4IRUB

Crystal structure of lepb gap core in a transition state mimetic complex with rab1a and alf3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
170
structure length
170
Chain Sequence
EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Legionella pneumophila GTPase Activating Protein LepB Accelerates Rab1 Deactivation by a Non-canonical Hydrolytic Mechanism.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase/hydrolase
molecule keywords LepB
total genus 53
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4iruB00
1NP6A 5C1BA 5FR1A 4GRAA 4DIEA 1QHHA 3A6PC 1J70A 4FD2A 5BW8A 3WP0A 3SC3A 4DCSA 4Q7MB 3LO5A 4LYHA 2D2FA 4ZV4A 4QGAA 4W5HA 4XIGS 4X8OA 1KJZA 2PCLA 3CPEA 4DVGA 1Q0UA 2ZS7A 2H92A 1SVKA 1KI8A 2GK7A 4A1FA 1J7KA 2XTMA 3P20A 1O3YA 4HAXA 4UNNA 3A1VA 5ELXA 1G4UR 1GL6A 1NSTA 3GJ0A 4GP6A 4BLPA 4TYQA 4W9MC 1W0KD 2A5GA 2BMEA 1LFDB 2ZYWX 2XTZA 1KI3A 1NKTA 4NH0A 4MYTA 2YWFA 3BE4A 2IUSA 2BMDA 2IYZA 5KSYA 3SFVA 1SKYE 2ZQ5A 2CL0X 5JZVA 3BC1A 5HPYB 5CB6A 5CB8A 3AF1A 2Z43A 4DLTA 4LHVA 1GNRA 1N2CE 1CRQA 1JI0A 3KX2A 3ADCA 4I99A 3GJ5A 1E2JA 3AVUA 1D9XA 3U61B 4L4UA 1QF9A 2CHQA 1AK2A 2WV9A 4HAVA 5BN5A 5B57C 2BBSA 2VSXA 1X6VA 3K09A 2NPIA 3VTKA 4CRWB 1F6BA 2V1UA 1CR2A 1OIWA 2GA8A 3IO5A 1PLJA 3SYNA 3TW8B 2O8DA 5DH9A 1ETUA 1SHZA 3K53A 2AK2A 2ECKA 2GHIA 1DPFA 5H1YA 3K9HA 1RJ9B 2OT3B 3GLHB 3C5HA 3QKTA 1ODFA 1HH4A 1R10A 1T6NA 3WBKA 4EPYA 3U4QA 2KI5A 3HPRA 3B9PA 1M74A 3TAHA 3KL4A 3RS7A 2ZJBA 2ZVPX 4MYUA 2ANCA 3IQXA 4JLBA 4GP7A 3T1VA 4DLUA 4RFSA 1RJ9A 4F4JA 2ZI4A 2Q9AA 4MKIA 5FOTA 5JWHA 1DE0A 2NOAA 3FMPB 2PLFA 3E5HA 2HUPA 1OFHA 3AF0A 4DDTA 4TZ6A 1NLFA 1G7SA 1MR3F 4RZ3A 1OXVA 4IOKA 1G21E 1XZQA 2Q3HA 3GLIE 1S9DA 4AG5A 2HJVA 4AC9A 3LD9A 4P4SB 3DZ8A 2WHXA 2GVZC 2ZRJA 4LV6A 4Z1MD 3B85A 2LCFA 4TN1A 4E5UA 5A4JA 1S2MA 1JR3E 2NO9A 5EZ6B 3N2EA 1SKYB 4GOKA 4TL8A 1KO8A 2GEUA 2VPPA 4LX0A 4HDQB 4I1UA 2J87A 2AR7A 2ZI5A 3AVYA 5BYJA 4LPSA 3UWKA 4LJ6A 1K5DA 3S1AA 4A0GA 5GJWC 4CGZA 4AURA 2C9CA 4C0LA 4P4TA 5J40A 1E0SA 4UNSA 1OH8A 5M04A 1MH1A 2WWFA 3QPVA 2W0SA 2PH1A 2QI9C 1IXZA 2WWWA 1GM5A 2YC4C 2GKSA 3U7FB 3BWDD 1BIFA 2I3BA 2FPLA 1FQKA 3QXSA 1G9XA 4C0AC 3AP2A 3KQUA 2HF9A 2WJHA 4HAYA 1OKKA 3U7HB 5E95A 4PQYA 4IXMA 2VP4A 1IM2A 4I4LA 1R0XA 3DPUA 1YE8A 4ZDWA 4B35A 4QKQA 2FX3A 4G3XA 3IIMA 3GJXC 4FMBB 3RSLA 4IDPA 4BZQA 2C8VA 2GCNA 2IA5A 3VKGA 3A1WA 2CMKA 4QHYA 2WAXA 2IWRA 2ZJ2A 1U9IA 1XFAA 4KLNA 3VQTA 2VHJA 1T3SA 1P75A 1WMSA 4QGGA 1H8ED 2Z0MA 3GLGE 1BO6A 3H4MA 2CDNA 2ZRCA 1QG2A 5FBVB 1XP8A 5JLJA 3I5YA 2IWHA 4JMPA 1ZRHA 2UZ3A 1OXTA 1XRJA 3GLGA 1TF5A 4IRUB 2DB3A 1E4VA 2YJTD 5DN6D 4JVNA 4XVUA 4CEIA 4C7OB 2WJIA 2R6AA 4HAZA 1U98A 4A0HA 2QAGC 4AIIA 2IYYA 4Z54A 1LNZA 2C78A 1VCOA 2NO1A 3R9WA 4TT3A 3FHOA 1Z28A 2QP4A 1GKIA 1VTKA 3BERA 1E79A 3Q72A 5FOSA 5SZIA 4A8JA 2V7QA 4DKXA 2V7QD 2ZR9A 5FUYA 4M22A 2ZR0A 2OCPA 4OQFA 3UG7A 2AXNA 1VDZA 4AG6A 2ZJAA 3DOFA 4WAUA 5HZHA 3LBIA 4I1SA 1NY5A 3A58B 1W36D 3DOEA 1HQYE 3U7GA 3PVSA 5JFGA 3CR7A 1UEIA 3CH4B 4WZ6A 3RS4A 3T35A 3R8FA 3CR8A 2G77B 4JS0A 5E7MA 2R6DA 3CWQA 2ZM5A 4EJSB 3GPLA 2WTUA 2UVQA 2C5LA 4Q9LA 2FV8A 1US8B 4HDOB 2YINC 4DEXA 1XCPA 4LJ7A 3GLFA 3EZFA 2GTPA 3LH5A 3L2OB 2RCNA 4U5XA 3VU9A 1EG7A 5DHFA 1A5TA 1P2UA 2QBYB 4KAXA 2J46A 1EFHA 4PO9A 4PPGA 1SXJC 3OIYA 4V0NA 2BKUA 3P27A 4DLRA 1W49A 3QXHA 4JT4A 1J2JA 3KXIA 4PQFA 1KGDA 1E6CA 4P3YA 1QHSA 3J81k 4ZIRB 4LYAA 1E2DA 3UIEA 1XJQA 4Q7KA 4URYR 1G41A 1FX0B 1OE0A 2JIZA 3CBQA 3OAAA 4WXPA 5JCPA 1E9EA 5IDVA 4TTRA 2OXCA 3FMOB 2XNSA 1KAOA 1U0JA 3TE6A 4TL6A 4AKHA 2VP6A 3K09C 4LK2A 5GJCA 4BUJA 1XPOA 2R6GA 6Q21A 4NYJQ 2BMFA 1XB2A 1ZD8A 2WVJA 3QG1A 1SQ5A 4B76A 4B71A 1NVVQ 1IBRA 3T1TA 4WVFA 3H2YA 3PCRB 3FKSA 5DN6A 5F9HA 1DS6A 4BLTA 4PSVA 3F5FA 3U60B 3JVUA 2QMHA 4PANA 2WJYA 2DHRA 2CK3D 1ZC3A 1HYQA 2CK3A 2VEDA 4TYNA 2ZI6A 4OHWA 3LFUA 2GETA 4V0MA 2DFTA 4NTZA 4C0HA 3AP3A 1SVMA 3K9GA 1N6KA 3IO3A 1M1YE 4IFBA 4IVPA 4A6XA 2FH5B 2QORA 2J41A 1N6RA 4LJ5A 4FCWA 2VHQA 2DWQA 3K0AA 4AD8A 4PHGA 4YDSA 4F7WA 3B78A 3AVXA 5KTYA 4L9WA 2ZU6A 4RFVA 4B75A 1Z6TA 5AJYA 1JJVA 4TTPA 5L3VA 3O8CA 4EJSA 1NLZA 3TK1A 2FNAA 5KOYA 5EUQB 2EVWX 2Q21A 1ZD1A 3A4LA 3H1TA 1G7RA 1HQCA 3IEUA 1SKQA 3HR8A 4URVR 3CNOA 2W00A 621PA 3THYA 3ZVNA 4A15A 3K0FA 1NKSA 2CCGA 1A82A 1Q3TA 3CB4A 4UNRA 3NIBA 4JYBA 4AYTA 5JBQA 1G17A 1R5BA 2GBLA 2VQSA 1DAGA 1NJFA 3QXCA 4KLZA 1DAIA 2XXAB 5FL3A 3KZ1E 1Z0IA 3EC1A 3OHMA 1S96A 1X3SA 4PTLA 3GP8A 2PZEA 1FP6A 3C41J 2XZOA 2BBOA 1QHHB 2QRZA 3B82A 2RGXA 1TNDA 5AUNB 2JJ8A 3OF5A 4IKEA 4A36A 2QAGB 5FBQB 5F98A 4MH0R 4YMSA 3BB1A 2ZSDA 4HUQA 5LB4A 5HE8A 2FFQA 3MJHA 4XWKA 4J0QA 2YYZA 5EE3A 2F1HA 4Q9HA 5CM9C 1MRSA 4DCTA 2ODEA 4JLOA 2QP9X 3PEVA 3WHLA 2OCBA 4QNRA 1RC8A 1CRPA 3QY0A 3M0EA 2G0TA 1IN4A 2DWPA 1LV7A 4Q00A 4C30A 2QGZA 3AQ4A 2OFOA 4EIWA 1E0KA 4JKYA 4OL0A 3HU2A 3N70A 2OFXA 4KBGA 2KBFA 3WMEA 2MMGA 4MUBA 4WZBE 3VU9B 4EPWA 4B3DA 2LWIA 2AFHE 4DIDA 3ZQJA 2BC9A 1KZ7B 1AS2A 1E2GA 1KTVA 3F3YA 1Z6XA 1CJVC 4XTCS 2EFEB 2C96A 5EP4A 1I2MA 4JVSB 2GJ8A 4Q18A 1PVOA 1FNNA 3RAPR 2QU8A 2CNWA 5KNCA 3CX8A 2IUTA 3NTUA 2OZEA 4JLVA 3EZ7A 2HLDA 