4IRUB

Crystal structure of lepb gap core in a transition state mimetic complex with rab1a and alf3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
170
structure length
170
Chain Sequence
EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LepB
publication title The Legionella pneumophila GTPase Activating Protein LepB Accelerates Rab1 Deactivation by a Non-canonical Hydrolytic Mechanism.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase/hydrolase
total genus 53
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4iruB00
1KI8A 2NO7A 1RPZA 1D2NA 4GP7A 1P2UA 3THYA 1P62B 4C4PA 1N6PA 4TLEA 1S4QA 3MMPA 4HAVA 2DCUA 5AJYA 5FUYA 3IO3A 1S3SA 3RS2A 2PZGA 3NBYC 4WBSA 2ZJOA 4A8JB 1VYVA 3NDPA 4ZKEA 4C3ZA 3HYTA 2IC5A 1HA3A 1P4SA 2VP5A 1F2UA 2CCGA 3HYRA 4DT1B 4DLXA 4BLOA 2KE5A 2IUSA 2A30A 2YWFA 1ZD1A 2NG1A 3A6PC 3BXZA 3TSWA 1JR3E 1P9WA 1GNRA 3GLFE 5KNBA 1F6BA 3CLVA 3VQTA 4R98A 3EG5A 1NKSA 1U8ZA 3PEVA 3H84A 1M7HA 1U0HC 4HZIA 5G40A 1EFRD 2GTPA 2KSQA 1JQJC 3K0AB 3OEHD 4JLNA 4LJ8A 1RYHA 2PJRA 2BJVA 4WZ6A 2REBA 2JJ1A 4HZUB 2VHUA 1R0XA 3K53A 3OEED 3UIEA 3CWQA 4PTLA 2Q6TA 2XNSA 2ZE6A 2RHMA 3HU1A 1CJTC 5J4LA 2OBNA 4MRVA 1IY2A 3ZD7A 3ZD6A 3SI7A 4LWZA 3C4JA 4R2HA 3H86A 1Z8FA 1XB2A 1SZPA 4IDPA 4XJXA 2Z83A 2ZRHA 2NO6A 4MRNA 2O8EB 3AEZA 2FPKA 1V43A 1GTVA 4F93B 5JZVA 1MRSA 3SDZA 2SHKA 4Q1FA 3W8RA 4MDFA 3DKVA 2VL7A 3I73A 1OFTA 5J40A 1X1RA 5GJWC 3U6KA 1EG7A 5EE9A 1NLFA 3T5GA 1AS3A 5BN4A 2GXUA 4F4IA 4C0KA 4M1WA 3DEFA 2J0UA 3I8SA 1E0KA 1YR7A 1P2VA 5FR2A 3F8TA 1BIFA 2QPOA 2O8DA 2BOVA 3IGFA 4PAQA 3GLGA 2RGNA 2QTHA 2RH5A 3I4LA 3QKSA 1NJFA 2CCKA 1CJKC 1T0HB 2H5EA 3SYKA 2RGAA 4XSGA 1XMVA 3QF7A 2C5LA 2FX3A 2HJGA 3FMOB 2CCJA 2J87A 5BN3A 1PV4A 2X1VA 1XEWX 1SXJB 2OXRA 3GJXC 3ZZUA 2Q21A 4BRUA 2K5UA 4DXAA 5FOXA 1ESNA 2ZJYA 3KKMA 3LQRA 1ZINA 2XNDA 4EIWA 4HAYA 5FUXA 2BMDA 3PENA 4MA4A 3D8BA 1Z28A 3BJIC 4HB4A 3X2SA 1N6OA 4NPHA 2IHBA 1OIWA 1J70A 3K70C 1VHLA 1T5LA 3QKRB 3CUEF 1Q1EA 3QXJA 3EA0A 4MUBA 1VCOA 2GVDC 5IDVA 1DAGA 2A3RA 2R62A 3O8RA 2FSIA 2IXFA 1FP6A 4UJ3A 3ICQB 3UMRA 3F3YA 4XD7A 2ZSFA 2ZRBA 1TQ6A 1ZNYA 2REOA 2HLDD 2CLSA 3SBDA 2F6RA 4F7WA 2BKEA 1WRBA 2Q3FA 221PA 3VR3A 4LJ6A 3AQ4A 2F1RA 1ZC4A 2IYLD 5TMPA 2GAOA 5EXSA 2HYIC 2C77A 3BFKA 4AD8A 1KO5A 2QRNA 3WYGA 3BBPA 4RY2A 1R8SA 4DLZA 4S2EA 2BBOA 2WV9A 2EFEB 4Q21A 3K0FB 4C7OB 1XPUA 2W6IA 2ZYUX 2JA1A 2O52A 3BGWA 1AQUA 1N6KA 3C41J 3KKQA 4A8JC 2W0SA 3AB3A 1M7BA 4OJQA 3R8FA 3FHCB 5BN5A 1UKVY 1KOFA 1IONA 1E79A 2GDJA 3MRSA 2PMDA 3AKYA 3WP0A 4JT2A 2HDNB 2ZU6A 1US8B 4R2IA 2ZAOA 3MD0A 3R9XA 4P4TA 2GXSA 2F9LA 2BBTA 1UBGA 2H17A 2OILA 3GJ7A 1GL9B 3FMFA 2GAAA 1Z06A 2ZSEA 2XEXA 4B3FX 3THWA 4KODA 1E32A 2IYXA 4B71A 3LVQE 4L9SA 5M04A 1IBRA 4Q66C 4DDWA 2C9YA 1M34E 1WMSA 1EX7A 5H1YA 3VU9B 2NO1A 3EIHA 3LX8A 1JNYA 1XFAA 2A9KA 1G16A 2ZQ5A 4FN5A 2C2HA 2YZ2A 1KI6A 5BWMA 1Z2CA 2JLVA 1UEJA 1II8B 1OIVA 1XEWY 1UJ2A 2ZJ8A 4OQXA 4URUR 4B34A 1E2KA 4LBYA 3LY5A 4QFMA 1N6HA 1N5JA 2VP4A 1G5RA 1R6BX 4M1YA 2IWHA 1OH8A 2H18A 4IOMA 2WJJA 4WOPA 4BE7B 2JDIA 4EPVA 2JLYA 1VPLA 2FPMA 5TARA 3C8UA 5KDDA 4MRSA 1ZBDA 5JMTA 5HPYB 1HE1C 2CE2X 1SQ5A 5AK0A 3SJAA 4D4MA 4EFMA 2F43A 2MSEB 3RYTC 3GMTA 1YZNA 2F1IA 1WDTA 4IOJA 2GHIA 5F2EA 1M2OB 1P72A 1TF5A 2ORVA 4BUJA 4LI0A 4C0LA 1G17A 5J4VA 3CH4B 1EFUA 1KNXA 4M1OA 3X1YA 4MKGA 3EIQA 3TSOA 4AKEA 4FXPA 1SULA 2MSDB 4OQLA 3IPYA 5D3MA 3SN6A 2J59A 5CLQA 2YNMA 4NP6A 4ZDKA 1R0WA 2HF9A 4LV6A 1DG1G 2C8VA 5DYGA 4AURA 2X8AA 4TT3A 1NNEA 5KNCA 4BLPA 5HE9A 2PZEA 1J8MF 2IA5A 3T35A 4PPQA 4H9GA 1KI9A 1XTRA 3L0PA 4I1VA 2XXAA 1SXJC 1D6JA 121PA 4PO8A 2XZLA 4ACBA 4B33A 1G4AE 1RVDA 3B6EA 2KWIA 4IVQA 3BE4A 1OKKA 4UNPA 1NVWQ 6Q21A 3A4LA 3Q3JB 3VKGA 1KGDA 4BQSA 3T15A 5EZ6B 3FKQA 5CYPA 3RWOA 4LPSA 3OIWA 1N3BA 2GJKA 4RFSA 2DFNA 3K0EA 4L5BA 3SOPA 1NIJA 1GKIA 3X1WA 1Q57A 3U3OA 1P2SA 3A1TA 2VPPA 5CIQA 4HLQB 1NG9A 1NJGA 4QJ3A 3EAQA 2QN6A 5JCZA 1SVSA 5JBQA 4KI0A 3VKWA 1OFUX 1D9XA 4MGYR 2H7VA 1HT2E 1NSTA 3TNFA 4B3DA 3DHWC 3GP8A 1GKYA 5EP2A 1VKJA 4XIGS 3V4RA 2NPIA 2OBMA 2OBLA 3NH6A 1E2MA 5HTKA 1FOEB 1T3SA 1NMZA 2WPDA 4PAMA 2YWEA 3KFXA 4A2QA 4AK9A 3PUWA 4Q47A 1CXZA 1G3UA 2VF7A 1W1WA 2J3EA 1J90A 3ZVNA 1W4BA 3AF3A 4PQRA 3FFAA 3RS0A 2A78A 1IN5A 2A5GA 2VP6A 3CB4A 4CEJA 4TMTA 5J47A 3FPAA 1JEDA 3X1ZA 4W9MC 4AKGA 2J9RA 3GLGB 4TL7A 3NH9A 1T4GA 3AF0A 3PJRA 1E69A 1GL7A 3KL4A 4QC2A 1RW4A 1W5SA 2UZ3A 5EE0A 5GJCA 2JJ1D 4L8GA 3UWKA 1KK1A 3JVUA 4POAA 2ZJ2A 4BPBA 5B64A 1NVVR 1XX6A 1QHGA 2RKOA 4HLCA 2VHQA 3GQBA 4YMUA 3SR0A 2KB0A 2QG6A 5JWRA 4HB3A 4LY6A 1MT0A 2O8FA 2Z4RA 4HATA 2WOJA 4BFUA 4URVR 1TEVA 1TL7C 4IXMA 2IYWA 3L82B 4NMMA 4ZV4A 2Q9AA 1E2NA 3R20A 2C96A 4GT1A 4B6FA 1G5TA 4Q1EA 1OYYA 1W44A 4AYXA 4C0SA 2C78A 3CF6R 2QQ0A 4Q9HA 3M6AA 2A5FA 3MJRA 4ZPXA 1NLZA 1C4OA 2D7CA 2GETA 3CONA 2WKQA 4O2LA 1OE0A 1IJEA 4A2PA 3GJ4A 1A4RA 1UM8A 3WYFA 3LX5A 4AY2A 1E4VA 2HV8A 2X19A 3MUFA 4JKYA 4NDZA 3BD9A 2O8BA 3L0IB 4IOKA 4M4SA 2EYUA 3QXHA 4TQAA 4QG7A 4OL0A 4Q5IA 1KSFX 1YVDA 3T1OA 4BFXA 2QU8A 4KFTA 2GXQA 4BFSA 2ZRGA 3G5UA 5C2JB 3P26A 2GXAA 2GF9A 5J4KA 5AJZA 4CZ2A 2OAQ1 5JSZB 4AG5A 