4IRUB

Crystal structure of lepb gap core in a transition state mimetic complex with rab1a and alf3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
170
structure length
170
Chain Sequence
EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LepB
publication title The Legionella pneumophila GTPase Activating Protein LepB Accelerates Rab1 Deactivation by a Non-canonical Hydrolytic Mechanism.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase/hydrolase
total genus 53
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4iruB00
4RZUA 3CBQA 1W5TA 1KMHA 4IEIA 2WOJA 1GILA 4IOKA 3N2IA 4UNPA 4C2UA 4ZV4A 3K8YA 5CIWA 4AYTA 2XSZA 4D0LB 4L16A 2IL1A 2VHJA 2X77A 3EZ9A 3THYB 2WV9A 2AK3A 1KSGA 3IGFA 3BB1A 4MUAA 3GCGA 3FDIA 5FTMA 4HZUA 4EPVA 2WWXA 3LRPA 2AKYA 1TF5A 2N42A 2FFQA 1XCGB 3LV8A 3ZIAA 2OCYC 3T06B 1P2SA 5TV2A 1C9KA 1UBCA 1VG0B 5EXSA 4A8JB 3FMIA 1OIWA 2W58A 4PO1A 4G5OA 4XOIA 3KB2A 1P3JA 2ERXA 3LD9A 5TARA 3FB4A 2X8AA 1XPRA 4PO9A 1G64A 2VP5A 3SOPA 1EFRA 5AUQA 2ZSBA 5FL7D 3KJIA 2QORA 4IJMA 3MWYW 4OK5A 4B3GA 1XPOA 2ANBA 1HUQA 3X1YA 5JRZA 5G3ZA 3B1ZA 3G0HA 1RIFA 3B13B 5IF9A 4CEIB 3B2EA 4RCYA 3SYNA 2O8EB 3SU8A 1KTVA 1IXZA 2OCBA 4LCBA 3FKSA 4Q03A 2F6RA 3RNLA 5JZVA 4DLUA 1AKYA 3DEFA 2YJTD 4QBFA 4DZZA 2PZFA 5B58C 4Q7KA 3Q8XB 2NTYC 2HYDA 4DIDA 2EFEB 1VG9B 1HQYE 5AUOB 4TL9A 1CJUC 2HYIC 1XX6A 1M6NA 5JWOA 1UBFA 1VYTA 4LBZA 1H8HD 1TU4A 4ZIRB 1KYIA 1BOFA 2QQEA 2YNMA 1R6BX 4V0MA 1ZINA 2ZJYA 1DADA 2FSIA 2X1VA 1W36B 3B1XA 1CRQA 1OV4A 4LRWA 1KI2A 4OHZA 4B3DA 2O8DA 3QI2A 4C2TA 1E1QD 4TWZA 2VO1A 1G5TA 4MH0R 4E09A 3QKSB 4URUR 4B35A 3AVXA 3HR7A 5FR2A 2BWJA 4DEXA 4XVQA 2FGKA 4QNRA 3X1DA 4EQ6B 4QRHA 5DI9A 4JSTA 3KJGA 1TNDA 4NCIA 1Q1EA 2B7CA 1G17A 2NO0A 3LQRA 4ZDKA 1YVDA 4UXIA 2B92A 4CEHA 3IEVA 2DB3A 4PO8A 2CHVA 5L3SB 2W83A 5BYJA 2CHQA 1DO2A 2GKSA 3BS4A 3WYFA 1E9RA 1QHXA 1YZLA 2RAPA 4QBGB 1OB2A 1E2QA 3A36A 2OZEA 1G18A 3GLHB 4F4IA 1JPNA 1OXTA 1KO4A 1UAAA 3CPEA 2UZ3A 3IO3A 2ZJBA 1KJYA 4QJ4A 4PTLA 1XD2B 4LJYA 2ZE8A 4E22A 2QMUA 2F9MA 3C41J 1BO6A 1CJVC 3T35A 5C46F 1FPMA 4K81B 4XWOA 3K70C 5FBRB 1NBME 1ZIPA 3CNNA 5EE9A 3EAQA 4PAMA 4PR0A 3EC1A 2ZRPA 2IS6A 4LBYA 4Q00A 1G8FA 2A5DA 2ONJA 4MKFA 3RHFA 2RKOA 5KPDA 4A36A 2QTHA 5ELXA 5LDDC 5J47A 3UATA 1U2RA 4A0FA 3QXCA 4ZI3A 1KZGB 5J4LA 2QRZA 3I62A 3K0FB 4D4KA 4GI7A 4DSTA 5JSZB 3U3OA 2JA1A 1MRSA 3Q3JB 1PUIA 1U0LA 2AFHE 4Q1CA 1KJZA 3IHWA 2R62A 4I99A 1AQUA 4NYJQ 1LS6A 3NBXX 3VTKA 1U8ZA 1VCMA 4IVPA 4AYXA 5JJIA 4JMPA 1OHHD 2F1HA 5G40A 2EVWX 2ZR7A 4HDOB 1GRRA 1IN6A 1MV5A 3WNBA 2ZXUA 1FMLA 3ND9A 4TL6A 1QHGA 4YMTA 4IDPA 4TSFD 1OT3A 3GLGE 3NC1C 1DVRA 3RDPA 2XOKD 2Q9CA 3CKLA 4R2HA 1TL7C 1OH5A 3CX8A 1OSNA 4ABYA 2CNWD 2IYTA 3GJ7A 5E95A 2R6DA 2WM9B 1PV4A 3TJZA 2YINC 3A1VA 2AFIE 4QHTA 1A7JA 2IEZA 2GAOA 2DPXA 3NBZC 3AVTA 4OHYA 2WPDD 1US8A 1EESA 1TUEA 2BMJA 2CHGA 1HEIA 4DCNA 1XBTA 1IN8A 1KY2A 1VIAA 4FMCF 5FPSA 2QENA 1ZNZA 2YWHA 1E2GA 4QC2A 2YZ2A 2F9LA 3GLIA 2VBCA 2G6BA 2QRNA 2H8KA 1C1YA 3REFA 4KFTA 3KXKA 3IHLA 5KUTA 2A9KA 2H5EA 1W2GA 1KK1A 2GHIA 3IBYA 3KQUA 3JZAA 1KJWA 4TMKA 4OQXA 2PT5A 2OO7A 3AV0B 3IDQA 1CEEA 4M4SA 2KB0A 3BORA 1G7TA 3BE4A 3CUEF 1VDZA 3GLFE 3W3AA 4IRUB 3LDAA 5F3WB 3KXLA 2R8RA 4G3XA 5AJWA 1IN5A 1T9HA 3ETLA 4M53A 4M9SA 2IEYA 1KKLA 3TE6A 1R4AA 2ZRKA 2C5LA 1QHHA 1TF7A 3CX7A 4CYMA 2C77A 2UZIR 1Z6TA 4JZKA 4TTPA 3U6KA 5F98A 3BFVA 1DAGA 4G5QA 4LWZA 5SZIA 2ZAOA 3UWKA 1JI0A 3MGCA 1ANKA 1MH1A 5E4FA 3HR8A 2IYRA 5CJ2A 2J45A 3W9YA 4RVCA 2GZDA 5CYOA 1W2HA 4I81A 1V43A 4PSVA 2C78A 4MYTA 1NLZA 2YWFA 4C0LA 2V6JA 2V4ZA 1J2JA 1OW3B 5TVKA 4D4LA 4CEHB 1A82A 5FOUA 4JLVA 1KY3A 4JKIA 4DDWA 2C03A 1TTTA 4H9GA 2P5TB 2BVNA 2CLDX 5L8VA 2XZPA 5EP4A 2QGNA 4E5UA 4MGKR 1CF4A 1JQJC 3SQWA 3MCAA 1T8TA 1B0UA 1K8RA 1WDTA 4A92A 2ZUDA 1YU9A 1TAGA 3NBFA 4KYUA 1MO4A 1U8AA 1G41A 1UF9A 2QT0A 2ZYUX 1E2EA 1E2MA 2ZRMA 4A0HA 3N5CA 2XXAB 1RC8A 3WP1B 2FPMA 4B2IA 4C7OA 4UNNA 2GEUA 3IIKA 1RE0A 5EUMA 2C8VA 3UMFA 2ZRCA 3KDSE 1VKJA 2B7BA 4DXAA 4NYJR 2QY9A 4AWXA 4UNQA 3WXMA 4RD2A 2V8OA 1WP9A 3AF0A 4EFMA 3CRMA 1FX0B 2WSSA 1G7CA 1H65A 4HYYA 1J70A 1MO6A 4IXNA 4LHVA 1Z28A 4N0EA 3LLUA 4M1KA 5UKDA 4AI6A 2ZREA 1I2MA 2YOGA 4PX9A 4Q4LA 4ESVA 5DYIA 2V55B 2WZQA 3U44A 3AP2A 4MGYR 1L8QA 1XEXB 5GJVC 2WJGA 5HCNA 1WB9A 1GDDA 2GJ8A 2FE4A 3VQTA 3PCRB 4RY2A 2RGEA 4OHXA 2OILA 2R6GA 2H7VA 3VX3A 3PEYA 3G82C 5K8UA 2WOOA 4IDOA 4RSGA 4A15A 5HPYB 3GEHA 1G21E 5TY0A 1W7AA 1CIPA 1XTRA 2PLRA 1QHNA 3GLFA 1VHLA 2G1JA 5G3YA 4DCSA 5FBVB 2BCJQ 3CW2A 2GCNA 3OFND 4L8GA 3WRXC 3AM1A 4JT4A 3LLMA 1JBKA 3KQLA 4QGAA 1W46A 2CCJA 4XSHA 1IXRC 2R44A 1CS4C 5FI0B 2PX0A 3R20A 4I4LA 3ZS9A 1WF3A 1OH8A 2OE2A 3KL4A 3TVDA 1MABA 2DYKA 3GLIB 1JR6A 4D26A 4QBHA 2RHDA 4Z8YA 3E1SA 1P7CA 3QXJA 1NNEA 2DY1A 1GKYA 3R9WA 3ICEA 3QKRB 2XNDA 2DWPA 1GVNB 3I5XA 4DB2A 2TMKA 4LYHA 4OJQA 4I1VA 4LV5B 1KI7A 2CL6X 1Z6GA 1G3IA 4Q9KA 1M7HA 2C9YA 3X1ZA 4JLNA 5G53C 3OEHA 4F91B 2A5YB 5AUNB 5BN5A 4I1OA 2IHBA 4BQSA 2GEDA 4PC6A 2ZI5A 3HP1A 1QHHB 2P6RA 3SN6A 2VP9A 3ZVRA 4KODA 1OE0A 2JLZA 4CT4B 2DHRA 3AF2A 3VX4A 2Z4RA 1KI4A 