4M0LA 2O0HA 4WW0A 3AUYA 5HCNA 3C4JA 3EIQA 2I4IA 1EFRA 3I73A 1KK1A 1DBSA 2EFDB 4NHOA 4G5SA 1AZSC 4JKIA 2ZJZA 4E03A 2RGBA 1DVRA 5JHGB 1P6XA 5DIFA 4RY2A 4A8JB 1DG3A 2C04A 2DBYA 2MSDB 3PG5A 3FKSD 4Y0VA 3TUZC 3VHLB 3AGQA 1COWA 1W47A 2GXQA 4O2LA 2N46A 1MV5A 3HU3A 1GILA 3TKLA 2V3CC 3C14C 1WBBA 2A3RA 2CL7X 1HV8A 4D4KA 4FCTA 3GFPA 1A2KC 3LXRA 3PUVA 4RD4A 1G3UA 4FCVA 1E69A 3LXXA 2Q9CA 1XXHB 1Q1BA 2ZSFA 2BEKA 1KDOA 4KVAA 2VO1A 3FKQA 4LGMA 1VCMA 4M2LA 4LV8B 4MKGA 1A1VA 1EGAA 2GAOA 3WRXC 3WYAA 4X8HA 4MGZR 2JIZD 4URWR 1UJ2A 4BFWA 1G18A 1ZCBA 4G0NA 1QHYA 2YZ2A 1HTWA 2EQBA 2GXUA 3MFYA 4F92B 3HP1A 1QHNA 2FSHA 2VHUA 4R71A 2G88A 4BFTA 1JAIA 4US2R 2ATVA 1PJRA 4GMDA 1LVGA 1UBGA 3CNNA 3AVOA 1G5TA 2YV5A 1IN8A 3I3SR 1Z29A 1CIPA 2NG1A 3LA6A 1QZXA 1JALA 2R65A 1AQYA 1YRBA 2J0UB 4PHTA 3FVQA 4KJZA 3PFIA 1DELA 2ONKA 3GLIB 2BEJA 5C4MA 2IL1A 4LHWA 3MWLA 4TTQA 3QBTA 2B92A 3W34A 1KNQA 2H8KA 3SOPA 1NVWQ 2X2EA 4EQ6B 1NIJA 2OEPA 4IVQA 1ZM7A 1OH5A 2ODWA 2ZYUX 3MD0A 2CLSA 4RD1A 4TQUS 4AYWA 1JNYA 2BJVA 1D9ZA 2GVDC 2QG6A 4TMKA 4EFNA 4E22A 1CEEA 4KFRA 3P1JA 2FFHA 3K0EA 4YMVA 5K8UA 5DI9A 3I5XA 2FF7A 5SZKB 3QXXA 3VR2A 1XMVA 1MO5A 2DFLA 3IBYA 1BH2A 2VL7A 4G5QA 2IC5A 1HE1C 4RD2A 3TR5A 5C18A 4BRWA 2ZITA 5L3SB 5B30A 3ICQB 3I8SA 5KO2A 2QTVB 1E32A 2GCOB 4LYJA 5EXPA 3EPLA 2ZANA 3QPUA 1FFHA 1YRAA 3EWSA 3B60A 1S4QA 2VP2A 2V54A 3T5GA 3MMPA 2JLVA 1HA3A 4V03A 2ZE8A 4Q5IA 5FI0B 4D4MA 5BN4A 5LD2C 2GCOA 4N0DA 3MWJA 1GWNA 4KXFB 1AA9A 1DADA 5JRZA 3CF6R 3ICEA 4Q4HA 2P6UA 2ZUBA 3M1IA 4LJ9A 3ZDQA 4M1SA 4YDHB 3BD9A 4LJ8A 3W6NA 2GEDA 1UM8A 1Z3IX 2ZUCA 5TARA 4XD7D 4GZLA 4NYMR 3UK6A 2QMOA 3MWKA 5LB2A 4YXWD 2ZJ5A 2IX3A 3ZYCA 2OESA 2BCJQ 4MGKR 2CVHA 4Q4AA 4ZI3A 5FTMA 3K70B 2XB4A 3K0SA 1N6OA 5G3ZA 1II8B 3U4QB 1Z8FA 3RNLA 4CT5A 5JEDA 2LKDA 1UBCA 2DR3A 3ZH9B 1XMJA 5EXXA 2H5EA 3MLEA 2WSSD 4Q02A 3KB2A 1E9DA 1LB1B 2FFBA 4UQOA 4MRSA 1VG0B 4US1R 5JECA 3AF3A 4NBSA 1H8HA 1IOZA 2PLRA 3SR0A 3VHXA 1NJGA 1X8KA 1JQLB 2PX0A 5JHHB 1P2TA 5L8VA 2RGNC 1E0JA 4TWZA 5EJEA 4KHZA 3UWOA 2JEOA 2NPFA 2C03A 2CXXA 4P31A 2Q9BA 3A4MA 4PO8A 2J0UA 2W6JA 4JL8A 3NKVA 2OG2A 2FMXA 4AI6A 2QAJA 4A0RA 4Q7LA 1FNMA 2A5JA 2PCJA 1T9HA 2GBLC 3ZS8A 4Q1BA 3W5IA 2IYRA 2REOA 1N0VC 1SHKA 3D7MA 2BDTA 4C0JA 3ASYA 3LVQE 1CBUA 4U02A 4CW7A 1Z47A 4DCVA 5GADl 3KJIA 4PO1A 4CEHB 2QE7A 2GZDA 2C2HA 2OE2A 3NH6A 1Z0DA 4PC6A 4BLQA 3SBEA 2BM0A 3LQRA 2RGCA 2WPDD 4G5OA 4AYXA 3VFDA 2QA5A 2WWIA 1LW7A 1JEEA 4M1KA 4WOPA 3SE0A 1UDWA 1SXJD 3L8YA 3ONWA 2O8CB 4OK5A 5JMTA 1NG9A 2DCUA 5EE5B 5D3MB 4B3FX 1W5SA 1UKVY 3TRFA 4Z1MA 4DB2A 3KFVA 1ZIOA 2R6CA 3K8YA 5EQTA 3SN6A 3DM5A 1ZVQA 4R9UC 3FB4A 4ZDJA 3ADBA 1T0JB 1RKBA 1IJEA 1EK0A 1H8HD 1OSNA 1Z08A 2ZRPA 2PX3A 4CVNA 4HB0A 5BYKA 4JSTA 1OFIA 3LQQA 4RSGA 4QJ5A 4U00A 5CK4A 3NEJA 4FI3C 4Q19A 2OBLA 1GNPA 3NDBB 3QPWA 5FOWA 2GEVA 3VNUA 1RRPA 1PLLA 1Z83A 4NCNA 3DEFA 4C0BA 1G16A 4DB4A 4FIDA 5UKDA 1AIPA 4M9XA 1YHNA 3ZZ0A 3X2SA 4R7ZA 2GZAA 1W44A 2BMJA 4TYWA 2OBMA 2GWHA 4IDQA 3R9IA 3GQBA 1JPNA 4LBWA 1XZPA 2VSOA 4FWIB 1WCV1 4V0KA 2B7BA 5GVRA 5F9FA 4HLCA 2MMCA 1ZYUA 2OLJA 2HXYA 2GXSA 3HJNA 1IQPA 1U0HC 4GDFA 1OXUA 3PEYA 5FUXA 4BEJA 3ZIAA 1W0KA 5TXGA 2GNOA 2BKEA 2K5UA 4X8LA 2FPKA 4Q7JB 1HEIA 1SXJB 4TMWA 3DDCA 3K0CC 4PAOA 4MGIR 2F9LA 1UKZA 3NG1A 1J8MF 1ZJ6A 3MG9A 5DHAA 5BQ5A 3W3ZB 2AKAB 2V8OA 2YNMA 1TUEA 1NLYA 2BBTA 4Q21A 1CF4A 2ASEA 3AEZA 3L0IB 3T12A 4A2QA 4OKSA 2CHGA 1J99A 2XGJA 2IYLD 2XAUA 2IF2A 3L43A 4IOLA 5F3WB 4HLDA 4O25A 1XX6A 5FTNA 3FE2A 3WXMA 4Z51A 4UNPA 3Q9LA 5EXTA 1BKDR 1Q1EA 2ODNA 1OYYA 1XEXA 4A2PA 4DT1A 3QI2A 1NRJB 2NZJA 3DO6A 3SNHA 3E70C 4LC1A 2C98A 3WBJA 1NN3A 1ZM9A 3FWYA 2XX3A 4QC2A 2IXFA 4E07A 4IEIA 1EWRA 2G1JA 2GK6A 4EPRA 5CJ2A 5FH9A 4PAQA 3AVTA 2YOFA 3PEWA 3NHBA 5FUWA 2G6BA 4ON9A 5AJWA 3GEEA 1A2BA 5CIWA 2O8BA 4OHZA 2A5YB 1WB9A 2RGAA 1F2UB 4HATA 1XJCA 2NIPA 2ZRHA 2Z4SA 2QENA 1OLOA 2IYSA 2YOHA 4HDCA 5D3QA 3LNCA 1Q1QA 1T5IA 4OK3A 4Y0AA 2IYQA 2ZTSA 4JJKA 3GLFE 1JPJA 2Q3FA 3I8XA 2BV3A 2AD5A 1XMSA 1G64A 2GESA 3KJHA 5GJBA 1XF9A 1II8A 4EAQA 3B1ZA 4TMTA 1MO3A 3CWZA 2N42A 2E9SA 2V55B 2ZVQX 3W8NA 5KUTA 1KDPA 2IYVA 2D74A 4H9GA 4ASUA 1NVUQ 1XEWX 2C9YA 4KFTA 2VRWA 4ACAA 1E9AA 1FUKA 1I4TD 4LC0A 4K46A 5KSOA 3U3JA 3N5CA 4FMCB 4GL2A 1ELOA 2Q3MA 5JS7A 2IS4A 3L82B 3VR3A 1X8JA 4O3MA 3ZLJA 3NXSA 3CRVA 1G291 4TT3D 4NZYA 2WWHA 1YZTA 2QRNA 3FGNA 3WY9A 4A6PA 1Q20A 3DZDA 4Q1DA 2ZETA 5KDLA 4JLKA 3QIAA 2ZI9A 4LJYA 3U6BA 4RCYA 3R9XA 3LAWA 3UPUA 3X1WA 2NO6A 1Z0FA 1E9RA 2BCGY 3I1FA 2AWOA 1X86B 1VHLA 3IEVA 2VIIA 1U9IC 1YR7A 1G20E 1CS4C 221PA 5TY0A 4PX9A 2RH5A 4TSFA 4EDHA 1RW4A 2DPXA 4FWTA 1ZBDA 2B8WA 4HLQB 4D25A 4LHXA 1OT3A 1Z07A 3WYFA 1N6HA 1S1MA 4C0QC 3ZVMA 2PJZA 3CRRA 3SZRA 1VG1A 1XTRA 4A2WA 4V0LA 2VYFA 1ANKA 4RZXA 5HKKA 2OHFA 1KI7A 2WKQA 3E1SA 4XH9B 3BXZA 2PZGA 3IILA 4RJLA 1UKYA 2R62A 1OXSC 1QHXA 1G7CA 2QAGA 2YVUA 1KOFA 2GJSA 1E3MA 1M7BA 1E1RA 1VIAA 3RDPA 4HB4A 3HPQA 4CEJA 5EXSA 3AVVA 1K8RA 4RZ2A 2JJ1D 4MITA 3SJBA 3VR6A 1NF3A 2XZLA 3DKPA 4RCZA 3GD7A 2PMKA 1YQTA 1XTIA 2ZAMA 1GRNA 2ERXA 2AK3A 2TMKA 4C7OA 1VYVA 1VKJA 1OFUX 3I4LA 4XTRA 4GOJA 5E3HA 5GJVC 2H57A 