4DSUA 3AM1A 1NRJB 1JPJA 1Q1ZA 2BMJA 1T8UA 4CEHB 1KDPA 2G77B 2BC9A 4D25A 3K0CC 4QJ5A 4TL9A 3CKLA 3TKLA 3GLIA 4CVNA 3VR1A 2XNDD 1HE8B 5FOUA 2QSZA 1GFIA 2A5YB 4BZQA 5E7JA 2O0KA 1T9HA 2E1RA 2ZI4A 3RSLA 1W48A 4FW9A 3SQWA 3QJYA 2ODEA 1S0UA 5BQ5A 2IYZA 2AKYA 1XXHE 2ZI9A 1XNJA 1YR9A 3SQXA 1DADA 2ONKA 1KSJA 2ZR7A 3QSYA 2V54A 4Q4HA 3TIFA 2GCOA 1GAJA 4XD7D 3WMGA 4D26A 3VTKA 5EP3A 2ERXA 2KJQA 3E1SA 4KITB 4X8MA 1Z0FA 2GRJA 1KO7A 4W7SA 2QMEA 4LHVA 1L2TA 2QSYA 2VA8A 1UKZA 4V0OA 4JVNA 1AN0A 4N3NA 1CR4A 2DY1A 2GEVA 3PUZA 3I32A 2O8CB 3GLHB 4B73A 4X8OA 4C0JA 1JBKA 1A82A 4RJLA 1AM4D 2J41A 1M7GA 2OESA 4M0LA 1RYFA 2XSZA 5P21A 3K8YA 2WVJA 1R4AA 4LJAA 2W6ID 4PHHA 2VBCA 3AVVA 1OSNA 4JL6A 2DB3A 2QEQA 2VSFA 4EJSA 1F3OA 5IK2A 4AKIA 2QPTA 1M8PA 1N5KA 1OLOA 3B82A 3OHMA 3SC3A 5K8TA 3SYLA 1E79D 4KCGA 5FPSA 1II9A 3W8NA 1O87A 3I5XA 2Q9BA 2X2EA 1UBCA 2O5VA 1IQPA 4DLWA 3AKEA 3U5ZB 1JAIA 4QGAA 3LXXA 5DI3A 3QXSA 3UWOA 4FD2A 1UF9A 2IWRA 1VIAA 1KI3A 1X86B 3B60A 4FI3C 1NN1A 1HYQA 1XXHA 2JATA 2N46A 1QBKC 3RNLA 2OXCA 4EFNA 1W4CA 5EE1A 1U90A 2ZRIA 1AQYA 1XJ0A 2ZRPA 3SZRA 4HLDA 2RGNC 2C98A 2WJGA 1CIPA 2QY9A 2OT3B 2ZRDA 3KQHA 3LWNA 3A36A 1VG9B 1UPTA 1XD8A 2CEAA 4Q4JA 4RZUA 5DHFA 1XCPA 2FA9A 5IRCD 2DYKA 2WICA 3FMPB 3IQXA 4G3XA 4MRPA 4EQ6B 2BCGY 2CVHA 1YZLA 1CS4C 2GZAA 1XEXB 4JSYA 2QAJA 3IHLA 3JZMA 4KJZA 3THXA 2VHCA 1G6OA 4B3XA 1NSFA 2PT5A 2YC4C 5FTNA 3EPHA 1FMLA 3O8CA 3A37A 1KI7A 3O8DA 4KBGA 2PJZA 3K9HA 2EWWA 1Z6TA 2F3RA 3C14C 1KI4A 3TW4A 1IN8A 1ZUHA 3LVRE 5EXPA 4S35A 3VR2A 3FDIA 1FX0B 4B3CA 1ONBA 1E1RA 2F7SA 2ZAMA 3O47A 4LJ5A 3VMFA 3C16C 5JECA 1WA5A 2NQ2C 1KYIA 1C9KA 3RANA 2QQEA 1W36B 5FH9A 4JBYA 4XOIA 5LBIA 2CMKA 3H4MA 3WBJA 3G82C 2W58A 2WWXA 2A2ZA 4E5UA 1NIPA 4V0NA 5JCPA 1XF9A 1MRNA 4A0FA 4Z8XA 3Q5DA 1E99A 1Q0UA 1NVVQ 1KIMA 2WJVA 5DN6A 5BYKA 1GRQA 4WZBE 4ZIRA 3U44B 4KYIB 1Z63A 4NU0A 821PA 4TT3D 2WWIA 4DZZA 3IEUA 2GEDA 4HUQA 4WA7A 1MABA 4NBSA 4EFLA 5BW8A 1ZU5A 1E2FA 3LA6A 4M53A 5FOWA 3T1TA 4WW0A 1OKKD 2AFIE 2G3YA 3EC1A 2RCNA 4B44A 4B48A 5GVSA 3DDCA 4P4UA 3ADBA 2ZRLA 4MYCA 2B6HA 4OI1A 2BKUA 2A7QA 3OF5A 1VYTA 2QE7A 4Z54A 4IDQA 3F5FA 3UANA 1E2GA 4FCVA 3NEJA 1S3GA 5EP1A 1VDZA 2WMOB 2WWGA 1J99A 1XD9A 2EQBA 3RS7A 3CX7A 2FGKA 2VRWA 4RZ3A 1F48A 3EPKA 1L4UA 2YKGA 5GVRA 1C1YA 3R7WB 1TEXA 4FMCB 5ELXA 4P31A 3TLXA 1SGWA 3AF1A 1WXQA 2YWGA 3U60B 1EWQA 1F5NA 4JLOA 4AIIA 5FTKA 1SKQA 2QT0A 4Q1BA 2OE2A 1KKLA 3LBNA 2R6CA 3WBKA 4ZCMA 5E4FA 4XWKA 5C4GB 2EW1A 1G20E 3KJGA 1OB5A 4NYMR 4ZCLA 1W0JA 3QXCA 4JVMA 3NC0C 3WHKA 4K8OA 5KSPA 2B8WA 5HR5A 2QP4A 4GRAA 2PEZA 3L8YA 2WPDD 4OJKA 5DE3A 1OF1A 2FWRA 3ZVLA 4CEIA 1OHHA 4A1FA 1OB2A 1OXVA 5SZKB 3TW8B 2HXSA 2CJWA 4IDNA 1HY3A 1QG4A 2PZFA 4TYPA 3T1VA 2OLJA 3B7GA 5KSOA 2H1LA 2R6GA 4KVAA 3ADKA 2FF7A 1CP2A 5L3SB 2OSBA 4G1UC 2GBLA 3K0SA 4NYJR 1MO4A 5FUVA 3TQFA 3H2YA 2CNWA 1EGAA 1IXZA 4HB0A 3ASZA 3HPQA 3KQUA 4IW3B 2BM1A 4PC3A 3SHWA 1E1QA 1XD2A 1HUQA 4TMWA 2VO1A 3BK7A 4UXJA 1RRCA 3I3SR 2B21A 3PIRA 4LYFA 1H8EA 2QBYA 2CHVA 3ECCA 2QGNA 3IKJA 3WNDA 3CNLA 3S1AA 1LVGA 2OHFA 1DELA 1E2IA 4I1UA 1KAGA 3QVVA 1WB9A 1N25A 5FPKA 4C0HA 1DVRA 1UAAA 3AVTA 3AVWA 1SVMA 2HEIA 1KSHA 2GCNA 1FTNA 4P3YA 2B92A 2PT7A 4D4LA 4NCIA 1DG3A 4DSOA 4XTCS 1LNZA 2QROA 4ZI2A 3F0TA 4TYQA 3QQ5A 3ZQJA 1IN4A 1E3MA 5JLJA 3SJBA 5A0FA 4R7ZA 2BJWA 2J0QA 4B76A 2ZE8A 1QHHA 3ND9A 3QEOA 1ZD8A 2EWVA 2IXEA 4EPWA 4QM6A 1EFTA 2KBFA 5CB8A 1UDXA 5CYOA 3M1IA 4EPXA 4Q7JB 4LBVA 2W83A 3KTAA 4BZXA 5LD2B 1AGRA 3W3AA 3REFA 2J7KA 2RGEA 2F1JA 3P4YA 2OCBA 2Q3HA 3A1SA 2QORA 1W36C 2IS2A 2H57A 4BFWA 3UMFA 5KTYA 1E9DA 4RVCA 2DWPA 4V0LA 1UADA 1DS6A 1GUAA 1Z29A 1S2MA 4KSCA 3ZGXA 4HSEA 5JEDA 3N5CA 4N1AA 4DBLC 1HV8A 1L8QA 1RRGA 5DGXA 5HZKA 3AVXA 2AK2A 2XOKA 3AVUA 2ZS9A 4CRWB 4C0QC 3MCAA 2QM7A 3KQKA 1P75A 3QNUA 4OHVA 1Z83A 3ND8A 1JR3A 3C7KA 3GLFA 2V1XA 2BV3A 3DZ8A 4Q7KA 1H65A 3CBQA 4G01B 1N6NA 1FUKA 1JPNA 4OHXA 4OQMA 2HCBA 3HJNA 1Z0KA 2I3BA 1HT1E 3NG1A 2R6DA 4US0R 2WJIA 2GZHA 2ZI7A 2GJSA 3T5DA 3EC2A 3KFVA 3NKVA 5C1BA 1L4YA 4DCNA 1A2KC 1T0JB 3MFYA 1LY1A 3MLEA 1R7RA 1E9RA 2BIFA 3OIVA 2OG2A 3TR5A 2J0SA 2WZQA 2Q3MA 4O3MA 4HUTA 2ZJZA 3FOZA 1AS2A 4DDTA 2AWNA 5L3RA 2XSZD 3TBKA 4DLUA 4JZKA 1G3MA 4D0NA 3QBTA 3IQWA 2XGJA 4D0LB 4TLCA 4Y0AA 1JJ7A 2F3TA 1KI1A 1ANKA 2QRZA 2QMUA 4W5HA 5IK2D 4PHTA 4MKHA 3KUDA 3OIUA 3QF4B 4TYNA 1ZIPA 4B2LA 4BLRA 1SVWA 3AGPA 2ZRCA 4L15A 4DLYA 2JEOA 4Q9IA 4B47A 3SEAA 5KPDA 2D2FA 1OFIA 5K8LA 4P4SB 3AP1A 4KAXA 1OXXK 2AXNA 1A5TA 2ZJ5A 3LFUA 3P1JA 3U7EB 5IF9A 2QAGA 1KSGA 1NY5A 1OH7A 4TLBA 2DFLA 1F2TA 5BYJA 3PEWA 4JS0A 2FPLA 2G0TA 4ESVA 1Q22A 4DUGA 2FG5A 1G3QA 3REGA 4PANA 5AUQA 3TK1A 2UZIR 2IS1A 3ASYA 2WIBA 1JALA 2CLCX 4Q7LA 1JR6A 3MWJA 1UEIA 4CT4B 1NMXA 3DM9B 4OQFA 3QXXA 1Q20A 1T5IA 1W4AA 2ECKA 2IEZA 2WAYA 3EWSA 4LUCA 1XZPA 2BDTA 4QRHA 1FUUA 5FR1A 1G8HA 3W6NA 4B32A 1W4RA 3CWZA 4ARZA 4RD6A 3U7GA 1KDOA 1ZVQA 4PC1A 5EZ5A 1KMHA 3I61A 3GLHE 2R6AA 3T61A 4LK2A 3V00A 3QVUA 4E22A 5JFGA 1RRPA 2ZJBA 1VMAA 3RRNA 4Q1AA 4CYMA 5B58C 3SJCA 3TAHA 4ESHA 1E1RD 3VR4A 3FKSA 3P4XA 4M1TA 4NCKA 4JLJA 4AYTA 3NXSA 3U3RA 3Q7QA 1LTQA 1TQ4A 3A1VA 2XTMA 