4A6PA 1X8LA 2ZJAA 1R0ZA 2NPIA 1OH7A 1HT2E 3L82B 4NYMQ 4BZPA 1YZUA 1AQYA 1G291 3V00A 3KQHA 2XTNA 5E7JA 3ZS8A 4URVR 2IXFA 3AVOA 3OEEA 3FGNA 1NN3A 3PFIA 3MSXA 1YJ5A 3H4MA 1T3HA 2VLIA 5EE0A 4QM7A 5BYKA 4DLZA 1KSFX 2JJ2A 2W00A 4ZKDA 3FFBA 5B30A 3PUWA 4JBYA 5BW8A 1KO8A 1YR8A 4BZQA 3ZVMA 1Y3AA 3WNCA 4YMSA 4KHZA 1E99A 1DAFA 1KDTA 1Q3TA 1RKBA 2QE7D 3CNLA 4KFUA 5J4YA 2WJYA 1MRNA 2Q9AA 4NCHA 4EFLA 1E2HA 1FOEB 3JZMA 3MUFA 4NDZA 2AN9A 2F1JA 2VL7A 2YWEA 4GP7A 1F3OA 1EXMA 2JJ1A 1Z8FA 1G4AE 4CVNA 2WKRA 5EXXA 2WWFA 4B73A 1VPLA 1MOZA 3FWYA 1T5LA 3L2OB 1JB1A 3DOEA 4JYBA 4A2WA 1G5PA 3KKMA 2E87A 4PHGA 1GP2A 2BKUA 3BERA 2WWHA 2GXUA 1N0WA 3CO5A 4MGIR 4TYQA 2DFTA 4Q9HA 4JLDA 4B71A 1QG2A 2GZHA 2QSZA 3OIUA 3U2QA 1AIPA 3L43A 4C7OB 3WY9A 2GJKA 4DWJA 4MKIA 4URXR 1SXJA 1YZQA 5FBLB 2FX3A 3D7MA 4C30A 4D6PA 5TMPA 2AXPA 5BN3A 2OM2A 2FN4A 1KNQA 5AR1A 2RGDA 1HT1E 3L8YA 4EIWA 2BBOA 2CXXA 2FMXA 3WYAA 2GJ9A 1P2UA 4HEJA 4V0LA 4HUQA 1ZNYA 5JLJA 3ONWA 2ZRGA 2ZRNA 1II0A 2A2ZA 2D2EA 4FMDF 5G41A 4DSOA 2W2XA 4URYR 1SZPA 4LI0A 2LCFA 3SC3A 4TT3D 4FXPA 3AGPA 5FTJA 3KQKA 2W6IA 3QPWA 3ZD7A 1CR1A 2ODEA 4TLAA 1GITA 3EA0A 5DO9A 2YV5A 2D74A 3FE2A 3OAAA 4AD8A 4RFSA 4Z1MD 5DN6A 1WBBA 3MMPA 1HE1C 4ITRC 2I1QA 5KO2A 1BYUA 3FYHA 2OXRA 2ZI3A 3U4QA 1SKYB 2J46A 3NEJA 3CWQA 1PLJA 5KNCA 3QBVA 5JCZA 1CLUA 1XJCA 2ZRIA 3BIFA 5HKKD 4Q4HA 2AD1A 4IXMA 3MFYA 4HDQB 1LY1A 1ZUIA 3K0EA 3CR7A 2VIIA 1ZJ6A 4MQBA 2D7CA 4Q4JA 1X8KA 3QG1A 4O2RA 2CMKA 2J9RA 1SVWA 1M2OB 3QJYA 2PZEA 3QF7A 4PXAA 1IY2A 4B2LA 2VRWA 3OIVA 3FMOB 4KO8A 2IC5A 3GJXC 2J41A 1IM2A 2CVHA 5JS8A 1MABB 4U02A 5HCIA 5C1BA 2CE7A 2GXQA 3MJHA 1NSFA 4PZLA 1OLOA 2YVUA 4TL8A 2BBSA 5J4VA 3TUZC 4BPBA 5DHFA 5TXGA 1W0JD 1NVWQ 2BMEA 3VHXA 4DCVA 1KHTA 1U9IC 1ZUHA 1N6LA 5CM9C 2IWHA 1W36D 4HUTA 3A1TA 3IPYA 3OE7D 1U0HC 3THWA 3KJEA 1ZC3A 1CKEA 2WIAA 1WE2A 2XEXA 2O8CA 1G7SA 3P27A 2ZIAA 3GFPA 3PXGA 2ZQ5A 2IYVA 4Q48A 4HZIA 1KDPA 4TYPA 1NLYA 4DC9A 5KNBA 2RB4A 4GMXA 1ZC4A 3HU1A 1RYHA 4NONA 4TL7A 3X2SA 1M7BA 1SVMA 1DO0A 4CT5A 4EFNA 1VIYA 4OI1A 4TMXA 2XZLA 4EPYA 2G3YA 1P9RA 1KZ7B 3W6NA 5FPTA 1A2KC 3FMFA 1XTJA 5FOVA 3TUJC 1ELOA 5EE1A 2ZANA 3VR6A 1XJQA 4NYMR 1DELA 1ZMXA 3I73A 4O0MA 4LDJA 3OIYA 4IDHA 4OBEA 1T3SA 2ZS9A 1QVRA 1Q1ZA 1WBDA 5DISB 221PA 1ONBA 3NG1A 1JPJA 4LJ9A 5LB2A 1FTSA 3ZZTA 3DZ8A 1R2QA 1ZW6A 1NP6A 3EA5A 3K0CA 4OHVA 2IK8A 4NE2A 1BMFD 3UIEA 4BLSA 3P20A 2ZRFA 4W5JA 2GVDC 4QXAA 4BUJA 3RRMA 8OHMA 3V4RA 2PL3A 2C2HA 4P3YA 2ZSAA 2JIZA 4EJSA 1IXSB 2CJWB 2BC9A 4X8MA 4NU0A 1I2DA 2GEVA 1E4YA 1FTNA 4CGZA 2GXSA 1YR7A 1N5IA 5JI3E 3CWZA 4XD7A 2ZS7A 3R7WA 2EU8A 5KDLA 1GKUB 2O52A 1U8YA 2R6AA 4AYWA 3Q72A 3ASZA 3UMRA 2MMGA 1H8ED 1XXHE 2A5GA 2FJUA 3DKPA 1NMXA 1T91A 1FNMA 3W90A 1XMIA 5KNDA 2VHCA 2F7SA 1HYQA 3PENA 2WWWA 2V9PA 3T1OA 4ASUD 4QKQA 1Z6AA 1D5CA 5L3QA 4X8LA 2D3WA 1K6MA 3EIHA 3GPLA 1Q1BA 1XP8A 3A1SA 4P31A 2F55A 4PSKA 5FTKA 5HZHA 3DDCA 1SXJB 3Q5DA 1OYWA 3RC3A 4A9AA 3W5IA 1NVXQ 1OH6A 3FHTA 1XEWX 1T0HB 1W36C 3IUYA 2RCNA 1Z5ZA 1FUKA 4TYWA 4LJ4A 2JASA 2IYXA 3JVVA 2W2VA 1X6VA 4HUQB 2AHOA 5DLQC 3S1AB 3EPJA 4GFDA 1W47A 5FL3A 1YZKA 4WA7A 3FFAA 3KKPA 1F48A 1R0YA 2PLFA 3RRNA 4U5XA 5KDOA 3GJ5A 1AM4D 4BZXA 1KAGA 1XMSA 4IOJA 1E0SA 1XU4A 4RD6A 1KSHA 4ACBA 4HLDA 2WAXA 4QHSA 4MGZR 4ESHA 1DAIA 2BBTA 3EXAA 4KYIB 4YMVA 2ZETA 4BASA 2IS4A 4RFSB 5KHOC 1CJTC 5IK2A 5BWMA 1JR3E 3K9HA 2B21A 1JEDA 3U4QB 4EUNA 4K8OA 4G5GA 3I92A 4IVQA 4Q4HB 1S2MA 1E79A 1TQ4A 2PX3A 3DZDA 3M0EA 3FKSD 3SJAA 3CRVA 4GNKA 3SDZA 1S3GA 3BB3A 4ZO4A 2JLVA 4B76A 4ARZA 4Q9LA 1YQTA 2ZSFA 5JCPA 1E6CA 3F0TA 4QGGA 1XTSA 3LA6A 3UMSA 4B2PA 1E2KA 1F5NA 3C8UA 1II8A 2E9SA 5CB6A 2MSCB 1HV8A 5FBQB 4LC1A 3D8BA 4ON9A 1P2VA 3LW8A 1X8JA 2OCAA 5EP3A 2JCSA 3AF1A 2RHMA 4LYJA 5EZ5A 5DNYB 2VP0A 5H8WA 1R0WA 3BFKA 3AVUA 5B64A 4PHHA 1T5IA 3THWB 1LFDB 5M04A 4I1UA 4A2PA 3KUDA 4Q9IA 1NIPA 3RANA 1RPZA 1IONA 1G3MA 1G8PA 4O2LA 2REXB 1ZD1A 3PVSA 3LBNA 1OKKA 4BEBA 2IYZA 4LBVA 3TAUA 5J40A 4HB3A 2C04A 1FL9A 1KO5A 1N0UA 3B1YA 2P2LA 4TZ6A 5IDVA 3H0KA 3F5FA 3VKGA 1KMQA 3D31A 2XZOA 1QHIA 3B6EA 2DCUA 1BH2A 4FCWA 5K8TA 1NN1A 2V7QD 1DAEA 1NIJA 4V03A 2GCOA 1NVUQ 1OIVA 2VTKA 2IHYA 2QROA 2ZU6A 1JR3D 1NJFA 3IQXA 4M9ZA 1NG1A 1B23P 4KLZA 1WXQA 3BBPA 1SVKA 2XJ9A 3QVUA 4NCKA 4OK3A 3IO5A 4WW0A 4C0BA 4PC3A 3RC8A 5DYGA 1H8HA 4GSYA 3SJCA 3VFDA 3CH5A 3KTAA 1UDXA 4BLTA 1X1RA 4A0RA 1YRAA 4BRWA 1E1RD 1NRJB 2ZRDA 3U61B 4RD3A 4O3MA 3R7WB 4WZAE 4LGMA 3VR5A 3M4YA 3EX7C 2WICA 3VU9A 1OPXA 1XWIA 3ZQJA 721PA 1W4RA 2GRJA 2BJVA 2XJ4A 4LJAA 4BLQA 1ZM7A 1E1QA 4US0R 5KOYA 4KVGA 1UADA 1ZD9A 3B7GA 3RABA 3RWOA 3ASYA 3KJHA 3T1VA 2L0XA 4XSGA 3T1QA 2P6NA 4A1FA 1LTQA 4NP6A 1Q20A 3GFOA 5FFMA 1UKYA 3SFZA 5FR1A 2RGAA 4BLOA 4RD4A 5DH9A 3I8SA 3BC1A 3TMKA 3Q85A 2X2FA 3A1WA 2HV8A 2J7KA 3FMPB 5KTYA 3K9GA 4HAXA 1Z0IA 1RZ3A 2ODWA 4DLWA 1A2BA 3VR2A 2VA8A 3CR8A 5JS7A 1JQLB 3PUXA 1KMHB 2KWIA 1LVGA 3H86A 1NVVR 2PCJA 5FPYA 4M0LA 1XEWY 1E2DA 1AS2A 1E69A 5DSZA 1KK3A 2CCGA 4HZUB 3A6PC 2CVFA 4O25A 1S96A 4M21A 2ZM5A 4C0KA 4DT1A 1AJEA 1OFUX 4G0NA 3BWDD 4DB4A 5P21A 5K8LA 3U7HB 1ZAKA 4MKHA 