2WIBA 5K8LA 4F4CA 4O0MA 1KK0A 4NMMA 4DZZA 2WWGA 2REXB 3CF2A 5JS8A 1IJFA 3CIOA 4BASA 2ORVA 3W3AA 2IUUA 2O0JA 2GXAA 1TL7C 5KPDA 3NEYA 2W2TA 5JEEA 4QRHA 3JZAA 1JXOA 1G8HA 1DO0A 1ZIPA 2PEZA 4DLVA 4IOMA 4NYIQ 4LRWA 1N0UA 2F55A 4A0FA 3IIKA 3TQFA 3WYGA 1RRCA 1XTQA 1YZKA 3ZD7A 2YC2C 3LDAA 4GNKA 2A30A 3QSYA 1S3SA 2O5VA 3RABA 3MAAC 2JATA 4KODA 1T3HA 1TU4A 1CLUA 3KUCA 2G9NA 5BWMA 1XD9A 3C7KA 2CCJA 3DKVA 1G1MA 3OE7A 1ZAKA 1DAKA 2IYTA 2J1LA 1W36B 1JR3D 3KQNA 3QKRB 2BIFA 3WHKA 4NE2A 4D4JA 2OFWA 5FPSA 1D6JA 1M34E 1VHTA 4LBYA 1IXSB 2Z5FA 4KBFA 1N3BA 2VLIA 3AUXA 4A4DA 3EASA 3K0CA 1KO7A 3CRMA 4LPKA 4M53A 5TMPA 4M9QA 5FL7A 4C2TA 1RE0A 3THOA 1TAGA 1P5ZB 1GL9B 3TSWA 4LSGA 1AJEA 1OW3B 1ZW6A 4TL7A 2CEAA 3I62A 2D2EA 2FEOA 5DYIA 3THXB 3THWB 2FSGA 2KBEA 2IXEA 3TSOA 3BOSA 1XU4A 3SU8A 1WBDA 3GFTA 1SVLA 5FBWB 4MQBA 3G5UA 3PQCA 3P32A 4LBZA 3AVWA 1UBEA 5ANRB 5KHOC 2RAPA 1Z6YA 1U8ZA 1WF3A 3PV0A 2IHBA 2F6RA 1EFRD 1E9FA 1NBMA 2WWYA 2D7DA 4WBSA 1FQJA 3TBKA 4HUQB 4LV5B 3H0KA 2VP9A 2QM7A 5KDDA 1SGWA 1G5PA 1XTSA 5LBIA 2OXRA 4C2UA 4KO8A 2ZRNA 3DVLA 4KSBA 2FOLA 1YKSA 2QEQA 2V1XA 3EZ6A 1II9A 5A5GA 4R2IA 4IDHA 3B1YA 4OJKA 5IRCD 1GDDA 1ZNZA 4TZ0A 3A1UA 2QNRA 3PXGA 2IK8A 3OFNA 1CJUC 1FTNA 2ZSAA 2IEZA 3EPJA 2N1BA 4A82A 2JGNA 1QVRA 4DDWA 1GG2A 1EFCA 2ANBA 1ZUIA 4C3ZA 2RGNA 2BBWA 1AN0A 1W4RA 1W4CA 2R6FA 1KHTA 4UXHA 4ZDKA 1E2PA 1MO6A 2FZ4A 1OH7A 4JVLA 2GAAA 3QF4B 4II7A 5B2ZA 4NU0A 2VSFA 5IK2A 1CR4A 3SJAA 3NC1C 1KJWA 3TR0A 2O8CA 2JLQA 1VECA 5J4VA 2PMDA 4TLCA 1UADA 2BHRA 2KE5A 4QL3A 4UKDA 2ERYA 1Q57A 3MGCA 1KO4A 4PXAA 1YU9A 5SZHB 4QBGB 1E94E 1JEDA 2F43B 3QG5A 5FPYA 2ZRLA 2ZPTX 3NWJA 1VPLA 4DWJA 2XOKD 4TQ9A 4W5WA 1WP9A 3UMFA 2ZJ8A 3AH8A 2BWJA 4YQFA 4BWYA 4M9SA 3AV0B 2WSSA 1R8QA 3T5DA 4XVRA 3ZVLA 3O47A 1N6NA 2OUKA 1M6NA 1P60A 5FPHA 3EC2A 2WJGA 1E2MA 5TVKA 2H7VA 3U3KA 3KFXA 3D6TB 2W6ID 3CPHA 1G19A 1MO4A 1U0LA 2ZR7A 2H16A 2O8FB 1CR1A 1NMXA 2E87A 3CF0A 1CU1A 3SYLA 4BFYA 5FPTA 1IN7A 3HYRA 5J4LA 4CEIB 1OB5A 2OV2A 1NSFA 2VA8A 4A8JC 2J0VA 2IF0A 5A0FA 1O87A 3ZZTA 1AZTA 2ZYTX 3B9QA 1U99A 2O8FA 1KSFX 4CYMA 2AN9A 2OCAA 2X8AA 1Z0KA 4DHEA 5H8WA 4TL9A 3TUJC 4AWXA 4TLDA 5IT5A 4B6FA 5E7JA 4ZIRA 1W4BA 1U8YA 3IKJA 2WWXA 2ZRGA 3TSZA 4DSNA 2FGJA 1GIAA 121PA 3OEHD 4BPBA 4L16A 1KI2A 4XD7A 4D2IA 2FWRA 3Q7QA 2EWWA 3IPYA 3FYHA 5C4GB 3PJRA 4JJZA 2HT6A 4BFSA 5H70A 5G53C 1T3LA 2YKGA 3TIFA 4EKDA 2VHCA 2B6HA 2ZEJA 4M1TA 4OQXA 3O8DA 1P2SA 4B74A 1H65A 2GJAA 1Z6GA 3CPJB 3Q5EA 1IN6A 2WMNB 4UXIA 4BFXA 2OSBA 1GAJA 1P3JA 2F9MA 2J9RA 1CULC 1N5LA 3MRSA 3Q85A 2ORIA 1W48A 4GI7A 1CJMA 2OLKA 2W6JD 1G3QA 1GUAA 1KI1A 1H8EA 4OHVA 4PZZA 5KPJA 2NGRA 5FTJA 1RFLA 4KYUA 1MKYA 3QEOA 3GEHA 3OFND 1R0WA 4YMTA 3C5CA 3TMKA 4B33A 1KK3A 1PUJA 2H17A 1ZC4A 1ZNYA 1X1RA 2R44A 4XWAA 4BFVA 4B3CA 4EPTA 4Q4JB 4BECA 2E1RA 1WRBA 3G0HA 2YHSA 4OI1A 3U44B 4URXR 2IYWA 3I72A 1XPRA 3D8BA 2D7CA 3V4FA 2DY1A 2WSMA 1M2OB 1CP2A 1W2GA 2P2LA 1AS3A 1E2HA 5AJVB 4DLZA 4DSOA 4GBMA 2CLDX 2HT1A 4DUGD 5KSZA 4UJ5A 5CLLA 2OAQ1 1CJKC 1F60A 1S0UA 1VCNA 3CLVA 1I2DA 3GFOA 1OIVA 2JASA 5B58C 4PSAA 3U5ZB 3VR4A 2P5TB 5EE9A 1R8SA 3CZQA 1G8YA 1G8PA 4AKEA 5K8IA 3TNFA 4F93B 1UKEA 1TEVA 1ZM4A 3BFXA 3X1YA 3A8TA 2DFNA 4IDOA 4PPQA 1G3IA 5C2JB 1EXMA 4JL6A 4V02A 4B48A 1OFTA 4OI2A 4X8MA 4PHHA 3OIUA 5HE9A 1GZSA 2GF9A 3QJYA 4NCIA 2RGEA 4JYCA 4KCGA 2ODBA 4DXAA 5AJZA 4TYYA 5JI3E 2NTYC 3V9PA 1NG1A 5L3QA 1FZQA 5FR2A 2P3SA 3RC8A 3VR1A 4LJ4A 2OO7A 2ZJYA 4E09A 1VYUA 1E79D 4QBIA 4DDUA 4ZPXA 2HV8A 3KKOA 3QXJA 1G5RA 3ZZUA 3MJRA 3FDIA 1W0JA 1E9SA 5DE3A 1E2NA 1KI4A 1P7CA 5FOVA 1V5WA 1VIYA 2W2XA 1D5CA 1L7VC 3FFAA 2RHDA 5CLQA 3LX5A 4JBWA 4OHXA 3QEJA 4R98A 5CITA 2F1JA 3KXKA 1LTQA 2QTHA 1Z63A 3UXMA 3VKHA 5BN3A 4F4IA 4RD6A 1G6HA 1RRGA 1KO5A 3BFKA 3BGWA 2ZXUA 1YZLA 2FFAA 4MUAA 4N1AA 4BLSA 3ZS9A 4MRPA 2ZRIA 1GL7A 3C8UA 2J7PD 4ERNA 2FN4A 4XSGA 4WIAA 1SXJA 2ZRAA 1RYHA 2QM8A 3GJ4A 1Q12A 4HZIA 1Q44A 1R7RA 3TVDA 2PZFA 2V4ZA 2WPDA 1C4OA 3LW7A 4HUTA 4KSCA 2CCKA 1MABB 4Z8XA 1KIMA 2AWNA 4PPFA 1QHGA 1XPUA 4PC1A 5KSPA 2QBYA 2WKRA 1LS6A 3AB3A 4D26A 2VF8A 3QQ5A 5L3SA 1KNXA 1NMZA 2XB2A 2O8EA 1JR6A 4JIMA 1DTSA 3TVTA 2A5DA 3CM0A 3NBXX 2IYUA 1FTSA 2VH5R 3I32A 4ZCIA 1IAQA 1HUQA 3AM1A 4TMXA 5JJLA 1ESMA 3SQWA 3DMNA 1GNQA 5GVSA 1NN0A 3LX8A 2W2VA 3RYTC 3W6PA 2O8EB 1DAHA 2YWEA 2ZRFA 2FPMA 3U2QA 2KSQA 2J7PA 2EFHB 1XTJA 3QKSA 1Z06A 1P2VA 3BH7A 4NYIR 4OI0A 3JVVA 5IHPA 4LY6A 1TQ2A 5TDHA 1MABA 1ZU4A 2C77A 2QP3A 4YONB 4HEJA 3PENA 5LD2B 2IS6A 4OQLA 2HCJB 2ZI3A 1W36C 2Z4RA 3GJ6A 2Y8EA 3RWMB 3B2EA 2QUZA 1N5IA 1NBME 1D2NA 3QKRA 1NVXQ 4TLAA 5JJIA 2BJWA 3NHAA 4KYIB 1Y3AA 2P5SA 4JT2A 3EW9A 2QSYA 3KQLA 3D31A 1GSIA 3MWYW 3C16C 1NBMD 2C9OA 1TQ4A 1UEJA 5JSZA 5FFMA 4JBYA 4DCUA 1E0AA 1E99A 2OM2A 5EE1A 5HZKA 5IF9A 2GJKA 1SVSA 3WNBA 1N5KA 2ZRBA 1L4UA 4ASUD 1LY1A 2J5XA 1RIFA 1Z6AA 2J7KA 1G8GA 4ZKDA 5HR5A 1EFUA 4DEYA 1DG1G 1P62B 3THYB 3GLFB 2JJ2A 4URZR 1Z2AA 3SYKA 4KU4A 1Z0AA 2I1VB 3W5JA 4DLYA 2Z83A 1W5TA 4L9SA 4M9ZA 4B43A 4AKGA 4QXAA 4BE7B 1XJ0A 2XEXA 1ESNA 3CRQA 4MDFA 2HYDA 4DLWA 3KXLA 3P26A 1E1QA 1A7JA 3BRWD 4HLUA 1TUIA 1KJYA 3GJ7A 1R5NA 4CT4B 