4IQBA

High resolution crystal structure of c.elegans thymidylate synthase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
288
structure length
288
Chain Sequence
QVHLNQDEYKYLKQVEQILREGTRRDDRTGTGTISIFGMQSKYCLRNGTIPLLTTKRVYWKGVLEELLWFISGSTDGKLLMEKNVKIWEKNGDRAFLDNLGFTSREEGDLGPVYGFQWRHFGAKYVDCHTDYSGQGVDQLAEVIRQIKEQPDSRRIIMSAWNPSDLGQMVLPPCHTMCQFYVDNGELSCQLYQRSGDMGLGVPFNLASYGLLTHMIAKVCGLKPGTLVHTLGDAHVYSNHVDALKIQLDREPYAFPKIRFTRDVASIDDFTSDMIALDDYKCHPKIPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of nematode (parasitic T. spiralis and free living C. elegans), compared to mammalian, thymidylate synthases (TS). Molecular docking and molecular dynamics simulations in search for nematode-specific inhibitors of TS.
pubmed doi rcsb
molecule keywords Thymidylate synthase
molecule tags Transferase
source organism Caenorhabditis elegans
total genus 96
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2013-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4iqbA00
1JMHA 1NJDA 4G6WX 4IRRA 4GYHA 1EVGA 1TSWA 3H9KA 2H2QA 1TDUA 4DPHA 1B49A 1NJAA 3IX6A 4EINA 1FFLA 1LCEA 1JUTA 4XSEA 5BY6A 2ONBA 3CLBA 3EDWX 3BFIA 4IQQA 1NCEA 2TDMA 4KYAA 1I00A 3IHIA 1HW4A 1TSDA 1NJEA 3GH0A 4E28A 3DG8C 2TSCA 4KNZA 1F4EA 1B02A 4ISWA 4DPDA 1HW3A 3EBUA 2G8AA 1HVYA 3HJ3A 1LCAA 1FWMA 5H38A 1TYSA 3EHIX 3HB8A 3KJSA 3KJRA 3N5EB 1BQ2A 4KPWA 1BSPA 3CL9A 5HS3A 1F4BA 2VETA 1LCBA 4ISKA 4F2VA 3UWLB 3TMSA 2FTOX 2OIPA 5WRNA 1VZEA 2G89A 3B5BA 3EGYX 3I3RA 4H0UA 1TLSA 3BNZA 3UM8A 1AJMA 3DL6A 1TJSA 1SYNA 4XSCA 1ZPRA 1THYA 1TVWA 3IJZA 3K2HA 4LRRA 3C0AA 3BZ0A 1DNAA 1JTQA 2TDDA 1KCEA 3B9HA 3IRNA 1BSFA 1BJGA 1B5EA 3IK1A 4H0RA 1F4FA 4Q0EA 1EVFA 3EJLA 2RD8A 4ECKA 4XSDA 3HBBA 4O7UA 1TSLA 1VZDA 4IQBA 1AOBA 1SEJA 1YPVA 3INVA 4FQSA 1TSXA 1TDCA 1NJCA 4H1IA 1KZIA 3UM5A 3ED7A 5H3AA 3KGBA 4O1XA 1TISA 1BPJA 2RD8B 2VF0A 1DDUA 4EB4A 1TRGA 3EF9A 4DQ1A 3JSUA 1JMGA 4FOGA 4UP1A 4JEFA 1EV8A 1BIDA 3C06A 4O1XD 1RTSA 3UM6A 3DGAC 1AN5A 3OB7A 3IRMA 1JG0A 3DL5A 1TVUA 4FOAA 2G86A 4FGTA 1AIQA 1TSMA 1HZWA 2BBQA 1QZFA 3IK0A 1J3KC 1QQQA 4EZ8A 4GD7A 1EV5A 2AAZA 3BYXA 2TSRA 3BHLA 3QJ7A 1TSVA 4KY8A 1VZBA 4DP3A 