4IRUB

Crystal structure of lepb gap core in a transition state mimetic complex with rab1a and alf3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
170
structure length
170
Chain Sequence
EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Legionella pneumophila GTPase Activating Protein LepB Accelerates Rab1 Deactivation by a Non-canonical Hydrolytic Mechanism.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase/hydrolase
molecule keywords LepB
total genus 53
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4iruB00
1SXJA 4D0GA 1G3MA 4OQMA 3W8RA 3THXB 2FFHA 2OUKA 2YWGA 4DCSA 4HAUA 4IOKA 5KSZA 4TLDA 2CLCX 1G64A 1G9XA 4V0KA 2C9OA 1N5LA 1MO3A 5EQTA 4ERNA 5DYGA 1RYFA 1RZ3A 3AVTA 1T91A 1VCOA 1DARA 1YZGA 2ZR9A 4Z54A 1JXMA 4B3FX 1DPFA 1SXJC 1Z6AA 3QVVA 5IK2A 3RC8A 3T06B 3Q7PA 5DLQC 5HCNA 4OK6A 2IT1A 3U3KA 4PAOA 4LZZA 4D0NA 4PC2A 1N6KA 2ZRFA 2VPPA 4IDQA 4X8MA 3W90A 3IDQA 2QT0A 1OIVA 1E9BA 4I1OA 1NVXQ 2FJUA 1R5NA 3L8ZA 2NGRA 1BH2A 1PLKA 2GVDC 1P4SA 3CWQA 1E2JA 2QSYA 3KJGA 5JLJA 2IYQA 2HXYA 3SZRA 4QM7A 1YU9A 4DLVA 4M53A 4ZDKA 3U7HB 2QBYA 2VRWA 3AF2A 3BFKA 3U44B 4OI0A 2IWHA 4YMTA 3EASA 2ZRPA 4QFMA 4TMKA 2V6JA 4NCNA 4WXPA 1HE1C 1P7CA 2IYWA 4BGDA 1PLJA 3CH4B 4EJSA 2C96A 2NOAA 1ZIPA 4DRZA 4Z1MD 2J0QA 5JCPA 3H4MA 4FMCF 4TTQA 1VG8A 1P75A 4WXRA 3PJRA 1Q1BA 4AG5A 4C2UA 2GRJA 1XTSA 4EKDA 3U5ZB 1DAFA 4C0QC 2D7CA 1IN7A 3CW2A 4FXPA 5GJBA 3AKEA 2CHQA 4JVMA 4XWOA 1A1VA 2ZU6A 5D3QA 3A36A 4O2RA 4P31A 3IKJA 1ZM9A 2CCJA 1J99A 3BERA 4FI3C 2W6IA 4ACBA 4I81A 1X8JA 3GJXC 3RYTC 1GAJA 3QKRA 2D74A 3NBFA 5FOVA 4AURA 2WOOA 2Z0MA 3UG7A 1XB2A 4OHYA 1P2SA 4BLRA 1KOFA 5C4MA 1Z2AA 2J41A 3LW8A 4UXJA 2X77A 3CB4A 1F2TA 1NLFA 5FTNA 4AC9A 2ZSDA 2ZETA 2QI9C 3BH0A 1Q1QA 1RE0A 1VIAA 4PPNA 2ZS9A 1R4AA 3DKVA 4R2HA 4LBZA 2OO7A 2QY9A 2QTHA 1UKEA 1KO5A 2W6JA 1EX6A 3FGNA 3I8XA 4FINA 1QHXA 3GFPA 4IDOA 4XTCS 3QKUA 3TQFA 5L3SA 4Q18A 3R8FA 2QORA 2WJJA 5G3ZA 2EVWX 1G21E 3QPWA 2A5GA 3U6BA 1G8YA 2EQBA 5A4JA 1N2CE 1U8AA 5GJWC 3AKCA 2ZI9A 1Z29A 3GLIB 4OHZA 3CF0A 3SC3A 4M9XA 2ZE7A 2ECKA 2QNRA 3KJEA 4DUGA 3D31A 1CJKC 1LY1A 2BM1A 2EYQA 1VG0B 3BH6A 3QXXA 2XTMA 2VA8A 3KFVA 3REFA 2BKEA 3B9QA 4Q03A 1NRJB 2GJAA 2B8WA 4BFWA 4D0LB 2G1JA 3GEHA 2PX0A 3GMTA 4HUQB 2BMFA 3A8TA 1TUIA 4E03A 4M9QA 1UKYA 1AS2A 1QHYA 4L9SA 1E99A 2W2TA 3ZVRA 1K6MA 4TT3A 2VO1A 3LBHA 1GRQA 3VR3A 3NBXX 4CYMA 5BWMA 3FYHA 1ZC3A 4JVLA 4A6PA 5EUMA 5FUXA 2ZROA 4BFZA 4QBIA 3W5IA 4DLYA 3QUSA 3ZZUA 2P6NA 2Z83A 2AXNA 1AA9A 5EXTA 4NYJQ 4L16A 3E70C 2D62A 3U3RA 3QNUA 5J5CA 4EIWA 5J4YA 1OHHD 2RMKA 4IDNA 3R7WA 1RFLA 1GKIA 3AP1A 3DM9B 5KHOC 3SS8A 4TMXA 1YR9A 4AY2A 5ANRB 2B7CA 2PLFA 2RGXA 2ZU0C 2HF9A 3PUWA 1FNNA 5G53C 2YC2C 3L82B 3P4XA 3R20A 2F43B 3HWSA 5GJCA 4Q02A 4U7DA 2NO7A 4IFBA 1TAGA 2D2FA 4LPKA 4YDSA 2A78A 1XTRA 1GOTA 3P1JA 3KTAA 5LPNA 1RRPA 3MFYA 3X2SA 1JI0A 3WMEA 2C9CA 1YRBA 4JL8A 2ORIA 4DHEA 2FSIA 1HT1E 1FX0B 3RNLA 1A2BA 3W8NA 1YZNA 3LW7A 2PT7A 2GKSA 3FKQA 2WJYA 2ATVA 1MV5A 4KFSA 2CLSA 4LGMA 2Q9CA 2YINC 3RS0A 1Z0JA 1CLUA 4ZV4A 3GLGA 1Z0KA 4TSFD 1N0UA 2QM7A 3ZIAA 4ASUA 3GLFB 3DMNA 4FMCB 4TLEA 4YMSA 5TY0A 2FEOA 1YZLA 1J90A 1YKSA 2FWRA 2EFDB 4YMUA 4BPBA 1GSIA 1P61B 3SOPA 1CR4A 4MYTA 2O8EA 1US8B 2J0VA 4PSVA 4G5OA 4LV8B 3CM0A 2W0SA 3UPUA 1Z2CA 3P32A 1E9FA 2QT1A 4NYIQ 3LLUA 1U8YA 3CR7A 2OXRA 3P20A 3PFIA 1MH1A 2ASEA 2ZREA 3LFUA 4A4DA 2FPLA 3VU9A 5CYPA 2CE7A 1VHTA 2GDJA 3ZQ6A 5E7MA 3T34A 3KTAB 2IF0A 4Q9IA 2P6RA 1AK2A 1KI6A 1M7BA 2R9VA 1DELA 3FPAA 4RD3A 3OF5A 2IYZA 1K5GA 1YJ5A 3RC3A 2VP0A 1R6BX 2ZRKA 3ASYA 4BLSA 1SZPA 3B8HA 1UKZA 2IS6A 2WWYA 2CCKA 2VSOA 1BS1A 3DOFA 3A37A 1I4TD 2PMKA 5JFGA 1II8B 3HU3A 4AYXA 1G8GA 1L8QA 1PJRA 2AWNA 3B1WA 2V8OA 3Q9LA 1R5OA 3ETLA 4TQUS 3EAQA 2YWHA 4D4JA 2ZUCA 3GLIA 1D2EA 3B60A 1CU1A 1S1CA 3G82C 4NCIA 4QNRA 2IUSA 1R0YA 4HLQB 5DI3A 621PA 1SKYE 2BJVA 2AK3A 4GZLA 3OIYA 3KKQA 4PQFA 3R8CA 3WNDA 5KPDA 4O0MA 2IEZA 1KO7A 4M21A 4NYIR 1WE2A 3A1TA 5KTYA 2GHIA 1JAIA 1N6OA 2R6GA 3IIKA 3T12A 1AJEA 2IL1A 3KJHA 1G8FA 1OYWA 4M1OA 2A5JA 3DL0A 4HI0E 2JLQA 5E7IA 2NPIA 2BBWA 3K09C 3WRXC 1E0AA 1KKLA 2ANBA 2GA8A 1E9EA 1A5TA 2HDNB 1CS4C 3ZGXA 4BECA 1QVAA 4II7A 2QP3A 5F2EA 3FHOA 4QKQA 1G17A 1M7HA 1OIWA 3MJRA 3J81k 3NC1C 5GADl 1IHUA 3UMFA 1H8HA 2GJ8A 2IF2A 1UDWA 1A2KC 4GP6A 3WMGA 4D80A 1FMLA 4M1KA 5LB2A 5B58C 4QL3A 4AKIA 2KE5A 1ZD8A 2A7QA 3I62A 3BAFA 3T1TA 1W4AA 3TW4A 1RRFA 2J46A 1ONBA 2F1HA 2CVFA 1NNEA 4FCVA 4U02A 4V0MA 5HR5A 2RHDA 2MMCA 2CNWD 2R62A 2IYUA 4MGZR 3AVVA 4X8OA 1OHHA 1T5LA 1J70A 2Z5FA 3NHAA 1NY6A 1TEVA 2ZJBA 4E5UA 2ZYUX 3ND8A 1NN0A 2X2EA 2ZRCA 4Q4AB 3O8DA 5DSZA 4C0SA 5JSZA 4KBGA 5AJVB 4RFSB 4DKXA 1S4QA 4QGGA 1W0JA 1IQPA 4HYYA 3BE4A 4US1R 2DB3A 1SHZA 2IXGA 3UANA 3ZZ0A 4LY6A 3TVDA 4J0QA 5CIQA 4RZXA 4EFNA 3ZQJA 1F6BA 1P72A 1P9WA 2O8FB 2LCFA 3LLMA 2H17A 3IUYA 3AVQA 5EE9A 3DDCA 2J45A 3AUYA 4M2LA 5FI1B 1QHHB 4NONA 2GCNA 1KI2A 1KI4A 1Z22A 3T1VA 2V6IA 2VHUA 1OKKD 1Z47A 5AJZA 2ORWA 2NPFA 3IHWA 4BRUA 4KCGA 1FPMA 1KK3A 4BLTA 1OH8A 2Q6TA 5G3YA 1UPTA 3HU1A 3BH7A 3IO5A 1E2PA 3IBYA 4H9GA 4F92B 1KTVA 1X8LA 1KI6B 3FVQA 1RPZA 2AD5A 