4LWZA 3KQHA 3IDQA 2J3EA 1GOTA 3SHFA 4PPNA 3LW8A 5HKKD 3U6KA 4ZDIA 1KK2A 3EAQA 2X1VA 4QHSA 4US0R 4FMCF 3P4YA 1ZU5A 1KI9A 4HI0E 1XD2A 2H18A 2R9VA 1UDXA 2G83A 1E2QA 3U3OA 1LF0A 1T4GA 4IJMA 4ZCLA 4TSFD 3U7EB 3LLUA 5FUVA 2AD1A 3CO5A 1IY2A 4ESVA 3KKQA 3HDTA 1RYFA 2QMUA 1KMQA 1AM4D 3BAFA 1ZINA 5AUQA 5H68A 2DYKA 2BM1A 3L0OA 4I81A 1IN5A 5E4FA 5KNBA 4M8NE 1D2MA 4EPVA 2FU5C 3SS8A 1NL3A 4C0KA 2R2AA 4CEJB 1MRNA 1G8FA 2YWGA 4NL4H 4B3BA 5DI3B 5IK2D 4OHYA 2CLCX 1SVWA 4RKEA 2JJ2D 1TX4B 4D80A 2ZS9A 3LBHA 1FPMA 5EP1A 2FEMA 4H1VA 4IFEA 4ABYA 4DRZA 3CUEF 4DLXA 2RKOA 8OHMA 3BBPA 1E2KA 2KWIA 2WJVA 2JLUA 3AP1A 1TADA 4M1YA 4PC7A 2IT1A 1OJLA 3GLHA 4N0EA 4BQSA 2JAQA 2AHOA 2WM9B 2XITA 3D3QA 3WNDA 4P4SA 3JZMA 1DO2A 2F7SA 3MUFA 5HTKA 1S3GA 3DHWC 4ILEA 3UKDA 3QVUA 4I1OA 3Q7PA 2V9PA 3GLHE 4Q9IA 1MOZA 1RVDA 4DT1B 1EFTA 4POAA 4ARZA 5FOUA 4EPXA 4CF7A 4AK9A 1KMHA 1BYUA 3IHWA 3QKSB 4B34A 4JLAA 2QZ4A 3T15A 3R7WA 5G41A 1KY3A 1AGRA 1GKYA 1GVNB 2EWVA 2KJQA 5K8TA 4KVGA 3MCAA 5E7IA 1E2EA 1KI6B 4HAWA 4DLSA 1VG8A 3CNLA 2QT1A 1E96A 4TMVA 4ZO4A 1GRQA 1D2EA 2ATXA 2FGKA 1FMJA 2XOKA 4QHTA 3EPKA 3K1JA 1DAEA 1E2LA 3LRPA 3LVRE 4L8GA 1CXZA 1W1WA 1KI6A 5DISB 4OI4A 3TJZA 4JBXA 5FTKA 3EA0A 1R6BX 2D06A 3EPHA 1TEXA 2XNDD 3SEAA 3AVPA 1IY0A 3UANA 2AKYA 3AGPA 4HYYA 4M4SA 3T61A 1BYIA 1CTQA 3FMFA 1N6LA 1YZUA 1Z5ZA 1AKEA 3N2IA 4GZMA 2FSFA 3X1XA 3HR7A 5KU1A 3BJIC 2PL3A 3A1SA 3F0TA 3BORA 3RWOA 1OKKD 1KO1A 2ZYVX 2PJRA 1Z0JA 1L2TA 3FHTA 2X19A 4BGDA 4B44A 3THWA 4KFSA 2EFGA 2ZU0C 1PLKA 3K0AB 4DDVA 4PSKA 4S2EA 1U2RA 1Z2CA 4GSYA 5LPNA 3PUXA 4YMWA 1PZNA 2WICA 3OZXA 1FUUA 4IOJA 1UAAA 4F38A 2FG5A 1SVIA 2VBCA 3AKYA 3TW4A 5FTLA 2OAP1 1CJTC 3AF2A 3CRW1 3V4RA 3EIHA 4BFZA 1COWD 2FDCA 4KITB 4IDNA 3SJCA 3L0SA 5EUMA 2ZJOA 3QOFA 1OV4A 721PA 1WXQA 4C0SA 1VCIA 1XMIA 3B1VA 3QENA 4PZLA 2VF7A 2XZPA 3FOZA 3SHWA 3VAAA 3KKPA 4O2RA 3GLGB 2CE7A 2CVFA 1E9BA 1KYIA 4YC7A 4QM6A 3SI7A 1OF1A 1KY2A 1JXMA 4LOAA 4DCNA 3KDSE 4Z8YA 1SVOA 1ZNXA 2QQEA 1DAMA 3O8RA 1OHHA 4LI0A 2G1KA 3EZ9A 2QL6A 2QPTA 1U94A 4MGYR 3VX4A 3LBNA 4U7DA 4ZKEA 4GMXA 4Q03A 1HURA 2ORWA 4QJ4A 1QHIA 4HZUB 1BOFA 3ZJYA 4MKHA 4OYHA 2IXGA 1XWIA 5FL7D 1TF2A 1XEWY 4MYHA 1W46A 2IYXA 3KKNA 2GILA 2QMEA 3H86A 3WNCA 2V6IA 3M6AA 4YXWA 1WQ1R 2EW1A 4D0LB 4LZZA 1T91A 3U3MA 2RGGA 4WZAE 3OEED 1SXJE 3EWAA 2HDNB 2UZIR 4XOIA 3FHCB 4QFMA 4PFSA 3AVQA 1N6PA 2L0XA 2A2ZA 4FN5A 2ZE7A 3Q8XB 1BS1A 4HLUC 1EWQA 1N6IA 1NNEA 1P61B 1YZQA 1R0YA 5L3RA 4WA7A 1OYWA 2GZHA 2D4HA 3QF4A 4B6EA 3HWSA 2C95A 2F1IA 4BRUA 2W83A 2QN6A 3K9NA 1AGPA 1F2TA 3KB1A 1VYTA 3VMFA 1R0ZA 2NO7A 2ZI7A 4BZPA 5JWRA 2NZ8A 3RS2A 4HSEA 1FOEB 1NI3A 3ECCA 3RS3A 3CZPA 2H1LA 3L0PA 1GKUB 3KQKA 1TQDA 3A37A 4KV9A 4OQNA 1IY1A 1OH6A 2FJUA 4Q1CA 1DEKA 2F43A 3TH5A 4HB3A 3ZGXA 1F2TB 1TF7A 2W6IA 3AKEA 2QY9A 4RD0A 3HYTA 1TMKA 2RB4A 2WOOA 3ADKA 3BFVA 1JAHA 4Q4HB 3W6OA 4DBLC 4ITRC 1YVDA 4V0OA 1I4DD 1P9WA 5CYOA 1GTVA 4P4UA 2Z6VA 3FFBA 3F8TA 1BMFA 1JBKA 3CX6A 1BMFD 3QNUA 1ZD9A 5G3YA 1Q22A 1XCMA 2WIAA 3THXA 1F48A 3QKUA 1UFQA 2X77A 4XJXA 1S1CA 4GPTA 1FW6A 1S8FA 2O0KA 1AS0A 1HT1E 3NDPA 2SHKA 4CEHA 4A9AA 4M1WA 1TTTA 3BB3A 1E2FA 4IW3B 1Q21A 3EG5A 3QBVA 4QG7A 5CYPA 1WE2A 5G40A 1WA5A 1XXHA 4R2HA 1XDBA 1C9KA 1U81A 1OIXA 1LS1A 4IVRA 5TV2A 3NVAA 1N5JA 3RRMA 3A1TA 1UBFA 4MA4A 2A9KA 4EFMA 5J4KA 3K70C 1ZP6A 2A7QA 4FMDB 2VP5A 2RGDA 3RS5A 1XTKA 3PITA 2GJ9A 5SZJA 1U90A 3W90A 3ADDA 4ESHA 4D0NA 3LLMA 1TU3A 4KFUA 3DMDA 5CK5A 1P9NA 2VHTA 3RHFA 4FXPA 1P9RA 4AY2A 2JLYA 4JL5A 4LHZA 2IBMA 2AX4A 1FX0A 1ZUHA 3CX7A 4IHQA 4NONA 4OJQA 5FBLB 1XNJA 3RRYA 1SULA 5DNYB 5KNDA 1TQ6A 4L5BA 4B3GA 1XBTA 3AF4A 3RRZA 421PA 2I1QA 4LYFA 1II0A 4Q9JA 1ZMXA 2MSCB 3TAUA 3IUYA 1YJ5A 3IPXA 1K6MA 2CNWD 4B3XA 1KSJA 2G3YA 2P67A 4Q1EA 4Q01A 1JB1A 3B1WA 4QBHA 1OHHD 3RLFA 3UG6A 1UPTA 4XWOA 5JJKA 2R8RA 2PT5A 2CJWA 1G7TA 2ZROA 3KUDA 5EP3A 4NCHA 1F3OA 4PR0A 2PBRA 1G6OA 4P0TA 4NKRA 2VTKA 2JA1A 1DOAA 4BEBA 2XSZA 4C4PA 1QBKC 5EZ5A 2Q0HA 4Q48A 1KKMA 3Q3JB 2ZREA 2GRJA 1EX7A 4D0GA 5FI1B 4GFDA 4I1VA 1AQUA 2D3WA 1F2UA 2A5FA 4PQRA 4QNMA 2JCSA 1W0JD 2GCPA 2ZS8A 2QTFA 3GMTA 821PA 5EP2A 4OQMA 2YOGA 4KI0A 1LF5A 1P73A 1FMLA 3PEUA 4M21A 1GFIA 1G4AE 1W4AA 1E98A 1ONBA 2P6NA 3IIJA 4ACBA 1S9HA 3Q5DA 4MRVA 2G0NA 1JR3A 1HY3A 1ZM2A 1XD8A 3PUYA 4P32A 2GDJA 3EARA 3W9YA 3UMRA 4NPHA 4JLMA 4B2IA 2EYUA 1PUIA 1XEXB 4TQAA 3SBDA 3VNVA 4RVCA 1T8TA 2JDID 5JI2E 5FBRB 2REBA 1IXRC 1TPZA 2A78A 2FSIA 4JLDA 1QG4A 2PT7A 2W58A 3ETLA 1YZGA 2OBNA 3OEHA 3OIVA 4FW9A 2ZSBA 5F2EA 3SFZA 1J90A 2QSZA 3I92A 5B64A 1FP7A 3KJGA 4LHYA 3WRYC 1T8UA 5KDOA 4JVMA 3B6EA 4TLBA 5J5CA 1I4LD 2ZIAA 2QQ0A 1PV4A 2JLSA 2IW3A 1US8A 4HB2A 1YR8A 3EA5A 1NVVR 4DUGA 2CE2X 3REFA 3ASZA 2P6RA 1XD2B 1J8YF 3QVVA 3ZQ6A 2CBZA 1GITA 4B32A 1U8AA 4S35A 1QRAA 1XXHE 4DJTA 1P4SA 4MRRA 1KSGA 4N3NA 5AUOB 3BK7A 4FINA 4LDJA 3IQWA 1B23P 1CKEA 4BLRA 5CJPA 3PR1A 3QE0A 2C99A 4Q47A 2JJ1A 4NDZA 1A4RA 3R8CA 3QF7A 4Q1FA 1RRFA 2XXAA 4B2LA 1HT2E 4GOXA 4LUCA 2JLRA 1AKYA 2JDIA 4PC3A 4A92A 2QPAA 5J4YA 3IGFA 5TB5A 1NMYA 1VG9B 3K0FB 3RS0A 2WJJA 5EE0A 4W5JA 4Q4AB 3ND9A 1KZGB 1G3MA 3HU1A 3RRNA 1NN1A 3P4XA 3VKWA 