1AXWA 1VZAA 3N5GA 1J3IC 5FCTA 1BO7A 1B5DA 1VZCA 2G8XA 2KCEA 3GG5A 1F28A 1TSYA 5H39A 1BDUA 1TLCA 3BHRA 1F4DA 1BKPA 3IROA 1JU6A 1TDBA 3QG2A 4GEVA 4PSGA 1JMIA 3QGTA 1F4CA 1JTUA 4E5OA 4G2OX 4Q0DA 1BQ1A 3N5EA 1JUJA 1BP6A 1NJBA 1TSZA 1BO8A 3EAWX 5J7WA 1TDAA 3BGXA 3NRRA 4FOXA 1JMFA 3GH2X 1BP0A 1BKOA 2FTNA 4KY4A 4EILA 2FTQA 1TSNA 2A9WA 3UWLA 1TVVA 1CI7A 2RDAA 4TMSA 1KZJA 1F4GA 1J3JC 2G8DA 3V8HA 4O1UA
chains in the Genus database with same CATH superfamily
1JMHA 1NJDA 4G6WX 4IRRA 4GYHA 1EVGA 1TSWA 3H9KA 2H2QA 1TDUA 4DPHA 1B49A 1NJAA 3IX6A 4EINA 1FFLA 1LCEA 1JUTA 4XSEA 5BY6A 2ONBA 3CLBA 3EDWX 3BFIA 4IQQA 1NCEA 2TDMA 4KYAA 1I00A 3IHIA 1HW4A 1TSDA 1NJEA 3GH0A 4E28A 3DG8C 2TSCA 4KNZA 1F4EA 1B02A 4ISWA 4DPDA 1HW3A 3EBUA 2G8AA 1HVYA 3HJ3A 1LCAA 1FWMA 5H38A 1TYSA 3EHIX 3HB8A 3KJSA 3KJRA 3N5EB 1BQ2A 4KPWA 1BSPA 3CL9A 5HS3A 1F4BA 2VETA 1LCBA 4ISKA 4F2VA 3UWLB 3TMSA 2FTOX 2OIPA 5WRNA 1VZEA 2G89A 3B5BA 3EGYX 3I3RA 4H0UA 1TLSA 3BNZA 3UM8A 1AJMA 3DL6A 1TJSA 1SYNA 4XSCA 1ZPRA 1THYA 1TVWA 3IJZA 3K2HA 4LRRA 3C0AA 3BZ0A 1DNAA 1JTQA 2TDDA 1KCEA 3B9HA 3IRNA 1BSFA 1BJGA 1B5EA 3IK1A 4H0RA 1F4FA 4Q0EA 1EVFA 3EJLA 2RD8A 4ECKA 4XSDA 3HBBA 4O7UA 1TSLA 1VZDA 4IQBA 1AOBA 1SEJA 1YPVA 3INVA 4FQSA 1TSXA 1TDCA 1NJCA 4H1IA 1KZIA 3UM5A 3ED7A 5H3AA 3KGBA 4O1XA 1TISA 1BPJA 2RD8B 2VF0A 1DDUA 4EB4A 1TRGA 3EF9A 4DQ1A 3JSUA 1JMGA 4FOGA 4UP1A 4JEFA 1EV8A 1BIDA 3C06A 4O1XD 1RTSA 3UM6A 3DGAC 1AN5A 3OB7A 3IRMA 1JG0A 3DL5A 1TVUA 4FOAA 2G86A 4FGTA 1AIQA 1TSMA 1HZWA 2BBQA 1QZFA 3IK0A 1J3KC 1QQQA 4EZ8A 4GD7A 1EV5A 2AAZA 3BYXA 2TSRA 3BHLA 3QJ7A 1TSVA 4KY8A 1VZBA 4DP3A 1AXWA 1VZAA 3N5GA 1J3IC 5FCTA 1BO7A 1B5DA 1VZCA 2G8XA 2KCEA 3GG5A 1F28A 1TSYA 5H39A 1BDUA 1TLCA 3BHRA 1F4DA 1BKPA 3IROA 1JU6A 1TDBA 3QG2A 4GEVA 4PSGA 1JMIA 3QGTA 1F4CA 1JTUA 4E5OA 4G2OX 4Q0DA 1BQ1A 3N5EA 1JUJA 1BP6A 1NJBA 1TSZA 1BO8A 3EAWX 5J7WA 1TDAA 3BGXA 3NRRA 4FOXA 1JMFA 3GH2X 1BP0A 1BKOA 2FTNA 4KY4A 4EILA 2FTQA 1TSNA 2A9WA 3UWLA 1TVVA 1CI7A 2RDAA 4TMSA 1KZJA 1F4GA 1J3JC 2G8DA 3V8HA 4O1UA
chains in the Genus database with same CATH topology