1OXSC 2AXPA 4URXR 1A4RA 2K5UA 2AWOA 4LJ5A 5AJWA 2XTZA 2ERYA 1XMIA 4XVRA 1IY1A 3RVBA 1TU3A 4B47A 1BOFA 2FPMA 4BFUA 5KU1A 4DIEA 1N6NA 3W3AA 2GCOB 3KKNA 5CM8B 4CEHB 1DAHA 3IO3A 4RKFA 1I4LD 1M2OB 3TR5A 5FPSA 3PV0A 2IYSA 2MSCB 2V7QD 5E95A 4TMVA 2GILA 3MD0A 3WRYC 4BRWA 2OBLA 4B34A 5EP3A 4OI1A 1W4RA 1A82A 1E1RD 1DG1G 3L0PA 5JZVA 1NMYA 4M8NE 5ELXA 1M74A 3UG6A 2Y8EA 3EPHA 3UWOA 1L4YA 1XEXA 3DVLA 2F1JA 1PZNA 4Y0AA 3N5CA 5KNBA 3I72A 1DBSA 2J7PA 4FD2A 1OF1A 1Q3HA 4UJ5A 5CIWA 1E2HA 1ZC4A 2KSQA 4W9MC 4JBXA 2P65A 1XF9A 3BGWA 2ZSAA 1COWD 3OIUA 1HEIA 2GNOA 1SQ5A 4NCHA 3KQLA 3AVWA 1SVKA 2ZUDA 3H2YA 3H1TA 1OFHA 1OW3B 1NLYA 1E2LA 3PG5A 1NBMA 2KI5A 4M1YA 4LV5B 3VKGA 1HV8A 4LBWA 4F91B 2XGJA 1Z83A 2KB0A 2OCPA 4PSAA 1MT0A 2OCAA 5KUTA 3C8UA 1KI8A 1P9RA 5FUWA 1X3SA 4LJ4A 4AG6A 1NIJA 1E6CA 2PBRA 4P4TA 2FE4A 4Q47A 3VR4A 1XNJA 3WHLA 1Q12A 3CNOA 1SGWA 2WWGA 1XEXB 4HDCA 4HLCA 2QTFA 1R2QA 4E07A 4YONB 2P0EA 4HAZA 1LS6A 4AD8A 4B2IA 3GJ0A 3GLHB 4NL4H 3GPLA 3Q85A 2PMDA 5EXXA 4L4UA 3ZIAD 3EARA 4TSFA 3TR0A 3OIVA 1HUQA 2ZI7A 1HURA 3QG1A 3RS3A 4OL0A 4OK3A 4JYBA 2R2AA 1NVUQ 4XD7D 3JVVA 3KKMA 4I1SA 1DVRA 1M1YE 4I99A 3PITA 5CITA 2KBFA 2W2XA 4A0GA 5B30A 1N6HA 5JI3E 2BBOA 2GWHA 1F5NA 3OAAD 2GAAA 1G3QA 3AGQA 1WBBA 4Q1FA 2FF7A 3A1VA 3ONWA 3U3OA 1WMSA 3VHXA 1G19A 1FZQA 2IA5A 3FDIA 1LF5A 4B44A 4GFDA 4MA4A 1AM4D 5IK2D 1G5PA 3FMIA 4LK2A 4XVQA 1ZD9A 4CEIA 2CE2X 1KSHA 4JLVA 1FW6A 4ZCLA 3EX7C 1KO1A 1IN5A 1NLZA 4B2LA 5IT5A 2BMJA 2BMEA 3RS4A 3AM1A 2B92A 3TVTA 4MGIR 5FI0B 5D3MA 2RGNA 4HLDA 4WZ6A 4WZAE 3D3QA 2GXQA 4K46A 1S3SA 4DLZA 1F3OA 2PZFA 5C1BA 1TUEA 4QHTA 4ESHA 3B7GA 5JS7A 4GP7A 4WZBE 4CIDA 4UNRA 5A5GA 1ZNZA 2CK3A 2OAP1 2P5SA 2QP4A 1LNZA 3A4MA 2V55B 3NC0C 1ZU5A 1OFIA 4TL9A 5C2JB 2I1QA 1CBUA 1S9DA 3OFND 4BZQA 3CF6R 5FBLB 1WB9A 4L8GA 1CXZA 3N70A 5L3VA 4C0HA 1SKYB 2G6BA 3AVXA 5L3SB 2O8CA 4XWAA 2ZI6A 2F55A 3GJ8A 2QUZA 1P62B 2ZYTX 2WTUA 1FMJA 4FCTA 4RZ3A 2IYXA 1OE0A 2CEAA 4RVCA 4CZ2A 5EUQB 1Z0FA 2QQEA 2WJIA 4B35A 5JCZA 3SJZA 2SHKA 3U6KA 4LCBA 1T5IA 2VP2A 1QF9A 1ZMXA 3SEAA 2I4IA 2QPAA 3DZ8A 1E9CA 2GXSA 1XXHB 1XFAA 4FN5A 1JJ7A 4K81B 2GBLA 4DUGD 1NJFA 5E7JA 3UWKA 3I61A 4KFTA 4N1AA 2KWIA 3GEIA 2ZANA 5JMTA 4W5JA 4RD2A 1U9IA 3X1WA 1S9HA 4UNSA 4V02A 5FOXA 1VCMA 2QU8A 4IHQA 4FMDB 2G83A 4JS0A 2JLZA 4CT4B 1G7CA 1XD2A 3SN6A 3K1JA 1KK2A 2JLRA 3MG9A 1F2UB 4DIDA 3OEEA 2QAGA 3HR8A 4BFTA 1KSGA 3CPEA 1XCGB 1HA3A 4IOMA 2FH5B 1SXJB 3U7GA 5EP1A 2JDID 3DO6A 2J87A 4YDHB 3VR5A 5BQ5A 2FFAA 3EZFA 3O8BA 1D9ZA 1KI1A 4BEJA 2AKYA 2OCBA 1MO4A 1S1MA 3Q5EA 3QKSA 4IDPA 2V3CC 3SU8A 2V4ZA 4G0NA 3K0SA 1YRAA 5FOSA 1N5JA 3SYLA 3QY0A 1R10A 2LKCA 2XSZD 1RW4A 4KO8A 1E2IA 3ZD7A 1E2DA 3BB1A 1W4BA 5GVSA 2ZRGA 1W36B 4HDOB 3REGA 1NN5A 4ZKDA 2ZYVX 2WBLC 1AZSC 1W2HA 3HPRA 3C41J 5K8IA 4V0ME 1E94E 2HCJB 1ZNYA 3D7MA 2NG1A 3QI2A 2BKUA 4ILEA 5KDLA 5TVKA 1G4UR 1N6RA 2OZEA 3MWYW 4EFMA 3FKSA 1KI3A 1IJFA 1OSNA 3GFOA 3LBNA 4JYCA 2J0UA 3C5CA 2ZJAA 4IVQA 4DCTA 2A2ZA 4LJAA 3TW8B 2GZHA 3MJHA 3GJ3A 4EQ6B 1DADA 3EPKA 4JLAA 4TLAA 2FSHA 2VP9A 3U44A 2IW3A 2QP9X 1KGDA 2AR7A 3I73A 1NIPA 2AFHE 2A9KA 4Q9JA 1E9DA 2QMHA 3P27A 3W6PA 5JJIA 3OEED 4V0LA 1E2NA 4IXMA 5K8TA 1KY2A 2OT3B 5EXSA 1NBME 1AGPA 1U0JA 1SVOA 5C46F 1UDXA 3CRW1 4S35A 3TJZA 1O87A 1SVIA 2PEZA 2C9YA 2IHBA 3LO5A 4OYHA 4ARZB 2FV8A 5EE3A 1G5RA 4TL7A 5K8UA 2CHGA 1XXHE 4D2IA 3QXJA 4URUR 4B6EA 4B74A 5JECA 1KAGA 4B2PA 1T4GA 2XNSA 4MGKR 4C9BA 1ZNWA 3X1DA 3PXGA 1XD8A 2RB4A 1KJZA 3AKYA 2J7PD 2YOHA 2VYFA 2XSZA 3SHWA 2NZJA 2E87A 3CZPA 4EPVA 2B8TA 4FWIB 2R8RA 2OG2A 2JLUA 3O8CA 1PUJA 2JA1A 1DOAA 1G6HA 2WOJA 2ZE6A 1E9AA 3NTUA 5SZHB 4GOXA 4JJZA 1DG3A 3KQNA 1Z8FA 3U60B 1M7GA 3WXMA 1NI3A 1XU4A 4A2QA 2JDIA 3WNCA 1ESMA 2JLXA 2RAPA 1BO6A 2QE7D 4D81A 4NMMA 4LUCA 4Q1BA 4PPQA 1KJYA 3MMPA 3F8TA 5EXPA 4JSYA 4US0R 1ETUA 2ZR0A 1W47A 4UKDA 3TH5A 3FHCB 2C99A 3KKPA 5KPJA 4HZUB 1L2TA 3PEVA 4PHTA 2P5TB 4BZXA 3PEWA 1XMVA 4KI0A 5BN4A 1QG4A 4TTRA 3JVUA 5JWOA 4C7OB 5L3QB 4LYJA 2GF9A 3OE7A 4M1TA 4WA7A 3VAAA 4ZIRA 2X19A 5J4HA 5FPTA 1JEEA 1F60A 3ASZA 4KU4A 1CRQA 121PA 1CP2A 2AX4A 1E9SA 2WSMA 4MKIA 5F98A 2WVJA 2IYTA 2MSEB 3LWNA 4BFXA 3VX3A 2F7SA 5JJKA 5H70A 4A8JB 1XEWY 2XZPA 3I8SA 3DKPA 1ZP6A 4G1UC 1OB5A 2EFGA 3VR1A 2ZEJA 3K0FB 3CKLA 1ZJ6A 4U00A 3CZQA 3CPHA 3CH5A 3MAAC 3A1WA 2R6CA 1XP8A 2IYRA 3L0SA 4HUQA 4XD7A 3TGPA 2IS1A 1GL6A 1YR7A 3MLEA 2O8DA 1ELOA 3MWJA 2QAJA 1R0WA 3Q7QA 1VKJA 4NYJR 2BEKA 4JJKA 2IYLD 1II0A 4RFSA 4JIMA 1D6JA 3C4JA 1KAOA 1AKEA 1MABB 2RGBA 3LQQA 4PO9A 3VFDA 5L3QA 1S8FA 2Q3HA 2ZJ2A 4KODA 3EG5A 4LJ7A 5JEDA 3IHLA 2Q3FA 3WP0A 4MDEA 3B2EA 2REXB 1KZ7B 2QMOA 1XCPA 3VNUA 1NSFA 4YMWA 1Z3IX 1R8SA 1Z28A 2WWIA 3WHKA 2F1RA 4GL2A 2CBZA 1Z6XA 1QZXA 3LD9A 4UXIA 2ODWA 2C78A 4UJ3A 3I32A 3EA0A 3I92A 2LWIA 4AIIA 1W0KD 4N0EA 1P9NA 1FL9A 4TMZA 2PZGA 4WIAA 2CL7X 1PV4A 1E79D 1CTQA 1LV7A 1NN1A 3TUJC 8OHMA 4GSYA 3SDZA 1KDTA 4C0KA 1RKBA 2P3SA 2RGGA 3U4QA 2YV5A 4KYUA 3NKVA 1IM2A 3SE0A 1JECA 4G3XA 4LJYA 2O0KA 1TF2A 1KNXA 3U2QA 1NY5A 2QENA 4LJ6A 1II9A 1E1RA 3K0CA 4Z8YA 1JPNA 1OIXA 3V9PA 5JRZA 2VHJA 4KSCA 3AB3A 4HSEA 1NG9A 1ODFA 3RWMB 1TQ6A 2IC5A 