2X2EA 3W34A 2HF9A 1KI3A 5JI2E 3R8FA 4WBSA 3U7GA 1CJMA 1DS6A 5H70A 2D2FA 2OBNA 4WXPA 2W6JD 3CM0A 2V1XA 3CPHA 4B3CA 1IHUA 3AKEA 2QAJA 1T0JB 1N6RA 3A4LA 1ZNXA 5L3RA 4ARZB 3PG5A 2Q0HA 4DCUA 5LD2C 3PV0A 4MKGA 1II8B 2OLKA 4JLKA 4JLAA 4WOPA 3TAHA 4Z51A 3SE0A 5FOTA 2IUTA 3T5DA 3SYKA 4Q1FA 3WMFA 4AG5A 1N6NA 2J59A 1UPTA 1E2IA 2XNSA 1CBUA 1X86B 5JFGA 4JS0A 4TSFA 1WA5A 1FP7A 4EPXA 2HJVA 1D8TA 4DLSA 1VCNA 3REGA 4HSEA 3C4JA 5IT5A 1GFIA 3GD7A 2HLDD 2CNWA 2WWIA 4A82A 1L2TA 4U7DA 4ZDWA 5DHAA 2F43A 3RWMB 2JEOA 1J8YF 4FCTA 1Q12A 2BMDA 1G7RA 2Q3MA 1QBKC 1Y63A 1PLKA 2IA5A 4RZXA 3W6PA 1PUJA 1L4YA 2IYSA 3K70B 2ASEA 4EAQA 4GPTA 1SKYE 2O8DB 2ZRAA 4E03A 3DVLA 4F4CA 1NMZA 2CDNA 2W2TA 1KIMA 2ZR0A 2VSOA 3O47A 1NBMA 1E32A 1Z0DA 1JNYA 2H92A 2W0MA 1HA3A 5JMTA 3ADDA 1CU1A 4M1WA 2GCOB 1R5BA 3CRW1 2V54A 1M8PA 4IW3B 1CXZA 4KVAA 4PQFA 1UBGA 3IIMA 5AUPB 3THXA 3A37A 2HF8A 1UJ2A 1S9DA 3C15C 1OFTA 5L3VA 2P0EA 4X8OA 4QGFA 3SJZA 4TLEA 5CYPA 5J5CA 1XEFA 2PZGA 2OAQ1 5C4MA 1KGDA 3BAFA 4PHTA 4IEEA 1EK0A 3K0AA 2ZU0C 3HWSA 3V4FA 4PQYA 2BM1A 3CF2A 1HY3A 1XD8A 3VU9B 2IYQA 5FOXA 4PC1A 5DI3A 3NTUA 3CIOA 4PPFA 2IYLD 5BXQC 5GVSA 1G9XA 1S8FA 1XTQA 3IIJA 2QM7A 1AA9A 1KI9A 4XTCS 5BQ5A 2P3SA 4BRUA 4CF7A 2FDCA 1E96A 2G1KA 1LB1B 1WRBA 4W5WA 3RS0A 3GLGA 5FUYA 2C99A 2XITA 2QPTA 1P9WA 3QEOA 4LX0A 4XJXA 1M34E 4Q01A 1I4DD 2FZLA 2CBZA 1NMYA 2Q3HA 4GBMA 3P4XA 3EIEA 2H17A 4JVMA 4RJLA 1A4RA 2J5XA 4AY2A 3LX8A 4JT2A 1UBEA 1XB2A 4N1AA 2ONKA 3E70C 4DDVA 1P6XA 4PAQA 4Q1BA 4B44A 2O0JA 4CRWB 1P60A 4W7SA 4A4DA 2V3CC 2W0SA 1KOFA 4Q1AA 2VEDA 2NZJA 1X1SA 2XTMA 3BGWA 1FNNA 4TLCA 1AZTA 3BD9A 4R9UC 2B6HA 2QPAA 1W1WA 4V0KA 621PA 1Q57A 3TLXA 3CH4B 5JRJA 2RGNC 2B8TA 1OFHA 3K0SA 4D81A 1ZM2A 4YXWD 3KFVA 1W4BA 2PMKA 3SQXA 2QP9X 2YOHA 1GSIA 1G6OA 2J0SA 4IKEA 1GKIA 1US8B 3EZ6A 4L5BA 1MR3F 4MA4A 5DE3A 2MSEB 1U99A 2ZRBA 3AF3A 4MUBA 3I1FA 5A4JA 4US2R 3QKUA 4Q66C 2BEKA 1E2NA 2PT7A 4D4MA 2VHQA 2GF0A 2JDID 4TTRA 1D2EA 1KSJA 4KJZA 3RYTC 1DTSA 2NPFA 2Q21A 1Z0FA 1NI3A 1UM8A 1VG1A 4DVGA 3OEHD 2CCKA 1RVDA 2HCBA 2R6CA 3NKVA 2GETA 4JLJA 1ESMA 1E4VA 3U7EB 1FP6A 1E94E 2EQBA 1EWRA 5FUWA 4DSUA 3ZLJA 1AZSC 3T12A 1DBSA 1ZD8A 1G1MA 1P5ZB 2BEJA 2QGZA 2JATA 2REBA 4JLBA 4M2LA 4CW7A 4LJ7A 2FZ4A 2GK6A 3K9NA 1RRPA 3TSWA 1KK0A 3MRSA 1N3BA 2UVQA 5IRCD 1YKSA 4OKSA 3H84A 4OI0A 3Q7QA 4FCVA 4M1MA 3B5JA 3EWSA 5KU1A 1ZNWA 3BH6A 2D62A 3OEED 2PJZA 1TEVA 3EARA 3LBIA 3WBKA 2QI9C 4GZLA 4IVRA 2Y8EA 2FG5A 2JJ2D 2KBFA 3TR0A 1P75A 1UEIA 2PEZA 1VCOA 4HAUA 3U3RA 1Z47A 3RS4A 4JVLA 3VKHA 1Q1QA 4DLRA 1Z29A 3FHOA 1R7RA 3QENA 3D3QA 3NH9A 5JECA 2HXSA 3HPRA 3QKTA 1QHSA 3RS7A 2Q9BA 4U00A 3A4NA 3NXSA 2BHRA 4D0GA 2RH5A 1XDBA 1E2FA 3C16C 2QUZA 4B32A 2VP6A 4B6EA 4UJ5A 4BFWA 2NG1A 1NF3A 3K0AB 4C9BA 3LX5A 1COWD 4DUGD 4GRAA 3L0SA 2CK3D 3H2YA 4KFSA 1KO7A 1FFHA 3NVAA 2AKAB 3GJ3A 5DI3B 1SVOA 1NKSA 2FEMA 2VHUA 1SXJD 5TB5A 4HLCA 1GL9B 1DAMA 1G6HA 1ZBDA 3R9XA 3VNVA 4QFMA 1Z08A 3A4MA 2ZSEA 5FH9A 2OXCA 4C0JA 2F1IA 2QNRA 4M1OA 1XZPA 3N2EA 2KJQA 4FD2A 4UXJA 1PJRA 1P61B 2JLQA 4M8NE 4Z8XA 2RGBA 4II7A 4F38A 1UKEA 3TGPA 3PQCA 1SHZA 2KE5A 2D06A 3TBKA 3B9PA 1BKDR 2WMOB 5KDDA 3CPJB 2IS2A 4HAVA 1T8UA 4MDFA 1E9AA 2J7PD 2QEQA 1OF1A 3BXZA 4DDTA 2O8FA 1N6PA 4YC7A 2OCPA 4XWKA 4PPNA 2FV8A 3OAAD 3CLVA 1RRFA 1XNJA 1NSTA 4G5RA 1G16A 3A1UA 4HB2A 1Z63A 1QF9A 4DLTA 3LO5A 4Q7JB 1CRPA 4LJ8A 2GK7A 2GBLC 3HYTA 4Q21A 3EW9A 1ZM4A 2QQ0A 3AB3A 3O8BA 3U44B 2OSBA 3LVRE 4LUCA 1U9IA 2AWNA 3RSLA 4MRNA 5HZKA 3GEEA 3LFUA 1EX7A 1JJVA 2BMFA 4Q1EA 4Q18A 3QE0A 1GOTA 3GLHE 3NWJA 3OHMA 3TKLA 4JLOA 4MITA 2QBYA 4LC0A 2IS1A 3DKVA 1Q44A 3THOA 4DEYA 3U3KA 4S2EA 2GF9A 4HATA 3I32A 2ZJOA 3B78A 4BE7B 5SZKB 3QOFA 3GLFB 3THYA 1C4OA 2BIFA 1W0KD 1KAOA 1ZVQA 3MWJA 4PC7A 3DPUA 4ZDJA 1W5SA 3K09C 4URZR 2ODNA 2VSXA 2R65A 3CZQA 3WHKA 2NQ2C 2QAGC 1CJKC 4B3XA 4XWAA 3P4YA 4H1VA 4M9QA 3UPUA 1RYFA 2ZI6A 5HE8A 2J1LA 4TT3A 2QP4A 3WYGA 2GTPA 3NH6A 3ICQB 2FH5B 3BK7A 1FW6A 1NJGA 1XRJA 4Q47A 4PANA 4Q19A 4Z1MA 4UNSA 3RS3A 1VECA 2WHXA 3GFTA 1GWNA 2G77B 3SNHA 2CE2X 5BN4A 1GZSA 1Z83A 4YDSA 3EPLA 2JLWA 1UEJA 3C7KA 2ZE6A 3GP8A 4CEIA 2IUUA 2ANCA 2VSFA 3BB4A 3SJBA 5HKKA 2O8EA 3I3SR 3SI7A 5FUVA 1SKQA 2D7DA 2HT1A 4KXFB 3WNDA 1E9FA 1YR9A 2GVZC 5AJZA 2A7QA 3U5ZB 1P73A 4MRRA 1RW4A 4TTQA 4BLPA 1N2CE 2IF0A 5CDFE 4V0NA 5LBIA 3CX6A 4B33A 2JLUA 4DBLC 1M7GA 4A8JC 4HB4A 3HDTA 4B43A 4BFSA 3QBTA 1Z3IX 5EXTA 3T61A 1AGPA 1E9SA 1L7VC 1NY5A 1S3SA 3PUYA 2PBRA 3FKQA 2ZS8A 4NKRA 3QQ5A 4UXHA 2N46A 2ORWA 1NY6A 4RFVA 4EPTA 5LPNA 2BV3A 2C98A 1I4TD 121PA 1QDEA 1ZCAA 2OFOA 3OE7A 2YKGA 4DIEA 3WHLA 3CF0A 3K9LA 3PEUA 2VPPA 4GZMA 2HCJB 2ZUBA 4M1TA 2NMVA 1JXOA 1F6BA 1GRQA 3ZZ0A 5HR5A 1GM5A 2NO7A 1AKEA 4HB0A 4AC9A 4C3ZA 2R6FA 4EQ6A 3FOZA 2ZEJA 3TW4A 3PUZA 2GNOA 4LHZA 1R8SA 5B2ZA 5CLQA 4BWYA 2XB4A 4PFSA 2ORVA 4JL6A 1R10A 1Z22A 1E0KA 1Z0AA 3CONA 4GMDA 5JEDA 1G4UR 1F2TA 5L3SA 2ZSDA 2F3TA 2Z0MA 5JEEA 1XPUA 4M1SA 1BMFA 3SS8A 2YOFA 1SVIA 4LPKA 4I1SA 1XD2A 2WSMA 3RVBA 2XSZD 2A5JA 3NIBA 3UK6A 4ZI2A 3LBHA 2EWWA 2ZITA 2VYFA 3H1TA 4WIAA 1AK2A 1FQKA 4PPGA 2O8FB 5KSOA 4QL3A 