1JMHA 1NJDA 4G6WX 4IRRA 4GYHA 1EVGA 1TSWA 3H9KA 2H2QA 1TDUA 4DPHA 1B49A 1NJAA 3IX6A 4EINA 1FFLA 1LCEA 1JUTA 4XSEA 5BY6A 2ONBA 3CLBA 3EDWX 3BFIA 4IQQA 1NCEA 2TDMA 4KYAA 1I00A 3IHIA 1HW4A 1TSDA 1NJEA 3GH0A 4E28A 3DG8C 2TSCA 4KNZA 1F4EA 1B02A 4ISWA 4DPDA 1HW3A 3EBUA 2G8AA 1HVYA 3HJ3A 1LCAA 1FWMA 5H38A 1TYSA 3EHIX 3HB8A 3KJSA 3KJRA 3N5EB 1BQ2A 4KPWA 1BSPA 3CL9A 5HS3A 1F4BA 2VETA 1LCBA 4ISKA 4F2VA 3UWLB 3TMSA 2FTOX 2OIPA 5WRNA 1VZEA 2G89A 3B5BA 3EGYX 3I3RA 4H0UA 1TLSA 3BNZA 3UM8A 1AJMA 3DL6A 1TJSA 1SYNA 4XSCA 1ZPRA 1THYA 1TVWA 3IJZA 3K2HA 4LRRA 3C0AA 3BZ0A 1DNAA 1JTQA 2TDDA 1KCEA 3B9HA 3IRNA 1BSFA 1BJGA 1B5EA 3IK1A 4H0RA 1F4FA 4Q0EA 1EVFA 3EJLA 2RD8A 4ECKA 4XSDA 3HBBA 4O7UA 1TSLA 1VZDA 4IQBA 1AOBA 1SEJA 1YPVA 3INVA 4FQSA 1TSXA 1TDCA 1NJCA 4H1IA 1KZIA 3UM5A 3ED7A 5H3AA 3KGBA 4O1XA 1TISA 1BPJA 2RD8B 2VF0A 1DDUA 4EB4A 1TRGA 3EF9A 4DQ1A 3JSUA 1JMGA 4FOGA 4UP1A 4JEFA 1EV8A 1BIDA 3C06A 4O1XD 1RTSA 3UM6A 3DGAC 1AN5A 3OB7A 3IRMA 1JG0A 3DL5A 1TVUA 4FOAA 2G86A 4FGTA 1AIQA 1TSMA 1HZWA 2BBQA 1QZFA 3IK0A 1J3KC 1QQQA 4EZ8A 4GD7A 1EV5A 2AAZA 3BYXA 2TSRA 3BHLA 3QJ7A 1TSVA 4KY8A 1VZBA 4DP3A 1AXWA 1VZAA 3N5GA 1J3IC 5FCTA 1BO7A 1B5DA 1VZCA 2G8XA 2KCEA 3GG5A 1F28A 1TSYA 5H39A 1BDUA 1TLCA 3BHRA 1F4DA 1BKPA 3IROA 1JU6A 1TDBA 3QG2A 4GEVA 4PSGA 1JMIA 3QGTA 1F4CA 1JTUA 4E5OA 4G2OX 4Q0DA 1BQ1A 3N5EA 1JUJA 1BP6A 1NJBA 1TSZA 1BO8A 3EAWX 5J7WA 1TDAA 3BGXA 3NRRA 4FOXA 1JMFA 3GH2X 1BP0A 1BKOA 2FTNA 4KY4A 4EILA 2FTQA 1TSNA 2A9WA 3UWLA 1TVVA 1CI7A 2RDAA 4TMSA 1KZJA 1F4GA 1J3JC 2G8DA 3V8HA 4O1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMH A;  1NJD A;  4G6W X;  4IRR A;  4GYH A;  1EVG A;  1TSW A;  3H9K A;  2H2Q A;  1TDU A;  4DPH A;  1B49 A;  1NJA A;  3IX6 A;  4EIN A;  1FFL A;  1LCE A;  1JUT A;  4XSE A;  5BY6 A;  2ONB A;  3CLB A;  3EDW X;  3BFI A;  4IQQ A;  1NCE A;  2TDM A;  4KYA A;  1I00 A;  3IHI A;  1HW4 A;  1TSD A;  1NJE A;  3GH0 A;  4E28 A;  3DG8 C;  2TSC A;  4KNZ A;  1F4E A;  1B02 A;  4ISW A;  4DPD A;  1HW3 A;  3EBU A;  2G8A A;  1HVY A;  3HJ3 A;  1LCA A;  1FWM A;  5H38 A;  1TYS A;  3EHI X;  3HB8 A;  3KJS A;  3KJR A;  3N5E B;  1BQ2 A;  4KPW A;  1BSP A;  3CL9 A;  5HS3 A;  1F4B A;  2VET A;  1LCB A;  4ISK A;  4F2V A;  3UWL B;  3TMS A;  2FTO X;  