2XXAA 4P3YA 3B13B 2IWRA 1GL7A 4DBLC 4HLUA 2UZIR 1RIFA 4OQXA 5SZKB 3V00A 3W6NA 4DWJA 1R0ZA 2JASA 1Z6TA 2B6HA 3H86A 3GLHE 3PUXA 2ZVPX 2Q9BA 4PC7A 1TMKA 2PCLA 2VLIA 1TNDA 4YXWA 1D5CA 3NHBA 1UJ2A 1UBCA 1JXOA 3U7EB 1OH6A 2A5FA 1P5ZB 1EFUA 1T9HA 1KYIA 4LV6A 2D4HA 1G4AE 1X1SA 4FW9A 1W5TA 2BBSA 3HDTA 5DIFA 3V4FA 4DJTA 1X1RA 4MUAA 1YHNA 4MKHA 4ON9A 2OESA 5CK4A 3THWB 4TN1A 3MUFA 1S0UA 1AQYA 1KO8A 2QRNA 1JJVA 3QQ5A 4FCWA 1KJWA 1QG2A 1VMAA 4UNNA 3EC2A 4KFUA 5DN6D 4IDHA 3THYA 4PHGA 2Q3MA 5DI9A 2IBMA 2FGKA 1JEDA 1AS0A 4ASUD 3N2IA 5KNCA 3HP1A 1K5DA 3TIFA 4C0BA 2IX3A 4G5RA 1MO5A 2YWEA 3E2IA 3T5DA 1AKYA 2OAQ1 3AVOA 1J2JA 2ODNA 1RYHA 4Q1CA 5E3HA 3TKLA 2D06A 1XTIA 4GDFA 4A92A 5AJYA 2ZJZA 3VHLB 1XCMA 3IPYA 1T3SA 3CO5A 3QBTA 4LHWA 5H8WA 2WMOB 1KHTA 4LDJA 2XITA 4LX0A 3ECCA 1TEXA 1TQ4A 1QBKC 3HR7A 3CRRA 4V0OA 1TF7A 2DFTA 3AV0B 4YMVA 4DLTA 4DDTA 3DZDA 3P26A 4A0HA 3VNVA 3D6TB 1ZU4A 2WJHA 1DTSA 3A4NA 1Q44A 2VHQA 4NE2A 2HCBA 3UKDA 2BBTA 4M22A 2IHYA 2V9PA 4JBYA 2VP5A 3WBJA 2R44A 3G0HA 1UKVY 4MQBA 2EWWA 1B23P 3KFXA 4PZYA 1LS1A 1Q21A 2JJ2D 4TYNA 4MRNA 3VR2A 1W0JD 5BYJA 3LV8A 2OSBA 3GJ5A 1KDPA 1E0JA 3CONA 3L8YA 4NH0A 3RRNA 1W7AA 2ZE5A 3TRFA 4Q4HB 3WP1B 4UXHA 4B73A 4DLRA 2IEYA 1W48A 4PHFA 3U4QB 3K0AA 2BCJQ 3UXMA 1CULC 1W36C 1NVVQ 3EXAA 1Z08A 3FMPB 4OJQA 1W1WA 3CF2A 3LXRA 5LBIA 2W58A 4M4SA 3TUIC 4ABYA 4YQFA 2BHRA 2VEDA 1GKYA 1TPZA 4DB2A 2OILA 2ONJA 1E2EA 1RVDA 1WP9A 2BIFA 2ZTSA 4JVNA 2PEYA 4X8LA 5AK0A 5AR1A 3QF4B 3U61B 4B3CA 1U81A 3G5UA 1GWNA 1MR3F 221PA 4I1UA 4YXWD 2OBMA 5CB6A 2ZE8A 1HY3A 4XSHA 2X1VA 3F0TA 3R9XA 3GLGE 2VTKA 4IOJA 2WZQA 3W5JA 1NN3A 4IXNA 3V4RA 4V0NA 2I1VB 2G88A 3KUDA 3TMKA 4F93B 1Q3TA 3LRPA 1Q22A 4A6XA 1YZKA 4Q48A 1N5KA 2XZOA 2J1LA 2X2FA 3AP3A 5BN5A 1F2UA 4KAXA 3FWYA 4CEHA 3HPQA 1XTJA 1IOZA 4G5SA 4Q66C 1Z0AA 5FPKA 5KSOA 3K70C 2UZ3A 4XH9B 2OE2A 2QPTA 1SVSA 3EIEA 2P6UA 4BLOA 3OIWA 5J47A 2Q21A 2TMKA 4QJ4A 5E4FA 3THWA 3SFZA 5HPYB 4A8JC 3BB3A 2QGZA 3IILA 3L0IB 2ZUBA 2V7QA 3LDAA 1QHNA 4M1MA 4A0RA 5G41A 2D7DA 4DDUA 3QIAA 1JQJC 3IIMA 2WMNB 1EFCA 1Q57A 5FR1A 4D25A 1US8A 2OHFA 4BLQA 5FFMA 3OHMA 3GQBA 3ICEA 3L2OB 1II8A 4LYFA 2EWVA 2W6ID 3DHWC 2H8KA 2F9MA 4GZMA 2CXXA 5FTKA 1BYIA 4D4KA 3OZXA 1IXSB 3CX7A 4DEXA 1QRAA 2N1BA 4TZ6A 4M9SA 4ZI2A 4TYPA 2FSGA 2O0JA 4RD0A 2AKAB 3KB1A 4PAQA 1WRBA 2IUUA 1J8YF 3M1IA 1KDRA 3QENA 2WKQA 1OKKA 2HF8A 3K9HA 1P6XA 3ZJYA 2ZSEA 1Z0IA 2J0UB 2IK8A 2OLKA 4QRHA 2BVNA 3RRZA 3SR0A 4US2R 5IF9A 5TDHA 5JRJA 3RSLA 2OM2A 4P0TA 4XIGS 4OK5A 1IONA 3M0EA 1K8RA 4P4SA 4Q21A 4RD4A 4TL6A 5P21A 1W44A 1KKMA 1G18A 1FNMA 4KJZA 1CKEA 4EFLA 3TUZC 2O0HA 2BM0A 3K9GA 3ZS9A 3T1OA 1UF9A 4MH0R 5AUQA 3GLHA 1DAKA 2BOVA 2ZS8A 1DO2A 1ESNA 3BC1A 5BN3A 1ZD1A 1FOEB 2ZYWX 1OJLA 1NJGA 3HYRA 2JEOA 4XOIA 3S1AA 2QEQA 3CWZA 1E98A 1FUKA 5H1YA 1NVWQ 2JCSA 1KO4A 4PX9A 5HTKA 3Q8XB 3WBKA 1DS6A 4L9WA 4TL8A 1VIYA 5FUVA 1OV4A 1ZM3A 5G40A 5EZ6B 2IS2A 2DHRA 3L43A 3QOFA 3M4YA 3WMFA 3AVPA 5LDDC 1HYQA 2FNAA 1GKUB 4QG7A 2Z4SA 3K0EA 2HT6A 2FU5C 1FFHA 3PQCA 4EPYA 2XX3A 2BEJA 4QXAA 3OE7D 4F7WA 3PR1A 3CX6A 3K0CC 4B3XA 4CEIB 1D2MA 5BYKA 4IJMA 1KK1A 3SBEA 2IYVA 4CRWB 1L7VC 4PTLA 3TAUA 3QF4A 1UBFA 2G1KA 2WJVA 521PA 1EGAA 3BJIC 2BMDA 2NO1A 2C04A 4NCJA 5J4LA 5JSZB 4JLNA 4R98A 3W3ZB 4ZDIA 4KYIB 4DDWA 1NMZA 1Q1EA 2LKDA 1R0XA 3EZ6A 1VTKA 3IIJA 4DSNA 1YZTA 1PVOA 1OYYA 2ZAOA 3QXHA 3KXLA 4GOJA 2MSDB 4PC1A 3ZS8A 2O8CB 3I3SR 2CCGA 1T0HB 2N46A 3W6OA 3FMFA 2QPOA 1LF0A 3AEZA 3T35A 4A36A 5DN6A 2AD1A 4Q4JB 2WPDA 4DXAA 4NZYA 3P4YA 3CLVA 2ZSBA 4R9UC 2J3EA 4RCZA 4RJLA 2OEPA 4PQYA 4NP6A 4IVPA 4LYAA 2RGAA 2Q9AA 2ZQ5A 4HDQB 4R7ZA 4R2IA 3CRQA 4C30A 4WAUA 6Q21A 1QHGA 3ZYCA 4CF7A 2YKGA 1TL7C 4IW3B 4ZCMA 4DLUA 3B6EA 4EJSC 3UIEA 3EIHA 2ZS7A 1SXJE 2JJ8A 5FOTA 2GZDA 3K53A 3MRSA 2WKPA 3BRWD 5AUOB 3NDBB 4G5GA 5HCIA 3ZD6A 3SQXA 4KITB 3CNNA 4B32A 1NVVR 4MRRA 4Q01A 3BB4A 4GNKA 1P2TA 2ATXA 3F5FA 4AWXA 1G5TA 2CLDX 4HB0A 1A7JA 2UKDA 2DFKB 4GPTA 1UAAA 2H16A 3FE2A 1KIMA 2CMKA 1CJTC 4JLKA 4Q4JA 4GRAA 1H8ED 1T3HA 2WIBA 1H65A 3NDPA 1TF5A 2A5DA 5KYKA 4JZKA 4UQOA 5JS8A 4WOPA 1CR2A 1XZQA 3NG1A 4LHZA 1BMFA 2ZI5A 4CGZA 2HYIC 5DO9A 4JLPA 3DM5A 1G1MA 2DR3A 4OI2A 1G3UA 2W83A 4C3ZA 2JLWA 4JKYA 4NCKA 1I2MA 3VKHA 3BIFA 5KSPA 3BBPA 5HZKA 1JNYA 4D6PA 1HQYE 4Q7KA 2GEUA 4QC2A 3AP2A 4IVRA 4I4LA 1YZUA 2ANCA 2XOKD 4OJKA 2QQ0A 4DLSA 1E79A 4DDVA 5FOUA 2YZ2A 3HU2A 2O5VA 4NU0A 4RFVA 5J40A 4B3DA 4MRVA 5FPHA 1W0KA 3L0OA 2ZRJA 2ZRIA 2ZM5A 4ZO4A 2F3RA 2G0TA 4U5XA 3U3MA 2XB4A 1RJ9B 1GTVA 1DEKA 5CJPA 2XB2A 3SI7A 3T5GA 4F4CA 5BXQC 2FFQA 2JJ1D 1ZUNB 1VDZA 2NO0A 2ZRLA 1ZUIA 5EE1A 2BWJA 4GMXA 2F9LA 3AVYA 2OV2A 1IY0A 1YR8A 2FEMA 2XOKA 4HEJA 3AGPA 2R65A 4KHZA 4JBWA 3SFVA 3WY9A 3I5YA 1E1QA 1OH5A 2JIZA 4CW7A 1IN4A 3ADKA 3CUEF 4DSOA 3DPUA 3VMFA 1ANKA 4JLJA 1XPOA 1J8MF 2RGCA 2VH5R 2B21A 2FOLA 4LSGA 3QG5A 4D4LA 4OQFA 4ARZA 2HV8A 4WW0A 2FMXA 3AF1A 3RS2A 3EPLA 5FBVB 2OLJA 2G3YA 2FGJA 2ZVQX 2YYZA 4QJ3A 4QHYA 4NYMR 3SJCA 1G6OA 2ORVA 4E22A 1CEEA 3JZAA 3OESA 4MUBA 2EFCB 4OQLA 5SZIA 1ZAKA 4BASA 3A1SA 5IDVA 2XNDD 4Q7JB 3K70B 2KBEA 1IY2A 1BYUA 4AYTA 2WWHA 3MWLA 4UNQA 3WYFA 