4XVQA 2JLSA 4A0RA 1XTIA 5E7IA 5KPJA 2HT1A 2HT6A 4FINA 2ODWA 4IXNA 5A4JA 2FDCA 5KSZA 1GNPA 2O0JA 1MO5A 4BFTA 4QOSA 2CL0X 1EESA 4F92B 2YV5A 5JS7A 2R44A 5DN6D 5LD2C 2A5DA 4JLVA 3AVPA 4NZYA 1ZCBA 2ZI3A 1I4LD 2J45A 4YQFA 1SVKA 3E5HA 3NHBA 1A2BA 1N0VC 1SKYB 4EDHA 5CK5A 4EJSC 3BAFA 3GJ0A 4CT5A 2AKAB 3LNCA 1G7TA 4MITA 5TY0A 4YMWA 2TMKA 3K9GA 2PMKA 4YDHB 1VG8A 1TUIA 1HQCA 2FFQA 2QE7D 1PVOA 2O8FB 3QEJA 4YMSA 2IYVA 2UKDA 2J5XA 3THYB 4PZYA 1ZU4A 1QHSA 2ZE5A 1TQDA 1NMYA 2H16A 1TPZA 3A1WA 4JMPA 4JKIA 621PA 2RGXA 1CJVC 2JIZA 4OQNA 3AVYA 4ITRC 2FFHA 1E9EA 1JXOA 4U7DA 4F4JA 4RCZA 2EVWX 5G3ZA 2FU5C 5TV2A 5EQTA 2QZ4A 2HJVA 4BRWA 1F2UB 1RRFA 2J46A 1G7CA 2IYRA 2ZITA 3GEHA 1U9IC 4JJZA 2V55B 4KBFA 1QZXA 4XTRA 4I99A 1G64A 4OBEA 3NHAA 2ONJA 3B8HA 1PLJA 1GP2A 1W0JD 1DTSA 2GVZC 2NO0A 3UATA 4YLGA 4IVPA 2A5JA 4HLUA 1OHHD 4IDOA 4JLKA 3AVQA 4QBFA 5FTJA 2CHGA 3HWSA 1LF0A 1RIFA 5FBWB 4PPNA 5L3QA 4QGFA 5FUWA 2IHYA 4IRUB 3CPHA 4KSBA 4TZ6A 3AV0B 1NI3A 2ZROA 2MSCB 3VFDA 2PBRA 2BMFA 1N0WA 1RJ9A 2EFDB 3RWMB 1IAQA 1NBME 5C18A 2CNWD 3B1WA 1E2PA 3CM0A 4OHYA 2ATVA 4OK6A 4IVRA 3PQCA 1E1QD 4TQ9A 5HCIA 3EZ9A 3EPLA 3NEYA 4W5JA 4US1R 2VIIA 4NYIR 4LSGA 1H8ED 2GJ9A 1R0YA 4NKRA 3RRMA 4TN1A 3BH7A 1JB1A 4ZO4A 3T12A 5FI0B 5FBLB 3Q7PA 1XJQA 4KFSA 1FP7A 2OCAA 1IOZA 1YQTA 1QHNA 2IW3A 1GVNB 2BCJQ 2WJYA 1YZUA 2O0HA 1Z2AA 4Z1MA 5FFMA 5FOVA 4OI2A 3FVQA 1N6LA 1ZJ6A 1X6VA 3GFOA 3DZDA 3J81k 3AUYA 5CJ2A 5GJVC 3AH8A 3WNCA 4V0KA 2J0UB 2LKDA 1RE0A 1AKEA 2ZREA 4LDJA 5B30A 2G0NA 1COWA 2AD5A 4M1KA 4NTZA 4C9BA 2D3WA 1ZC3A 4DCUA 2O8DB 5B2ZA 5F9FA 1QRAA 3B1ZA 1G1MA 3IIMA 3QKSB 2GJ8A 4LC1A 3SBEA 1R5NA 2QP3A 1OH5A 1BOFA 2Y8EA 3BORA 4BECA 4BASA 1Z07A 4LRWA 2E9SA 3GPLA 4I81A 5FBRB 1P9RA 3UG6A 2PLFA 3IIKA 2Z4SA 3CX8A 4J0QA 3TRFA 2VH5R 3LDAA 2IF2A 3ZS9A 1AS0A 3MSXA 4QKQA 4PPGA 1AKYA 2N42A 3ZQ6A 2VSOA 4CGZA 4ZI3A 3GCGA 1ZM9A 3U61B 4QM7A 2MMCA 4FWTA 5CM9C 4BZPA 2ZEJA 4B2IA 1IY1A 3OAAA 4C30A 4A82A 2IL1A 4HB2A 4XWOA 3A8TA 3KQLA 2XOKD 1T8TA 4TMVA 1E0JA 3G0HA 3PCRB 1CRQA 2W2VA 2P5TB 4Q03A 2GKSA 4HDOB 1LV7A 3RLFA 1GWNA 1TF2A 3HPRA 1KHTA 3EASA 4ABYA 1HTWA 2DBYA 4URYR 1OXSC 3PUVA 721PA 3GEEA 2CVFA 1SVOA 2AFHE 2W0MA 1U81A 1U98A 2HUPA 2R65A 4NH0A 5G53C 1JR3D 1Q3HA 1RKBA 2J0VA 3SNHA 4A4DA 3DOEA 1TMKA 2IS4A 2REXB 2GBLC 4GSYA 3GFPA 2WOOA 4KO8A 1AIPA 5LDDC 3T1QA 3QKTA 5K8IA 4IFBA 1ELOA 1GKUB 2E87A 2JLRA 1KAOA 1RC8A 3KB2A 1Q12A 4LZZA 1CLUA 1AJEA 1Q3TA 5H68A 5FPTA 4GFDA 1NVUQ 2X77A 4GOJA 1ZM3A 4OYHA 1LB1B 4DLRA 1VCNA 1P2TA 3CNOA 2IYQA 5CLLA 1P73A 1YJ5A 4Q4AA 4Q1DA 1MV5A 3UMSA 1ZYUA 1AZTA 4UNRA 4IEEA 1TUEA 2FH5B 3P32A 4DEYA 2CLDX 1IY0A 4V03A 2JLZA 1EFCA 2EFHB 3BB1A 3QPUA 4UXIA 5DISB 3MWLA 3NDBB 3MG9A 3MWYW 3THWB 2ZIAA 4TL8A 3BERA 1YR8A 2DHRA 2R8RA 1GRNA 2PL3A 4UNSA 1NY6A 3V4FA 1KY2A 4A8JA 1XTJA 1XEFA 2P3SA 3IBYA 5JJLA 2PH1A 1YKSA 4LHYA 2P67A 4JBXA 4TMKA 4FMDB 2FSFA 1N2CE 1RFLA 4GZMA 1KKMA 5DLQC 1KI6B 4DT1A 4DUGD 3SS8A 4MYUA 2RHDA 2JLUA 1XMIA 1D2MA 1Y3AA 4II7A 4D4JA 1XP8A 1NF3A 2DR3A 4KU4A 4PHFA 1KO1A 2H8KA 3LXRA 4DC9A 1E98A 3FE2A 3JVVA 4HDQB 3SHFA 421PA 2R6FA 3HR7A 3QG5A 1JQLB 4MDEA 4KV9A 1J8YF 3I5YA 1G6HA 3LBIA 4FWIB 1U0JA 1JAHA 2ZI5A 3LW7A 4M9XA 4RKEA 4HZUA 2GK7A 2RGGA 1DAIA 3IILA 2JJ8A 4QNRA 5DSZA 1SXJE 2ZPTX 4JIMA 4MGIR 2ZVPX 2V3CC 2F43B 4PAOA 3ICEA 1PUIA 5KUTA 2IXGA 2FV8A 1VTKA 4QL3A 4YMTA 5E3HA 4B43A 2Z43A 3U7HB 3FGNA 5F98A 1P60A 4DSTA 3B5JA 2QA5A 3FKSD 3KXKA 1JJVA 5DNYB 2FEOA 4L16A 521PA 1KMQA 2O8EA 3BOSA 1GNQA 1DAFA 5D3MB 4HEJA 3FWYA 3W34A 1YZQA 2C9OA 3A1UA 4KYUA 2OFXA 3TE6A 1ZUIA 4YDSA 2NTYC 4ZDIA 1Z0IA 4MGKR 4A6PA 2ZUBA 3B13B 3W5JA 3M4YA 4R9UC 1R8QA 4AYWA 3ZZ0A 2XXAB 2G88A 2H92A 4WXRA 3EW9A 4X8LA 1OXTA 3FTQA 4RD3A 3WRYC 2VTKA 4AKHA 2CK3A 5H8WA 3D3QA 3X1XA 4TQUS 2ZJAA 3AP2A 3GD7A 4DDUA 1W0KA 2Q9CA 5SZIA 3B1YA 5JWOA 1GG2A 3ZLJA 4LX0A 4RFSB 3RHFA 2R9VA 1XCMA 2JDID 1KJWA 3BB3A 1K6MA 3DKPA 5AUOB 4OK5A 5GJBA 4W5WA 1TF7A 4BLTA 3RRYA 2QAGC 1S8FA 2AL7A 5KDLA 1SXJA 1VYUA 2D7DA 5AJVB 1CBUA 1S9HA 1P5ZB 1LS6A 2BMEA 4H1UA 3RSOA 3K09A 2OCYC 1GDDA 4URWR 2JIZD 4FCTA 1E0AA 3V9PA 1OPXA 3K9LA 3KKOA 1D2EA 3GJ3A 4LCBA 2YINC 1OT3A 5TB5A 4GNKA 5JRZA 5CJPA 4MQBA 4M2LA 1G8PA 5CM8B 3R8CA 3EZ7A 4JJKA 4Z51A 1Q1QA 3EZ2A 4DVGA 1G41A 2G6BA 3QKRA 4DKXA 3C5CA 1HEIA 4PFSA 4ZCIA 2JLXA 5JRJA 2B7CA 3VKHA 4G0NA 2XZPA 4Q4LA 4V0ME 5BXQC 4JLMA 3E2IA 5L8VA 4BGDA 1FL9A 3CX6A 2V9PA 2IF0A 1GM5A 1E9SA 3FHOA 5JEEA 5A5GA 4CEJB 4O25A 1E2HA 2CE7A 1T3HA 2V6JA 1IM2A 3D31A 5HZHA 2OCPA 3GJ5A 2UVQA 4IFEA 4L9WA 5HE8A 4AWXA 4DEXA 3U4QA 1G291 3QI2A 2AK3A 4K81B 3PEUA 4OI0A 1AK2A 3KB1A 2C9CA 3LW8A 4DIEA 3K0FA 2ZUCA 4Q9JA 3I62A 1P3JA 4C7OA 2ZS7A 3IIJA 1XCGB 2RGDA 3OZXA 1T91A 4UNQA 4ERNA 4PX9A 3TUIC 4G5QA 1ZW6A 2IUTA 4PC7A 4RZ2A 3SU8A 3QPWA 4MUAA 3CRMA 2D2EA 2RAPA 4JLBA 2GILA 4YXWA 4UKDA 3GJ8A 1XZQA 1OIXA 2AWOA 4PZLA 3IHWA 4Q02A 3B9QA 2WMNB 3I8XA 4HAZA 4TSFA 5HKKA 2C99A 4PZZA 1EK0A 1GZSA 4QHTA 2QUZA 4Z1MD 1U2RA 2RMKA 5DHAA 4PXAA 2G1JA 1EFHA 4U00A 4WAUA 2DFTA 2V7QA 1ODFA 3L2OB 4LYHA 5IHPA 2O8BB 1E96A 3IEVA 1Z0AA 1UDWA 4V0MA 5CDFE 3VU9A 3BWDD 4HDCA 3EWAA 3BH6A 4WVFA 1KJZA 1COWD 