2OIP A;  5WRN A;  1VZE A;  2G89 A;  3B5B A;  3EGY X;  3I3R A;  4H0U A;  1TLS A;  3BNZ A;  3UM8 A;  1AJM A;  3DL6 A;  1TJS A;  1SYN A;  4XSC A;  1ZPR A;  1THY A;  1TVW A;  3IJZ A;  3K2H A;  4LRR A;  3C0A A;  3BZ0 A;  1DNA A;  1JTQ A;  2TDD A;  1KCE A;  3B9H A;  3IRN A;  1BSF A;  1BJG A;  1B5E A;  3IK1 A;  4H0R A;  1F4F A;  4Q0E A;  1EVF A;  3EJL A;  2RD8 A;  4ECK A;  4XSD A;  3HBB A;  4O7U A;  1TSL A;  1VZD A;  4IQB A;  1AOB A;  1SEJ A;  1YPV A;  3INV A;  4FQS A;  1TSX A;  1TDC A;  1NJC A;  4H1I A;  1KZI A;  3UM5 A;  3ED7 A;  5H3A A;  3KGB A;  4O1X A;  1TIS A;  1BPJ A;  2RD8 B;  2VF0 A;  1DDU A;  4EB4 A;  1TRG A;  3EF9 A;  4DQ1 A;  3JSU A;  1JMG A;  4FOG A;  4UP1 A;  4JEF A;  1EV8 A;  1BID A;  3C06 A;  4O1X D;  1RTS A;  3UM6 A;  3DGA C;  1AN5 A;  3OB7 A;  3IRM A;  1JG0 A;  3DL5 A;  1TVU A;  4FOA A;  2G86 A;  4FGT A;  1AIQ A;  1TSM A;  1HZW A;  2BBQ A;  1QZF A;  3IK0 A;  1J3K C;  1QQQ A;  4EZ8 A;  4GD7 A;  1EV5 A;  2AAZ A;  3BYX A;  2TSR A;  3BHL A;  3QJ7 A;  1TSV A;  4KY8 A;  1VZB A;  4DP3 A;  1AXW A;  1VZA A;  3N5G A;  1J3I C;  5FCT A;  1BO7 A;  1B5D A;  1VZC A;  2G8X A;  2KCE A;  3GG5 A;  1F28 A;  1TSY A;  5H39 A;  1BDU A;  1TLC A;  3BHR A;  1F4D A;  1BKP A;  3IRO A;  1JU6 A;  1TDB A;  3QG2 A;  4GEV A;  4PSG A;  1JMI A;  3QGT A;  1F4C A;  1JTU A;  4E5O A;  4G2O X;  4Q0D A;  1BQ1 A;  3N5E A;  1JUJ A;  1BP6 A;  1NJB A;  1TSZ A;  1BO8 A;  3EAW X;  5J7W A;  1TDA A;  3BGX A;  3NRR A;  4FOX A;  1JMF A;  3GH2 X;  1BP0 A;  1BKO A;  2FTN A;  4KY4 A;  4EIL A;  2FTQ A;  1TSN A;  2A9W A;  3UWL A;  1TVV A;  1CI7 A;  2RDA A;  4TMS A;  1KZJ A;  1F4G A;  1J3J C;  2G8D A;  3V8H A;  4O1U A; 
#chains in the Genus database with same CATH topology
 1JMH A;  1NJD A;  4G6W X;  4IRR A;  4GYH A;  1EVG A;  1TSW A;  3H9K A;  2H2Q A;  1TDU A;  4DPH A;  1B49 A;  1NJA A;  3IX6 A;  4EIN A;  1FFL A;  1LCE A;  1JUT A;  4XSE A;  5BY6 A;  2ONB A;  3CLB A;  3EDW X;  3BFI A;  4IQQ A;  1NCE A;  2TDM A;  4KYA A;  1I00 A;  3IHI A;  1HW4 A;  1TSD A;  1NJE A;  3GH0 A;  4E28 A;  3DG8 C;  2TSC A;  4KNZ A;  1F4E A;  1B02 A;  4ISW A;  4DPD A;  1HW3 A;  3EBU A;  2G8A A;  1HVY A;  