2GBLC 5A0FA 3SBDA 2WJGA 1S96A 2GJKA 3IGFA 3KJIA 3GCGA 3LA6A 4JKIA 4EPRA 4QGHA 1KZGB 1WQ1R 2BDTA 1AIPA 1QHSA 1QHIA 4KVGA 4KV9A 4Q4LA 4LI0A 3M6AA 3TSWA 5JHGB 2GEVA 3E5HA 2DBYA 5DE3A 3B1YA 5TARA 1JB1A 2DPXA 3BXZA 3RAPR 4POAA 5JWRA 3VQTA 5HZHA 3FB4A 5DYIA 4O3MA 2FZ4A 4HZUA 1P3JA 4D82A 1SHKA 3NH6A 4BEBA 3LXXA 2WM9B 2YNMA 5FTLA 2AN9A 2QM8A 3K70D 4TLCA 1E2KA 2WV9A 2XEXA 1XMSA 1E0KA 1XRJA 2WPDD 4PC6A 4TLBA 1GVNB 1XTKA 2ODEA 1AGRA 1E2FA 2FPKA 4O2LA 4URZR 3FFBA 1E3MA 3EIQA 2C77A 4RZ2A 4FMDF 1E9RA 4Q9HA 4QBFA 3KX2A 4GMDA 2PJRA 1AN0A 4NKRA 1U0HC 3EW9A 5AJXA 2X8AA 2VP6A 4RZUA 1GM5A 2CHVA 2NO6A 1JALA 4C7OA 5DHFA 4Q1EA 1Z0DA 1JPJA 2ZJOA 1FQKA 3TSZA 2QG6A 1IN8A 1OXXK 4L15A 3RWOA 3E1SA 1OXUA 2PH1A 4HAXA 1CJMA 2E9SA 3BS4A 4CDGA 2H7VA 1Q0UA 5KSYA 4IEEA 5FR2A 1X8KA 3HJNA 1HTWA 2ONKA 1FX0A 1FQJA 1SVLA 1YQTA 4F4IA 2XNDA 3LNCA 3RANA 4KBFA 1XEWX 3A58B 1GNQA 5J4KA 1WCV1 3BOSA 1PLLA 3RDPA 2H5EA 1OFTA 3GLGB 4Q4HA 2F3TA 3QKSB 5DNYB 4PANA 5FH9A 5J4VA 1U9IC 1IXRC 2HYDA 1XD2B 2CVHA 2DWQA 3CRVA 2H1LA 2HJGA 2FDCA 3CX8A 3NEJA 3ZVMA 1UADA 2VF8A 3H84A 5AWFC 3SHFA 4DB4A 5JHHB 1MABA 4MDFA 4EJSB 4KFRA 2H92A 2IS4A 4MYCA 1YR6A 4B33A 3B1ZA 4WBSA 1G7SA 3VU9B 3I5XA 1KMHA 4HUTA 2PZEA 2JLYA 4TYYA 1E1QD 1OXTA 4PC3A 1MKYA 4QHSA 1U2RA 1ZRHA 2QBYB 1Z6YA 1VECA 4URVR 2HT1A 1NBMD 4QBHA 4B71A 1XPRA 4C2TA 5B2ZA 4A2WA 3NXSA 3QVUA 5HE9A 3KXKA 5JWHA 2PT5A 2BC9A 2VL7A 3A6PC 2OBNA 2RGEA 2WSSD 3EZ9A 4LYHA 3ZVNA 3RSOA 1V5WA 4QGAA 3SYKA 2IYYA 1JQLB 4DCVA 1D9XA 1N5IA 2P67A 4HB2A 2YC4C 4BLPA 5IRCD 4P32A 4XTRA 4PO1A 2XZLA 1ZM4A 4LHXA 1OLOA 5GVRA 2XXAB 1T6NA 4M1SA 4A82A 1L4UA 2VP4A 5FTJA 5KDOA 1ZINA 1WDTA 1E4VA 2Z4RA 4HAWA 1NKTA 1OB2A 2DWPA 3AF0A 1G41A 1DO0A 4URWR 4EQ6A 3ZVLA 1ZBDA 5KOYA 5JJLA 1WBDA 1G3RA 2WICA 5K8LA 1Z6GA 1IBRA 1AZTA 2C2HA 4IRUB 5LB4A 1OFUX 3LAWA 4GOKA 4N0DA 2ZITA 3PUZA 1G8HA 5LD2C 2FFBA 2JLVA 3PIRA 2BCGY 3CR8A 5DI3B 1F2TB 4ZCIA 1YVDA 4FMBB 4DEYA 3BORA 4M9ZA 4LPSA 4CT5A 4IFEA 4K8OA 1W49A 1H8EA 1OPXA 4OHXA 2V54A 3ZDQA 2Z43A 2YHSA 2P2LA 3OEHD 1LFDB 3KB2A 2VIIA 3KUCA 2NO9A 4QBGB 1E69A 3KZ1E 4HZIA 4RD1A 3WNBA 1CIPA 4DT1A 1KI9A 3D8BA 2H18A 4PFSA 3THYB 1U98A 1LTQA 4I1VA 4G01B 2J59A 1CR1A 1TQDA 3TE6A 4LRWA 3B5JA 2OFXA 1R5BA 3PENA 3QKTA 2UVQA 2V1UA 3OFNA 3ZH9B 4NTZA 1NF3A 2A30A 2ZJ5A 3B1VA 4JMPA 4MITA 1NP6A 4RCYA 1TQ2A 4LJ9A 4XWKA 2CK3D 4M0LA 4MKGA 5F9FA 3ADBA 2DWOA 5KDDA 2F1IA 1S2MA 2GZAA 1S3GA 3LVQE 4RD6A 1GFIA 3NH9A 4ZDJA 1OH7A 4F4JA 1UM8A 1RC8A 5FUYA 3VKWA 3S1AB 2ZI4A 1AQUA 5EP4A 3EPJA 1U90A 2HLDA 4Q1AA 3IQXA 2BV3A 4LBVA 1ZVQA 1ZNXA 2AHOA 4MKFA 3A4LA 2OFOA 1Z5ZA 3RS5A 3PEUA 4DT1B 2RH5A 2WWWA 3B9PA 3R7WB 4JLMA 5DHAA 3C14C 2JJ2A 3JZMA 5EJEA 4PQRA 4Q00A 2RHMA 1QHHA 4JT4A 4BZPA 1XPUA 1E4YA 4D26A 4YLGA 3BWDD 4PXAA 4OHWA 4ZIRB 4ACAA 1MRNA 2H57A 3AQ4A 4NHOA 1P73A 3OAAA 4XVUA 1KMHB 1CF4A 1VG9B 3CBQA 2ZRBA 4OQNA 1TX4B 4DCUA 4ESVA 3N2EA 1V43A 4NBSA 2XTNA 4L5BA 1N0VC 3GLFE 1D8TA 1C1YA 3I1FA 4NPHA 3LH5A 5DGXA 2NZ8A 1GRRA 5CLLA 2NTYC 3DEFA 4A9AA 4B75A 4C0AC 1U0LA 2GK7A 1JR6A 3K0FA 4HLUC 4ITRC 1MO6A 5EZ5A 1E96A 3B1XA 1W46A 3AF4A 3QE0A 4X8HA 2GCOA 3TAHA 3TBKA 4BUJA 1HE8B 5IHPA 1JR3E 2QMEA 4TWZA 4A15A 4W7SA 3O47A 3GD7A 2J7KA 4PPFA 2ZJ8A 4RY2A 1GILA 1KSJA 2JGNA 4TTPA 4PR0A 4Q7MB 4R71A 3SJBA 2O8EB 1T3LA 2D2EA 3TQCA 1GP2A 1CR0A 3O8RA 4OHVA 3NIBA 5KO2A 1GNRA 1HT2E 5DH9A 3T15A 3GLFA 1Z63A 1P2UA 5HKKA 2ZRMA 4AK9A 2HUPA 4B43A 3FFAA 4LWZA 1ZUHA 4Q19A 4W5HA 3MGCA 3X1XA 4H1VA 1E0SA 5AUNB 2BJWA 721PA 3AF3A 3CRMA 1GITA 1EFTA 3T61A 4DSUA 5LD2B 2E1RA 4Q5IA 3IPXA 3BFXA 4EPTA 3EWSA 1G3IA 1COWA 1CJVC 4KVAA 4PAMA 4UNPA 2ZRHA 4PZLA 1RRGA 1XTQA 4KLNA 5CDFA 1G7TA 3KQUA 2AL7A 4AI6A 3T1QA 4IOLA 3A1UA 3I4LA 2WWFA 3K9LA 1W5SA 1YE8A 2CL0X 2DY1A 2C98A 2QA5A 5SZJA 3BD9A 3QKRB 1EX7A 2IUTA 3SYNA 4MRPA 4Z51A 2GESA 1G291 3KQKA 5CB8A 2GVZC 2C03A 1OXVA 2ZIAA 1N6IA 4TQAA 3UATA 5FL7D 1N3BA 3C16C 5KNDA 3SQWA 1MRSA 3MSXA 3RABA 4B76A 1M34E 5CLQA 2FX3A 2XJ4A 4YC7A 2REOA 1VPLA 3ADCA 1W2GA 2JLSA 1KSFX 2YOGA 1GRNA 5HE8A 2WHXA 5CK5A 1GZSA 2G77B 1SVWA 5FPYA 4HATA 4LHVA 4JT2A 1XMJA 1I4DD 2RKOA 1KK0A 3RHFA 4V03A 4B6FA 1VCIA 3NVAA 4M1WA 2ZI3A 3LBIA 1XX6A 4LHYA 4OBEA 1XEFA 4JSTA 1RJ9A 3VR6A 4B3BA 4AKEA 3QXCA 1KDOA 2GETA 3IEVA 1JR3A 1J7KA 4CEJA 2ZAMA 2GF0A 2NQ2C 3F3YA 5AUPB 4ZKEA 5EE0A 4KSBA 3Q72A 1XD9A 3IEUA 3B78A 4BWYA 4C4PA 1QVRA 5HKKD 4PHHA 2HJVA 1KI7A 5FBWB 1GIAA 1M8PA 1FTSA 5FL3A 4XJXA 1NL3A 4OKSA 1C9KA 3NEYA 2GXAA 3ADDA 3NBYC 3AUXA 1I2DA 2MMGA 1Y3AA 3LX8A 2AFIE 4TQ9A 2O8BA 2DYKA 3BK7A 3QXSA 2RCNA 4C0JA 4EUNA 1P60A 1IJEA 3CPJB 4D4MA 4QNMA 4Q4AA 4QM6A 4DLWA 5EE5B 2PJZA 2HXSA 2REBA 4KLZA 4Q7LA 1O3YA 1XJ0A 3TLXA 5JI2E 2G9NA 1EXMA 2CNWA 5EP2A 3W34A 2GTPA 2ZJYA 1E2QA 3AKDA 2J5XA 4MRSA 3R9WA 4MYUA 3PUVA 2PX3A 4FWTA 1BKDR 1E2MA 3QF7A 4WVFA 3WYAA 4IEIA 1Z07A 1G20E 1SKQA 4TYQA 3VX4A 4IKEA 1PUIA 5DISB 5CM9C 5C4GB 4CEJB 1NSTA 3UMSA 3GP8A 4TYWA 2OCYC 2FSFA 1XDBA 1FP7A 4AYWA 2QRZA 5B57C 2R6AA 1DAGA 4LOAA 1KY3A 4MYHA 3RLFA 3FOZA 1H8HD 1W4CA 2C8VA 2GXUA 3B82A 2C95A 3U7FB 3MWKA 1R8QA 4JVSB 5FBRB 2B7BA 2F43A 3GJ4A 5L8VA 1Y63A 1IAQA 3QEOA 3TK1A 1JR3D 1XJQA 