3EC2A 4PSAA 2GILA 4WZ6A 3VR1A 3ZIAD 1XD9A 2DR3A 2QMHA 2FF7A 1Z07A 1DE0A 3U3JA 4TN1A 3AVVA 4NCJA 2N1BA 4QJ3A 3GJ4A 4OQNA 2GWHA 3NBYC 1BIFA 5J4HA 3VNUA 1LF5A 1NVVQ 2ZYWX 1N5JA 2Z4SA 4EPWA 2IW3A 1A5TA 3AVQA 4IOMA 3KQNA 1EFRD 4P4SA 3EASA 5JSZA 1HURA 3LNCA 4D82A 5HE9A 1IOZA 3AP3A 2H16A 2O8BA 4ASUA 1GUAA 5J4KA 2QBYB 1E9DA 1G3UA 2RGXA 1UKZA 1SQ5A 2X19A 3QG5A 4JVNA 4XTRA 1T4GA 3LWNA 1ZM3A 6Q21A 1ZCBA 4JL5A 1N6HA 1X3SA 4MRPA 1EFCA 4TYYA 4Q4JB 3M6AA 1G19A 4UNRA 1NL3A 5AJVB 2XB2A 5F9HA 1Z0KA 3W5JA 4OQFA 5FTNA 3L0OA 1E9BA 2FNAA 2J87A 4IDNA 2IYUA 1KI1A 1AS0A 3B82A 2A5FA 3I8XA 2IYYA 5CDFA 1G8GA 1Q0UA 5CM8B 3SEAA 4W5HA 3F8TA 1GL7A 4ZDIA 4DDUA 4QHYA 3P1JA 4FW9A 4ZKEA 2BKEA 1OKKD 4QG7A 4Q4AA 4PZZA 4RKFA 3E5HA 4LYAA 3QY0A 1KDRA 2FFBA 5D3MA 4DRZA 3CNOA 2G0NA 1QZXA 4PZYA 4RD0A 1W44A 3VR4A 4YQFA 1G20E 3K70D 5JJLA 2BJWA 2ZYVX 4TMWA 3CB4A 1IY1A 4W9MC 3QF4A 4HAYA 2O8CB 3ADCA 2ZVPX 2PCLA 4NBSA 3BFXA 1RJ9A 2FU5C 5F2EA 1GNQA 5GVRA 4EDHA 1TPZA 1UKVY 4HAZA 4N3NA 5FL7A 4M1YA 3SHFA 1RRCA 1YZNA 3RS2A 5FPHA 1YZGA 4C0QC 4NCNA 3VR3A 1ZYUA 3I4LA 2ZRJA 4B3FX 5KSYA 4BFZA 1IN4A 3OIWA 4LK2A 2HJGA 2CLCX 4D0NA 2FGJA 2NIPA 1OIXA 4S35A 3WMGA 2WIBA 1XXHA 5E7MA 1E2PA 3I61A 3TQFA 4PHFA 2F1RA 2JGNA 3MD0A 1NKTA 3NEYA 3UANA 5B57C 4TMVA 5JWHA 821PA 3GQBA 3I72A 1AN0A 2C9OA 3UXMA 5GJCA 1XCMA 1U90A 3GJ0A 1WMSA 4EJSB 3DOFA 3GJ8A 3GLIE 2JLRA 4UJ3A 1JEEA 3IQWA 3SFVA 1RFLA 3RRZA 2IXGA 4OI4A 3OF5A 5FOWA 3SBEA 1P4SA 4LJ6A 4XIGS 4Q7MB 5DGXA 1DOAA 3P26A 1F2UA 2ZVQX 2XGJA 1YR6A 3R9IA 2WAYA 2ZRHA 3SZRA 3BRWD 4RD1A 1Q21A 2MSDB 4X8HA 1GG2A 3PUVA 3ZVLA 4JVSB 1FQJA 3W8NA 3ZYCA 3AUYA 1I4LD 4AURA 4YMUA 1G5RA 2ZUCA 1TU3A 4C4PA 4MYHA 2FPKA 3QXXA 2ZRLA 4ZCLA 1F2TB 1YHNA 2V7QA 4LSGA 4PPQA 1IQPA 3PR1A 4R71A 1J7KA 1SGWA 1SHKA 1D6JA 5L3QB 2EFCB 1PVOA 1JR3A 4FMCB 1EGAA 2GA8A 4M9XA 4YLGA 5FOSA 5H68A 2KSQA 4QOSA 4P4TA 4NMMA 5CK4A 4DSNA 4Q02A 1GAJA 2VP2A 1R0XA 4YONB 5GJBA 1E1RA 3QXSA 5TDHA 2RGCA 3NC0C 2XXAA 2IWRA 2ZTSA 5CITA 2OUKA 1DG3A 5JJKA 5A0FA 4LHYA 4C0HA 3SBDA 4ERNA 2YWGA 4LV6A 1JJ7A 1VYVA 1KNXA 2FFHA 4P4SB 2Z5FA 1OFIA 3WMEA 2QM8A 3AKCA 4PAOA 1YRBA 4XVUA 2EWVA 2O8BB 3MG9A 4NYIQ 2ZJ2A 2ZYTX 1TUIA 1FX0A 1TMKA 4KLNA 3VHLB 4OI2A 3TNFA 4P0TA 3UKDA 1FUUA 4PC2A 2PEYA 1M74A 3AKYA 3EIQA 1OJLA 2H57A 3KKNA 3EPKA 1XCPA 3QUSA 1IN7A 2AD5A 3HU2A 1XEXA 4R2IA 1JXMA 1JALA 4NHOA 2LWIA 3RS5A 1HTWA 3PJRA 3B85A 3K1JA 4MDEA 2OG2A 1OHHA 2NO9A 1GL6A 1U81A 3CRRA 4ILEA 2BOVA 2V6IA 4M22A 1K5GA 3PEWA 2HXYA 2ZE7A 4V02A 5H1YA 3AVYA 4LV8B 1DAKA 4Q4AB 2GJAA 2FFAA 3Q9LA 2ECKA 1D2MA 5D3MB 2XOKA 3QEJA 4AKGA 4ZCMA 4Q7LA 5FUXA 4IFBA 5KSZA 2OV2A 4J0QA 1G3RA 1G3QA 2HEIA 1U94A 5CLLA 4IDQA 3QF4B 2KBEA 2Q3FA 4LOAA 4OJKA 3ZVNA 2FA9A 4OL0A 3U6BA 1RJ9B 4B6FA 4EKDA 3FTQA 1LS1A 2WPDA 1ZU5A 1NBMD 2W6JA 2QZ4A 3LH5A 1OXUA 3QKRA 2QMOA 4GL2A 1ETUA 2AWOA 4KCGA 4MYCA 1S4QA 4GT1A 1EFHA 4BFVA 3QIAA 3ECCA 4TLDA 4P32A 1JAHA 2EFHB 1XXHB 2EW1A 4MRSA 3UG6A 2QU8A 2XX3A 1V5WA 1VCIA 2QA5A 3RRYA 1W48A 5EE5B 2GXAA 3ADBA 1R8QA 1FMJA 1E0AA 2GAAA 2VF8A 3B8HA 4HLUA 1M1YE 4B74A 4JLMA 4LY6A 2BM0A 2OEPA 4GP6A 2BBWA 2HLDA 3KB1A 1N0VC 2DWOA 4JJZA 1GNRA 2GDJA 2KI5A 2WWGA 3AVPA 1GTVA 2WKPA 3KTAB 5KSPA 2V1UA 4QM6A 4H1UA 1VYUA 1UDWA 1XMJA 4WVFA 4LZZA 1D2NA 1F2UB 2NGRA 4A6XA 1P9NA 3U60B 2FSFA 1BS1A 1EFUA 3B9QA 4G1UC 1XJ0A 2QT1A 1N5LA 4GOJA 1L4UA 4NPHA 3TR5A 4BFTA 2IX3A 3OESA 4TZ0A 3LVQE 4CEJA 1VG8A 3RAPR 3AP1A 2G83A 1D9XA 2ZJ8A 4FMBB 1WQ1R 2I3BA 1N6IA 2RGNA 3HJNA 3B1VA 3MJRA 2QP3A 4YMWA 1EFTA 3DM9B 4LBWA 3QVVA 2WSSD 2HUPA 4KI0A 1D9ZA 4D25A 3AQ4A 1E9CA 2I1VB 1MO5A 3BJIC 4GOKA 2NO6A 4L15A 4F7WA 2QTVB 1KDOA 3MWKA 5EXPA 4BGDA 2G0TA 2ZJZA 2DFKB 3HYRA 3DO6A 4HLUC 2ERYA 4FN5A 1CTQA 1T3LA 4LHWA 1G8HA 1CR2A 2WMNB 4L9SA 5AJXA 1GRNA 3W8RA 3NDPA 2O0HA 4IOLA 5LD2B 1KI8A 4KBGA 4KSBA 3TH5A 4GDFA 2E1RA 1DAHA 4BFUA 4LHXA 5EP1A 1QHYA 2LKCA 4HLQB 3QNUA 2GCPA 4GOXA 4ZPXA 3VMFA 3IEUA 2XAUA 3DMNA 4TMZA 1JAIA 4NYIR 1TADA 5SZHB 2QMEA 2ZI4A 2G9NA 2OESA 3TIFA 2BCGY 3QPVA 1E3MA 3J81k 2CEAA 2UKDA 2ZI7A 2WBLC 4NZYA 1MO3A 4DT1B 3T1TA 5JWRA 4Z54A 1IAQA 2FWRA 4YDHB 4F93B 2CL0X 3C5HA 521PA 4RCZA 3AUXA 4QBIA 1DPFA 4WXRA 4AG6A 2HT6A 1Z2AA 1G8YA 4HI0E 3A58B 4JKYA 2AR7A 2Z6VA 2ODBA 4FIDA 4Q5IA 3GEIA 3A8TA 1UFQA 3BOSA 4RZ2A 1N5KA 1W49A 3PEVA 3QPUA 4JBWA 2XNDD 1T6NA 2EFDB 1TF2A 4JSYA 2FSHA 2BDTA 3EZ2A 2NO1A 2AXNA 5AK0A 1QRAA 4FWTA 1ZP6A 3PIRA 5CK5A 1SXJE 1E2JA 2P5SA 3G5UA 3X1XA 3T34A 3D6TB 4XH9B 2GESA 1VTKA 2ZPTX 2J0UA 4A2QA 3QSYA 1O87A 1R5OA 4RZ3A 2J0QA 5IHPA 2CLSA 1TQDA 4C0SA 5DIFA 1DARA 3T5GA 2QPOA 1ZUNB 2FEOA 2OT3B 1SULA 4TYNA 1A1VA 3IKJA 2ZE5A 2OFXA 3O8DA 5FPKA 1ZM9A 2DFNA 1Z06A 2C95A 3LXRA 3TRFA 4BFXA 3O8CA 5FBWB 1SVLA 3AH8A 2REOA 4DHEA 4YXWA 3DL0A 1S1MA 2VP4A 3HU3A 3GMTA 5SZJA 2F43B 3AF4A 3IPXA 4OQMA 1LW7A 1N6OA 3O8RA 3TUIC 2AK2A 3AVWA 1CP2A 1ODFA 2HDNB 3OFNA 3EWAA 2RGGA 2ATVA 5GADl 3AGQA 5GJWC 1OXXK 3MWLA 3RLFA 4LYFA 4FINA 2JDIA 3WBJA 2WTUA 4BFYA 5CJPA 3EPHA 4KFRA 5EP2A 1XZQA 4POAA 4CDGA 4XVRA 2OBLA 1NN0A 3V9PA 1EX6A 2WJVA 3THXB 3C14C 1KO1A 1NN5A 4DKXA 2DWQA 2JJ1D 1BYIA 1VMAA 