3AUXA 1KZGB 1W47A 2ZU0C 4BFYA 2VF8A 1WQ1R 1R0ZA 5SZJA 3SFZA 4CF7A 1II8A 1BYIA 1DAHA 2NMVA 3CRQA 4URZR 4LPKA 3KUCA 1TQ2A 3ZH9B 3NWJA 1S9DA 4RD0A 1XBTA 1LF5A 2Z0MA 2FSHA 2QM8A 1OW3B 4RCYA 1XTQA 3OESA 1E2LA 1MO3A 3UPUA 4DB2A 1QHIA 4UQOA 4BLQA 4DSNA 3MAAC 1E94E 1BH2A 3RDPA 3WYAA 3GLIB 1E2EA 4V02A 3CF0A 5KHOC 4C2UA 3CPJB 1VG1A 1IXRC 4TL6A 3HU3A 5DYIA 1XPRA 4YMVA 4KLZA 2LKCA 2I1VB 3L8ZA 2GA8A 1PLLA 1S1CA 1NL3A 3WNBA 1QF9A 3CZQA 3BC1A 3RC8A 4X8HA 3QIAA 1Y63A 1DAEA 4HLUC 2D06A 2EFGA 3HU2A 4LJYA 3QY0A 3LLMA 3CW2A 5CB6A 5EP4A 4Q4HB 1DO0A 4LC0A 2GCOB 4GBMA 4BFZA 4DCSA 2YOHA 3TJZA 2AN9A 4DHEA 3K0CA 1G8FA 1Z22A 4Q9LA 4O0MA 3WRXC 4LJ9A 1N6IA 3WMFA 2F9MA 3U2QA 4M9SA 2IX3A 5CDFA 1FQJA 2ZYWX 2L0XA 1IJFA 3RRZA 2D74A 3ZVMA 2QT1A 2JCSA 1JXMA 3Q9LA 1FNMA 1MH1A 4NONA 4OKSA 2OAP1 3VHXA 5JJKA 3CZPA 1FZQA 4IKEA 3K70D 4TYWA 1KTVA 1Z0JA 3DOFA 4LYJA 4PSKA 1G19A 1Z47A 2P65A 3ZIAA 1NLYA 5E95A 1FMJA 3MGCA 4EUNA 3GLGE 4TLDA 4EJSB 3KZ1E 3GEIA 2QGZA 4M21A 3TAUA 4Q1CA 1IN6A 1JI0A 2WSMA 3DMDA 2MMGA 2WM9B 3UK6A 3N70A 3TMKA 2DFKB 2DWQA 1QDEA 3IBGA 3VHLB 4IOLA 4F38A 4P0TA 4OHWA 1S1MA 1OH6A 3CH5A 2CL7X 1FTSA 5DI3B 4O2RA 4DIDA 3C15C 1NG1A 1WP9A 1XXHB 1CEEA 3BH0A 2XB4A 3KXLA 3QUSA 4DDVA 4ZKDA 3LBHA 2ZI6A 2G83A 2HYDA 4AI6A 1ZM2A 1H8HA 2VP0A 1UBEA 1W5TA 3ETLA 2GWHA 4LHWA 1CR2A 5AUNB 1HQYE 2P2LA 4LV5B 1M1YE 4G5RA 2OV2A 4RFVA 2GEUA 4LHXA 3ZDQA 2JJ2A 3CR7A 3TGPA 1E0SA 3NBFA 4Q4JB 2V4ZA 4PSVA 3EPJA 2ZR9A 1VCMA 3B1VA 5KYKA 1W2HA 3QG1A 3P20A 2ZYTX 2JLQA 2W00A 2P0EA 2VLIA 4ZDJA 3THXB 1TU3A 3SFVA 2HXYA 4ASUA 3UG7A 1YZTA 2G1KA 4LHZA 3ZJYA 2J1LA 5TVKA 1KDTA 3KDSE 3KQNA 2JLWA 1ZP6A 3NC1C 3ZS8A 4DWJA 4L4UA 4QBIA 3IUYA 2IBMA 4WZAE 4M9ZA 2AD1A 5JHGB 2XJ4A 3AKDA 4XWAA 5C4MA 3U3MA 3H1TA 3A4NA 4Z8YA 4BEBA 3CRW1 1OXUA 1P6XA 4U02A 3EA5A 1TADA 4A36A 1CU1A 1G7RA 1Z6GA 4NCNA 1DPFA 1N5LA 2W6JA 1G3IA 4FMBB 4QBHA 2WWHA 3RS5A 3I72A 4GPTA 3IPXA 4JL5A 5TDHA 3QOFA 3W9YA 4JL8A 1Q21A 5LB4A 3TUJC 1FFHA 4RKFA 1DEKA 1R2QA 4YONB 4JVSB 2OFOA 3N2EA 1K5GA 1MOZA 4TMZA 4ZIRB 2RGCA 5AUPB 2IK8A 1KNQA 1XMSA 4HUQB 2NZJA 3W3ZB 1MABB 1DO2A 1X1SA 2ZRAA 1PJRA 5FTLA 1FPMA 1YHNA 5K8UA 4E07A 3HR8A 3HDTA 3JZAA 4U5XA 2BEJA 2CK3D 5AJWA 4MKFA 2HF8A 4URXR 3B1XA 5DH9A 2IYYA 1W0KD 4NYMQ 1ZMXA 2P6NA 4G5SA 4PSAA 3GJ6A 5ANRB 2ZRFA 4DCTA 2XAUA 1OJLA 1ETUA 4UJ5A 3U4QB 5JSZA 1G3RA 2ZSBA 2YJTD 1XU4A 4OHZA 2XB2A 2R2AA 1U8YA 1YZGA 1N5IA 2EU8A 5J4HA 3KJEA 5AWFC 1SXJD 4N0EA 2ZETA 3CRRA 4CEHA 2ZTSA 2V1UA 4Q7MB 2XTZA 3K1JA 4Q19A 1OV4A 2BM0A 1K8RA 1J7KA 1G4UR 4NYJQ 1X3SA 1ZCAA 3LLUA 4QGGA 1BMFA 5C46F 3FFBA 3Q85A 4JVLA 1FQKA 3EZFA 2WKPA 1CJUC 5DIFA 1DAKA 5AR1A 3TH5A 5EXTA 2ZSDA 1W49A 5JJIA 4CEIB 1II0A 4XSHA 2ANCA 1CJMA 1O3YA 3IO5A 2ZXUA 2CJWB 4Q9KA 2VP9A 4QJ4A 1G9XA 1UKYA 3BRWD 5EXXA 2IUUA 2GK6A 4FCWA 4PC6A 5F3WB 4A15A 2I1QA 2RB4A 5FL7A 1GITA 2JAQA 3Q72A 2YVUA 1DARA 4CDGA 2FSGA 3TR0A 2VP2A 3GLHA 3SE0A 2O8CA 3KKPA 1D9ZA 2LCFA 2VHJA 1XD2B 3TSZA 2HCJB 3QPVA 1U8AA 4GOXA 4A2WA 4RD4A 4ILEA 4UNNA 2QBYB 4DJTA 1HH4A 1LW7A 4IEIA 1UKEA 5GADl 2J7PA 2QMHA 3S1AB 4QHSA 3P27A 1KK0A 3ONWA 5IT5A 4MYTA 4YXWD 3X1DA 5LPNA 4N0DA 1MO6A 3EX7C 2W2XA 4M1SA 1GL6A 1OYWA 4PC2A 4TSFD 2YC2C 3CRVA 5HKKD 4MKIA 3U3KA 2W2TA 4M1MA 1XPOA 3ZZTA 3AGQA 3NTUA 3BFXA 3EARA 4RSGA 2WKRA 1TAGA 2PX3A 3D6TB 4C0AC 4KFUA 1VG0B 2ERYA 1EWRA 1KZ7B 3L0SA 2V7QD 4FMDF 4PO1A 1WBBA 2CBZA 2NGRA 3LQQA 4DLSA 1QVRA 3BB4A 2NPFA 1SHKA 4I1SA 4Q01A 3NIBA 2Z6VA 1YE8A 2QTFA 1QVAA 2OO7A 3FB4A 4D82A 3VX3A 1IXSB 1QHHB 1A7JA 3PUXA 4KLNA 2PLRA 1XMJA 1KI2A 2FJUA 1Z08A 3W5IA 4EKDA 3ZYCA 2OZEA 4EQ6A 3KTAB 2BWJA 3UXMA 1TX4B 1R5OA 3U6BA 1XEXA 1Z0DA 1KK2A 2C04A 4JLDA 3O8BA 3K09C 1I4TD 4US2R 3LRPA 1Q1BA 4XVUA 3U7FB 3PFIA 4KXFB 2C03A 2ZRNA 4P32A 5KDOA 1CKEA 2ZVQX 1Q44A 2VQSA 5KSYA 2F55A 2NZ8A 1ZD9A 1RZ3A 1YZKA 3AKCA 5FOTA 1LS1A 5FOSA 1ZRHA 4A6XA 2C95A 2ZRJA 4EPRA 1E4YA 1D5CA 1FX0A 1SHZA 1Z6XA 4A9AA 3EIEA 2PX0A 4NL4H 3AF4A 3SYNA 4YC7A 2DWOA 2QI9C 5FI1B 3R9WA 3QKUA 3WMEA 3C5HA 3GLFB 4ZDWA 4JBWA 4EPYA 2ASEA 3OFNA 1LFDB 3OE7A 5EJEA 3A58B 3BFVA 5EE5B 3NBZC 2F1HA 2GZDA 3L0OA 1E6CA 2IT1A 4LJ4A 3LAWA 4ON9A 3AP3A 4Q48A 3RAPR 4DLVA 3KKNA 2RGBA 3U44A 1GOTA 4IDHA 4JT4A 2XJ9A 2WWWA 3VNVA 1GSIA 1ZIOA 4C2TA 4DCVA 2WHXA 1NBMA 2YWHA 3AVOA 4B2PA 3ZIAD 4TYYA 4TWZA 2OEPA 2PCJA 2WSSA 4RD2A 4NCJA 3M0EA 3QENA 5J5CA 2WWYA 2AXPA 1B0UA 4LV8B 4PQYA 3W6PA 4TLAA 3B2EA 2CXXA 2WBLC 2XX3A 2XZOA 2IYTA 1NN5A 8OHMA 3Q8XB 4OI4A 5CIWA 5JI3E 1N0UA 2FGJA 3PG5A 5JWHA 2AX4A 3LD9A 3WXMA 2QAGB 4AG6A 1I2DA 2FZLA 4MGZR 3R7WA 3VR5A 3GLIE 5EUMA 1U0LA 1X8LA 1WF3A 4PHGA 1XRJA 2OFWA 1F2TB 1E2DA 3QBVA 4Q00A 4PO9A 2OUKA 2QNRA 4M22A 4F4CA 1Z5ZA 3SJZA 1W46A 1H8HD 4PR0A 4JLAA 2QPAA 5EUQB 1G18A 4HI0E 4I4LA 2PCLA 3DO6A 1YRAA 3WHLA 3TUZC 4TZ0A 1F60A 2JJ2D 3QE0A 1D8TA 4NCHA 3R9IA 1ZNXA 3KJHA 1R10A 1DOAA 1K5DA 2GNOA 3IDQA 2ODNA 1P7CA 1SVIA 1EFRA 2CL6X 2FEMA 4ARZB 4ASUD 3N2IA 1I2MA 3TQCA 2KI5A 3OEHA 1JECA 5KOYA 2Q0HA 3PVSA 4G5GA 4Y0VA 2YOFA 1KMHB 3BIFA 3CPEA 3OEEA 5L3SA 1X8JA 4EPTA 1XJCA 5FPHA 2NOAA 4MYHA 1BO6A 2FFAA 4LJ7A 3T06B 1E9AA 2B7BA 2D62A 1E9FA 4FMCF 2GCPA 3OIYA 1KO4A 