2CDNA 3IBGA 2O8FA 3C7KA 3K9NA 5F3WB 2AK2A 2L0XA 3OEHA 1GNPA 3QJYA 5CYOA 3SNHA 1U8ZA 2EFHB 1D2NA 1TTTA 4DCNA 4GI7A 1Q1ZA 3PUYA 4BFYA 1WXQA 3R9IA 1CJUC 2I3BA 4PSKA 3QPVA 4G5QA 2ZRNA 2WAXA 3GEEA 4DLXA 1RRCA 2QGNA 5CDFE 1HQCA 2YJTD 3FTQA 2CJWA 1F48A 5UKDA 4FIDA 3X1YA 4Q9LA 2FZLA 1LW7A 2PLRA 5L3RA 1FUUA 3W9YA 2ZXUA 4P4UA 2QE7A 4JLBA 2C5LA 3K8YA 3K0AB 3PEYA 2GCPA 2IXFA 1UBEA 1T0JB 1BIFA 2WWXA 4JLOA 5FL7A 3ZZTA 3KL4A 4ZDWA 1E2GA 2W2VA 1CRPA 1UEIA 2ZSFA 1FP6A 2QTVB 5M04A 1AS3A 1TU4A 4B3GA 2QMUA 2Z6VA 1EWQA 2GK6A 1Z06A 2VQSA 1ZCBA 2GAOA 4P33A 3EA5A 4BE7B 1KMQA 1U99A 1FTNA 5TXGA 5B64A 4PO8A 1DAMA 4HB3A 1NKSA 2ODBA 3RS7A 1UBGA 2WSSA 4BQSA 5F9HA 4TZ0A 5CJ2A 2DFLA 3TNFA 1GUAA 1B0UA 3LY5A 4O25A 1GL9B 1P2VA 4PPGA 4QOSA 3FMOB 4DSTA 2YWFA 1ZW6A 4Z1MA 1GDDA 2QL6A 4ZPXA 4DC9A 4GT1A 1G7RA 2VHCA 1UEJA 3NBZC 2ZR7A 3C15C 3UK6A 4C0LA 4DVGA 2VF7A 4RSGA 4GBMA 1VYTA 4MGYR 1XZPA 4CVNA 1EK0A 1R7RA 4JLDA 2JIZD 5JBQA 5TV2A 1NMXA 2XAUA 2FA9A 4B48A 2YOFA 2O8BB 1G16A 3GLIE 3B85A 2JJ1A 3EC1A 1DE0A 4H1UA 3THOA 1EG7A 1VG1A 5FBQB 1TADA 4LC0A 2JAQA 2VHTA 421PA 3QSYA 2WAYA 2HEIA 4JL6A 4KXFB 1N25A 2EFEB 1XBTA 2IXEA 2VBCA 4EPWA 5JEEA 2ZPTX 4AKGA 2JATA 1ZYUA 1QDEA 1W36D 3FKSD 1T8TA 2J0SA 4OI4A 4P4SB 2GJ9A 1ZIOA 1VCNA 2VSXA 2W00A 4Y0VA 1XWIA 2EW1A 4Q9KA 1IN6A 1XJCA 4Q1DA 1EESA 2CL6X 4LBYA 3KQHA 3NWJA 1M6NA 3EWAA 3H0KA 3U3JA 1N0WA 5FOWA 4DZZA 2V1XA 4EPXA 1X6VA 5C18A 2F6RA 2WIAA 4LC1A 5TB5A 3EZ7A 1DAEA 1N6PA 1LVGA 2FN4A 4JL5A 3RRMA 4BFVA 4S2EA 1EWRA 1ZCAA 4PZZA 5D3MB 4HB4A 1X86B 4LJ8A 1SXJD 1Q20A 2GJSA 3CNLA 3GJ6A 4Z8XA 1DAIA 4E09A 3ICQB 3AH8A 4EDHA 2WKRA 1ZM2A 1U94A 1BMFD 2DCUA 3GJ7A 3HYTA 3KDSE 3QBVA 3EZ2A 4HAVA 2HLDD 1YZQA 3AVUA 2VSFA 3DOEA 4N3NA 3LVRE 2R6DA 1N6LA 1WA5A 2NIPA 3PCRB 4NYMQ 2Q0HA 2NMVA 2QSZA 3BFVA 4TT3D 2RGNC 4F38A 1EFRA 1G8PA 1WF3A 4TMWA 3Q5DA 2A5YB 3PVSA 3QPUA 3ZLJA 1VYUA 2N42A 4A0FA 2CJWB 1C4OA 3KXIA 3MCAA 3CIOA 3KKOA 2QZ4A 3Q3JB 2W0MA 2R6FA 2QN6A 3DMDA 4RKEA 2J9RA 4AKHA 3K09A 2PCJA 5BW8A 4QGFA 1E32A 2FG5A 3RRYA 3THXA 1EFHA 1T8UA 1UFQA 2GEDA 2PL3A 2ZRAA 4QJ5A 3VTKA 1GG2A 2YVUA 2ZRDA 4A8JA 4NDZA 2QROA 4EAQA 4ZI3A 2A3RA 2OXCA 2QAGC 3IQWA 3LX5A 1NG1A 1SVMA 1JAHA 3C5HA 1VHLA 2EYUA 1LB1B 4URYR 4W5WA 1KNQA 2RGDA 3FHTA 1MOZA 5GJVC 1IXZA 1OT3A 5FTMA 4TMTA 2D3WA 3TSOA 2ERXA 1SULA 2XJ9A 2O8DB 1JBKA 4BFSA 1EFRD 2O52A 821PA 2DFNA 2KJQA 5TMPA 2W6JD 1XXHA 2OFWA 3UMRA 4A1FA 2QAGB 3ND9A 4HAYA 3X1ZA 3LQRA 5H68A 4A2PA 1HH4A 3QEJA 4XSGA 2G0NA 2EU8A 3GFTA 1ZM7A 3SJAA 3WYGA 1VYVA
chains in the Genus database with same CATH superfamily
1MJNA 5COAA 1SXJA 4EG0A 1M2EA 3C3BA 2FFHA 4HEA1 4LXQA 4DV1B 3JSXA 3NBMA 4IIFA 3ZWAA 2V96A 1RQ2A 4FSDA 4QA9A 2ZSUA 2C1EA 3ENWA 2X9GA 1DX4A 3KT3A 4IO0A 3WIVA 3C6YA 2RK3A 4JX9A 4WNAB 2IDZA 4O8ZA 4YRBA 4IJ5A 2XBLA 1GLVA 3A7EA 3BREA 2POQX 5E6SB 3ZCQA 1UC9A 3QHPA 4WZBB 1VB3A 4EHAA 2HA5A 4F9EA 5KI6A 4X93A 4Y6GB 4IH4A 3WJAA 5BPFA 2AW3A 3QVVA 2X0NA 4HS4A 5IK2A 3RC8A 1O96B 1BU8A 1Z4MA 2ENUA 3T06B 1OT5A 1XRMA 1YOVB 3QE2A 2IT1A 2I2CA 4HX9A 2P35A 4RU1A 1GUDA 3I83A 4LZZA 4AUMA 5KTTA 3RYCB 2ZRFA 1ZQ9A 2WPNA 2VPPA 2R87A 4TZTA 4TLMB 4BL5A 4IDQA 5LQMA 2NM0A 1X80A 3IDQA 3G0GA 1OV6A 5EMMA 5KC8A 2C7OA 2GVDC 2EJVA 3LPAA 5C7LO 1PZXA 3H1AA 3HR4A 3DB1A 4CMKA 5CH5A 4FDVA 4HEHA 5J2TA 2EFYA 1KF0A 4E30A 1K66A 4M8IA 1MPTA 3OIGA 3OX2A 4C7XA 4ZDKA 3OEYA 4RVOA 2YJZA 4DMLA 4AMVA 2FEXA 4E2WA 2QBYA 1U6KA 1NUPA 1K7FB 1ZMOA 2ZRPA 4PN3A 2REQA 3T54A 6REQB 5JNWA 2G07A 1BC5A 3WIEA 4BGDA 1X15A 1PLJA 2JAPA 2C96A 2NOAA 2JJYA 3IPRA 4XR4A 1AHHA 2VQDA 4PS0A 5JCPA 2J0QA 3ETEA 4HRXA 4EABA 4TTQA 3GJSA 4BTEA 1P75A 1EK6A 1PR0A 3PJRA 1JIXA 2PRIA 1Y7IA 2AMVA 2GRJA 3RAEC 4EKDA 2VAXA 3EOAI 1LSUA 3U3DA 1Z74A 4EJ0A 1DAFA 3GK3A 1GDHA 3ZWYA 1GGKA 1K9SA 4PV7A 2Y2UA 4RADA 4FXPA 4MV4A 2OSVA 2CHQA 2FPRA 3SKVA 4XWOA 2ZU6A 1MC1A 2XODA 4EG8A 3AYXB 1G38A 2YRWA 3A36A 3AEKA 2WIJA 4RY8A 8LDHA 5JSFA 2CCJA 2SKDA 4RTJA 4FI3C 2W6IA 1PL0A 1UKCA 2CNLA 4I81A 1YJAA 2BT4A 1EGMB 1NXVA 1PE0A 2D2XA 3FTFA 3UVEA 4LRQA 5LZ4A 1FXSA 3CX4A 4JP8A 1MG0A 4HGPA 1GAJA 1V8PA 4QUDA 5EY5B 3NBFA 1KQOA 4U8HA 4AURA 3TPCA 5IW8A 1R6VA 4OHYA 2VRBA 2QRHA 2RKWA 4BLRA 2IPMA 3OLQA 4UDXX 1BSVA 1ESZA 1ODLA 3G0BA 3OQ6A 4QVKA 3WRXA 4CLXA 2A1TR 5C4MA 3LW8A 2J41A 2VLBA 4GAEA 3ZWPA 1AQIA 1F2TA 5FTNA 4DVJA 3ZGOA 3H2JA 5KTPA 1Q1QA 4DR1B 1H5UA 1VBNA 3P94A 3TZCA 1RNLA 1T4DA 4LBZA 3MJCA 2I2WA 2QTHA 2W6JA 1VIDA 4XJTA 3FGNA 1VPTA 1ZN9A 1QHXA 3R77A 4GKAA 2IY9A 1TPYA 1Y5NA 4GYWA 2A4MA 5BN4B 3U7QB 3UJ3X 1EVKA 2Y93A 1JKXA 2O2EA 1J8VA 5AHOA 5F52A 1UXOA 1DHTA 2ZWAA 5J2TF 3TRKA 1DBQA 3T7DA 1O6ZA 3ACBA 3TQFA 3R8FA 4JU9A 4P22A 2BM8A 3E22A 2P1RA 1X1CA 4IMIB 1L1QA 1T8PA 4FFBB 4WLFA 4C3OB 4EF5A 4C6SA 4D43A 5A4JA 3W7VA 3FUUA 3PXAA 1Z29A 3GLIB 5FNZA 1OTHA 3CF0A 3H2SA 1SZCA 1IL0A 3ROKA 3UBTA 1JT2A 1MX1A 1GYPA 2QNRA 5JQGA 3D31A 1NX9A 1GGMA 1X7ZA 1VG0B 5I4CA 3LPMA 4FSHA 2OXEA 1VE7A 4QREA 2FDXA 4Q03A 5F7JA 4ZU3A 3P2IA 3OCUA 2JIBA 3RAFC 2PX0A 3GFRA 2FN8A 3UMCA 2VTBA 4HUQB 1F7UA 5TEVA 3A8TA 1TUIA 4H7PA 4JBNA 4N5LA 1C4WA 1K6MA 2VA9A 3F8SA 3DMTA 1KBOA 1JTVA 3I9MA 3PKJA 4GGPA 3DVRX 