4FMDB 4WAUA 4KITB 5D3QA 2OLJA 3LY5A 3U7FB 3ND8A 4KSCA 3FHCB 2RMKA 2P65A 2YYZA 2GBLA 3ZGXA 2ATXA 4DCTA 4ZCIA 2JAQA 1CR4A 2VQSA 2VF7A 4US1R 2WVJA 1P72A 1II9A 1ZIOA 4BEJA 1R5NA 1TQ6A 2OFWA 3MAAC 4N0DA 4CEJB 1N25A 2CJWA 4NH0A 2F3RA 5EQTA 1GIAA 2H1LA 4TQUS 1XTKA 3KX2A 3DMDA 4CZ2A 1U98A 4P4UA 2A78A 2IUSA 3BH0A 3SHWA 5KYKA 4IHQA 4IFEA 2YC2C 3KFXA 4BECA 3GLGB 4C0AC 3M1IA 5JHGB 1J99A 1KKMA 2IXEA 5AWFC 4QGHA 2MMCA 3KZ1E 2CL7X 3TK1A 4R98A 4TQ9A 5HTKA 1CULC 3K09A 5CIQA 1AGRA 2EYQA 1J90A 2W6ID 1QVAA 2QAGA 4TQAA 3ZD6A 2QN6A 3L0IB 1P2TA 1VHTA 2QE7A 3HPQA 1COWA 4DUGA 5DN6D 2CK3A 2K5UA 2FOLA 2JLSA 5ANRB 1E98A 4G5SA 1ZRHA 1KI6A 2IT1A 1Q3HA 3B60A 1PZNA 1TEXA 1LF0A 1E0JA 4DJTA 1GNPA 4B47A 3LXXA 4AK9A 2IF2A 2IYWA 3PITA 4CIDA 1OXSC 2R9VA 2GJSA 1S9HA 4D2IA 4E07A 4AKIA 3LW7A 2DFLA 1KK2A 2P6UA 4NL4H 3CRQA 2PJRA 3VAAA 3NHAA 1ZU4A 3T15A 1DEKA 5EJEA 2VH5R 4KV9A 4UQOA 4DLYA 4LJ5A 4MRVA 2OHFA 1J8MF 4DLVA 2IBMA 2ZROA 3B1WA 4TMTA 1W4AA 3S1AA 4HAWA 2J0VA 2Q6TA 2FSGA 2EFGA 1DG1G 3FVQA 1E9EA 2J7PA 1TX4B 3AEZA 3NHBA 1OXVA 4AKHA 2D4HA 2FPLA 2H18A 4FWIB 3EZ7A 4FI3C 3U3MA 3W3ZB 1K5DA 1N6KA 4A8JA 4JJKA 2WJJA 4JYCA 2NOAA 5E3HA 2AL7A 5C2JB 4Y0VA 1Z2CA 3X1WA 1Z6XA 3ZJYA 4JIMA 2PMDA 2J0UB 1PLLA 2ZJ5A 1XTIA 2Z83A 2YC4C 421PA 4JLPA 1SXJC 3QXHA 1IJFA 3C5CA 1IJEA 4G01B 1S0UA 2O0KA 2XTZA 1XF9A 4RKEA 5JHHB 3NDBB 1NLFA 3ZDQA 2Z43A 3MLEA 2WKQA 4B48A 2GZAA 2C9CA 5AJYA 3Q5EA 5EZ6B 4QJ5A 2PH1A 4L4UA 5LB4A 1HH4A 4AKEA 1Z0JA 1YE8A 1RRGA 1W0KA 2O5VA 2ORIA 1MT0A 2ZR9A 4A0GA 3L0PA 4LPSA 4UKDA 2R2AA 4OQLA 1Q22A 2YHSA 4B3BA 2QL6A 3SR0A 2C96A 2JIZD 3DM5A 1O3YA 4AIIA 5A5GA 3W6OA 3KKQA 3L8ZA 4KBFA 3IILA 4QNMA 3LQQA 4ZIRA 1W0JA 4XD7D 3RSOA 3TSOA 3N70A 1TQ2A 2JLXA 2QSYA 3JVUA 1EWQA 1HQCA 2VHTA 4D4JA 2OBMA 5FI1B 3GJ6A 5E7IA 2JLYA 2AX4A 2J3EA 2DBYA 3UG7A 1OB5A 4DLXA 5EE3A 3VKWA 4ACAA 1XFAA 4B34A 3QKSA 5FTLA 5C18A 1YZTA 4KAXA 2ZI9A 1E2LA 1QG4A 4OK6A 4Q9JA 1NG9A 3E2IA 4KU4A 2B8WA 3DHWC 3R8CA 3UWOA 1MKYA 5JBQA 4JL8A 3OZXA 3TVTA 1F60A 4Q1DA 3EG5A 4MYUA 1P62B 2EYUA 3ZQ6A 1WCV1 3TW8B 3CF6R 1FZQA 3WRYC 4F92B 1JECA 4K46A 3P32A 5EUQB 2SHKA 4EPRA 4HDCA 4TLBA 4V0ME 2NZ8A 2QTFA 2WJHA 3ZH9B 5C4GB 3AKDA 3GLHA 1AS3A 1CR0A 3IBGA 4L9WA 4B75A 2WWYA 4BLRA 1SVSA 4R7ZA 4URWR 1ESNA 4P33A 2LKDA 1OYYA 2A30A 3SYLA 4NTZA 5K8IA 2JJ8A 3Q7PA 1EG7A 1LNZA 3TSZA 3ZZUA 3ADKA 2G88A 1Z6YA 2QAGB 3KUCA 4F4JA 4D80A 1XMVA 1HE8B 3LAWA 1W4CA 1LV7A 3TQCA 5IK2D 3I5YA 2P67A 4V0OA 4Y0AA 4OYHA 3KKOA 1KI6B 1U0JA 2I4IA 4OHWA 3FPAA 3EZFA 2OAP1 3F3YA 1IBRA 3K0CC 4WZBE 1H8EA 5CB8A 2ZAMA 4JBXA 2WJIA 2A3RA 3K0FA 1IY0A 3KXIA 1E79D 4PQRA 1S1CA 5F9FA 3BH7A 5KPJA 3WP0A 2QG6A 3K53A 3CZPA 4EJSC
chains in the Genus database with same CATH superfamily
1UMCB 3DDHA 4RZUA 1W5TA 2ODPA 4U5QA 1QORA 4MWDA 4UNPA 4C2UA 4XWGA 4ZV4A 5P8WA 5JCOC 1XCBA 2XSZA 1WCIB 4L16A 4B3TB 1QWOA 4G07A 1E7WA 4TS3A 4Y30A 3FHJA 3DUFB 1EZZA 3IGFA 4NMXB 4MUAA 1CY1A 4F8YA 4JUIA 3FDIA 5FTMA 4CMCA 5HIKA 1FLNA 1G0NA 2I8CA 2AKYA 4ZVLA 4CM1A 4ZVNA 1RLUA 3ZIAA 2VDRB 5LP6F 1U80A 2UYOA 3M6XA 5EXSA 1UBCA 2IE8A 3D4LA 3HWWA 4U1RA 3FMIA 1OIWA 1HDGO 4XOIA 1NOIA 2ZUWA 3FOCA 4YRTA 3MN1A 2X8AA 2VZ0A 3FFXA 3OM1A 1BJKA 3RYFA 2VP5A 4JP3A 4KQ9A 2F17A 2V3WA 4D0SA 3KOMA 2GA9A 2O7QA 4YLEA 2XQGA 3C1AA 2XOXA 3YASA 1QIFA 3HVJA 5AK5A 4I9UA 2FDXA 1KOJA 2A67A 1CUSA 4YI5A 3V1MA 1YE5A 1XZDA 3E4CA 3H5TA 3K4HA 3B1ZA 4BVBA 3G0HA 1ECJA 1RIFA 1WS6A 1VBKA 2B9VA 1YB1A 3ABSB 2O8EB 4WCDA 1NUSA 3SU8A 1RVV1 1IXZA 4JCCA 4LCBA 3DB1A 3LYLA 2C20A 1QBGA 2Y6UA 4NEHB 1X1QA 3RNLA 5JZVA 1E9VA 3MRXA 3DEFA 5B58C 1FFBA 3TD9A 1KYTA 4NBRA 1V47A 2OTCA 2WJZB 4MVJM 3PWZA 1IVYA 3OT1A 1UJBA 1EMDA 4DIDA 2O3SA 2PUAA 2FZKA 3CLRD 4R3WA 2V03A 1SUPA 3CISA 3B7PA 4B9EA 1JUDA 1JEYA 1BGVA 2HYIC 1KMMA 1KEVA 5JWOA 4KQKA 1VYTA 4G0XA 5IC6A 3H1FA 5FT9A 4ZIRB 1T29A 1C41A 1KYIA 1YHZA 3E18A 4KOEC 2QQEA 3WBFA 3PDIB 2I6TA 4ZMSA 3FGZA 4V0MA 2PS1A 2C2ZA 1DL5A 4KZKA 3OPXA 1DADA 1XVUA 3VR5D 2Y99A 4K0RA 4OOFA 3TZHA 3VU8A 5AVVA 3B70A 1R6AA 3FSGA 4H4CA 1CQIB 1OV4A 4O8ZA 4E3WA 1KI2A 3F5QA 3IUEA 5KBYA 2OG1A 2EJWA 3FTNA 1G2PA 2QV7A 3ESQA 4TWZA 1G5TA 1F0PA 1LWNA 3PYLA 1L8OA 3QKSB 4E09A 5CW1A 5HXAA 2Z6AA 1ECLA 2NSLA 4OJMX 5FR2A 3AVXA 2EBUA 4E5SA 1WZEA 4DEXA 3WSVA 3FNQA 3NAQA 2VT2A 2H48A 3QWFA 5JH7B 1HOTA 1PUXA 3ZK9A 5DI9A 1NNLA 4NCIA 1PGPA 4MGHA 4KGXA 4R9VA 1G17A 2BGTA 4LXXA 4QTXA 4TTJA 3E9DA 2HMTA 2B92A 5C8XA 1T25A 3BQNB 1Q0RA 1P2BA 1KMIY 4P8RA 3VV3A 4MVXA 1LK5A 2VXOA 2W83A 1EQ2A 1ADYA 3DNMA 4MVCA 2CHQA 5BYJA 2LV8A 3N86A 1AN9A 3SF8B 1KAEA 2REQA 2WP0A 5HUQA 1X7XA 3ZDBA 5JLAA 4CQNA 1E2QA 3EMDA 4K6KA 1CY0A 1VHWA 2C83A 2R8XA 2WVAA 1C8KA 1OXTA 2WM2A 5DX0A 3TPCA 3KM0A 4NECA 1F14A 1KGSA 1WG8A 5KJ1A 4PTLA 4B17A 3OE1A 1XJ5A 6GPBA 1XQXA 4P0QB 1YH3A 1Z13A 4HRVA 2XVXA 1PR6A 1J8QA 2QMUA 4FZ5A 1A96A 4LJYA 5BVHB 1BO6A 3T35A 5C46F 1VHJA 2HHJA 4L6CA 3K70C 1TTQB 3OJ0A 1PZFA 2HGZA 3OU2A 4PG7A 3RFFA 3RVLA 1ZIPA 4EHNA 2YXBA 5EZYA 2IV7A 9GPBA 4PAMA 4Y2GA 3H1AA 3BX1A 5EJ2A 2IS6A 4LBYA 3N07A 4ESEA 2A5DA 1P9LA 1ZJ4A 2JC3A 2XE7A 4P82A 2ETXA 2RKOA 3PC4A 3ZLUA 2GJ4A 1RYMA 