4CIDA 3EZ2A 4H1UA 2GF0A 4QGHA 4RD3A 1F5NA 1E4YA 2HJGA 2RMKA 3NH9A 3RC3A 1YZNA 1ZCAA 5AK0A 1JJ7A 2HLDD 3KTAB 4D6PA 1B0UA 3X1ZA 1R5OA 4B2PA 1P72A 4WXRA 1KDTA 1E9CA 2HCBA 2D62A 5CDFE 2J59A 4JLJA 5DYGA 1T0HB 1KSHA 3R7WB 5JWOA 1OB2A 2IEYA 2XSZD 2XTNA 3L8ZA 4LJAA 2MSEB 1L8QA 4JLNA 3T1OA 3TUIC 4XVQA 1JQJC 1R4AA 3B13B 4ARZB 4JZKA 2LKCA 4LBVA 4RZUA 1SZPA 3U44A 4G5GA 3NBFA 3U3RA 4PZYA 2KB0A 2P65A 3SDZA 2QT0A 3C15C 3M4YA 5FOXA 3KJEA 2NMVA 3LV8A 1X8LA 2FZLA 5BXQC 1ZUNB 2FE4A 2WMOB 4M1OA 4OBEA 5LDDC 5JSZB 3KKMA 1EESA 1X1SA 3LWNA 2JLWA 5DI3A 4JLPA 2F1RA 4Q4LA 2JLZA 4Q1AA 5JCZA 4NYJR 4Q66C 3IHLA 3NC0C 4PC2A 2HXSA 4TYPA 1E1QD 3EX7C 1QVAA 2ONJA 1QDEA 4HAUA 4BFUA 1RZ3A 4C9BA 1Z22A 4G01B 2BOVA 4IXNA 3B8HA 3OE7D 5CDFA 4G5RA 2YWHA 3T34A 2JLXA 3OEEA 2FA9A 5AJXA 4IEEA 4RKFA 4MRNA 1IONA 4NCJA 3G82C 2XJ4A 2V6JA 4OK6A 4UJ3A 1Q3HA 4NCKA 3WMFA 4MYCA 3GEIA 5P21A 1L4YA 3DM9B 3RSOA 2X2FA 3NBZC 3TQCA 3KTAA 3ZD6A 3E2IA 4UXJA 4K8OA 3FPAA 1RPZA 1KDRA 3RANA 2AFIE 4URUR 5FPKA 1Q1ZA 3A36A 2NQ2C 4DSUA 3REGA 2ZRKA 2O8BB 3QUSA 4TLEA 3O8BA 3K70D 3GJ8A 4M1MA 1E2IA 1XCGB 1FL9A 1DARA 3BIFA 1JECA 1YR6A 2B7CA 2IHYA 4D4LA 2OCYC 4AKIA 3EXAA 5DLQC 5HCIA 3SJZA 1W7AA 4TMZA 5L3QB 1M8PA 2AXPA 2EFCB 2WKPA 3OIWA 5AWFC 5D3MA 4HZUA 2P0EA 4YMUA 5CM8B 2WZQA 4UNQA 1V43A 5KYKA 2Q6TA 2ZAOA 3PUWA 521PA 3ZIAD 4F91B 3OESA 4FMDF 2EYQA 4NP6A 2HYIC 4PAMA 4YLGA 1ZM3A 2B21A 1WDTA 2ZSEA 3B5JA 5C46F 3S1AB 4B73A 2WAYA 3R20A 4K81B 3VR5A 1M7GA 4MDEA 3X1DA 4DC9A 4L15A 1NY6A 1GRRA 2CJWB 4BZXA 2QPOA 2ZUDA 3ZVRA 4EJSC 3NBYC 1KMHB 1ZNWA 1M7HA 4XSHA 2VP0A 4QM7A 2XNDA 4ZI2A 2J45A 1NIPA 2W0MA 4JSYA 2PEYA 2WBLC 4P33A 5J4HA 3A4NA 2O52A 4D81A 3UMSA 2AL7A 1W2HA 1EX6A 3K9LA 3T06B 4V0ME 5AUPB 3CH5A 3OAAD 4EUNA 1C1YA 1G3RA 2UKDA 2OILA 5DGXA 5DO9A 3W8RA 4B47A 2IS2A 1GP2A 4QBFA 3WMGA 3T1QA 3EIEA 3AKCA 3SQXA 3FTQA 3TGPA 3PIRA 2J0SA 2DFKB 3WP1B 2ZRMA 5JRJA 1IHUA 3MSXA 3BH6A 4QJ3A 3GCGA 2QGNA 4QOSA 2NO0A 2CHVA 4MKFA 3I61A 2WOJA 4Q9KA 3IBGA 4CZ2A 4QGFA 3ND8A 2B8TA 3BS4A 4Q4JA 1K5GA 1D8TA 2QE7D 3AKDA 3PUZA 1DAFA 2CL6X 4G1UC 4EQ6A 5J47A 3BB4A 3CONA 1OXXK 1YR9A 1N0WA 2ZE6A 3VX3A 1KAGA 3GLIA 4EFLA 2ZE5A 4DSTA 1VMAA 1KKLA 3LY5A 5CIQA 2ZRDA 5DSZA 2XJ9A 2F3TA 1XEFA 1CR0A 3V00A 4CDGA 2O8DB 4ZCMA 2IS1A 4W7SA 2DWOA 2HEIA 5AR1A 3BH0A 3H84A 1Y63A 2J0QA 2HF8A 2EU8A 2BVNA 4GT1A 1N25A 4BLOA 3DL0A 4LCBA 4NYMQ 4PHFA 3GJ3A 2QROA 1NN5A 1HE8B 1MT0A 1UF9A 3RVBA 2F3RA 1R2QA 3B7GA 3CKLA 1T5LA 4RFSB 1E1RD 3CW2A 3TLXA 3B1XA 3FMIA 3UATA 2RHMA 4D82A 1OPXA
chains in the Genus database with same CATH superfamily
1HORA 4L8LA 1KC1A 3A14A 3AR6A 4KGXA 2WUGA 3FBWA 1QR6A 1I4OA 2BKVA 4GRAA 2F3PA 4YQYA 4DIEA 3S0JA 2DQ4A 5BW8A 1SQ6A 3WP0A 3SC3A 1G1AA 4DCSA 2YNMC 4LYHA 3VAZA 2AC7A 4DZRA 2WJ4A 1MHTA 5AXAA 4X8OA 2V9ZA 5CW1A 3DZHA 1JHPA 4U8GA 3RFUA 4FFSA 4CKEB 1Q0UA 1GA6A 1HYBA 2J3DA 2XY4A 1SCDA 1PDVA 2GK7A 5EQJB 1AB6A 3I2FA 5KC9A 3HYNA 4HAXA 1O3YA 4UNNA 2MINB 3IVAA 5ELXA 1M6VA 4JI3B 1WXEA 2OFPA 4H6PA 3F6YA 1NSTA 1H1DA 4CR6A 5B3KA 2QTGA 2JIQA 2C5EA 4TYQA 2ZBUA 4S24A 2VA9A 1Y4ZA 3QBEA 4HS4A 1C1HA 2XNKA 4Q4DA 4ZGBA 1W0KD 4MR7A 4W9MC 2HQOA 2BMEA 4IG4A 3PC2A 2ZYWX 1LSJA 3I6QA 2JIOA 3I9V6 1C9EA 1NKTA 3N7AA 4NH0A 3AM5A 3TQOA 3HFGA 3A31A 4G8DA 2FHSA 3VO8A 5LJLA 3KVYA 2BMDA 2MIIA 4C4RA 4Y2VA 2HMVA 1TZ2A 2YNMD 4P58A 3BC1A 3RROA 1ICEA 3GA7A 3IRUA 4P83A 1Y1LA 2Z43A 2ST1A 5CG2A 1GNRA 1N2CE 2I2CA 5IZCA 3E18A 4BVGA 3NNSA 1U8XX 3TQTA 1AKTA 4I99A 5JROA 2J5QA 1GL3A 2WDPA 3KB6A 5F2OA 3UJ8A 1D6MA 2DWCA 3R7DA 2AC4A 3QYFA 1CQJA 1AK2A 1UQUA 2EATA 3EGOA 4GX2A 1KAEA 4HAVA 3ZXYA 3REQB 3V46A 1E4OA 3SZGA 1JSCA 5FJJA 2VSXA 4RLSA 3K09A 2NPIA 2X8JB 1YT5A 2DPHA 1OIWA 1AG9A 1HLFA 2GA8A 1PLJA 3LFHA 5EJ8A 1JVNA 2G36A 3D0OA 4C4ZA 2F8MA 3TW8B 4GOND 4BNDB 1TD1A 1SHZA 2GHIA 3LZDA 2YWJA 3HI4A 3DUWA 4BQIA 3DOHA 2OT3B 1HC7A 1ISSA 3C5HA 3B9RA 2V3WA 5LZ5A 3K6SB 3AEKB 4EPYA 3BTSA 3HPRA 3B9PA 4R8MA 3VC7A 3RS7A 1NDUA 4RWZA 5F78A 2ANCA 4YP9A 5AKLA 2ZBEA 5LQKA 4QFCA 4TYMA 1H05A 1KYVA 5H59A 4DQUA 2ZI4A 1WDWB 3GVPA 4GLFA 5AOBA 1LBHA 5M7EA 4EL0A 4YJHB 2B4KA 4XA8A 5BW4A 3QELA 4J1QA 3W8DA 4KDRA 1RI2A 3GWGA 5EKSA 2OCIA 3GLIE 4BO2A 2IPNA 4BWGA 1WZ2A 3L6EA 1S9DA 2E4WA 4HNTA 2HJVA 3FOCA 4UVEA 3E1KA 1XTPA 1XLTA 3FPFA 3DZ8A 4G1FA 4PQGA 3ZU3A 1ZRSA 2QVGA 2ZRJA 3H5AA 4LV6A 3QLEA 3B85A 3B2QA 3I6MA 5HF9A 4DMKA 4NWIA 1HKUA 2NYRA 2NO9A 1BN6A 2HWUA 4P93A 1Y80A 3VHQA 4AY3A 4BMCA 4TL8A 1KO8A 4MQFB 4OP1A 4BBPA 2J87A 3DGEC 3RLIA 4MW9A 4HTFA 4K6OA 3VOAA 4C20A 5AW2A 5KTSA 2PK3A 3TCKA 1REQB 3NANA 4UE3S 1M2FA 2IP2A 5GJWC 4WKBA 2C9CA 3C0KA 4C0LA 4P4TA 3CJTA 2QUAA 3KALA 4J2OA 5J40A 5LA6F 4XVCA 2FETA 5H0IA 3QE2A 3TQHA 2FPGA 2WWFA 5SYMA 3JQFC 2NXWA 2QI9C 4IV0A 4XX0B 3VM6A 2YC4C 2WUVA 3H8WA 5I7HA 2X8LA 3OE5A 4MQEA 3V8PA 1BIFA 5LP6A 1EFDN 4FI3F 4KRYA 4MAFA 2I3BA 3E8SA 2CHUA 2MHCA 3O1JC 4REMA 4IX9A 5FTWA 4C0AC 3WGIA 3AP2A 4O2BB 1BFKA 3EQ7A 1Z4KA 1N7HA 3HLYA 1PJTA 3T4PA 2AZTA 4FHDA 4YJ2A 2JPDA 1ZUNA 1OKKA 4HAYA 3K4HA 3U7HB 2XDQA 3H3XA 1TK3A 4IXMA 1MTOA 3DLCA 3DPUA 3DEJA 4GX0A 4JFRA 4X62B 1YE8A 3ETCA 4ZDWA 3S8MA 1T0BA 2D5LA 5SICE 5DZSA 2JJYA 