4G5OA 2EYQA 2OM2A 1QG2A 3B78A 4GP6A 2NIPA 4RD1A 4GOKA 3RC3A 4P33A 2YYZA 2W6JD 1XTSA 2ZS8A 3VAAA 3UKDA 5JS8A 2BBSA 5KNDA 1E9BA 1U99A 1AZSC 1FNNA 5E7MA 4DRZA 2X2FA 4KFRA 1PZNA 4QGHA 2ZE7A 1G8YA 4GMXA 4XVRA 1GRRA 1YU9A 2Z5FA 3FYHA 4F91B 5LB2A 4LOAA 2VSXA 3W6OA 4BLSA 2XITA 1GILA 2JGNA 3GFTA 3K0AA 4NE2A 5FBQB 4M9QA 3E70C 3B85A 5CK4A 5H70A 1QHYA 3VR6A 3EZ6A 3KXIA 4BEJA 1CRPA 4B3BA 1QHXA 5UKDA 1W2GA 1KK3A 1XWIA 1WE2A 4WIAA 3VX4A 1NN3A 2GJAA 1M6NA 1TTTA 4JSTA 1EX6A 2ZUDA 2FNAA 3T34A 1ZAKA 2I4IA 2GF0A 1L7VC 1BYUA 5SZHB 4HAUA 1WBDA 2IEYA 1A1VA 1YR6A 5F9HA 3D7MA 2FE4A 2BVNA 2BEKA 3U3JA 4KHZA 4C0BA 2ATXA 2P5SA 4JYBA 1NKTA 1BMFD 1B23P 4MH0R 4M8NE 4GI7A 4JLPA 1ZM7A 3A4MA 1NVXQ 4CIDA 2WJHA 2WWFA 1G8GA 1CR0A 4RZXA 2JASA 4NYIQ 2FN4A 2KBEA 4EAQA 4R71A 1AGPA 1TNDA 2FMXA 2HLDA 5B57C 2DPXA 5L3QB 3RS3A 4HAWA 1AA9A 1BS1A 1YRBA 2IYSA 1VIYA 4LBWA 1BKDR 2N1BA 3PR1A 3CR8A 5FL3A 1FW6A 1U9IA 3ADDA 1DBSA 1CTQA 2EFCB 3RVBA 5FL7D 1RJ9B 3LH5A 5JHHB 2WIAA 1IN7A 1UBFA 3L43A 2FFBA 3B9PA 1U94A 2FZ4A 4TMXA 3I1FA 3AF2A 5CITA 2NO9A 1XTKA 1SVLA 2QENA 3EXAA 2CDNA 4GDFA 1N6RA 1VECA 4LBZA 4ACAA 4B35A 2ANBA 1ESMA 3PITA 3KX2A 1X8KA 1V5WA 3CIOA 3PXGA 4TTRA 3FMIA 5DI9A 3TVDA 4AC9A 3I92A 2CHQA 3PUYA 3QF4A 2ODBA 4XH9B 2J7PD 1P61B 3K9NA 1OFHA 4TTQA 3CO5A 4CW7A 1S96A 1P9NA 3TVTA 2QMOA 2VEDA 2GESA 3H0KA 2WTUA 1T6NA 5G3YA 4P4SA 1UFQA 4B74A 1I4DD 1W7AA 3DMNA 4D6PA 3KJIA 4MRRA 4D80A 2LWIA 2BBWA 2D4HA 2VHTA 2ZRMA 3DPUA 4QBGB 3DVLA 3FHTA 5D3QA 1Z6YA 1ZM4A 2YOGA 3LO5A 3RABA 4E03A 1EXMA 3NBXX 4D0GA 5FTMA 4UXHA 2WAXA 1E9CA 4Q18A 5L3VA 4JYCA 2P6RA 4B3GA 2AR7A 1ZNZA 1DE0A 5DO9A 4D81A 3PEYA 4GMDA 5G41A 4KVGA 5KO2A 4B6EA 1PLKA 2QP9X 2XTNA 1KJYA 1SKYE 2ZR0A 5TXGA 5JI2E 2QL6A 3MJHA 2P6UA 2IS6A 3RS4A 1NP6A 3LV8A 4HAXA 2YHSA 2IYUA 4WXPA 1CULC 4BFVA 2V8OA 3THOA 1HURA 4A0GA 1US8A 3NVAA 1KO8A 2VYFA 1G7SA 3DM5A 4PPFA 4IJMA 1PUJA 5HCNA 4LGMA 2ZRKA 2ZSAA 1IHUA 3ADCA 4OK3A 1DAMA 1VCIA 4I1OA 4HYYA 4DB4A 2AHOA 4FIDA 1R5BA 4DLTA 3BS4A 5KU1A 4QXAA 1MKYA 3VNUA 4QHYA 5FBVB 1W36D 3WY9A 1Z3IX 1E2QA 3OFND 2V6IA 4IHQA 5FPYA 3W90A 3OE7D 4GZLA 4H1VA 2ZANA 3Q5EA 5EE3A 1G5PA 4K46A 4TTPA 1ZNWA 2FOLA 1TU4A 1CR1A 3K70B 1NN0A 4PQFA 4NHOA 2PEYA 5AJXA 2G9NA 4A92A 2QTVB 2ZYVX 1XDBA 3CNNA 2B8TA 1G21E 3PV0A 3DL0A 1KDRA 1Z6AA 1M74A 4B75A 3HP1A 1E2JA 1CF4A 2ZM5A 1NBMD 4GL2A 1MR3F 1VHTA 4Q4AB 4QNMA 1T3LA 1ZUNB 5J4YA 4D4KA 2ORIA 1WCV1 2WSSD 2BHRA 4BWYA 3WP1B 4A0HA 4D2IA 3MWKA 3ZVRA 1GIAA 2OLKA 2ORWA 3CF2A 3OAAD 1J2JA 1KY3A 4LYAA 4E09A 1JEEA
chains in the Genus database with same CATH superfamily
1KI8A 4IHKA 1RHUA 1WJGA 1Z6QA 3V80A 2CJFA 3KCNA 4B84A 4FTWA 3THYA 4C4PA 2ISCA 3TLGB 1S4QA 3FCUB 5EJ9A 2XA2A 2DCUA 3MGGA 2CNDA 4C6SA 5FUYA 1S3SA 1VSQA 4OM8A 2PZGA 3GAMA 4XWWA 4W5QA 4WZZA 2ZJOA 5CCBA 2UDPA 2QN8A 4ZKEA 2JZOA 1COZA 3ZV5A 4FPXA 2GNAA 4RIHA 1CUXA 3HJFA 4F8YA 1HA3A 1PX2A 3HKCB 2ZB8A 3H9JA 4DT1B 5F4BA 3RM3A 3OPVA 1U9JA 1EP9A 2X3UA 2AJDA 3SOZA 2Q28A 1WOMA 3N0VA 3RYCB 3T3HA 4GXTA 3E58A 1GNRA 4J7UA 3SHQA 5DXJA 3IT3A 3HRKA 5IANA 2AYXA 4BNVA 5KNBA 1H1LA 2PLAA 3VQTA 3RIMA 1P1HA 1YB7A 2KMLA 3LT0A 1U9CA 4IVNA 3SSMA 3IJEB 4HEA6 1MC4A 1FVHA 3MWDB 1E5LA 3O83A 2QRQA 4QJIA 4EUKA 3D2AA 3H84A 2PUTA 5ARBA 2CDAA 4CLHA 4DBVO 2FPGA 2BSQA 5JVDA 5T6BA 1DX9A 1RXYA 2ONYA 1JQJC 2QD5A 3K0AB 1RKQA 1SCIA 1WCYA 3DZGA 4JLNA 4PQGA 4AECA 2UYCA 1THGA 4WZ6A 1VHJA 4DDMA 2A94A 3GBSA 3ZE1B 2Z8YA 3H8SA 3U1VA 5C31A 3UIEA 2CL5A 1GAEO 3BGIA 2O6HA 5AJHA 3E7PA 3TKAA 2FX2A 3DBHB 2XNSA 5AHXA 4AJPA 4BLVA 2PUCA 2ODQA 1GQFA 3NC4A 3ZD6A 1YH3A 4GEGA 3IJ5A 4GUDA 1OUMA 2OUIA 3S27A 2OBYA 4R2HA 5DM1A 3AHCA 1LSOA 3PYXA 1Z8FA 2JBHA 3V4PB 4IDPA 3PC8C 5DMHA 1LPPA 1J2YA 2PA0A 2ATEA 3WK5A 1V43A 4UE3S 3HCWA 3RVPA 3D4OA 1WZEA 1RWMA 3ETJA 1MRSA 3HBFA 5T4EA 1EBUA 1Y80A 2R8BA 3O4GA 3DKVA 3GA5A 4WN9A 4TROA 5J40A 4X97A 1DUVG 3U6KA 3C6XA 1OLSA 2Z2ZA 3Q40A 3T5GA 4AX4A 4I9GA 5C7YA 1G8KA 5AXCA 4F4IA 1Y89A 3EAFA 2J0UA 3I8SA 1VIMA 3G6KA 4C20A 2VHWA 4HSGA 1EXWA 1BIFA 3F8TA 3FUWA 3H65A 3KUKA 4J0JA 1BGVA 1RVV1 1WHTB 3U5TA 2AJLI 2CFIA 3L3BA 3IGFA 4WLUA 2WFLB 5IDYA 2RH5A 3ZNQA 3FAKA 4JP2A 4M46A 4XSVA 1M0EA 3ESXA 2C92A 2CCKA 1GSHA 3KZKA 1EYZA 5F33A 1X0XA 2YS6A 3PYLA 2CMGA 1PHPA 3R4VA 4QPDA 1O0BA 3HDYA 1D4ZA 3FMOB 2DT5A 1NUQA 5KYTA 3GFBA 2RI0A 1WSWA 4ND8A 4L76A 3CN7A 4KWCA 1FU4A 2IYFA 2XTAA 4PG4A 2H7CA 4EW6A 3ZZUA 3GCXA 4RHFA 3HN6A 1ZSYA 4ZVLA 2JI8A 4JELA 5FYDA 4BRUA 1ESNA 1H2EA 4LVOA 3KQSA 5F7JA 2GTHA 4DGQA 1MLDA 1ZINA 2CWDA 3EODA 3G5MA 4HAYA 2BZSA 3PENA 4XPZA 3A6JA 4V2IA 5FUXA 5B3JC 4DA4A 1OFGA 1YC5A 4IF4A 2EBWA 5CNKA 4D96A 4HB4A 1QPZA 2QB5A 4P53A 1N6OA 4YR9A 5KYXB 4NPHA 4QRIA 1QMGA 1X80B 4L5CA 3KB6A 4S04A 1CJCA 1GA1A 1IAVA 1VHLA 3A6EA 1Y3HA 3WZMA 1PSWA 2ARKA 3GRVA 3EA0A 4MUBA 2QZSA 2GVDC 1C3OB 2A3RA 5IDVA 1F1BA 4UFOA 4UJ3A 4JC0A 2PJUA 4UHHA 3ICQB 3H5OA 2LRHA 2NZXA 5IEJA 5KHAA 3UMRA 1M54A 3P2IA 4H7EA 4J3FA 3ZCSA 2ZRBA 2EKLA 1V1RB 1IUOA 2Y3IA 2REOA 5H4GA 3N2YA 4OQPA 3BK1A 2F6RA 3SBDA 4I4IA 3BILA 3VR3A 1WRBA 2Q3FA 3EVAA 3PX2A 2R84A 3T9EA 2V7UA 2F1RA 2BFCB 2HREA 4YT2A 2GAOA 2HYIC 2H1FA 3OBBA 1WD7A 3OZEA 1W88A 