4L07A 3ZY3A 3LXMA 4PZ0A 3WKBA 4EQZA 2BSXA 1GRQA 2QD1A 4YNBA 2FPUA 2ZJFA 1UBSB 2GASA 3KDAA 4WKGA 3FYHA 5F5XA 5EUMA 4GP9A 2OB2A 2CVPA 1S2DA 2NUPB 3V7YA 3FOCA 4LZLA 4YJGA 3ZNQA 4NYJQ 2GERA 5BW4A 5FORA 2R47A 1XFDA 2GARA 1CIVA 1Z5OA 3MJDA 1FLDA 3BYZA 2Q8QA 2RMKA 4MVXA 2GQ0A 3R7WA 5GQSA 3EZXA 3KR1A 2X23A 2QV7A 1GR0A 1MA3A 4G07A 2PPLA 2OP0A 1JA0A 1V7CA 5FI5A 3DF7A 1EM8B 2HF9A 2ZU0C 3G9XA 4MWCA 1HEUA 1CETA 1NQVA 4MPRA 2F43B 3HBAA 4K7JA 5FO1A 3AB7A 3KO8A 4UUMA 5ES3A 4FGUA 2NO7A 4LOLA 2QLFA 3TNLA 2E2WA 2H3HA 5SY6A 3R5FA 1GU1A 4MUKA 1VXOA 1L8OA 3BDAA 2C2GA 4J0FA 4PZCA 1XKQA 1XTRA 3I04M 1CFZA 1GOTA 1VP3A 3FCUB 3JATB 3P1JA 3QFCA 5LPNA 4KQEA 3X2SA 3DBOB 1BJKA 2V5AA 3TECE 2XKJE 4OB8A 4ZAVA 1QQTA 2CBXA 3EXHA 4RVHA 5YASA 1UMCB 2R1VB 2Z6UA 1LBTA 3F4BA 4N01A 2PMFA 1ND6A 1A2BA 3QFTA 3RNLA 1RRVA 5EMNA 2UXDB 1UL1X 3B2QA 2GKSA 3MT0A 4XYLA 1AZWA 5KSWB 4KFSA 4DRXA 2NVUA 2JNWA 4Y2JA 5C3MA 1ZFNA 2QM7A 3OJ0A 3GUZA 1D4FA 4V0QA 4F3RA 4YMSA 3BT7A 4MB0A 2EF1A 2Q28A 3D7SA 4YMUA 1GSIA 1P61B 1SR8A 2W37A 3DDZX 1SCAA 1WHTB 2XYGA 3L7YA 4GBJA 4C3UA 5BR7A 1DX9A 1HNZB 4MYTA 2WQ6A 2XCIA 5BRJA 3F7TA 5FAXA 4LV8B 4KR9A 3WIUA 2EZ8A 2QUAA 5KNBH 5JVDB 1M66A 3QYAA 2OP1A 2QT1A 4NYIQ 1K7EB 4C78A 3WLSA 4JB3A 3ELYA 3DMYA 3FUVA 2ASEA 3PFIA 4A4DA 3JQ7A 1GPLA 1QONA 3GGPA 2IU4A 2IF0A 2G04A 2DG2A 4XVHA 1AKRA 5ISMA 2P6RA 1M7BA 4DV2B 1IOLA 2XYRA 2C8LA 1YJ5A 4G0ZA 1XRPA 5ITZA 3HA5A 4W9NC 3RC3A 2CFRA 1ZZGA 2PWAA 1R6BX 1YAHA 1U2GA 4KDFA 2IS6A 4TRJA 3ZBUA 1JHAA 3NTQA 3PGA1 2GB4A 1O95A 2WY2D 5HUJA 3EXEB 1II8B 4Y6LA 2V5UA 4EJMA 4BV9A 2WJWA 4PNHA 1G8GA 1L8QA 2AWNA 4IIBA 5FBHA 5I9BA 3T6KA 3UFXA 3Q9LA 2OXFA 2B5VA 3PRJA 3VNAA 1N2GA 2IQ5A 5EJ2A 2YWHA 2G76A 1S1CA 3K6JA 1V5IA 2CSUA 1XGKA 2HZBA 2XE7A 4PRLA 3D3WA 3GXOA 3IODA 4O2AF 1RXVA 1L4LA 2I8AA 2BISA 1R0CA 3EF1A 4Z3OA 4DV0B 1RBQA 2Q29A 3I6QA 4ZN6A 3A9RA 2J5RA 3OJOA 1C30A 1YQXA 3I01A 3KLPX 4HVLA 3WNDA 3D5TA 5ALZA 3T4EA 1X77A 5B53A 5C8VA 4NYIR 1WE2A 2OR3A 4CLRB 3HLKA 3D5EA 4UE2A 1ITZA 2GHIA 3M5WA 1GG9A 1SKMA 3IIKA 2IL1A 1PHRA 4R40A 4AF7A 1WPXA 3PQFA 3O8OA 5HQTA 3T3HA 2P2SA 1E1YA 4JR2A 2BBWA 4CIAA 2ZVDA 4EYKA 5FBZA 1KKLA 1J22A 1E9EA 3YASA 4TTJA 2OECA 2QD5A 3TRIA 4LIPD 2QUKA 3WWEA 4BQRA 5KQGA 5LCXA 3WNQA 4ZYZA 3FHOA 2EV9A 4C1NA 1DIHA 4JI3B 5DYTA 1M7HA 3P0FA 4DM3A 4KPUA 4I50F 5AVKA 4JLWA 4ADSG 3GUYA 2JGLA 2HRBA 2J3JA 1RQNA 3UMFA 1NJ6A 1KFCB 4X5OA 1A2KC 4KSYA 1UANA 4D80A 1FMLA 1T9DA 5LB2A 3FTEA 1GZ7A 5CCDA 3BA1A 4OAPA 3A6ZA 3PGMA 3SHTA 4AKIA 1M6EX 3OEWA 3HS3A 3IH5A 1KERA 1PTJA 3RYIA 4D9GA 1YZ3A 1W4AA 3TW4A 4CDRA 1UJBA 2VAPA 2I7DA 4W8OA 5T6MA 2J46A 5B3JC 1NNEA 1J49A 4CODB 3PGXA 2XWPA 2YMLA 4UE3S 4KO4S 1NC3A 4MGZR 5JDCC 3KOWA 4PY2A 1UJ4A 5B55A 1T5LA 4ZC1A 3KXDA 1JEOA 2V74B 3IMKA 3LC1O 5DNCA 2HHLA 2QXUA 1F0PA 1D4AA 1E61A 1N8TA 1NN0A 2ZRCA 4MI6A 1QC5B 3O8DA 3UJHA 4C0SA 2UUPA 1YVEI 4KBGA 5AJVB 3UGTA 1RYZA 1XWWA 3BJEA 1IZ0A 2W2MA 3BE4A 1Z2DA 4YJDA 4AJ2A 2BGGA 2IXGA 3UANA 1DC8A 4Y18A 4AN4A 4NJOA 3ZZ0A 2XA9A 1U5CA 2ID4A 1QOZA 1GG5A 4R2JA 3TCXB 4D9EA 3F3MA 3LGSA 3CJRA 4OMFG 4EFNA 4FR2A 1PSDA 3M9XA 2D1QA 4JU8A 5CHEA 2H17A 4GKVA 3KYBA 2YZGA 3PYLA 4PO3X 4XGIA 1CNFA 2SBTA 3AUYA 3ET4A 3M70A 1ZRMA 3JAKA 4UCQA 5EJMA 4LJRA 2DBQA 4MX8A 3ZQUA 4HRVA 5C8YF 1MEJA 2ZPAA 1DXQA 4QLOA 5ALPA 3PCXA 4HH1A 4RYLA 5ILQA 2QUIA 1WUJS 1Z47A 2I4RA 3IHWA 4IV0A 5LP6A 3P2JA 2HIHA 2Y3IA 3V4ZA 1KK3A 3HL0A 4BLTA 5ALYA 3ZXXA 5G3YA 1UPTA 3RADC 3BEDA 4PLCA 3BH7A 4NXMB 3CGWA 3IO5A 5H81A 4AT1A 2ZYHA 1KTVA 2QRPA 1KI6B 3WADA 4AUEA 1A4RA 2K5UA 1OY1A 1UJMA 1UMDB 2PBZA 4KIWA 4N12A 3ZHQA 3UHJA 2GR9A 2ERYA 3W2HA 4I4NA 2JZCA 4UVIA 1FVOA 1BOFA 1F12A 2JAUA 5KU1A 3IXQA 3I01M 1E1CA 3D4BA 3OX3A 2LZ0A 1DAHA 2I6GA 2RJ3A 5J2UA 1I4LD 3WGHA 3TR5A 4OH7A 5FPSA 5A1JA 1WR8A 2IYSA 2V7QD 1DBWA 2IYAA 1RT9A 5KYYA 4GYYA 4TM7A 3MD0A 1DFHA 1QGED 5TT1A 4R31A 2E89A 1W4RA 3ZCRA 1A82A 1GY8A 2PSJA 3JTMA 5CVDA 5P8WA 1DKOA 1NMYA 2WM8A 5I8ZA 3L77A 5E9AA 1M74A 4UM5A 2XMQA 2Y8EA 2WT9A 3DUFA 1L4YA 3HGQA 3DVLA 4DV6B 1PZNA 1NBEA 3EQ9A 5T41A 3RK0A 5C32A 1DBSA 2J7PA 1OF1A 1Q3HA 4OUKX 1E2HA 1YL5A 1UBTS 1XRNA 1ZC4A 1CQJA 2Q3DA 2XRYA 3HHPA 2P65A 4QYIA 1XF9A 5D01A 4BQIA 2ZSAA 5B6IA 3DEJA 4L8YA 1A8IA 4P4GA 1MB4A 2XRFA 3FVTA 4TSRA 3CZAA 4XASA 1A8HA 2HGSA 1I30A 5D6OA 1O6GA 2K4MA 3HCEA 2KI5A 4M1YA 5JCJD 4K8RB 1BGXT 3UY4A 1HV8A 3K9CA 5LA6B 3GP3A 2P75A 4FU0A 2PV0A 3N9IA 1Z83A 4DFDA 1YMQA 3BAZA 3CJQA 5AI9A 2FLVA 1H2BA 1LDMA 1NQTA 2H2WA 3C8UA 3FZGA 4I4TA 4PAWA 2I7CA 4XIFA 4PYRA 1B93A 4C1BA 3J81A 3AOEA 4CV0A 3EQ8A 5FIUA 1NIJA 2PKXA 1E6CA 2PBRA 4OQYA 2DLDA 3T7CA 5E1OA 1ARZA 4AZ3A 2G72A 1XNJA 4BOYA 1B16A 4YTEA 3DDNA 4BGIA 2XYPA 3GYGA 4Y7CA 3GZJA 3MZ0A 4XGRA 1W2WB 4G63A 4QUEA 4E07A 2O2DA 2P0EA 2CNDA 3A6JA 4HAZA 3WK8A 4AD8A 3AHCA 4LJKA 3O9ZA 1KZ9A 1L7OA 3GPLA 2HWWA 3Q85A 4IJWA 4X60A 1P1KA 3KM0A 1VL1A 1QH1B 2VYQA 5HKAA 3EF0A 2QG4A 4IG4A 3R40A 1GFWA 3KT8A 3TR0A 2PX8A 4DZTA 3OIVA 1HUQA 5F21A 1HURA 1MDFA 4KAAA 3TL6A 4NBLA 4OL0A 2Z2XA 1L3IA 1QX4A 4OK3A 4RE6A 4E32A 4I3HA 1WY5A 3JVVA 3KK0A 2BLNA 3KKMA 3OD5A 3NWBA 4I1SA 4I99A 4CKXA 1NMEA 1R15A 4A0GA 4H1TA 1EYZA 5JI3E 