2C8VA 4GXQA 1DC6A 4MJXA 1IH8A 2O3SA 3VKGA 3ET5A 3G8BA 4QHYA 2RH8A 1RABA 1XFAA 2ZJ3A 4KLNA 4Q9AA 1JJBA 2B98A 3BDAA 2YWRA 4J8PA 1S8NA 1N9KA 3GLGE 1G9SA 1NQXA 1BO6A 4OQQA 4TSKA 3H4MA 4OM7A 2M2IA 2ZRCA 1XP8A 1MC5A 1D2AA 1F17A 4PBSA 1JT9A 1DC4A 3KHUA 2IWHA 2AS0A 1APBA 1VZ3A 3GLGA 4BOYA 2FMUA 2FK8A 2KQUA 1PV2A 3USCS 2N47A 4WINA 2GD6A 5CFMA 2VKQA 4RVGA 5C7IO 1Z5WA 2ZULA 4AIIA 2IYYA 1L7XA 3EZGA 2RG1A 4KMOA 4Z54A 1GUDA 4J90A 1GPH1 3R9WA 1PR5A 1GPWB 4ZRNA 3BERA 1FX1A 1GKIA 2QP4A 3GRCA 3I2HA 3L18A 4MLDA 3FYCA 5FOSA 1VFPA 4BKUA 2EF1A 4KQMA 1Q7RA 1RWPA 1PWXA 2XW6A 4DKXA 2PFGA 4YQZA 4MROA 4FNAA 3WAJA 5FUYA 4K6GA 1P31A 4OQFA 4C7BA 3UG7A 3OPYA 1J09A 5EN4A 4AG6A 1X2EA 2IHUA 3FR8A 4P7KA 4BCCA 3K20A 2WNIA 3LWDA 2X1LA 4UZFA 4B83A 3TLGA 5KMGB 3U7GA 4FYWA 4QQRA 3SYMA 1LX6A 3WLHA 2WE7A 1MC8A 4AZSA 1O54A 2W6CX 5DGTA 3CR8A 5I6DA 4BLVA 3Q3CA 1KDYA 1LA2A 3IEMA 2ZM5A 2FTKE 1XTTA 4Q9LA 1LNSA 3EZNA 4BB9A 4BX2A 3GRAA 1GPNA 2JF0A 5EC8A 4LJ7A 3SEFA 3WSVA 3GLFA 2C0QA 2W2LD 1JDVA 1Q0TA 1CVLA 2AIRA 4JEIA 1Q5PA 4CM9D 4G8BA 4X54A 1UC9A 3FSJX 5DHUA 2QBYB 5DHFA 4YI5A 1JSRA 2QQGA 2EZTA 3LBAA 4G97A 1DZ3A 2IPMA 5J2UA 1R6TA 1B14A 1MG0A 2XNHA 1E3EA 3WNQA 1AV7A 2P9HA 2P2DA 4I4TA 3P27A 2E6UX 3O8OB 1JHDA 4TTAA 1T2DA 4TVKA 4DLRA 2XOXA 4AMUA 1YS7A 5A71A 4PQFA 1DT3A 3EEOA 3SFTA 1YVUA 1N9ZA 4FX2A 1E2DA 4F60A 4EMUA 3ONVA 1U5AA 1U4OA 1TLTA 3UIEA 1JLLA 1RAAA 2VJBA 3BJMA 4YECA 4MXDA 4BJHB 3OAAA 5K0CA 4F5EA 4NBTA 4FBLA 1WBJB 3ZDDA 5BR1A 1WSDA 1KFKB 5BNFA 1FTYA 1KAOA 2O1WA 5KREA 4TL6A 5GJCA 1MDFA 2ILVA 4BUJA 3F73A 2ZUEA 2N75A 2PNFA 3DTVA 5IX8A 1XZGA 2V65A 4ITUA 6Q21A 5CAEB 4NYJQ 3PEEA 4ROTA 4N01A 2NN3C 4OX9Y 1ZD8A 2P2SA 2WVJA 4UAUA 1SQ5A 1I0LA 1O95C 2CKDA 2HCTA 4ZOLB 4B76A 4RF3A 7MHTA 1IBRA 3T1TA 3B6IA 2BTQA 1CS0A 4KJXA 3OMLA 5F9HA 4YGYA 2EEZA 4Z2AA 1HTBA 3BXFA 1CUJA 3F5FA 4CTJA 3JVUA 2QMHA 2WJYA 5A3JA 1FRNA 1ZC3A 3OOHA 2VATA 1UXGA 3WI7A 4F9EA 4TYNA 3LFUA 1RC1A 1U7ZA 1XVIA 3IBSA 1DXYA 4LXHA 4TTTS 1I7QB 4DGSA 3AP3A 3AT1A 2F48A 3K9GA 4AJ2A 5I4BA 1E5LA 2JRLA 3ZG6A 4IFBA 3BE6A 3SC4A 2G08A 3SHQA 4L6IA 3P0JA 2FH5B 1ECFA 1N6RA 4JENA 3H7IA 4FCWA 4LJ5A 4AT1A 1YRYE 4DCPA 2DWQA 1SUWA 1FP2A 3BREA 1HQDA 1LPSA 4UC0A 1TB4A 2HWYA 4GQAA 3Q9UA 4I9GA 3UOAB 5KTNA 1BXRB 3RASA 1X7ZA 2H7XA 2OCDA 2XQJA 3CBGA 1O94C 3OHSX 4RFVA 5L3VA 1GKLA 1YUBA 3FOBA 4YQEA 3I3OA 3TK1A 4K5QA 4R5HA 5H02A 3LPNA 5KOYA 1QR2A 2W7TA 3A4LA 1G7RA 4NAHA 4YRPA 2HRRA 2TYSB 1CQXA 5KU7A 3TZ6A 3CNOA 1O6FA 2FUNB 4YRSA 4GM4A 3EXHC 3LGXA 3U7QA 3KQQA 3ZVNA 1IBMB 1P4AA 2ZDGA 1Q3TA 1QQ7A 4H0FA 4U6NA 4UNRA 4J07A 2I3AA 4AYTA 1BX3A 4L5AA 4CKBB 1VZ2A 2Q1WA 2EERA 2GBLA 2F9FA 1SC4A 1NJFA 2ZIUB 1J5XA 3EFBA 3EG9A 3LT2A 4R6WA 3KZVA 4KLZA 1H3EA 1DAIA 1K75A 1ZMTA 4C1NA 2XXAB 1UOQA 1X3SA 4EABA 3L01A 1TU0A 2V4UA 4WH0A 3IP3A 4GWKA 2XZOA 1QHHB 2YJ5A 3QWFA 3ZXUB 3OT4A 1IZZA 1N4DA 1EB9A 3T54A 2A1UA 3BL5A 2RJNA 1ZL0A 1DTWB 1RHUA 4N3CA 3OZVA 4GEGA 3WRVA 4RMNA 3HG7A 5LP6C 2R6HA 3BB1A 1SC1A 2I62A 4FHEA 3MJHA 1M8JA 1V37A 3X1KA 5EE3A 1AMUA 3S2SA 4J7XA 1Q83A 3IL2A 3H99A 2A1UB 1GAEO 3IUPA 3NZEA 4TT8A 2H0RA 4IJUA 3UM9A 4L75A 1P29A 3VO1A 1HG0A 1MZVA 1Z15A 3QE3A 1PJQA 4FZJA 1W5AA 4UEJA 3M0EA 1IN4A 4HGQA 1P9OA 1FF9A 4OHKA 1LV7A 1JTVA 3JSXA 1W75A 1NXVA 2PGAA 3V8NA 3CLRC 4UTXA 1A9PA 1N9GA 3PD7A 4I3GA 4WNAA 4AJIA 4AMBA 1D0VA 4JKYA 4K9PA 3N70A 5JAQA 4X45A 2OFXA 4MQ4A 4K9LA 5IULC 4FK8A 1JJIA 2GPJA 4CV0A 3CYFA 2QV7A 3Q88A 1E1MA 3TS1A 3U39A 4ZALA 3WIDA 4R0MA 4RSHA 1HLPA 3DBVO 3ZQJA 5BPHA 1EA7A 1T5HX 2XECA 2YH2A 3F3YA 3C3XA 4XTCS 2ZK7A 5LZ7A 2C96A 1T6XA 5EP4A 1I2MA 1MP0A 3RAPR 1CF2O 3WLSA 2QU8A 3RJTA 2Q27A 1Z17A 2D1RA 4UUQA 1SUSA 3CX8A 4RPLA 3TL2A 1DOZA 4YAUA 1BXKA 5DXFA 1UDRA 4CLEA 1HDIA 4JLVA 4EI2A 3EVEA 3RUAA 1YFJA 4WUVA 2BEWB 2D2IA 5E2IA 3NS7A 5HCNA 1L7AA 3ZEAA 3HB7A 4L9AA 2JZNA 4RS4A 4COOA 5LL6P 1RWMA 5I7VA 2GHTA 4TRJA 5GV8A 3ONNA 4G5SA 2JGEA 4NIMA 4ZVUA 3HI6A 2ZJZA 4PLPA 1VMEA 3R6GA 4LRUA 3RSQA 1XAJA 4J0FA 2GSDA 1P6XA 4O2AA 2X58A 1KE1A 3TUZC 4X24A 5IZCC 1XXLA 2BF7A 1IPEA 5JDIA 2PD4A 2VP3A 3V5NA 2XYVA 3VHLB 4DIKA 3PYMA 4O2LA 2A9OA 2N46A 3DVQX 3MPOA 3ETNA 3HU3A 3NHSA 3OO0A 2FWJA 3QU7A 2E49A 5GV7A 5K6TA 2V3CC 2YJGA 1WBBA 2EQAA 4RZSA 4ZEVA 1HV8A 3R1IA 4D4KA 3C3WA 2WLTA 5LJIA 1EQUA 4UOQA 1XTVA 1F9AA 3PUVA 2FPOA 2IITA 4FCVA 1WPQA 5TGZA 1GPBA 4YTEA 1Q84A 2PH7A 3VOBA 2VO1A 4D9HA 1ES9A 4M2LA 5B2EA 5C8XA 1EGAA 2IDMA 5GONF 1OGYA 4PLCA 3WRXC 3R7BA 1L9KA 1ISGA 2PZ8A 4URWR 4WD3A 4P34A 2JD2A 5DGIA 4C89A 4BLUA 2H2IA 1G18A 4KUHA 3OOYA 4C43A 1QHYA 1ZBQA 3HV0A 4X5OA 1NMEA 3O4VA 3MFYA 3SIRA 3HP1A 1JSLA 4HDRB 2VHUA 1YDGA 4AQDA 2J6BA 4U9HS 3FVTA 2C59A 2I80A 2ZUVA 3UH0A 1BXGB 3R5KA 4H4EA 2CXPA 4BNDA 2BKXA 1PJRA 1OASA 2ATVA 2OXTA 3CRZA 4HRYA 2EGUA 3AVOA 4EL5A 5A6VA 1G6Q1 2L17A 4RTMA 1R8JA 1IN8A 2X0RA 3BN3A 3WYBA 2NG1A 1XZKA 3L7CA 3CN7A 3G9ZA 1C7EA 4MQFA 4TRNA 3TOZA 3FVQA 5AXDA 4BVJA 5IF3A 1DELA 2ONKA 2OWEA 2BEJA 2IL1A 4NK4A 3W34A 3QBTA 1J2UA 3I01M 3CNEA 1VLQA 4HT3B 3K7EA 1D1QA 3GC6A 4GVPA 2NPOA 1OH5A 2ZYUX 2CLSA 3W9UA 4RD1A 4TQUS 4LY0A 3KZXA 2GVDC 3MUOA 2OV8A 4EFNA 1NR7A 1CEEA 2FPGB 3WK6A 2A9QA 2Y1FA 