3VR6H 4AD8A 4YRRA 3VC7A 3BBPA 2Z4TA 3PSHA 2HQ1A 4RV9A 2AXEA 4LGCA 1PTJC 3Q7EA 1GUFA 1CE8A 1UAGA 1YJ8A 2ECFA 2HWXA 1QQ6A 2EFEB 4PVCA 2G71A 2WTAA 3KJQA 3I2HA 3G59A 3C41J 4HNVA 3HDHA 3WWOA 4K9LA 2DKFA 3K4HA 5J2UF 1B0AA 1Y6FA 3ELBA 4AN0A 3FHCB 5BN5A 1IWOA 2B25A 1IONA 1PD1A 2JIPA 2GDJA 2QLLA 4FOPA 5SV2A 2C4VA 3A4TA 4JT2A 1RPNA 2ZU6A 3V8BA 3WP0A 2ZAOA 4AJEA 4MWZA 5A9TA 4CLDA 4REOA 2JKZA 5AVJA 3N7TA 3NHRA 3TG8A 1ML4A 3PWKA 1MXFA 1WUHS 1P77A 1YRQA 2XVAA 4XVCA 4QYIB 3DZKA 3V33A 5IXJA 5K5EA 2PUDA 3D3WB 3MMSA 3G89A 5EGSA 5I7OA 2XEXA 2FMKA 5FNVB 5LQMA 4KODA 2FZ5A 2V96A 4HVTA 4A3SA 3LVQE 2V6BA 4IHJB 3FROA 2IDMA 3MTGA 3H5AA 5GGYA 1WVIA 1EX7A 4QDOA 5FADA 2PGLA 5H1YA 3VU9B 4G86A 1U0SY 2YXBA 4H1TA 4KQXA 3BCSA 2SCUA 1YS1X 3EIHA 3MW8A 2WYWA 3OTWA 1IUNA 1JNYA 4FN5A 1FSSA 2QSUA 3LSYA 4RZIA 1WL8A 1UEJA 1OI3A 4MULA 1II8B 1OIVA 1XEWY 5EPOA 2VBGA 1SIWA 3FMVA 3C3PA 4FYPA 3LP5A 5LXTA 1R9NA 1OYOA 5KCMA 3NRJA 4URUR 1H23A 3O4IA 1FXSA 4ZAYA 4ZAVA 4ZTZB 3EXEB 2CV1A 4YRPA 2WVHA 3MT0A 3LY5A 4P86A 4QFMA 3WADA 3L5OA 3B3FA 1MFZA 3U4AA 4PWYA 1F4PA 1SUBA 3V42A 1Q14A 1BSVA 3C3AA 2C1ZA 4IKPA 1TC2A 4YN3A 1LK7A 9MHTA 4JXKA 2H18A 3RUAA 3KP1A 2YN0A 2DU8A 2E7ZA 4KQWA 3ISVA 4W4TA 2EP5A 3GYGA 4M7PA 2N9UA 4KXYA 2J32A 4LVCA 2JLYA 3FHJA 2XYRA 4QDZA 1JXAA 1ZBDA 5HPYB 1HE1C 2A0WA 2CE2X 2I4RA 1FXUA 3L1KA 1JJBA 4HDAA 1M2JA 1VJGA 4TXHA 4C1BA 2XKAA 2XE4A 3JATA 5A3SA 4AJOA 1DQRA 2YJGA 4IOJA 3HCOA 3BGDA 3N2KB 4YREA 5F2EA 4NS1A 2QTCA 2X1LA 3IP7A 4HDRB 4LI0A 2IEDA 5J4VA 3FUUA 2XA9A 3AIMA 4M1OA 4FP9A 4AKEA 4UAUA 1KFEB 1SULA 3E9EA 2MSDB 3GUCA 1HC7A 1AKTA 1EK1A 4RS3A 4XCQA 2J59A 2IBTA 3PX7A 5CLQA 4O02B 4NP6A 4ZDKA 1R0WA 2AHRA 1K0FA 4LV6A 3LLVA 4AZ0B 3PUJA 1DG1G 2C8VA 4LVUA 1Y9DA 4FKMA 5KYYB 3H8VA 1FNBA 5J2TF 2AG8A 3DBLA 2YBEA 2XWSA 1JMKC 1KI9A 3HACA 5T67A 1NYRA 4AY5A 1N8NA 1QAOA 1SHTX 4I1VA 4E14A 2XXAA 3RJ9A 2J6IA 1ENOA 3MXOA 5BT9A 4ACBA 4B33A 4J0EA 2ODAA 3BE4A 2VYQA 4UNPA 1NVWQ 1YA6A 3VKGA 4B82A 1TVMA 1KGDA 5DM0A 2PUBA 2WRZA 2JIMA 2RCYA 1TK2A 3BF8A 1JHOA 2EC5A 3FKQA 2W6OA 3GPDG 3OIWA 3QOWA 3W7BA 4R3WA 2QRPA 1RZRA 3ZX4A 2DFNA 4ND6A 1BU5A 1JA0A 3FZQA 1T9GS 3K0EA 1GLNA 4L5BA 2VJCA 1GKIA 2Y1GA 1Q57A 1JHPA 4P92A 2P69A 1M1ZA 2IXTA 3OKPA 3E84A 4G5YA 4JUBA 1HO3A 3E27A 3UXEA 2DBRA 3V9AA 2GM5A 2COEA 3I12A 3L01A 1D0IA 4O8ZA 1NG9A 4BMOB 2QN6A 5JCZA 1ZK3A 4G8JA 3PGA1 4DV2B 2E6UX 1BXRA 4S24A 3JQGB 5JBQA 2BR3A 2FPXA 3WKDA 1OFUX 2X5OA 4N01A 1U2EA 4U7GA 4EH1A 2H11A 5JD3A 4YCNA 3OOEA 1QGYA 4MGYR 1KEEB 3Q6IA 3TNFA 2JHAA 3EEFA 1NR5A 5EP2A 5AXDA 3ESAA 1VKJA 1WDLA 4G8BA 4XIGS 4QDKA 5JDIC 1ZDMA 5HTKA 1I24A 1FOEB 1T3SA 2HI0A 2OK8A 4HQOA 4M0MA 4PAMA 2YWEA 1L4NA 3QZUA 3I04A 3GARA 1NWCA 1OVGA 4FDVA 4UVHA 1HQDA 4AK9A 1SQSA 1E3IA 2JLBA 3NT4A 1Q0HA 3JAWA 4BAZA 1G3UA 4PHCA 1PFYA 2AOUA 2J3EA 4CMKA 1RI5A 3ID6C 3DFKA 3ZVNA 2R1VB 4PQRA 1RAGA 2W2MA 3FFAA 3HYLA 3RS0A 2FR0A 3A1EA 3TOZA 2UUAB 1I0IA 2H4JA 2PZAA 3CB4A 1BEUB 3TS1A 1ZGGA 2FR1A 5J47A 3FPAA 1JEDA 5J5VA 2DQSA 2VJPA 1CEQA 5FA6A 3G5AA 3GFFA 4Y9TA 4IICA 4TTVA 1L4MA 1GL7A 3E6AA 3M6VA 4ZGBA 3EDYA 2WWTA 3IX7A 1J00A 2UZ3A 3M6LA 1MNAA 1WEHA 4L8GA 3UWKA 3ZLTA 2OV3A 4KE8A 3WGUA 2GM4A 4BPBA 2EF1A 5IDQA 2ZBDA 5K0JA 2XT6A 4RPIA 1SURA 3ZGOA 4BMPB 1U6IA 2AW3A 1K75A 2GPYA 4IINA 3FSGD 4PNPA 2H51A 1JBEA 4HLCA 5BQXA 4TM8A 5J23A 1PG2A 3SR0A 2KB0A 4BBZA 2OECA 3PHLA 4Q37A 2QG6A 2QT9A 1UT8A 3H05A 4LY6A 3VO1A 1CPYA 2XGSA 4EELA 1EFVA 3P96A 3NMUF 4I5DA 4CMHA 3EGDA 1P7WA 4X7RA 5KHLB 3IPCA 4BGEA 3GVPA 1UKCA 1TEVA 3B89A 1TL7C 4IXMA 5JAHA 1LLCA 3FLMA 2VNIA 4FYIA 4DA9A 2IYWA 3L82B 4ZV4A 5BWBA 3I5MA 3IDFA 4GT1A 2GPTA 3AR3A 4B6FA 4DSUA 3BTSA 4C0SA 4BO6A 2C78A 3UMCA 4OP2A 3M6AA 1Q77A 2EJUA 2UVPA 2HJ9A 3NUQA 2D7CA 1NW7A 3PB3A 5TEVA 2H3EA 4A2PA 4PZAA 4G89A 2I91A 3WYFA 1A8IA 2UYHA 3HSKA 1E4VA 2HV8A 2M1XA 2ZCUA 1GU1A 5JD6A 1ZJWA 1XVVA 5GWXA 2AJTA 2PO7A 5EQFA 1LI4A 3HP4A 4WKCA 3VJRA 4QG7A 4X62B 1SQ6A 3CX4A 2G8NA 1CUBA 5DEIA 1KSFX 3BRSA 4BFXA 3GN1A 1JHRA 4J91A 3VYWA 3GEMA 3QFRA 3RBAA 5L95A 1CVRA 1P4GA 1X7XB 3CNQS 3G5UA 1WETA 3DC7A 5LQNA 2GF9A 3OQPA 2B1GA 2OAQ1 1CJSA 3TW6A 4AG5A 4RYDA 4GICA 3AM1A 4LNUB 1AHIA 3FNQA 4S0XA 1LEHA 3QYFA 4G1CA 4NZOA 5KOIA 1MQ9A 3MS2A 4NJEA 3V1YA 3MCUA 3TQHA 1WU8A 4CEHB 1VSTA 4FKBA 3RGGA 2AKEA 2JCYA 5EL0A 3W05A 3SHVA 1S01A 4P35A 4MJ7A 3CKLA 3GLIA 4IIYA 3A06A 3PXUA 4JJAA 3EXIA 2XNDD 4OAQA 1HE8B 4X84A 2Y0BA 3JYOA 3UICA 1QDUA 3GX1A 2A5YB 2Q07A 3COYA 4PG6A 3DF7A 4JBHA 3SM3A 3DTVB 2UYYA 1DRKA 4G0VA 4FW9A 3ZE6A 4DTIA 1SC6A 3QJYA 5C37A 4UZFA 3ICWA 2JBAA 3WWPA 1I33A 2IYZA 1KEZA 2ZI9A 4UBOA 3SQXA 1DADA 3COVA 2GPJA 5CA0B 5CG1A 2ZR7A 3OEWA 3V2UA 2O20A 2QRVA 2NWQA 2PR2A 5C3UA 2VLBA 3USZA 1D6SA 2DTDA 4OU5A 4MV6A 3JD3A 3TOSA 2HU7A 2V3WA 2ZP1A 1JQKA 3ONEA 4RH3A 4X8MA 3VPCA 2P8JA 4W7SA 1KO7A 5DB4A 1NR1A 2O1WA 3R77A 3OJLA 1NI4A 3QPAA 4S1OA 5JYCA 2BGGA 1U3DA 1AN0A 4X6XA 3P0JA 2V7BA 2XMDA 3ECAA 4QO7A 4I1YA 4LSZA 4NBUA 2QLMA 3UC5A 4B73A 3L0DA 4I50A 4PE5B 1A82A 1EJ2A 1L5KA 1KXJA 3FW1A 2XCLA 4CU5A 4F12A 5KJ1A 1RYFA 3K8YA 1BEEA 1WB5A 5AJTA 1J24A 4P3PA 1NUAA 1J9EA 3AETB 4RO0A 4CM1A 4JL6A 2P2ZA 3C3DA 