5GM2A 5T41A 2QTHA 1WNTA 2O19A 2G08A 2PQ6A 1IEQA 2XCSB 1T2NA 4EHDA 1TLFA 1P4GA 1JH8A 1ULBA 2YVQA 5J4LA 1EZ4A 4A8HA 4RV5A 4EO4A 5I9NA 1V6SA 4MEAA 2RI6A 5EN4A 2EF1A 1BXRB 4QICA 2JA1A 5KYXA 2ODAA 2DOKA 3RUPA 3Q3JB 1Q7GA 4BXOB 1IL0A 3EH1A 4B3DA 3IHWA 1M6YA 2R62A 3PHGA 3VTKA 3NBXX 3TKAA 2JFNA 4IVPA 2HRDA 2F1HA 4E2FA 2OSVA 4BO1A 4RVDA 1U2DA 3VOTA 1XAGA 2ZR7A 4OHCA 1GDTA 3R3SA 1W25A 1IBKB 2PD4A 2P0YA 3QBDA 3KO8A 3AIIA 3M4ZA 3S1SA 3MJ4A 3ZR4B 1ADJA 4LRUA 4Z3KA 1FMLA 2H85A 3KLOA 4LYGA 2ZXUA 2FN8A 1POWA 1E89A 3ZWNA 3A2KA 4CKYA 4ARBA 3S2IA 2OZLA 4ENUA 4HGYA 1RCTE 3CKLA 4R2HA 4BVJA 4ND4A 4C0WA 4ZEVA 3E15A 3RFCA 2ZWAA 3D8NA 3HSYA 1LZLA 4PM4A 2Z95A 3RS8A 2O4UX 4DA9A 3AB8A 2ZTVA 4QHTA 5E9AA 3TPZA 3RYFB 1U7OA 2D2IA 2H0QA 3C6XA 4YWJA 1RPTA 2ZWVA 4A5OA 1C50A 2DPXA 1OGYA 1US8A 3EGIA 4E5DA 4EG8A 1HDOA 1P80A 3WK8A 3M8KA 1UIMA 1GAQA 1W5FA 3WL5A 2ENUA 1BWQA 2XXJA 2XUIA 3MBIA 2EJCA 2YZ2A 4CKXA 4C21A 4P92A 4W5QA 2G6BA 3DHYA 1GQSA 1JVBA 2W6PA 3REFA 3E2MA 4ZARA 5CDYA 3IHLA 3CVOA 1NW5A 2IJGX 4D6XA 1M2KA 2I2CA 2LCQA 2XUOA 4E1AA 4KG7A 4RV9A 3KQUA 1GQYA 3JZAA 1D1SA 1Z8DA 5CCDA 3OT1B 1NI4A 3JPYA 4DABA 4N8EA 5LYYA 3IDQA 5IKEA 4M4SA 3DLAA 1JEYB 4J76A 1G7TA 3DP7A 4ZANA 5E6RA 3GLFE 2A6PA 1Z38A 4LSWA 2PZLA 4O5OA 4C2BA 4IMPA 1GRVA 3LDAA 3MUEA 3BZWA 5D8DA 4YCLA 4MQ4A 4IS2A 5AJWA 3ETLA 4W7IA 4YMIA 4KO1S 9ATCA 5BSRA 1VYHA 2ZRKA 3GEDA 1TF7A 4FGKA 2VPTA 2OHGA 4QWWA 5D3ZA 4CYMA 1EX9A 1RFGE 3U3ZA 4XIJA 3H8WA 3VO9A 4TTPA 2WU0A 5HIIA 2BTOA 4YHBA 3NCTA 4Y1RB 4UD6A 4Z1OA 1WZ2A 3BXFA 3WLKX 3HB5X 1MH1A 4UHBA 3SICE 2IYRA 5CJ2A 1Z9BA 3LHFA 5EPEA 3PQ6A 3W9YA 4CUZA 4RVCA 5CYOA 3PVCA 1TKAA 4O4JA 3RK0A 2F2TA 4L75A 1YT5A 4W63A 2R6JA 2YR0A 2W2LD 4O0LA 1X7HA 3EULA 4LXTA 1QGAA 4TKLA 2P1ZA 2C7GA 1ZICA 4C0LA 4YRZA 5CFNA 3MMXA 3OD1A 1PL7A 4DARA 3OPNA 1J2JA 4Y2TA 1O97D 4D4LA 4OSEA 2Q6LA 4U4AA 4YXFA 5LA6F 5LMNB 4DR2B 2IBSA 4M0UA 4R05A 5FA8A 3KBBA 4MJLA 4FLEA 4H9GA 2FJ0A 2REQB 4P93A 4MI3A 2XH8A 5EP4A 4OH7A 1HL7A 1P3DA 2R7KA 4CKBA 4E5UA 1DMSA 1SCNE 1FRQA 5EFOA 1AHPA 3FH0A 4N8SA 3A9UA 3MCAA 1VSBA 4OQPA 1RMTA 2AG1A 3JATA 4QZVA 3Q8LA 1QR6A 1LLCA 3ZBQA 3KETA 2ZUDA 1YU9A 1J8VA 4KYUA 3UQYS 5K4AA 1E1LA 2CD7A 4U6SA 5BV8A 5EZYB 4F1WA 2XBUA 1YK0A 3GR6A 2RGYA 2PX6A 2QU7A 1QH8B 3N5CA 3VKFA 5C37A 4DV4B 2H1IA 4IDGA 2Y27A 2FPMA 4C7OA 3DCYA 3F3KA 2OD2A 4YROA 2GEUA 3IIKA 5BNZA 3LYAA 1RE0A 4LQCA 5EUMA 3G8DA 2C8VA 2YS7A 2J3KA 2POCA 3HLKA 3UMFA 1OWLA 2GUWA 2ZRCA 3CMCO 4BNGA 1SQFA 2QY9A 4PSDA 1MG5A 4YAOA 4YBZA 4DDMA 3H97A 1EDBA 3GBVA 1U8XX 3MGBA 4NLLA 1C3VA 2V8OA 2WYWA 1O8CA 1X74A 2BE7A 4ZALA 3T8YA 3AR9A 3CRMA 2WSSA 4KDEA 1G7CA 1TC2A 5A4MS 2RGWA 4R7GA 1J70A 4LHVA 4V0SA 1Z28A 5UKDA 1L7RA 2P9FA 1M1UA 2CNDA 4I2VA 1MGOA 3FNFA 3PS9A 4TRMA 4TTSA 5FBKA 1I2MA 2NW6A 4OAQA 4PX9A 2Q2NA 4ESVA 2OORC 3LXUX 4NZNA 1BDJA 3OSZA 5DYIA 2C0CA 5JAQA 4MGYR 1GQFA 2X0KA 1L8QA 5T7BA 1ZXBA 2QLLA 4CIBA 4I5DA 5HCNA 1GARA 1GDDA 4FFWA 4A26A 4GLFA 1SIBE 1UFKA 3PHJA 1NXSA 1K4YA 3PCRB 5KQRA 2RGEA 2WWTA 3IR5A 4OHXA 2H7VA 3VX3A 1KS9A 1ZISA 1YSCA 5FJJA 5JR3A 3IT2A 4MJ7A 2WF6A 4EB6A 2QM3A 5A9SA 5DCUA 5C8VA 5K8UA 2LBPA 4RSGA 4A15A 1VBNA 1U3FA 3GEHA 4OB6A 1W7AA 3DEZA 1M0SA 5LWHA 4Q93A 4IIFA 3IIEA 4AB1A 4BU0A 5CCBA 4BLWA 3O4JA 5G3YA 5IZCC 2VZ9A 4OQ4A 2GCNA 2IHUA 3LC7O 3O7MA 2BKAA 3GY0A 3LLMA 3OFND 4HN2A 1U8CB 1LD3A 2IZZA 3DQQA 4JT4A 3GPLA 3KQLA 2QUAA 5AKLA 4UU7A 3ZC3A 1M1YA 4C5CA 4HH1A 3V3TA 5KINB 3DD1A 3R20A 4I4LA 2PSEA 5FO0A 3X3HA 5L4LA 1FSPA 2OE2A 3KL4A 4ZT5A 1U2ZA 2I3GA 1AQJA 3FBGA 2G5GX 3PZRA 3T5TA 1A9SA 1C30A 4XR9A 3PL1A 1P7CA 1HRKA 4HTFA 4JR2A 1P5FA 1U04A 5C8DA 2VBIA 3R9WA 4MVJH 4EBFA 3SOZA 1SPXA 5ER9A 5IJ0B 1Q3KA 1HE3A 2F00A 1WV1A 3KYBA 1GV0A 4UHFA 4YRPA 3DAOA 3RIYA 3G0BA 3QU4A 3VJMA 2P69A 3EF1A 1KI7A 1O6FA 4LV5B 3NOVA 1Z6GA 2OKGA 5BV1A 4Q9KA 5E6RB 1RRVA 4LS3A 2FMFA 4LXHA 1BDIA 3BD7A 3RVPA 2II6A 2UZ1A 1EBUA 4L8FA 5ALWA 3WJ2A 1B15A 3NKFA 4J1NA 1FFSA 2CLKB 3OZUA 1C3EA 2Z57A 1CD5A 3PC3A 5MN4A 2FPXA 3JZIA 4PC6A 4WBNA 2LDBA 2QMZA 3FI9A 1TCVA 4KODA 1Y7IA 3BFPA 3NJ4A 5JNLA 2CDCA 4CT4B 3ZW8A 5ICEA 1NE7A 3C70A 2XLBA 2Z4RA 1KI4A 1SIWA 4K87A 4A6PA 1EVYA 4KLRA 2DFVA 4BX2A 2NPIA 1PG2A 3VSCA 1C14A 2W2QA 1HT2E 3VU1A 3K6JA 1YZUA 4CCSA 3KQHA 2H1SA 4LMRA 4K6GA 3GIWA 3QOXA 5AW5A 2AE2A 3RSHA 1NW7A 1Y7LA 3A28A 3MERA 2WAOA 2KW5A 3MSXA 3H4MA 2AMJA 1CHNA 2VLIA 4XCXA 4QM7A 1DBPA 2IYOA 4NX2A 5ISMA 2HA7A 2JJ2A 3BVPA 3HJRA 1QH1B 3LSTA 3VZPA 3GEPA 3PUWA 1LPPA 4H17A 5HRCA 1KO8A 1UDBA 3NU1A 1CV2A 4BZQA 5EL0A 4NDNE 4BEVA 3GOQA 1RKBA 3G9UA 5JQWA 1JIQA 4HFNA 5F2KA 4LCEA 2WJYA 4F45A 2CYBA 3ZDRA 1E2HA 1X7ZB 3JZMA 1XAJA 2F1JA 2R1VB 2YWEA 2JJ1A 1EXMA 3BWXA 4IICA 3OKPA 3A6HA 3LUPA 5EXXA 5I9SA 3VNAA 1MOZA 3JATB 4KLCA 3MUOA 2IZ5A 4KKVA 5ES3A 4A2WA 3NPAA 1JE0A 4QTUB 1F7VA 1G5PA 3MELA 3ZGZA 4DSAA 1MUUA 3NRBA 1GP2A 1PT8A 5LOVA 4Y9SA 2WWHA 3BIOA 4ID3A 3OX1A 4JBIA 2JVJA 3KQVA 4Q9HA 4KRGA 4B71A 1QG2A 1GSHA 2CMHA 2GZHA 2QDXA 2QSZA 1AIPA 3L43A 3OIUA 5FNVB 5I7FA 4C7OB 3LZDA 2FN7A 4URXR 2RHWA 5CLIA 2X58A 4C30A 3WL4A 4D6PA 1X92A 2BRUA 3JQ9C 3LK7A 4L50A 4DSZA 3UENA 