2FFHA 3VKFA 4YMVA 4TTJA 2X6TA 2WFZA 1Z26A 1YB7A 2HNKA 4OKNA 4M8SA 1XZMA 2VL7A 4MP3A 4RD2A 1HE1C 2FSVC 4Y2TA 3VH1A 2IPLA 2ZITA 3N6VA 2NV0A 3GRKA 3JWEA 5L3SB 4LXQA 5KO2A 1ECBA 2OM6A 5CRIA 2IIPA 3QPUA 3G59A 1F8UA 2R1VA 4B5KA 1RDFA 2VP2A 3OZWA 3T5GA 4LVOA 2RSLA 3H2JA 1HA3A 4DOMA 3DV9A 4UDNA 1DSSG 3C8MA 4V03A 3EGIA 2NSHA 2PLAA 5FI0B 3E7DA 2YY5A 4MVJI 2HTFA 4AAYA 4ZQGA 1N2ZA 2AQIA 1CR6A 1IHDA 5JRZA 5B55A 4KNWA 4AZ0B 4Q4HA 4LJ9A 3B20A 1HSOA 3BD9A 5TE9A 1O9BA 1V8BA 5TARA 2ZYSA 2J4FA 2AH5A 3MQ2A 4XD7D 4J1NA 1N2HA 2IHKA 2PIDA 2Q4BA 5LB2A 3VNSA 1EBFA 2AVNA 2ZJ5A 3O4RA 3WNZA 1E64A 3A6FA 2OESA 1W2WB 2F4NA 4ALIA 4H7JA 4JJGA 3FLMA 4IJ6A 4RXMA 3DMRA 3ZWPA 3KEGA 1H5QA 4Q93A 3K70B 2XB4A 2XUJA 3TEJA 3K0SA 5FA6A 4RHCA 1TUBA 2AI2A 4ALKA 1II8B 3KT0A 2J5KA 3V6LA 2I6XA 5JNLA 3IA7A 4CT5A 4XM0A 4PYQA 4N65A 4MLZA 3R7AA 3KB2A 1LB1B 1DKNA 2UV8A 1BGVA 3IDAA 1VG0B 4MRSA 3DYVA 3JQ9A 4BNLA 1C3OA 2NZ2A 1HRKA 3TCXB 2B30A 2AKEA 3MOIA 3DH0A 4C4XA 4WBNB 1X8KA 2O6LA 2GTHA 4PU0A 1QGOA 5L8VA 5DM2A 2LRHA 2NUPB 3OJ0A 1VBFA 2GNPA 4DCGA 2IZ5A 3B48A 3FWZA 2AW3A 5EJEA 4LY3A 4BJ5A 5BN3B 3KSAC 2C03A 4EJFA 1EAMA 5EVCA 1N0HA 3NCTA 2JFYA 2W6JA 3NATA 4JL8A 1TIPA 3QBJA 3FJYA 2FMXA 2NU7B 3CINA 4BNKA 4A0RA 4N7MA 4Q7LA 2A5JA 4NZNA 2ZIGA 1T9HA 3A26A 4QTYA 3L93A 4CR8A 2IYRA 1KF0A 1YS2X 4W1QA 1EDBA 2NXCA 4RVSA 2W42A 1LC0A 2D1YA 3D7MA 3E9MA 4XRRA 3AHFA 2BP7B 3ASYA 2VOJA 3LVQE 4U02A 3V48A 3WYDA 4DCVA 4RABA 1C8KA 2JLBA 1BJKA 4UBLA 3IBCA 5F76A 4G9EA 4KACA 2QE7A 4DQKA 3CG0A 4ENWA 2ZBFA 4BLQA 5CNKA 2QOEA 3WC4A 3PI6A 3LQRA 4Y3UA 2CFRA 4RTOA 2Q7XA 4G5OA 4WA8A 2BP7A 1ZK0A 2WWIA 1LW7A 2O54A 4FDTA 2R6JA 2W90A 3I39X 2WM3A 4OHPA 2Q5EA 4YASA 2OYRA 3ZE9A 2D1SA 1SXJD 3LHIA 3SKXA 3IB3A 2GLTA 2JG3A 1NG9A 2DCUA 3MTIA 4HWTA 5EPUA 1MEEA 2PT9A 1H2AS 1Y1QA 4KV7A 2VHZA 5C5IA 4B3FX 4JYMA 3GFRA 1NW9B 3L46A 3P2JA 1GRCA 3P71T 3ZNNA 4KX5A 1ND5A 1PGOA 2VJYA 3WJ2A 4S2UA 4IIJB 5EQTA 4CIXA 2YW9A 3HVJA 2NYVA 1GA4A 1HNWB 4LOKA 3ND7A 4CTMA 4MW7A 5CFLA 3CLUD 3ADBA 3D3KA 5A9SA 4Y2JA 1RKBA 1IJEA 4ZZ3A 1Z08A 2PX3A 3DKRA 4R81A 5D7NA 2JZCA 3H1GA 4JSTA 3RWBA 1ZR2A 4L3VA 1KOGA 1OREA 4Q19A 5H5JA 3S2YA 1GNPA 4M55A 3UB3A 3NDBB 5LSAA 3QPWA 4JB0A 2D3TA 4NAUA 1TJYA 5FOWA 3U7JA 5IH7A 5K0TA 1M1UA 2ADFA 1AUXA 2VTEA 2Z95A 1BRMA 3DEFA 2C57A 3HCDA 4NCNA 4DNQA 1TYAE 4FIDA 3T0GA 3BMOB 3WLIA 3BTVA 4J3NA 1GZHB 4R7ZA 5LBTA 1SU4A 1N8KA 4TYWA 2BFDA 4B4VA 2D2VA 2OBMA 2GWHA 4IDQA 3DEZA 1SELA 2I6QA 1JPNA 3GQBA 3MNFA 1YBFA 4JCCA 4LBWA 3TX6A 4FWIB 1DJOA 3T7DA 1C9MA 1A9YA 1O9HA 2I3GA 2D0OB 2Q50A 4ZVLA 2HXYA 3BX1A 3HXMA 1CNMA 4CV2A 5CB4B 3ST7A 3EMDA 3HJNA 3NHUA 4GDFA 2RBGA 3PEYA 5FUXA 5K0SA 2DE0X 1RWNA 1LX7A 5E6SA 1YS6A 1R66A 3GG2A 4EEZA 1H0RA 8MHTA 1SXJB 3GFQA 4L3OA 4TMWA 3V7NA 1S89A 2HIHA 5I7FA 1UKZA 2WG1A 3NG1A 1FIUA 1HE5A 2AKAB 1ZN9A 1X42A 1PRYA 1ZA2A 2BBTA 3UWSA 1CF4A 5EI5A 4FDUA 1QYDA 1Y6GA 1SXGA 4UTNA 3OEYA 3WWEA 1F2VA 1KP9A 4JUCA 1L8LA 1Q17A 2PT6A 3OCWA 4IOLA 4ZJPA 3QVXA 3QE4A 1FC0A 4UNPA 1BKDR 4EELA 4Z0PA 2QYHA 4DT1A 3ORHA 2EKDA 2FQQA 1QPZA 1W88A 3PWKA 4UVHA 3VJRA 2DJIA 3WBJA 2E4UA 3ER9A 2QX6A 2VTDA 4AJEA 1NN3A 2YXEA 1ZOPA 2IZ6A 3FWYA 5K3FA 1IG3A 2EZ9A 2X4DA 2QD4A 4C07A 4F5DA 1WZUA 2Q49A 3BGVA 4AX4A 4E2YA 3PNSA 4LIPD 5A03A 1RYMA 1OAOC 2CVOA 4XX1A 5CJ2A 1A7KA 4AULA 3N0TA 1R6XA 1CIJA 2CJXA 1BS2A 5SV2A 4I9NA 3RD5A 2G6BA 2P1ZA 4AN0A 2IDJA 4HH0A 3BBLA 1RYBA 1OGIA 4PE5B 4OHZA 2W2LA 2BE7A 3H04A 5DX8A 4MIOA 5IVDA 4HDCA 4C5BA 4WTOA 5D3QA 1RYZA 1ZK3A 1RXEA 4BKOA 4BBJA 1N2SA 2PNJA 1FS4A 3KCNA 4Y0AA 3ROFA 3W2IA 1K92A 2MR6A 1WNTA 4BAZA 3V9AA 3OTHA 1XMSA 5EIBD 1IZ8A 1T2UA 2X3YA 2CC2A 5GJBA 3HXPA 1UT8A 4WLFA 4EAQA 3E05A 1TYDE 2AZMA 2CD9A 2HMWA 2QB5A 3AOGA 3GZJA 4Q3DA 3MJFA 5JPCA 1LZKA 3W8NA 5KUTA 1KDPA 1PD1A 4H9GA 5KQPA 3O3OB 1XEWX 1EYZA 4YALA 1A71A 1E9AA 1PBNA 1I4TD 2C4WA 3UMJA 3WGKA 1PFUA 4K46A 3V4OA 3RIEA 4AUKA 5LU9A 3PL1A 1PE0A 2ZJ0A 3EVTA 2XR1A 1IK4A 1ELOA 2Q3MA 3IMKA 1LTHR 1T13A 3O9ZA 5BQ3A 4D8XA 3L82B 1NVDA 1PTJA 2N9UA 1K89A 5KNBH 3TYXA 2BFEA 3RG2A 3WY9A 4A6PA 3R3HA 1GG8A 4M0DA 4NEQA 2P2ZA 1GQQA 5A3SA 5KDLA 2ONYA 3W4JA 3QIAA 5LQUA 3BQ9A 1XZHA 4LJYA 2NXJA 3HBJA 3U6BA 8AT1A 1CY6A 2QRLA 3H19A 4REQA 2EGGA 4RHUA 2MDTA 3K9CA 4KR9A 1YGYA 5A6SB 3VJMA 4IMIB 2IEAA 4P98A 4BMDA 3I1FA 2GBCA 3VYTB 4Y6RA 2H85A 4ALJA 4B5LA 5E8JA 3IEVA 3QPAA 1U9IC 4RFLA 1G20E 2Z1MA 1WXHA 2JLCA 2PD3A 4EDHA 2DPXA 4FWTA 4CF5A 3UUWA 3AINA 4GS5A 3FDXA 2Z5GA 3HB1A 1MGOA 3IS3A 1WDMA 1ENOA 1ZL2A 1SIOA 4LHXA 4OOEA 3KQSA 4RPKA 2P7HA 5DIZA 5HK8A 2PJZA 2JFPA 4FILA 3NOQA 4PLHA 4F3KA 3SZRA 5KJCA 1X7HA 1XTRA 4DQ0A 4BGUA 2DPLA 2WKSA 3SHVA 3SK0A 5C7LO 4M0KA 4HVLA 1YCFA 3E1SA 4V39A 2ZXEA 5KVAA 1VJTA 2P75A 5DEOA 1V9LA 4AF7A 2YVUA 2ZQYA 1RQNA 3EGWA 5EJ9A 5LZ2A 1X9HA 1UANA 3C3MA 5J5AA 4YRIA 1E3MA 3FWHA 2R4QA 3W7AA 5E9AA 2AN5A 1FQWA 2P41A 3HPQA 5HCUA 5B58T 4Z3DA 3AVVA 1IRIA 2JJ1D 2CJYA 4CF6A 5BNWA 3W79A 1NF3A 3WYNA 5JDIC 2FPPB 4RCZA 1YQTA 1U0OC 3I5MA 1GRNA 4DABA 2E89A 1ZI8A 4K0RA 4V3CA 4C7OA 1L4FA 1U2GA 4OD0A 1LKZA 1PS8A 2E4XA 4XTRA 4LNAA 5ALXA 1F2DA 3CUKA 2G04A 3L8GA 5IM5A 4NMMA 4GI5A 1WMAA 2B9EA 3ADPA 