5THQA 2Z95A 2VDOB 5E6UB 3E9QA 3AGQA 3D6JA 4AN0A 2ZQYA 2FF7A 1PJ3A 4CM9D 3DFFA 1G2IA 3JQRA 3QSGA 1KH3A 5E1MA 3BRCA 4ZAYA 5CBPB 5B3AA 1G19A 2OQVA 2IA5A 3FDIA 2HPHA 4C87A 2DTEA 2HGZA 1AM4D 3NWOA 2GK3A 4MA4A 3VZDA 4WKCA 4B5LA 1BWPA 2FCRA 2QM3A 3FMIA 1RZUA 2GVNA 4XVQA 4E5KA 1ZD9A 4CEIA 4WNIA 4F96A 3B38A 4M8KA 5J1SB 1IG0A 4G9BA 1P4GA 8ATCA 1YB4A 5AVUA 3BWYA 3DFZA 2L17A 1KSHA 1FW6A 1H0SA 1KO1A 3AM1A 5IT5A 2BMEA 4C05A 4B1FA 3DXYA 3IR6A 5FI0B 5D3MA 1GAEO 4HLDA 4Y1EA 4B8WA 5CP8A 2CY0A 3D3QA 4DLZA 4DR7B 2YNMD 2PZFA 5C1BA 1TZKA 3TZHA 2X4GA 2XGSA 3JQBC 3B7GA 3NDJA 3OPXA 1H5NA 2JI9A 4CIDA 4UNRA 2VF4X 4WGGA 2OAP1 1VDMA 2QP4A 5AKIA 1LNZA 1FYXA 3MWGA 3QTTA 3NC0C 3KOOA 1RCTE 1V1MB 4TL9A 3LHDA 3LT2A 5ILGA 5C4IA 5LJIA 1FFXB 1S9DA 2I1QA 3KHUA 3OFND 1E89A 2FI1A 3CF6R 2HK7A 1CXZA 4BWFB 3PNVA 2KLHA 1IWOA 4M88A 4DDMA 4C0HA 3OQNA 1GQRA 3F7NA 5L3SB 1Y34E 1C3OA 2O8CA 1P1CA 1DOZA 1XA4A 1T35A 3A0RB 1P62B 2BUCA 4MR9B 3H1EA 4ZZ1A 1FMJA 4FCTA 4P84A 5JNUA 3V7FA 1YH3A 4FEYA 4CZ2A 2QQEA 3B3GA 4P83A 2IHZA 1P6UA 1K9VF 3AEQB 4HD8A 1R74A 2ZTHA 4U7PB 4CMHA 1M34A 2QPAA 1QH8B 2JKYA 1ID1A 1KYZA 3AHIA 3DZ8A 3PC8A 3OLXA 4JZYA 1E9CA 1RWBA 1XFAA 1JJ7A 2R48A 1QLWA 3IELA 3O38A 4NARA 3MTEA 4REQA 3RSFA 3I61A 3R0ZA 2Y1CA 3IV7A 2IEGA 2KWIA 4L76A 2O19A 4L8VA 3A6KA 3RIMA 1PWZA 2FPSA 2J6HA 1Z7EA 3X1WA 1S9HA 4UNSA 4F2PA 5IVHA 2TMGA 4G65A 4HC4A 4GDMA 4CDMA 2Q0QA 3HKEA 3PNMA 3JVDA 3F2VA 4IIYA 4MWOA 3F9RA 3DWIA 4XB2A 1IAVA 2JFVA 2XD9A 2I78A 1A9ZA 4X7BA 1PDOA 4CT4B 2JLZA 4K0KB 2E55A 4TWJA 3SN6A 1KK2A 4U7HA 3JWJA 3E3MA 4GECA 4DIDA 4BFTA 2MYUA 4ZYLA 2CXNA 1BEUB 3CPEA 3JWPA 4H7DA 1L5HB 5J5AA 5BUSA 2VUSA 3WK4A 3DONA 3DO6A 2J87A 4KV7A 5LP6C 5EJ5A 3O4VA 3EZFA 2G6TA 1D9ZA 1KI1A 3A14A 3IVRA 1QCDA 1CUFA 4LSZA 4OREX 2ZUEA 2V4ZA 3H9JA 3OG9A 2EZUA 1KEZA 4G0NA 4PFKA 4R6XA 3K0SA 1KARA 1YRAA 5FOSA 4MXDA 2ONZA 4IDFA 4BCBA 4CG1A 3CVXA 1MW9X 1R10A 5C53B 2XSZD 1GGFA 4B87A 2PKQO 2HLHA 4J4TA 3EJWA 2RI0A 1W36B 3G0CA 1JHMA 1WETA 1IJBA 4ZALA 4ZKDA 3IKTA 5D7NA 1E6WA 16PKA 2ZYVX 1V0JA 2FQYA 1RHRA 1AZSC 1VE6A 2ODAA 2WBLC 3EQ2A 3C41J 3NKFA 3RJ9A 3SZUA 3MWEB 5EZYB 1RLJA 1OAOC 1E94E 1UC4B 2HCJB 4X24A 2YXDA 5TVKA 2GPAA 3EW7A 1ZAYA 2B5OA 2OZEA 2XYVA 2QTWB 3V97A 4ME6A 2BDUA 3V4OA 2HA3A 4DGSA 4IFIA 3BX1A 3ICCA 3GFOA 4WCFB 3LBNA 5JH7F 5L4NA 4P5DA 4L6IA 4Q3KA 1WW8A 4P2BA 1UBOS 3C5CA 2ZJAA 2X15A 4IVQA 3N28A 1T1GA 5FADA 1NYLA 2HHJA 2WVAA 3MJHA 2ZUUA 3OMLA 2XRZA 4EQ6B 2ACEA 1NVGA 4GKBA 1GPYA 2W6ZA 2FSHA 2VP9A 3IJEB 3W5UA 4JP5A 5ALOA 1SH7A 3Q3EA 4RHFA 5NLLA 2ACKA 5EJ8A 4I55B 1SB8A 3CA8A 1AN9A 4CKZA 4YRSA 3I73A 5AHWA 2ISSD 4Q9JA 2A9KA 4L5CA 3E7DA 1Y1SA 4KLCA 4QBKA 5CPBA 1A7AA 1KMIY 2WQZA 4GOOD 1LLUA 1YRYE 5F1OA 2CNBA 3VSBA 4EI9A 3VMMA 4C6TA 2A59A 3PEWA 4HAOA 1DJMA 3G8YA 3GFGA 3IURA 5EXSA 2UYGA 1OWLA 1U0JA 1SVOA 3RG8A 2O7SA 3BZUA 3N07A 1A50B 1SVIA 1XZEA 4ALIA 2YCBA 4GO1A 4NR0A 4LF4B 1ZDMA 3QU2A 2CHGA 1XXHE 3ICVA 2WKWA 4G86A 3ONVA 3QXJA 4CLOB 3AG5A 4K6FA 4WJKB 3SSNA 1Z5UA 4LWQA 4B6EA 1LC3A 1SBQA 1BGVA 1DGQA 4KIJA 4CKCA 5AK3A 2IV7A 1XVLA 4DMMA 3LBAA 1J0AA 2SECE 1AQ6A 3SY8A 3NVDA 3AKYA 3RUHA 5ICEA 5C51B 1NNSA 1C5KA 1YDGA 1ZGBA 4MDHA 4BVEA 1WXDA 5JAOA 1OI2A 4G0OA 4OQEA 3JQ8B 4YJFB 2MINA 1JDBC 2R8RA 2JANA 1P74A 3NT5A 1PUJA 4CQMA 2JLUA 1G6HA 4OFXA 3NTUA 4F8JA 2XDWA 4ND4A 4UVGA 4MTCA 1DG3A 2JARA 2JCGA 3KQNA 1FP4B 1GCGA 3HEBA 3Q98A 1O94D 1M7GA 2IZ0A 2QTTA 1LRLA 4N18A 4Y2GA 1NI3A 3WXMA 5ALXA 1KPGA 1UQUA 2AG0A 1E7QA 1FYVA 1ESCA 2XXBA 2JLXA 2RAPA 4W5NA 3ZWCA 1LH0A 1BO6A 2XD4A 1BX1A 3LX4A 3MCWA 4WEQA 3CUSA 3P52A 3RSSA 4WBNA 4PPQA 3MMPA 2YQ5A 1NW7A 3F8TA 3FCSB 4J75A 1FSFA 5BR4A 5DMHA 1W47A 3I12A 4H7HA 5FRDA 3SM3A 2LRHA 4JDUA 5JNTA 1A1SA 5KPJA 1WF6A 1TO6A 4Q6BA 2P5TB 4BZXA 3NBQA 1ZK4A 5AVSA 4N41A 1JHXA 1QG4A 4L5IA 2YYAA 2JIRA 2IH2A 2O57A 3GOHA 3GT7A 4IBOA 1Y9EA 3DTVD 2HSJA 2A0UA 4D46A 4UM9B 4UEQA 3VAAA 4WA7A 2QXTA 1GXSA 4BN5A 1T1SA 1JEYB 5DRTA 2XIJA 5J4HA 4GPZA 1JEEA 3EXIB 3ASZA 1Y9ZA 1CRQA 121PA 3FRIA 3I0MA 2AX4A 3LCCA 1QLJA 2WSMA 4FBMA 4RGVA 2WVJA 5AXAA 2DERA 2IYTA 2JGAA 4HWPA 1GGEA 1W4LA 4E51A 2F7SA 2P30A 2NZUG 4WRRA 2IOYA 1CUDA 1RS0A 2QN7A 2C2ZA 4A8JB 3DHNA 3ANXA 1PNRA 4TKMA 4EAAA 1L5KA 2FQWA 1W9HA 1ZP6A 3N7TA 2P90A 3VR1A 3CKLA 3K2BA 1S01A 2ZCUA 1GO2A 1LV8A 4BEVA 1U1GA 4U00A 2RD2A 5F77A 2R6CA 2IYRA 4XD7A 1XSEA 4XCVA 3AIMA 3TGPA 1YR7A 3MLEA 4J03A 1NVEA 2ZB4A 1WULS 2PX5A 2WFLB 3JU3A 4WDRA 3MWJA 4XW2A 4RQTA 3SXJA 3ZCSA 1R0WA 3HK2A 1LCIA 3QVOA 3RBVA 1F17A 1RZRA 2IYLD 5DBIA 3ZWNA 4JBLA 4DQXA 4RFSA 1U2EA 1CPYA 3DAOA 4JIMA 4FYWA 1LBEA 1T5TA 3C4JA 5H3HA 3S28A 2FPGA 3N8HA 3VFDA 4BMNA 2XNKA 3PKIA 3V6MA 1JU9A 3GBVA 3ZEIA 2AIRA 2BFBB 4L8FA 1QFZA 1OLUA 1YBVA 2HSZA 4MDEA 2QY6A 4MICA 3JQCA 1A5BB 3PIIA 3G89A 1E7RA 4R2XA 2Q4TA 1CUIA 4HQFA 4BMSA 1KZ7B 1JTFA 3V8NA 5BV2P 3WKDA 1VKZA 4BJ3A 1IFXA 4N0QA 1NSFA 5E9JA 4F56A 2WWIA 4CMCA 4J9VA 1C7FA 1KU6A 4PZPA 1C8BA 3RC2A 1T9CA 3CEHA 4JI7B 5BSVA 4C14A 5KYUA 1ZA1A 1F1JA 2C4MA 1K7CA 4LMPA 4O1MA 1VOTA 1QG0A 3GUVA 1JKIA 3I2YX 2PZGA 1IM5A 4DQKA 1E79D 1A9XB 2PH3A 4XFDA 1PV4A 2JL1A 4G25A 1NN1A 1CUXA 4O4LF 4FDTA 5LZ5A 