3HJ3 A;  1LCA A;  1FWM A;  5H38 A;  1TYS A;  3EHI X;  3HB8 A;  3KJS A;  3KJR A;  3N5E B;  1BQ2 A;  4KPW A;  1BSP A;  3CL9 A;  5HS3 A;  1F4B A;  2VET A;  1LCB A;  4ISK A;  4F2V A;  3UWL B;  3TMS A;  2FTO X;  2OIP A;  5WRN A;  1VZE A;  2G89 A;  3B5B A;  3EGY X;  3I3R A;  4H0U A;  1TLS A;  3BNZ A;  3UM8 A;  1AJM A;  3DL6 A;  1TJS A;  1SYN A;  4XSC A;  1ZPR A;  1THY A;  1TVW A;  3IJZ A;  3K2H A;  4LRR A;  3C0A A;  3BZ0 A;  1DNA A;  1JTQ A;  2TDD A;  1KCE A;  3B9H A;  3IRN A;  1BSF A;  1BJG A;  1B5E A;  3IK1 A;  4H0R A;  1F4F A;  4Q0E A;  1EVF A;  3EJL A;  2RD8 A;  4ECK A;  4XSD A;  3HBB A;  4O7U A;  1TSL A;  1VZD A;  4IQB A;  1AOB A;  1SEJ A;  1YPV A;  3INV A;  4FQS A;  1TSX A;  1TDC A;  1NJC A;  4H1I A;  1KZI A;  3UM5 A;  3ED7 A;  5H3A A;  3KGB A;  4O1X A;  1TIS A;  1BPJ A;  2RD8 B;  2VF0 A;  1DDU A;  4EB4 A;  1TRG A;  3EF9 A;  4DQ1 A;  3JSU A;  1JMG A;  4FOG A;  4UP1 A;  4JEF A;  1EV8 A;  1BID A;  3C06 A;  4O1X D;  1RTS A;  3UM6 A;  3DGA C;  1AN5 A;  3OB7 A;  3IRM A;  1JG0 A;  3DL5 A;  1TVU A;  4FOA A;  2G86 A;  4FGT A;  1AIQ A;  1TSM A;  1HZW A;  2BBQ A;  1QZF A;  3IK0 A;  1J3K C;  1QQQ A;  4EZ8 A;  4GD7 A;  1EV5 A;  2AAZ A;  3BYX A;  2TSR A;  3BHL A;  3QJ7 A;  1TSV A;  4KY8 A;  1VZB A;  4DP3 A;  1AXW A;  1VZA A;  3N5G A;  1J3I C;  5FCT A;  1BO7 A;  1B5D A;  1VZC A;  2G8X A;  2KCE A;  3GG5 A;  1F28 A;  1TSY A;  5H39 A;  1BDU A;  1TLC A;  3BHR A;  1F4D A;  1BKP A;  3IRO A;  1JU6 A;  1TDB A;  3QG2 A;  4GEV A;  4PSG A;  1JMI A;  3QGT A;  1F4C A;  1JTU A;  4E5O A;  4G2O X;  4Q0D A;  1BQ1 A;  3N5E A;  1JUJ A;  1BP6 A;  1NJB A;  1TSZ A;  1BO8 A;  3EAW X;  5J7W A;  1TDA A;  3BGX A;  3NRR A;  4FOX A;  1JMF A;  3GH2 X;  1BP0 A;  1BKO A;  2FTN A;  4KY4 A;  4EIL A;  2FTQ A;  1TSN A;  2A9W A;  3UWL A;  1TVV A;  1CI7 A;  2RDA A;  4TMS A;  1KZJ A;  1F4G A;  1J3J C;  2G8D A;  3V8H A;  4O1U A; 
#chains in the Genus database with same CATH homology