4P5EA 3VISA 3DE3X 5D51S 5BURA 1F3OA 3IOCA 3AL3A 4AKIA 3UB2A 4AUKA 1M8PA 3OHSX 4HJRA 3PDIA 1OLOA 1WXWA 3WNQA 3B82A 4JUFA 3SMQA 5FPSA 4ZXFA 1C7JA 2OV4A 1IQUA 2DWCA 1NF9A 1OMOA 2NVUA 2VUHB 1P44A 4WFJA 3DGFC 3VSCA 2XIQA 1J06A 1CFZA 4R8VA 3GV0A 3IHKA 4S1TA 3RAGA 3LXXA 4NZ9A 4W9NC 1YMQA 1BFKA 1G8AA 1NYQA 4L22A 3WJ2A 5K09A 1ZH4A 3DKKA 5A0TA 3BMQA 3AUKA 3EQZA 1ZW1A 1BC5A 4EFNA 4Y2TA 1OI7A 5EE1A 1RRVA 2DERA 3BX1A 4RCVA 1VRCA 3I53A 2JAUA 1KHHA 1XJ0A 2WTBA 3SZRA 3UGQA 1UBMS 4W5NA 1QK5A 5B5SA 4KLAA 4DZRA 2UVDA 1C7IA 3KQHA 2GPNA 1FUEA 3RC9A 1J7JA 1K97A 1ISGA 1VG9B 1UPTA 3GDFA 2VNSA 3I9JA 3R3HA 4MVJE 3VOSA 4BVAA 2QZPA 2ZJFA 4FYJA 4FHEA 2FA9A 3E3NA 5E2AA 2FKAA 4MRPA 3IQXA 5ALFA 5LWHA 2ZBGA 4J2TA 3VYSB 2GZAA 1N8SA 1U7WA 1U7HA 3IHLA 3IHTA 2R8XA 4PYKA 1EXNA 2MSNA 1R74A 3PF8A 4FQ5A 3W2EA 3E18A 4C89A 1NSFA 2IIBA 1Z0ZA 4DN6A 1RD4A 3AY0A 4L8FA 4CWAA 1CUFA 2EZ8A 4JASB 3TZEA 1KI7A 4QDUA 3BULA 1K9SA 1QLJA 1ZLXA 2B1JA 2F3RA 3K9HA 3UPDA 1X19A 3G8CA 4K6GA 1PAUA 3T3MB 3TW4A 1IN8A 1YQWA 1ZUHA 2I62A 3DH0A 4K6HA 3BSFA 4M89A 3AO0B 4GI3A 4S35A 5EXPA 2OO5C 3VR2A 5LYJA 1F3LA 4CKZA 1VPWA 5DNDA 2CZGA 4B3CA 4GI5A 1XTPA 1W6UA 4LX8A 4ZTBA 5JECA 1WA5A 2BFFB 2NQ2C 3FCXA 5H4HA 4Z3DA 3UT6A 3UGKA 4E5PA 1NJ5A 2FUG1 3DBRB 4AWAA 1YMUA 3WGMA 5JALA 3WBJA 3G82C 2FG7C 4E5UA 5J1TB 2C4HA 2ZK7A 4IUBS 5KYVA 5JCPA 3F98A 3N2GB 4AU1A 3RHSA 5KTYA 4B80A 5EG5A 1E99A 1Q0UA 1YJAA 2YRWA 4ZK2A 1Y5IA 1Z63A 1LBHA 4JU9A 4WZBE 1C9EA 1S8AA 4JYAB 4I55A 4NU0A 3T7JA 4OQQA 1JE1A 3JV7A 4G5HA 4Y18A 4RMHA 4YQYA 1E3QA 2NAFA 4MVWA 4NBWA 5THQA 5KTPA 1CNEA 2LVBA 4QQNA 5F77A 3KJFA 4NBSA 5TJ9A 4EFLA 1RPJA 3IV9A 5K0LA 2EDAA 1X7ZB 2I76A 5FOWA 3AIOA 4XW2A 3T1TA 4WW0A 1JFRA 4BMVA 3CFYA 4C4OA 4MB2A 1LW6E 1D7OA 3DYIA 2O2IA 3DDCA 3ADBA 1Z4NA 2B6HA 4O4IB 5B58T 3K6SA 1KWGA 1AK9A 1QZZA 2A7QA 1JEJA 1SVUA 1VYTA 2QE7A 4R51A 3PU6A 3ROEA 5BRJA 4RPLA 1N3LA 4PRYA 2C2YA 5FBKA 5FBHA 1ODSA 4CMEC 1EZZA 1E1KA 5JS2A 2HMAA 3BL5A 2C0QA 3FHLA 3H8JA 3E5NA 4LC9A 4NAVA 1F48A 4X7PA 3EPKA 1RLUA 1V2HE 2CEKA 4KXQA 1DQPA 3STXA 3GQVA 1U5BB 3VM6A 2IUYA 2ZIEA 1T35A 1TTHA 3DTNA 4ZOCA 4J4BA 3OX2A 1IOVA 4JLOA 3VAYA 2QT0A 3MTAA 4C06A 3O8OA 1OFVA 3MUOA 1KKLA 4PQEA 5LLDA 5JH7A 4ZCMA 3KPJA 5C4GB 2PQ2A 4KDCA 1BW9B 1PNOA 5ECGC 1RQXA 1AUOA 4DG9A 4PCAA 5HS6A 5KMGB 2VCHA 3QXCA 2HLHA 2ZDGA 4K8OA 3MSCA 1W1UA 4GRAA 1R3UA 3L8YA 1LU9A 4P1ZA 5DE3A 2FWRA 4D8YA 5T6MA 5EGNA 1E3TA 1P2GA 4BQEA 3K32A 3EF3A 2FQXA 3TW8B 1W2WB 1F38A 4Y2SA 4C03A 2P2CA 3IVMA 2DUNA 3S2SA 3VC1A 2BI7A 3AEUB 2HPZA 2WD8A 3B7GA 1LPOA 1NR7A 3RJZA 1E4EB 2LUOA 3ZYZA 2PXXA 2R6GA 5IN5A 5KSOA 4GKKB 3WGLA 3DULA 1XZFA 2AFIA 1C30B 2FF7A 2VJOA 5BSGA 3HA5A 2EKQA 1DKMA 2FW8A 3B51X 2IZ6A 4B6QA 3RVJA 1WUTA 4ZK6A 2NZ2A 3EMBA 2CNWA 5LBTA 3TQIA 4DQ0A 5JAMA 1RWBA 3H9GA 4HAIA 1QIJA 4RVUA 5E38A 4OOEA 2H5IA 1MX5A 3LIPA 3NW9A 3SHWA 3U4MA 1XD2A 1KPHA 1HUQA 3BK7A 3I3SR 1UBNA 2B21A 1JP7A 3OCYA 4MEAA 1JHUA 1YI1A 2CHVA 3ECCA 5E6SB 2FQWA 2DUUA 4S1NA 2GBGA 3IKJA 3P9YA 4JN6B 5IKOA 2WYVA 4RSRA 3UT5A 5HRUA 2ZR8A 2OHFA 1H2AS 3EGWA 5D1HA 1ZSNA 3OIGA 1E2IA 5INTA 1TKCA 4LQDA 4YPFA 4L72A 4G0XA 3DE2X 4PF1A 1UAAA 2O2DA 4WY2A 3WK7A 1GDHA 2FYTA 2XLCA 1QK3A 5HDQA 4FFWA 1ZRMA 4NCIA 3HEBA 2OYRA 4JA2A 1SQ0A 3VJKA 4DSOA 1ZNQO 2XODA 4NXNB 2YV2A 4JLWA 1Q1GA 3IVAA 3Q3EA 1E8NA 2E1PA 3ER9A 1J33A 5DK4A 2B7LA 4EX6A 1USKA 3F0TA 4L3OA 3GC6A 3G2QA 3QQ5A 1LH0A 1O0SA 3QE3A 2HA2A 4IMIB 3JYPA 5A0FA 2KQUA 3ROGA 3AY3A 2CLLB 2YYSA 3F4LA 4YIHA 4E11A 5KVVA 3ZW8A 3DZBA 2IXEA 1WF6A 3S5JA 4FZRA 4EPWA 2C3YA 3DD5A 1N2XA 3GBPA 3QLTA 4O2AF 2F17A 2JL1A 3UJBA 5E6UA 5IXSA 4M86A 2Q5IA 3ILYA 3KTAA 1E61A 1X9GA 3W3AA 1WP4A 2F1JA 5MHTA 2PGJA 3NYIA 8AT1A 1QYDA 2WFAA 1YR2A 3U16A 4RVCA 1GUAA 2I54A 2R1UA 5JYDA 1N9ZA 5JOQA 3IBTA 4OF4A 5A1TA 3LPNA 5JEDA 3W7VA 3SQMA 1HV8A 2B2CA 4G24A 1GPKA 2E85A 2W6PA 3FVWA 3HMKA 2AK2A 3OZCA 4MQEA 3BMNA 1KE1A 1JIUA 4BJ6A 3UAYA 2FEPA 3RNOA 2P9GA 3C3YA 1KRHA 4IJ5A 1USIA 2I8CA 2QRKA 3LA8A 3SCZA 3MCAA 2IH4A 1VOTA 4O4LA 4D57A 1O6BA 4NDNE 1TVKA 5TPWB 3RSHA 2GBPA 1JVBA 4BNXA 1NDUA 2YJ5A 3UV6A 1OR8A 1P75A 1ORVA 2GDZA 2VJBA 1JLMA 4Z4HA 2GK3A 3ND8A 4PG7A 4B17A 4WD3A 4J7CA 2BV3A 3G1TA 1J22A 3OSZA 1H65A 2WIDA 5C8DA 4OQMA 3HL4A 3GCWA 1J0BA 4FSHA 2HCBA 3T52A 3G13A 1V41E 3JR7A 2C4WA 4O4JB 5LA6B 3WIUA 2P30A 4LA4A 1OZFA 1O54A 2WJIA 5EWMB 2ONZA 1BQ4A 3FUXA 5G2OA 2GJSA 4B83A 3EC2A 3KSZO 2YS7A 4TWJA 1JYSA 1V1JA 3MLEA 3TW0A 1R7RA 1QFJA 2OG2A 1MA3A 2WZQA 3W77A 2XDYA 2FWNA 3SY8A 4M3NA 3N6RA 5TX7A 1AS2A 3FDJA 2AWNA 5L3RA 2NT4A 2R60A 2XSZD 2XIJA 3WRYA 3ZLUA 4C3UA 4NQZA 4CR7A 5IABA 2QJWA 1P0QA 3M34A 4FXOA 4P2GA 4FK8A 3R76A 4D0LB 4OPMA 2XGJA 1A8HA 1RHQA 2R25B 3JQBA 1KI1A 2DVMA 1EKXA 4FONA 3TZLA 2I7XA 5IK2D 4MKHA 4R1SA 2V7GA 2VNKA 1FUIA 3AGPA 3WLLA 4H16A 2ZRCA 1Z3CA 2HQSA 4Q9IA 5CGZA 4YAJA 1QG6A 4QSMA 1T0IA 4X94A 5KPDA 4RHCA 1O2DA 2DULA 3ZDFA 1E6LA 4ZRMA 2G67A 1D2GA 4DNXA 4P4SB 1VFNA 1MENA 3AP1A 1M8FA 4ZMBA 5K8LA 3AC0A 1A5TA 3GRZA 1C1XA 4FJ0A 2Q4DA 2Y2VA 3TTSA 3U7EB 2DT8A 3FOWA 1AGXA 4H0FA 1KSGA 4B4KA 4KAJA 3UZUA 4TLBA 3WL8A 3L4SO 4OFXA 5CLFA 1OH7A 2IBSA 4KZKA 1AGYA 1CNMA 3I04M 