3OQMA 3ZWMA 3SDZA 1KDTA 1RSZA 1GNSA 2P3SA 4LZPA 1WPRA 3U4QA 1PK7A 5DNVA 4R0MA 3TX6A 2GN6A 2R3SA 4H2DA 1RR6A 4E2XA 3ZDFA 1MV8A 2FWBA 2MYNA 5LNK1 3KJFA 4QTUB 1IVNA 1GV0A 1TF2A 2YIDA 3O4GA 1C7QA 1M2OA 1TK2A 1NSYA 1OFGA 1WJGA 1C7JA 4GLBA 2PLNA 4LJ6A 4BVGA 5IWCA 3UCFA 3H97A 4LWPA 2PUEA 3G2OA 1OIXA 4A0SA 1U7PA 4PSDA 3V9PA 1FMTA 2XVXA 2VHJA 3NHLA 1QGDA 1WDWB 4L57A 2GEFA 2E1PA 4QE3A 1MGOA 1ORTA 4Y9DA 3VTAA 4DLNA 3W2FA 3IP5A 3A2LA 1XPJA 3B13B 1Q0LA 2IWRA 4GM1A 1KJ8A 1JG1A 2GMWA 2BMAA 3MTAA 4FE4A 5IC6A 3RVQA 5AIBA 4DBLC 2Z56A 1EJBA 2IITA 2WG0A 1X38A 3DAGA 2Q6OA 3QEMA 4URHA 4WA8A 2WK1A 1TLTA 2W98A 4JC0A 2D0PB 2ZVPX 1NQXA 1NFFA 1C0EA 3UKJA 4BKMA 1TMGE 1O9HA 2R84A 1VIVA 4W63A 4YXWA 3F1LA 3NHBA 1UJ2A 3HBMA 4DUPA 4E21A 3U7EB 3NP9A 3WSTA 5AVYA 3RM3A 1NW6A 1P5ZB 3CG4A 3CMCO 2QYSA 4U3JB 4D3SA 2Q49A 3CUUA 1KFJB 3FUWA 1DU4A 3AOGA 1W5TA 2I87A 3FVWA 3H8WA 1R0SA 3HDTA 4ZTBA 1X1RA 1Z88A 1L5SA 1Y6GA 1CUVA 1Y81A 4ON9A 5EKSA 2WE8A 1Y1QA 2B5WA 1QANA 4TN1A 1S0UA 4DA9A 4EO7A 2G9ZA 1PEKE 3B3QA 2QRNA 3M6MD 3KOZA 4L6CA 2B25A 2G8NA 5IT9A 2I71A 1YQQA 4ID9A 1VMAA 4ZYVA 2Q41A 3UENA 3O2SB 1A9TA 1QV9A 1RAAA 3JRWA 1OBCA 4WMLA 3WQSB 3LP5A 2R6JA 3RIGA 1KOGA 1QJ4A 2FGKA 5HFJA 3UOWA 4QXMA 3N2IA 4YRCA 4LXHA 5KNCA 1K5DA 4UM8B 3QITA 2IX3A 3VC3A 4CR6A 1QTRA 1X7XA 5ARCA 5HIMA 1MO5A 3T5DA 2WB4A 3DOUA 2JS7A 2AZTA 1BHO1 3AVOA 3R7SA 3RTAA 2DH6A 4DC0A 4EY7A 2BGMA 4Q1CA 4EFKA 3TKLA 1XTIA 3OY7A 1WU8A 1GCUA 1PGQA 1ZL0A 3PIDA 4A92A 5REQA 1Z7BA 4GMHA 2IY8A 3HN6A 5BQ3A 2VJQA 4R7GA 1ZCFA 2PWBA 3SWWA 3IPYA 1VM6A 1T3SA 4LHWA 5EOVA 4BQNA 3E48A 2NVWA 1TT5A 4EGQA 1PG0A 2W93A 1C1XB 4LDJA 5CTAA 3OZEA 4V0OA 3WMRA 2PGOA 3TXYA 2DFTA 5B7PA 2QYTA 2FPIA 4DLTA 4TUYA 4YO8A 1C2YA 1XNRB 3SMVA 4DDTA 1WCYA 5FV7A 3IMGA 4G09A 2IRWA 1DTSA 3A4NA 1B8VA 3MGKA 4RJJA 5LKAA 2B7LA 2ZUSA 5JY6A 4ZZ0A 2VHQA 4JK3A 4DPLA 2BBTA 5M3BA 1RTKA 5EIXA 4LKOA 1K3UB 3TD6A 3WBJA 4OUDB 4QULA 3ZW7A 4BNKA 4D92A 5K0LA 5BN1A 4MQBA 1EE2A 3G2PA 2HBYA 4E1BA 4OSEA 1W0JD 4MQLA 1PZEA 2R1ZA 4ZQHA 3WGMA 5BPHA 1E0JA 3CQ9A 4NH0A 3BTSA 3RRNA 1RI3A 1Z2PX 2ZE5A 4OPMA 4Q4HB 5EJ7A 1PG5A 7AT1A 1X9IA 4LHEA 1K8QA 4QUHA 2DBZA 1JR2A 3F5QA 1V35A 1W48A 3FI0A 4PHFA 3K0AA 2BCJQ 2QUHA 4EM6A 2V03A 3JR7A 5H4GA 2GHRA 2XI4A 3FMGA 4L75A 1W1WA 1J8FA 1Y7TA 1U5AA 2W58A 4M4SA 2JGJA 1KGSA 3S7ZA 4QAQA 4M89A 2VEDA 2OHHA 4AG3A 5JXWA 1ZH4A 5ED0A 4AMBA 1TPZA 5A7GA 3FPBA 3IA2A 1WP9A 2ZTSA 2LNDA 4EYEA 2VUTA 2WAOA 4X8LA 1WAMA 2WJ6A 2A0KA 4L28A 2WU8A 1U81A 5HDBB 3G5UA 3IAHA 1C3EA 3QMWA 4HDRB 1GWNA 5HGXA 2W4QA 4DWVA 5CB6A 2PRKA 1X3LA 4JT9A 3SQMA 1M5RA 1JIKA 3F0TA 4XIJA 2FPPB 3GLGE 1IUKA 1HM5A 4ONEA 4BBJA 2WIGA 4CM8B 4IOJA 3ZK7A 2YIJA 4PGMA 5GGXA 2ZSHA 1KEEA 4XQCA 1DDGA 2OO5C 2EGGA 1O5OA 2G88A 3V2IA 2JCBA 1MN6A 2I6TA 3D81A 3EZGA 4UTXA 1Q22A 5HJ2A 4A6XA 2VKTA 4FB5A 3R5TA 2Z57A 1YZKA 4BNXA 4AO8A 1N5KA 1C7IA 4MW2A 1M8FA 4ZGGA 2X2FA 2HL6A 1RFGE 4KAXA 1RHMA 4RX1A 3KV1A 1XTJA 2J9FB 1IOZA 1BE1A 1BVRA 1RYMA 2QK4A 2WINI 3L93A 1DJLA 1CQIB 4Q66C 5EWMA 7ADHA 3R3HA 1YS2X 3K70C 2H4JA 2NSDA 1KQPA 1LQTA 3DDUA 2AXEA 2H6EA 2X8WA 4HQKA 3RFVA 2I67A 3AMVA 3JQ9A 1FX1A 3OIWA 1N9GB 3P9CA 4QGBA 2G9QA 3AESB 5E4FA 3BEOA 4A8JC 1TZBA 2QGZA 2GBPA 3BB3A 3IILA 1L4KA 3BMNA 3L0IB 3LDAA 2V7QA 4M1MA 1QHNA 4A0RA 1TD9A 5B2FA 3O3NB 2C7VA 4K9LA 4DDUA 4LF6B 4U1RA 3T1YB 5IYZB 1J25A 1YGPA 2WMNB 4KE9A 4D25A 1AHNA 1M0TA 1SOUA 1TCAA 4FX2A 4E13A 1DV2A 1FS6A 3GRCA 5A3QA 5FFMA 6NULA 2DC1A 4RVDA 2KQUA 4RS4A 3DE5X 3MIIA 1O0CA 4GR5A 5J63A 3FF4A 3DHWC 2F9MA 1QP4A 5CT4A 3L6RA 3LQFA 1WHSA 3NOOA 4I55F 5FHQA 1M2KA 1QRAA 4GHWA 1QFXA 3S99A 4EL0A 3K94A 3OZWA 1WVIA 3HYCA 2C8KA 2O0JA 4M0CA 2AKAB 4PAQA 5DN9A 5FNVB 1Y3HA 1J8YF 3M1IA 1Z33A 2IUFA 5A2GA 2P1ZA 1H6BA 3DE2X 4LY9A 3ZJYA 1D5WA 3OCYA 4R68A 2J0UB 2VT7A 3HDHA 3TLYA 1VLMA 2VZLA 5KWJA 4UMVA 3C4QA 5IF9A 4FFVA 5JRJA 1H0HA 2OM2A 4X7MA 4RCVA 2E18A 2HIAA 3HCBA 2AMJA 2IXAA 3UHOA 1IONA 3M0EA 1K8RA 3GFFA 4BBZA 4N76A 1DBRA 1Q3KA 4TL6A 4D8YA 1Q83A 1E7MA 1S8OA 1W44A 1XL1A 4IIXA 4ZVRA 4DCMA 4HDNA 4KTTE 2LE0A 1NNUA 2B4TO 1CNMA 1GTG1 2CLEB 3S2SA 3QTLA 3HA3A 2V45A 4FYVA 1OXKB 4YH1A 4PIPA 3TVYA 5B4TA 1XAJA 3GZTB 3GLHA 1DAKA 1J00A 2KPOA 1EP1B 1DO2A 2FR1A 2ZS8A 1FOEB 2ZYWX 4CFZA 5EZYF 4IDEA 3AUSA 2VHEA 4YUZA 1H2XA 2NQTA 2HTEA 1VMDA 3ER8A 1ZWLA 4YUXA 3S1AA 1HDYA 4NAHA 3H8VA 4Y9TA 1G59A 3U16A 2JCSA 1DIGA 3ANTA 2WNSA 1KO4A 1XMXA 4PX9A 3UAOA 4IQFA 1QGUB 4Z6KA 3JR3A 1RJWA 5HJ7A 2JI4A 4EY6A 1MORA 1VPWA 2DHRA 1WNFA 1YUBA 3L43A 2LV8A 3FDXA 1ST3A 4ENWA 3AQIA 5GY7A 2GGSA 5HKOA 4GD3Q 1HYQA 2CZGA 3VZBA 4UFPA 4W1SA 1PBNA 3K0EA 1PZMA 2HT6A 1GZHB 2DFDA 1MIOB 2F59A 2DUMA 1FFHA 2XWBF 4KPUB 3ROXA 2BEJA 2DQKA 1L5LA 3PR1A 1J0CA 5T4EA 4F7WA 3K0CC 4JIGA 3A4VA 3BRQA 3U19A 2F8TA 3Q6MA 4GLLA 3VR6H 3KZNA 1L7VC 3PQ2A 2PQ0A 2C84A 3ZI4A 2G1KA 4MPJA 4NJMB 1WY7A 5JTTA 3UYLA 2BMDA 4NCJA 5E4TA 3N6VA 3RVOA 5CLJA 3W3ZB 3ORHA 2ABWA 3H4IA 3D4LA 3EZ6A 3INRA 4L4RA 4Y3UA 1FJGB 1VTKA 3OTOB 1OYYA 1DWOA 3QXHA 5D84A 4F9TA 1NQUA 3ZS8A 3KJNA 3SQXA 3PJFA 3FPHA 3UTCA 2N46A 1RWMA 1E3EA 3UUWA 3OE4A 5HJEA 2FUEA 1U7UA 3G85A 4OQ4A 2R4UA 3AEZA 5E1DA 2FAXA 1QPGA