 1JMH A;  1NJD A;  4G6W X;  4IRR A;  4GYH A;  1EVG A;  1TSW A;  3H9K A;  2H2Q A;  1TDU A;  4DPH A;  1B49 A;  1NJA A;  3IX6 A;  4EIN A;  1FFL A;  1LCE A;  1JUT A;  4XSE A;  5BY6 A;  2ONB A;  3CLB A;  3EDW X;  3BFI A;  4IQQ A;  1NCE A;  2TDM A;  4KYA A;  1I00 A;  3IHI A;  1HW4 A;  1TSD A;  1NJE A;  3GH0 A;  4E28 A;  3DG8 C;  2TSC A;  4KNZ A;  1F4E A;  1B02 A;  4ISW A;  4DPD A;  1HW3 A;  3EBU A;  2G8A A;  1HVY A;  3HJ3 A;  1LCA A;  1FWM A;  5H38 A;  1TYS A;  3EHI X;  3HB8 A;  3KJS A;  3KJR A;  3N5E B;  1BQ2 A;  4KPW A;  1BSP A;  3CL9 A;  5HS3 A;  1F4B A;  2VET A;  1LCB A;  4ISK A;  4F2V A;  3UWL B;  3TMS A;  2FTO X;  2OIP A;  5WRN A;  1VZE A;  2G89 A;  3B5B A;  3EGY X;  3I3R A;  4H0U A;  1TLS A;  3BNZ A;  3UM8 A;  1AJM A;  3DL6 A;  1TJS A;  1SYN A;  4XSC A;  1ZPR A;  1THY A;  1TVW A;  3IJZ A;  3K2H A;  4LRR A;  3C0A A;  3BZ0 A;  1DNA A;  1JTQ A;  2TDD A;  1KCE A;  3B9H A;  3IRN A;  1BSF A;  1BJG A;  1B5E A;  3IK1 A;  4H0R A;  1F4F A;  4Q0E A;  1EVF A;  3EJL A;  2RD8 A;  4ECK A;  4XSD A;  3HBB A;  4O7U A;  1TSL A;  1VZD A;  4IQB A;  1AOB A;  1SEJ A;  1YPV A;  3INV A;  4FQS A;  1TSX A;  1TDC A;  1NJC A;  4H1I A;  1KZI A;  3UM5 A;  3ED7 A;  5H3A A;  3KGB A;  4O1X A;  1TIS A;  1BPJ A;  2RD8 B;  2VF0 A;  1DDU A;  4EB4 A;  1TRG A;  3EF9 A;  4DQ1 A;  3JSU A;  1JMG A;  4FOG A;  4UP1 A;  4JEF A;  1EV8 A;  1BID A;  3C06 A;  4O1X D;  1RTS A;  3UM6 A;  3DGA C;  1AN5 A;  3OB7 A;  3IRM A;  1JG0 A;  3DL5 A;  1TVU A;  4FOA A;  2G86 A;  4FGT A;  1AIQ A;  1TSM A;  1HZW A;  2BBQ A;  1QZF A;  3IK0 A;  1J3K C;  1QQQ A;  4EZ8 A;  4GD7 A;  1EV5 A;  2AAZ A;  3BYX A;  2TSR A;  3BHL A;  3QJ7 A;  1TSV A;  4KY8 A;  1VZB A;  4DP3 A;  1AXW A;  1VZA A;  3N5G A;  1J3I C;  5FCT A;  1BO7 A;  1B5D A;  1VZC A;  2G8X A;  2KCE A;  3GG5 A;  1F28 A;  1TSY A;  5H39 A;  1BDU A;  1TLC A;  3BHR A;  1F4D A;  1BKP A;  3IRO A;  1JU6 A;  1TDB A;  3QG2 A;  4GEV A;  4PSG A;  1JMI A;  3QGT A;  1F4C A;  1JTU A;  4E5O A;  4G2O X;  4Q0D A;  1BQ1 A;  3N5E A;  1JUJ A;  1BP6 A;  1NJB A;  1TSZ A;  1BO8 A;  3EAW X;  5J7W A;  1TDA A;  3BGX A;  3NRR A;  4FOX A;  1JMF A;  3GH2 X;  1BP0 A;  1BKO A;  2FTN A;  4KY4 A;  4EIL A;  2FTQ A;  1TSN A;  2A9W A;  3UWL A;  1TVV A;  1CI7 A;  2RDA A;  4TMS A;  1KZJ A;  1F4G A;  1J3J C;  2G8D A;  3V8H A;  4O1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...