1MIHA 1HT1E 3TINA 3ZYZA 1R00A 1ETHA 1QXSA 1XZBA 2FMXA 2GTHA 3H3FA 5E2BA 5JDCC 1KBQA 4OHMA 2IU3A 2V8BA 3QBEA 4GXRA 4YYEA 2CUTA 2AQ8A 3DEJA 1ZNYA 4Z4HA 1TZMA 3ONWA 1GTSA 2FQWA 2ZRGA 4KSYA 4EVSA 1LU9A 3WLNA 1AKTA 1Q7RA 1Y1KE 2D2EA 2XKJE 3ILXA 3PJDA 3IQHX 4M54A 1Y1SA 1JDVA 2ZBRA 3I6MA 4RHXA 4Y6OA 1QE0A 1N7GA 2FR8A 3WL3A 4X0EA 4URYR 3DWGA 3QVOA 4C08A 2QF7A 4LI0A 4Y2RA 3AGPA 3KQKA 2ZZMA 3QPWA 2IE0A 3AEQA 5THXA 4TLAA 5A9RA 2YV5A 2AQIA 2IGBA 1IZ9A 4RFSA 5DN6A 4UTPA 2CWDA 3MMPA 4HGNA 5GAJA 4NK4A 4BYMA 1V95A 4REMA 4DM4A 3EEIA 2QTLA 5A9SB 3ESAA 4BP3A 1PLJA 3WLFA 5JCZA 5B36A 3BIFA 5A7HA 2AD1A 1A04A 3D6HA 3MFYA 3K5IA 4HDQB 1ZUIA 1NSYA 5AHKA 5IH7A 3PPXA 5FTWA 1UJNA 5JYDA 2A4MA 3TEMA 1KVTA 2R8YA 2ZCUA 1IY2A 3RO7A 2E5LB 1M1YB 1RTTA 3EYAA 5EMJA 4HOYA 3D64A 3FMOB 3IE2A 1S89A 2HF2A 4Y2JA 3PPIA 3UBTA 2ZWPA 4NXNB 4U02A 4K1LA 4DR3B 1L5QA 4N18A 1AUXA 1C30B 1P0FA 2GXQA 3MJHA 3JQ8A 4PGGA 1PGJA 3GDOA 1FMTA 4TL8A 5J4VA 3D81A 2VTVA 2I7DA 3IT0A 3LF1A 5DHFA 2XCTB 4CUKA 4DNFA 1WUKS 4L3VA 1N8SA 4M6WA 1YMQA 1JVNA 2OV8A 1ZUHA 1R6DA 1X42A 4J1QA 4LE1A 3MW8A 1V8FA 1YFLA 3H5WA 4P34A 5BR4A 2P8SA 2O3JA 2P9EA 3KJEA 1ABBA 1SUIA 2HDWA 1CKEA 2NACA 2WIAA 3MJSA 3P27A 2ZIAA 3GFPA 3PXGA 1MC1A 1LLQA 1UIRA 2ZQ5A 4HZIA 1KDPA 3JYHA 3AU8A 5KNBA 4KB5A 1EYZA 3UK2A 2UZ1B 1RYHA 1M2VA 4TL7A 4NBLA 1V5IA 3OETA 4MQLA 3LHIA 4ZOCA 3N0WA 4GF5A 1DO0A 2OB1A 2XZLA 1VIYA 3QWIA 4TMXA 4EPYA 2G3YA 3K35A 4AMVA 4BMVA 3OOWA 5FPTA 3RF7A 4MW6A 1I2ZA 1XTJA 4OP2A 4ZRMA 2FK8A 4RTRA 2NYVA 4G4GA 4AW9A 4HNUA 3C24A 1XJQA 3FUTA 3LBYA 1FBNA 4UBNA 3NWPA 4R8LA 3SY8A 2FLKA 3K8OE 4IDHA 4OBEA 1QVRA 1QIGA 2X8LA 2H2AA 5DISB 4YP6A 3BCRA 3NG1A 4LJ9A 5HRUA 1FZTA 1C0LA 4QNNA 9ABPA 3ZZTA 3EA5A 3VTFA 2ATEA 4NMWA 4BNDB 1ISIA 4WHMA 1RDFA 3EA4A 3UIEA 1JP7A 3I2HA 2JGDA 4K03A 4NC9A 4FGLA 3SXJA 1JWLA 2I8LA 5BR8B 1B00A 4L5JA 1SC9A 4P3YA 5G0VA 3WDMA 3KV1A 3V4RA 3OLVA 2ZSAA 3PSAA 2ZBFA 4BO0A 4X8MA 2BC9A 4CR6A 4EJSA 2G5CA 4C7JA 3QEMB 5DNUA 3UJCA 4YV7A 1YASA 2GEVA 1OI7A 1X9IA 1E4YA 3CQ9A 2C5HA 3FSEA 3G23A 4FHDA 4RFLA 2GXSA 1YR7A 3A3PA 1B6GA 5TPZA 1I4OA 2PY6A 3U5TA 2X8JB 2PFKA 3IP3A 3CWZA 3DEIA 1QYXA 2ZS7A 3R7WA 2EU8A 3N28A 5JCJA 4KOAA 1U8YA 2VK2A 2R6AA 3N53A 3SC2A 3U9TA 3Q72A 4JROA 1ATZA 2QTBA 4QTTB 4B6SA 4ZJZA 3BYZA 1Z45A 2J3JA 4OKNA 4DRXA 3LVFO 3BGIA 3L6BA 3M5DA 1H8ED 4QELA 4DWWA 5HM8A 5DIZA 1RAHA 2P91A 1T91A 1QH0A 1T3TA 1YIOA 3F4BA 4AFNA 3E0QA 3W90A 1N5MA 1Y5MA 1CY4A 2O59A 4ZT3A 3HCEA 5KNDA 4DFDA 4JI4B 2F7SA 2AN3A 5YASA 2FMUA 2W6MA 2BSAA 4UW9A 2A8YA 1GFSA 2HWYA 2F8SA 1HOXA 1Z4LA 2XUAA 1NPDA 5L3QA 4P31A 1FDSA 1XNGA 2F55A 4JSRA 3O91A 4F60A 1OYWA 1ZRNA 1BD4A 4H6XA 1OH6A 4QULA 4OA8A 1XEWX 3HLYA 1Q84A 1T0HB 5LYJB 2IQIA 1W36C 1TAHA 4OU5A 4R8RA 2HJSA 2W22A 1Q83A 1LC3A 1W76A 4BC1A 3BMQA 3E05A 4H1HA 3ANLA 3WLEA 3JVVA 4MQFA 2HTEA 4BWGA 1IB0A 3SWWA 2RK6A 2AHOA 5DLQC 3VMMA 3RAGA 1DHTA 5FL3A 1MNAA 1YZKA 3DZCA 4WA7A 5CA0F 5AOVA 3KFLA 3ZXUB 4AZ3A 3P2JA 3GJ5A 2JFUA 2B3TA 3RLIA 1DEAA 3NBMA 1N2BA 1IATA 3AUKA 1TD9A 3LYUA 5T6MA 4Q4DA 4ACBA 3T5AA 3ASVA 4HH4A 4KXWA 5EWLA 4C5BA 4DE5A 1ZWKA 2J30A 4DQUA 2X0IA 4U7GA 4YMVA 3JYOA 4NJEA 1YZVA 1TM4E 2AA3A 2MYTA 3K4QA 4RFSB 4HQRA 3KV3O 5KTKA 5J2TA 5CYGA 1JEDA 4RSRA 2WKWA 1G2IA 5LIRA 5AVOA 2QR3A 5KCMA 3I92A 3KR1A 4IVQA 4DUPA 2QD5A 1S2MA 1TQ4A 3DZDA 1PHPA 3D7LA 5K7SA 3KDAA 1JXAA 1BMQA 3CRVA 4GNKA 1U0NA 1TJ3A 3SDZA 5CDGA 2HJHA 1EHCA 1QK5A 3A7EA 3DCJA 3TD2A 3VR3D 2XGMA 4R16A 3BB3A 5JZ9A 1NRIA 4NXMB 3KEQA 2Z5GA 1F3LA 4L9AA 3R7NA 4Q9LA 3QA3E 1N7JA 1K08A 2FZGA 4QGGA 1QAMA 3LA6A 3UMSA 2Y9MB 1F5NA 5J9FA 3KSAC 1KP3A 2AC7A 5JQGA 1U7DA 1XDGA 3WB2A 4I08A 3DKRA 3MM4A 4MQ5A 3VO2A 4DR7B 3JQ8B 4FHFA 5FBQB 2I91A 2W70A 4X90A 1Z0SA 5LKRA 1MJGM 1TB4A 3HN7A 1X8JA 3I0ZA 4EOGA 1Y1TA 3KSBC 3O9MA 1ZRSA 5HG0A 2JCSA 2HA3A 3AF1A 1ARZA 2RHMA 3LDUA 4LYJA 4QEZA 4OM8A 5DNYB 5JE8A 1OFVA 3ZOZA 1EHYA 2BMAA 4YRMA 2RJOA 3KRTA 4PHHA 2DRIA 5B64A 3HFRA 4D74A 3IDZA 2Y0PA 4KMMA 2QJFA 3KUDA 1KEUA 3MFQA 4Q4CA 1NIPA 1YA8A 3KVOA 4O2LA 2BDUA 3ABRB 2WZCA 3BCUA 3G7UA 3OFVA 4PYMA 2QY6A 2IYZA 4LBVA 4LMPA 2RG7A 1MTZA 3RIGA 2C04A 1FL9A 1S01A 1ZI8A 3MYYA 4U2GA 1N0UA 3CRZA 5KX5B 2P2LA 4TZ6A 1SG9A 3AHFA 3PUIA 1NONA 1U7PA 2GAIA 1MOQA 3D3WA 3B1JA 3UUFA 4GX2A 3WMRA 3ZNNA 4GEGA 1KMQA 3VKGA 3D31A 5JAOA 4AWAA 3PJRA 3I1YA 3Q3EA 4DL9A 2DCUA 1BH2A 2JCVA 1SRQA 3LUHA 4BX8A 5K8TA 4DREA 2E6UX 1HX7A 1DAPA 1NN1A 1H2HA 2V7QD 3MT0A 3NTVA 4Y2YA 5BNFA 1EFKA 1ES9A 4L7QA 4CLXA 3PC8A 1NVUQ 2VTKA 2IHYA 2O48X 4OHOA 1VGRA 1NJFA 2I3DA 4R8MA 3VDQA 4EVQA 5AVXA 5K4GA 4KLZA 1W73A 3AHDA 3QVUA 2IEBA 3DE3X 1QOZA 2XMGA 3SJCA 3ID6C 3G1TA 1RWKA 1E4OA 1RMYA 1UDXA 3GRVA 4JEUA 4LWOA 5KYUA 3VBCA 1PT5A 1ZA2A 2JAXA 3CV3A 4HUJA 2TSYB 3AHGA 5HIJA 2WTAA 3GU3A 4JUAA 5I4KA 3R7WB 1K68A 4WZAE 4ZMBA 4LGMA 3ZS9A 3SC2B 2AYZA 2GVNA 2HRRA 1Y5RA 1OPXA 1XWIA 2WTMA 4U7PB 4A5SA 5EIAA 3GCZA 2B25A 1UP4A 3EG9A 2DKNA 4DRXB 3ETHA 2BJVA 4X24A 4PBTA 1CVLA 4WUVA 4Z9BA 4US0R 4BWVA 2FEKA 1EUYA 1QB8A 1XYVA 4HNSA 5KOYA 3CVWA 2L82A 4JCOA 4B40A 1U11A 2XWJI 3H2BA 4GIBA 4A8PA 3KJHA 1NI5A 4A1FA 3AEUA 2DPHA 