3B38A 5KNBD 3CIOA 3D64A 4M0UA 4CM7A 4RAOA 4ETWA 2BL4A 1UQRA 1T4BA 1CUCA 4NENB 1VSBA 1DAOA 4CQLA 3L7YA 2W2TA 1WETA 3H16A 3JZAA 2I65A 3FCYA 3S28A 1WQ3A 4IIXA 1JXOA 1WG8A 1ZIPA 4RESA 3PQ2A 4IOMA 4D9MA 1QU3A 3DBOB 3ZHCA 4FFOA 1CQIA 4JEHA 3L8MA 3OWXA 4UCWA 3WYGA 3L77A 5I9LA 1YZKA 1O6CA 1EUYA 1NF8A 1NUTA 1ZGZA 3FWNA 3LDAA 1OI7A 4IH9A 3FG9A 1S3SA 1W19A 3UT5B 3RABA 4BMXA 1MDBA 3MAAC 3KBBA 3KUCA 1TU4A 4BE9A 1UBRS 2G9NA 5EUCA 2O7VA 2DLDA 3DXFA 1QP0A 3GXBA 3N8NA 3C7KA 5IAKA 2CCJA 5E38A 5HMMA 3HYLA 1UL1X 4R0VA 2XXBA 3T9AA 4OFXA 1QKKA 1FCJA 5KINB 1ML4A 1TCCA 3WWOA 1M83A 5HWSA 1W36B 5JANA 4H15A 3UV7A 2N0SA 2O2IA 3DL2A 4V1CI 3L4BA 2QNIA 3GP3A 2V59A 4CFSA 1VSUA 3TLCA 1NR5A 4RDIA 3U1VA 1BTOA 2C2ZA 3B3QA 4OV6B 4K9SA 1D6JA 1VPVA 3DCYA 3M5DA 2NV2B 4YMIA 5LUBA 1U8CB 2Z5FA 4KMRA 1QYWA 3GRPA 3K2QA 2Q0SA 2A9FA 4A4DA 1CE8A 2I2XB 2VDQB 3ABOB 4RLHA 5FL7A 3THOA 1GL9B 3SQMA 3TSWA 1USIA 4LSGA 4UTZA 3SM3A 2NVBA 2OXIA 4KW7A 3STXA 1PK8A 2KBEA 2Z30A 5ALPA 3WGYA 2L69A 2Q2QA 5FBWB 1SB8A 3KD2A 4Y98A 2UYHA 4NV3A 2ZT6A 3AVWA 3UHOA 3IJRA 1UBEA 4PBRA 5JNVA 1QOPB 4NARA 1PZMA 3EGDB 5B1YA 1GFZA 1ILEA 3OZFA 1CUYA 4Y1RA 3PV0A 2IHBA 1AO3A 3JQAB 1BD4A 4UHHA 3DMTC 1EFRD 2QXYA 4FKMA 4B8ZA 4M0PA 3AC0A 4HJRA 1NLUA 4ZAWA 4MOWA 5REQB 1RRVA 4HUQB 3MM4A 3TBKA 16PKA 3C6BA 1OXBB 5IBRA 1R00A 1KOJA 4HDSB 4WN9A 3G5TA 1OVGA 4KXYA 4UEKA 2VQEB 4ZA2A 4C2UA 4L0CA 4CMIB 2I2WA 2GPYA 2VWGA 3DE3X 4L2IB 3HO8A 5K99A 4V2UA 5CTJA 1QNFA 3VUEA 2H07A 3GRRA 3ZJ5A 1RFGE 1II9A 3DS8A 1E7YA 1RXYA 2QQ5A 4IDHA 4JI4B 3R3YA 2O2ZA 4CKZA 1UKCA 1YQXA 3HJBA 4PG5A 5CLGA 5AM0A 1JWLA 3FN4A 2YJ6A 4KTTE 4MHTA 1BRTA 2YIJA 1CJUC 3CHYA 4ODIA 1XMQB 2GERA 4EHFA 5C52B 1L1QA 2BEUB 3EPJA 2IUYA 5I5GA 1N5MA 3SIXA 4CF3A 5L9AA 2BPOA 2V9CA 1GG2A 5EA2A 2F8TA 3MJCA 1ZUIA 4S0XA 4C3ZA 2IVFA 3F6PA 1AN0A 1KDVA 1W4CA 3HBMA 5HNKA 4WXMA 4CLXA 5BUZA 1KHTA 2WLSA 4ZDKA 4TM7A 1DWOA 1MO6A 1U0RA 1T9AA 5CFNA 3KTFA 4N5DA 4GECA 4NU0A 4U7GA 4YJFB 3LMKA 3C8ZA 3NC1C 5SZIA 4DV1B 2A9JA 2BFNA 3DVAA 2Z58A 3LLCA 3OCCA 4U2FA 1CRPA 3GNSA 5DTMA 1WNFA 2JLQA 1C3JA 1O2DA 2ZIWB 3LDFA 1VECA 4GKBA 1QX4A 1KWGA 2YIVX 4TLCA 1QFMA 3D4PA 1KEZA 1Q1NA 1A8PA 2SICE 3G68A 3K8ZA 4QL3A 3QITA 4Z7JA 4UPDA 1PTJC 1GUYA 4JP3A 2DLCX 3F5MA 1NURA 3MOGA 3U49A 3TTYA 3GMDA 1BA2A 1J8DA 2ZRLA 3KETA 3EZYA 1W30A 3VR4H 1M2EA 2NUAB 2XOKD 4L07A 3IP1A 2A8YA 4TQ9A 1WP9A 3UMFA 5IP5A 1GPAA 1M2WA 2BWJA 2A33A 1JFLA 2C7BA 4XLTA 5BNIA 1LEHA 3D8UA 5TGDA 4QUGA 5KI6A 4EGAA 1DIAA 1VBNA 3VDNB 3ZVLA 1MCZA 2PJDA 3O47A 1PYGA 1N6NA 1JA1A 3MCUA 1KC3A 1Y7IA 3KE9A 1E2MA 1XCJA 1XRLA 3SHTA 3MTDA 3C1UA 2DFPA 5AW8A 2AFRA 5LIPA 4CN8A 3D6TB 3CPHA 2R79A 1CR1A 1HT3A 3IQHX 4KVFA 4D9IA 1EFKA 4C01A 4DLLA 1D5WA 3U48A 4BFYA 2E5FA 1CY7A 1R16A 2A9PA 5CTAA 1KS2A 1JFRA 3IIEA 4HXYA 1ODSA 1WWKA 2J0VA 3GH1A 3ZTYA 1VFNA 4OUKX 3TD9A 4YHHB 3B1KA 1KSFX 2WAOA 5F52A 3GVHA 4E7OA 3UFXA 2R66A 3VXKA 1NPDA 4ICIA 4BXOA 1ZW1A 1Z0KA 1E8NA 3K9QO 4R1TA 4DHEA 1ZOIA 4ZTBA 1JKXA 1QLHA 3ZI7A 4AQYB 4BNNA 1BE6A 2HJ9A 4GOLD 4B6FA 3KXPA 4P38A 3KO8A 1HXHA 1NBAA 2PVCA 3AQIA 4QYIB 4CI9A 2PJUA 4DSNA 1Y8RB 4RIHA 3ISTA 3QLVC 1Q2UA 3JWJA 3OEHD 4BN5A 3PNBA 4YJ2F 4F3RA 4LCJA 5IN5A 5KQSA 3P9QA 3IPYA 5IC4A 3LJKA 4ND5A 5C4GB 3PJRA 4R2WA 2YZ7A 3RUEA 2RHTA 4EHKA 4L4SA 4EKGA 5EG5A 1GQOA 2KM1A 2FEKA 2ZYAA 3WGQA 3ZI4A 3TIFA 2VQFB 2VHCA 2VAMA 5C80A 3U16A 2ZEJA 4OQXA 3PQ5A 3Q87B 4RDCA 4X44A 5EERA 4REOA 4EYQA 5ALTA 1H65A 3R6TA 1Z6GA 3ZE2B 1O9GA 1W59A 4N7BA 4RKRA 4UXIA 2OSBA 2VAVA 3NNDA 1OLSB 5TT1A 4C4OA 3RPEA 1GCUA 3BMCA 1NVFA 2F9MA 3MRSA 1Y9JA 3Q85A 1DBVO 3OSZA 3A6HA 2W6JD 1HLGA 2PAFA 3O4FA 5KYUB 1SKBA 1RFLA 2YJ4A 4RAQA 1XZEA 3QEOA 4NC9A 3OFND 2R7AA 4YMTA 1PR3A 3FYTA 1NV9A 1X1EA 1P7YA 2DR0A 3TMKA 1EDZA 4FDMA 2Y05A 1U6JA 2H17A 1TGVA 3NVMB 1HE3A 5CDHA 1Z6ZA 1ZC4A 1X1RA 2CZCA 2R44A 3KQOA 2GAFA 5F7JA 4EVRA 1LLFA 5JD5A 4YB8A 4BFVA 3WGNA 4OHBA 1JA9A 3LC0A 3G0HA 5ENZA 3CZ4A 2VJNA 3H9BA 4OI1A 1NWHA 1UBSB 3E58A 4MW1A 2FRDA 1VKRA 4M7PA 4NE9A 1M1NB 2QSUA 3HJRA 3I72A 1WKBA 5BSUA 3TSCA 3YASA 1K86A 3JPWA 1QFXA 5FWYA 5HM8A 2UXDB 1M2OB 1CP2A 3A3YA 3RC7A 2JC3A 1E2HA 4Q16A 3DW1X 4KWTA 2EKLA 2ZZMA 3ZHUA 5TS2A 1S0UA 3O2NA 4YHBA 4U7JA 2PL9A 4UU0A 4DG5A 1I2DA 4I8XA 3COJA 1Y9ZA 1DBPA 2O7QA 1NAHA 2BFDB 2PXAA 3DWFA 2P5TB 1W87A 4O4LF 4DJFC 5BR7A 4AKEA 1OAOA 3KQVA 1USVA 4F93B 9LDBA 1TEVA 4JBIA 4HEA1 5CT6A 3X1YA 1FFAA 3AUAA 4IDOA 3RIGA 1Z5VA 2BFBA 2X13A 4V02A 4PHHA 3OIUA 1PF7E 2WTNA 2M9MA 2RHWA 2X6RA 3Q7TA 1D1TA 2K4MA 4EFDA 2X8WA 1K8QA 3MYYA 5GZ6A 1H0HA 5BT8A 5HSGA 3A7EA 4LF9B 3GAMA 3WS7A 1NG1A 3S2UA 4YAJA 1DUSA 1FZQA 2FR8A 3RC8A 1GTJ1 1TK9A 2AMLA 3NGLA 3VR1A 4DDUA 2ZJYA 5A7GA 2GZRA 4QBIA 4KR6A 3EZXA 1L9XA 3KKLA 2HV8A 2R0QC 1HDYA 3K8QA 3MJRA 3UJCA 1ULSA 3LYHA 4E88A 5AVJA 1P7CA 1KI4A 2XVZA 5FHQA 1V5WA 1JE1A 1SHJA 1X7XA 4YGXB 1AGXA 3FFAA 3PLAE 2RHDA 2HZ7A 2VJAA 3AY0A 4WCFC 2JJMA 2YS6A 4BP3A 3QEJA 4ND8A 4R98A 5H4GA 5FFNA 2VCHA 2WSIA 3JV7A 2WMYA 3VKHA 2BHLA 5BN3A 1R9JA 4MV7A 1JXQA 2PD6A 3UHAA 4RD6A 1RRGA 3WIUA 3GMIA 4KIJA 1I7NA 4G4SP 2F17A 3NO4A 3FDFA 2ID8A 5B36A 1MV8A 1YK0A 1ZOSA 3OMWA 4N1AA 3WKBA 1DFHA 1U0EA