2VXYA 1AX9A 3ZY2A 2D1FA 3PEWA 1YJQA 1UT5A 3IUPA 2PXCA 5IVHA 1ESEA 3W7AA 5AVKA 1G3QA 1EVYA 4IDDA 5KNLA 3T8YA 3TK1A 3QX3A 2UZIR 4LJKA 4CCYA 2I8AA 2IS1A 3QITA 3DTYA 2HMYB 2CLCX 2QVGA 5ITVA 2PM8A 3ORHA 4DIUA 2R48A 1Q20A 4L02A 2O6LA 3K92A 1I4EB 2DH6A 2ZJ7A 1UJ5A 4S12A 4K0KB 4I1RA 2BI4A 3BGSA 4JWKA 2BDTA 3W6NA 4EQZA 1FYFA 1UXJA 2H2FA 1UJ4A 4EBFA 4FMPA 1C3LA 4GW3A 3UJ9A 5CG2A 3ERCA 2HA7A 1RADA 3BKWA 3AZQA 4Z9BA 4P7FA 1TXGA 5ALRA 1DXOA 2MOKA 4EG4A 4UHBA 3FD8A 3JQAB 2D5LA 1ACLA 4Q9DA 4F9GA 3FDFA 4UZEA 2FN8A 4I4TA 1BX1A 3QVUA 3DV9A 4XLLA 1XQ1A 4E22A 1XALA 1AK1A 2ZB3A 1TRHA 4FDMA 5DSTA 3C8ZA 3FMGA 1NP7A 3F97A 3ENZA 1AURA 3P9PA 2DWUA 2PFSA 4J43A 4CYMA 1HR0B 3ZQ4A 3STTA 2DQKA 1V9CA 4O4HB 5ALWA 1VP9A 4HN4B 4PIVA 1L6RA 5EYPA 3D3NA 3U3RA 1O4VA 2PTGA 4EHFA 3D1VA 1NC3A 2XTMA 3ZNPA 2BR4A 3ND7A 3PUIA 5CFPA 4J0DA 2JLSA 1Q92A 5KPJA 2HT6A 2HT1A 2FDCA 1BD4A 1NV9A 3HA3A 5CVVA 3VGJA 4B3SB 2IOQA 2Q49A 4OD0A 1ZPDA 1DEXA 1OAOA 1XU7A 1Z12A 2YV5A 2GD0A 1JDBB 3OUTA 2BHSA 3REQB 5DGIA 2FXIA 5LSAA 4JLVA 1ACJA 1ZCBA 1RBYA 2ZI3A 2J45A 4M83A 2NAPA 3HCBA 2JH8A 1QFSA 2YIJA 4A8PA 1PFUA 3UHJA 2YMMA 1CIJA 3BAFA 3M4JA 1PJZA 2C1XA 2W98A 3PEEA 4BCDA 2OG1A 4EJSC 2DG2A 5JYBA 3GGCA 1TZCA 1Q0TA 1NUPA 1Y1KE 3DR3A 3NGLA 3OJEA 3QU9A 2J07A 5CM2Z 5JTUA 4HQRA 3D3JA 5TY0A 3K1AB 5EHXA 3QUCA 2F3QA 2VH2A 3BSYA 4ENSA 3K9GA 3GWZA 2CKDA 1WUJS 2QLJA 3LBFA 5DN9A 5EJ2A 4HV4A 2FFQA 4QQ8A 3HQ4O 4QJBA 1I4OA 3VZSA 4WECA 2IYVA 1JIXA 4KE9A 3EVNA 3THYB 3OZFA 1KQFA 2WUVA 5F52A 5B53A 5K0GA 1ZISA 1TQDA 1NULA 1U0RA 2VRCA 3OQBA 1TPZA 621PA 4JMPA 1J2TA 5SYAA 1CJVC 3I0MA 2XYGA 5SYMA 4CIXA 1T9DA 5CPFA 4ANFA 1IH8A 1X7WA 4U7DA 3LBAA 3WLHA 4RCZA 5G3ZA 1TZKA 3IR5A 4BRWA 1M34A 1RRFA 2ZITA 1JZQA 4ZCSA 1CEYA 4JJZA 1WXHA 4XTRA 5HG0A 2ZWIA 3H4VA 1WBJB 4I99A 3OFSA 3OZBA 3NWOA 2I65A 3B8HA 2FCRA 4HF7A 1ULTA 3JY6A 4JH0A 1DTSA 3ZIUA 5IX8A 2NO0A 3IV6A 3UATA 4N5DA 3RUPA 3S7ZA 2PL5A 3RR2A 3T0GA 1H1LB 4MK4A 3R7AA 1OHHD 1IFXA 1R66A 1S2NA 2FEKA 3T94A 3JQRA 3FFXA 2FHPA 4LMBA 4X93A 2PWAA 3L6EA 5FBWB 4NEGA 4DR6B 2GEFA 1U5AA 3F6PA 5K3OA 1S02A 4MUYA 4DCJA 1FRZA 3SVTA 2DETA 2FPGB 4OX9Y 5FUWA 2RK4A 5JVDB 1GGJA 1CY6A 1GZUA 2WJWA 3CPHA 4NOLA 1A9ZA 2JLVA 5F12A 4DPKA 3Q4GA 4EHBA 2MSCB 5AI4A 2FMTA 2TECE 2BDEA 5DYTA 5M29A 3PL1A 4IY1A 1N0WA 2VXCA 4PCUA 1PBTA 1EK5A 3C6ZA 5K0BA 1UDBA 1NBME 1Y5NA 3BMCA 1JDUA 3CM0A 4XJTA 4OHYA 3H16A 4PYMA 1SCQA 1ZRSA 1P0FA 1SB8A 2AEFA 3WGKA 1TCAA 3SHOA 1I3OA 1QQ7A 3ROXA 2H2WA 2NZWA 1H4SA 1I3LA 2R3SA 1DRWA 2PFGA 1SUSA 2PG3A 4HEHA 3O2QB 4ZO4A 1NASA 1YDMA 5FI0B 3T12A 4J03A 4R9NA 3EGXA 1GVNB 1RWVA 1IN1A 4MPPA 1J1UA 3IQIX 3G5TA 2YYAA 4J1TC 2XWQA 2HK9A 3OPQA 4LMAA 1L7PA 3MCTA 4M60A 4P54A 4WN9B 4C5CA 4C4RA 4FLFA 4IDCA 3H17A 4JROA 1OLSB 1Z35A 3F9CA 2PIAA 4H7KA 3WOHA 5CJ2A 3DJYA 3ZZNA 3RAFC 3AH8A 2J0UB 4BTLA 2GR9A 3DOOA 3OTGA 5DP2A 1DT3A 2G0NA 3JYHA 4OMDA 4NTZA 1EGHA 2YZMA 1E7RA 5B2ZA 3B1ZA 3DDUA 2DQYA 3L93A 3IIMA 1DSSG 2GJ8A 3SBEA 3PCXA 4X64B 1R5NA 1XA4A 3AR7A 1BOFA 2Y8EA 2LR0A 2ZOSA 1QYIA 2P90A 1Z07A 2E9SA 1L7EA 1PS0A 1XKQA 2YWRA 5JV5A 4XARA 1P1RA 3DOIA 3G0IA 3IIKA 4FEYA 4ND8B 4J0QA 3TRFA 4CNQA 2VH5R 1NX6A 2VUSA 3ZS9A 4R81A 1M6HA 5TE9A 4RXUA 3MSXA 2HSEA 2BELA 4PPGA 4Y2UA 3ZQ6A 4BU1A 3B7PA 3A2KA 1OGYA 2JHFA 3U61B 4PO3X 1QV9A 3DFUA 4C21A 5A4DA 1QO0D 1QAQA 3I58A 5IF3A 4XD2A 4JSRA 3D7KA 4F6CA 1QOZA 5HJ7A 1MD9A 3SIRA 3A8TA 2YCBA 1E0JA 3ES9A 4LKRA 5K8JB 3PCRB 1ECGA 1JDBC 3UF0A 4CKCA 5KYNA 5M7EA 2GKSA 5KQSA 1Z5PA 4EABA 3CNEA 4AS3A 1WW8A 1KHTA 2CBGA 2D1RA 2DBYA 2OXFA 3QE9Y 1IEVA 2I2FA 2AG6A 3MK31 3PKJA 4M99A 3V7UA 4EVQA 3EXG2 3GLQA 4AT1A 1Y8ZA 1Q3HA 2LNDA 3FNHA 5HW0A 1U80A 5HUQA 4QUDA 4GM1A 1NKVA 5K0CA 2HWYA 1TMKA 4JAVC 4KMMA 4YCAA 4CDRA 4ZHQF 3KTDA 4ZOQI 5EHNA 1RXCA 1W88B 4KWHA 5AKLA 3RJTA 4DLLA 1A9TA 4P38A 1OGJA 5LDDC 4IFBA 4HQNA 1G63A 2IGTA 2PGIA 3CZMA 1R00A 2UZ4A 1CE8B 2ZT7A 1RC8A 2XAAA 2IITA 2LE0A 4JLUA 4R6XA 4O1HA 1L5OA 1T1IA 1AJEA 3VU0A 5CU7A 1Q95A 2AEJA 5FPTA 4DADA 3JQ7A 4KN9S 4QTZA 4FB4A 1GPDG 1TK9A 2X77A 3P9CA 3P19A 4GOJA 3UT0A 1GDTA 1WW2A 2HIAA 2VPYA 2XUHA 1P2TA 3CNOA 5KKNB 1EEHA 4RYLA 4I1PA 1P73A 5BN5B 2AUTA 1XI2A 1XAGA 1YJ5A 1R15A 1MV5A 4Q1DA 2WTMA 1ZYUA 3UMSA 3SF0A 5ALHA 3AHHA 3RYHA 1IY0A 3FZNA 5GOZA 3U9LA 2EFHB 4MR8A 2Q3LA 4W82A 5AK4A 3L77A 4LY0A 1X87A 1J5EB 1KZ1A 1KWKA 4BNZA 4WWHA 2BT4A 3HCNA 4NRDA 4U2GA 3WQSB 2R8RA 2PL3A 4CCWA 3D4NA 1YVRA 1ZH8A 1KY2A 1NXVA 4A8JA 4FYXA 3IBYA 5AI9A 2AG0A 1VKZA 4B3HA 4LHYA 3Q2OA 5DOVA 2SCUB 3F7TA 3AIKA 1OA1A 2FSFA 2L69A 5L9AA 1RHJA 1RFLA 4FS8A 5DLQC 3L79A 1E7YA 3WLAA 4D3YA 2Y93A 4MYUA 4UOZA 1NSYA 4HAWA 1GV1A 3BZWA 3ED5A 5ELMA 5LXTB 1XMIA 1Y3AA 1NU6A 1XVUA 4IXDA 4II7A 4MYSA 1PJ8A 3V2HA 2GM9A 1JEOA 2DR3A 3WLTA 4PHFA 1KO1A 3LKBA 1A9RA 2VWPA 3O38A 4YCJA 3N76A 1JTVA 3DOHA 2BDUA 3NDIA 1QRSA 4D79A 3V34A 1HX7A 3IQGX 4HDQB 2RARA 3EIXA 3IAM1 2R6FA 3SHFA 10MHA 3W06A 2R7LA 1MIOA 5FO0A 1Z7BA 2H0QA 1PWYE 3R5HA 4YECA 1L8AA 2P27A 1DBWA 1G6HA 4DMCA 4R2KA 1GLVA 1KEPA 1U0JA 4LAFA 3MM4A 2EX4A 2YQ4A 3ELUA 4L7VA 4CM5A 4HZUA 2AR0A 2O2SA 3OECA 5DSZA 2RGGA 3L6CA 3WGOA 3WO0A 3ROMA 1SXJE 2ZPTX 3MYYA 4MGIR