;  2BMX A;  1WWJ A;  1AUC A;  4KGI A;  3MIX A;  1X9S B;  3FY7 A;  5DCG A;  2YZH A;  4JBB A;  4PUA A;  1T4Y A;  2E7P A;  2DBC A;  3LXT A;  3IC8 A;  1PMT A;  1SJI A;  3KTB A;  4POK A;  3D5J A;  2LS5 A;  3KP8 A;  1B9Y C;  4JU5 A;  4ZIJ A;  1N2A A;  3IHQ A;  1U3A A;  3ZVJ D;  1PL1 A;  4DSS A;  4KE3 A;  4N0V A;  3WD6 A;  2LST A;  2YZU A;  4GSS A;  2N5F A;  3U5R E;  3H79 A;  3V1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...