2J9GA 3QU7A 4NP6A 3T3HA 1UWCA 5FR1A 3IRVA 4JQSA 1N1EA 3ETEA 4JIGA 5DH9A 5JJCA 3OQ6A 3I8SA 3HY6A 4IDEA 3BC1A 4BP8A 3JD2A 2UXBB 1H85A 3EB9A 2HV8A 3LGXA 4CM5A 4UEWA 3CLRC 3K9GA 2Q3CA 4DGQA 3V8VA 4HNRA 1L4GA 1RZ3A 5THQA 4NOLA 1UJCA 1A2BA 5AKJA 4KRFA 3BMQB 1W35A 1JQLB 3FDFA 4I4NA 2QQFA 1CP3A 3EJWA 2KWIA 2FY8A 4HO1X 3L4BA 3VYSB 1JHPA 2W71A 1NVVR 1WTAA 2PCJA 3W5HA 1PGQA 4OMDA 4J7UA 1NQAO 1U3DA 5FPYA 4WXMA 3V1UA 2WI8A 2P68A 4GBGA 2XYRA 3I39X 2CWWA 2IIVA 1E69A 5DSZA 4P0PB 4MVJD 2CDAA 1U1GA 4PFKA 1RQLA 4NQZA 3A6PC 1PJBA 4G09A 1L4EA 2PLAA 5ITWA 4NOJA 1IG3A 2Z56A 4DT1A 4CU2A 2PZBA 3W2GA 7YASA 5J2UA 3RAEC 3QJ5A 4HAOA 5F51A 5J2TB 3CW9A 3ZXSA 4UTVA 1TO1E 4KE6A 1CC1S 1JR2A 4FJ2A 3U7HB 4MKHA 2E4ZA 3O31A 5KIAA 3R8FA 3ROQA 5CD1A 2P7IA 1CJMA 1DS6A 2D2FA 3CB2A 1U7UA 1MFPA 1ZDMA 4OGLA 4B3CA 1V7PC 2H1CA 3NTQA 2XI4A 2XA9A 1PT6A 1F0NA 2JGKA 4OP3A 1J2RA 3A4LA 5L3RA 3TQHA 5IKOA 2Y68A 2Z3VA 3PG5A 1Y7PA 4XUCA 1FLDA 3LC1O 5LD2C 1ZGCA 2HPHA 3P8ZA 5AI0A 5J59A 3TOXA 3DYIA 4WH0A 5T67A 4LFAB 4Z51A 2VAPA 3T5DA 2IUTA 7ABPA 3BXPA 3ENQA 1SU6A 1C81A 3WMFA 2J59A 1UPTA 5JFGA 1EM8A 1RWOA 3K6SB 1Y4ZA 3MT7A 4NATA 1ZUNA 3I9OA 3F96A 5ALHA 1FP7A 4L8WB 2FG6C 5IH3A 4DLSA 1VCNA 4INOA 3GEGA 3K2QA 3REGA 2CGEA 2IHTA 2LZ0A 4PS0A 1UOEA 2HLDD 3MLAA 2CNWA 2WWIA 3I01M 4F2DA 1IY8A 1GCAA 2AIRA 3NIWA 5EJAA 1YQGA 4KRYA 3O4VA 1JLLA 2F43A 5KTMA 2AOVA 4PCAA 1J8YF 1E3MA 3I64A 1LK7A 4B45A 2Q3MA 3B6MA 3ISVA 1A69A 2WSIA 5L3ZA 4E30A 4QREA 1L4YA 3TVYA 3GQVA 1E1NA 4MKRA 5BWNA 5DWQA 5DHQA 3D3WB 3KL2A 3SS7X 3O74A 1NYTA 1SKYE 2O8DB 2YRFA 2ZRAA 2FWNA 3EVTA 3T99A 4MHOA 5JNSA 2CDNA 2W2TA 1P4HA 1XRRA 2VSOA 3O47A 2VJQA 3CH7A 4QQFA 2W0MA 4MLZA 2IYAA 4BC0A 1RXVA 2ZVDA 3OY7A 1CU1A 2UYHA 3CRW1 1I6MA 2V54A 4IW3B 4PQFA 2NSJA 1R0LA 1ZVKA 5BMVF 1XTVA 4ECAA 4DLNA 2GPJA 1ZLXA 1S9DA 1OFTA 2AFRA 2HREA 2NO5A 4X8OA 4UZEA 5CYPA 3SYRA 1LRJA 3PUKA 1F5SA 2VCYA 1NVBA 2OAQ1 3E7FA 3C74A 4F3NA 4ZN6A 5C4MA 1QNLA 1KFBB 3ZHVA 4BKMA 3K9FC 3BAFA 3TLKA 4WXEA 4IEEA 2D0OB 3DE7X 3K0AA 2C7QA 3DS8A 2PE5A 3JTMA 1BOOA 4M8SA 1EVKA 4BTEA 3NTXA 3GARA 2QZPA 2BEWB 5C4IA 3EG9B 4TLLB 1J25A 2ZT7A 2IYLD 5CX1A 5GVSA 3WQQA 4PW0A 4HP8A 1XTQA 3MAGA 4RMNA 4ANFA 2YXLA 1AA9A 1GZ6A 3O1HB 2P41A 3FWNA 4QODA 1FDWA 2H8GA 2WF7A 2V5AA 1WETA 1B2RA 3G5LA 4CMJA 1ZCZA 4HNAA 2L18A 3V48A 4A73A 4L72A 2CEKA 3AEUB 3ONDA 7GPBA 5GV8A 1RM3A 1XN1A 4GBED 5AK3A 5ALNA 3T1TA 3HXTA 1KEKA 3U4GA 2P3LA 1E92A 4G86A 3AR4A 4NNJA 3E9MA 5AOCA 3HKBA 2FZLA 2O1EA 4YVFA 1BE6A 2AFIA 2H17A 1CNMA 4IX9A 1K92A 2J5XA 4XA8A 3E03A 1KXJA 3CEAA 4AY2A 4KN6A 1UBEA 1YR3A 4M0CA 4N1AA 4QVKA 1JFVA 3E70C 1QIKA 3JD0A 3C6KA 4OB8A 3IUQA 4PAQA 4WCFC 4F3CA 1NURA 2BDEA 2IEIA 4RK1A 3FVTA 4QT0A 3KQQA 3ZLTA 4CRWB 1F2VA 1GR1A 2W0SA 4KQGA 4N0PA 4N6OA 4Q1AA 3K32A 5A4DA 1X1SA 1CVIA 1N1GA 2VBGA 2Y1GA 4RS3A 3BGWA 5CBPA 1IHPA 1FNNA 1CERA 1LSUA 4M9RA 3WGGA 1AZTA 3C7CB 2W2OA 3JV7A 1ZITA 5IDXA 4V0KA 2GSWA 2XCQA 3ZWBA 1QB7A 1N5RA 1N7HA 1RSZA 1U65A 1V7QA 4NNOA 4EEKA 1NW9B 2FAXA 2WHQA 2RGNC 5J2UB 1SWWA 3VZDA 1OFHA 4F9EA 1WW8A 3K0SA 3S6JA 1ZM2A 3I04A 3VAYA 4UZFA 4D81A 4YXWD 5A3QA 3I2IA 5KREA 1CJBA 2BZ0A 3CINA 1H66A 3PT5A 5E8JA 1GSIA 4QT4A 4CV2A 2VH2A 4X61A 5EUCA 3UB2A 4RVHA 2J0SA 1CZNA 1SUFA 2AEEA 4EA6A 3CKMA 3EZ6A 4MA4A 4PG5A 1Q0PA 1UXOA 4AECA 3UAGA 1ODCA 1SOWA 2RCYA 3AF3A 4MUBA 2XTJA 3QKUA 3GWGA 4Q66C 3VSBA 3NMUF 4X7MA 4PO3X 3RK1A 2BEKA 3ZE9A 4Y2SA 1E20A 3AUJB 2MHCA 2UZ0A 2JDID 5KC8A 1D2EA 1T1RA 1T9BA 4GVPA 5GMOA 1DRUA 4FEAA 3RYTC 4G81A 5CUQA 1E2UA 1Z0ZA 1Q77A 2BR5A 3NGLA 4W5RA 3RADC 2AC2A 1ENOA 3IEIA 4DVGA 3IC5A 1RVDA 4G0MA 4JLJA 4O6VA 4WESA 5G4KB 3U7EB 2JBWA 2GN6A 4J0DA 3HCFA 1OTYA 2EGGA 2CXPA 4ZT2A 4DY4A 1UMDA 2YIVX 3R0JA 4M0EA 5FCDA 3IESA 5K6AC 2JATA 3DZGA 1DQRA 4CW7A 1RJGA 4LJ7A 2FZ4A 5I3CA 2QRLA 2RHGB 5AHOA 1RRPA 3MRSA 1JLLB 2AQKA 1IIRA 2UVQA 5IRCD 4E14A 2GZ3A 4OKSA 3H84A 4CF4A 3Q7QA 2BKXA 1C8BA 2V59A 2B78A 4G56A 1R0SA 4M1MA 5FAXA 1SIUA 4BNHA 1GRCA 4EITA 1GAXA 1ZNWA 1P2FA 3SJAA 1LDGA 1IG0A 3BH6A 3DE2X 5AVJA 5ALSA 3WKAA 4LWPA 3X1JA 3W79A 1O89A 1JF8A 2WNIA 3QK7A 3AG5A 3FJOA 1ISHA 2JBAA 1P74A 2RHOA 3KU1A 4GZLA 4UM5A 3VPCA 1FUIA 4L0CA 3ROZA 2Y8EA 2FG5A 2J8ZA 3GT4A 4RNDB 2JJ2D 3IP9A 4NFYA 1UEIA 2PEZA 1B41A 4HX5A 3R1IA 3W3AH 1Z47A 3K0BA 4MOWA 4JVLA 3RS4A 3NUZA 2FE1A 4KREA 2HRBA 2C9DA 1ILWA 2YY5A 3LUGA 4RJIA 2VQ6A 4N6GA 2X0FA 2WDZA 4YRIA 2XDAA 1Z29A 2PRJA 2HTFA 3SZMA 1GCGA 4JQOA 5HGJA 4FFBA 2HXSA 4FVTA 3QKTA 1XLTC 3FSJX 3ME5A 3AIMA 4U00A 5L4SA 5DGCA 1K7SN 2BHRA 4IIGA 5E38A 1E8DA 5ALJA 1ZIXA 1CDDA 1F8XA 2QUZA 4ZZ3A 2I4RA 1TT5B 2N75A 2YV4A 3HV0A 3RTGA 2PG3A 2XCOA 4B6EA 4DA7A 4BFWA 5BQXA 5JXIA 1H3NA 1OI2A 2EOAA 3K0AB 1YTLA 2RK4A 4WGFA 3CLSD 4GRAA 3ZBUA 3H2YA 4KFSA 1FFHA 3D02A 5CHYA 2Y1XA 1G9SA 5A3VA 4U3JA 5LP6A 1HC7A 2I4TA 2OY0A 3ZCUA 2VQEB 3HACA 5D7NA 1JMYA 3NC4A 4L4SA 1I4WA 4D5EA 4Q82A 1SVOA 1Q7CA 2DUNA 5KC9A 1ZH4A 5TB5A 4HLCA 1GL9B 1DAMA 1UPFA 1M72A 1G6HA 1Z26A 2SKEA 4RDHA 3VDXA 4QFMA 2LVBA 3C8DA 4YA6A 1ACJA 3S2EA 4XUDA 3AJAA 1NVMB 2VTEA 2YWBA 2IPXA 2ZYSA 3F7OA 3HI4A 2V96A 3I5UA 2G5TA 3NW9A 5DSTA 2I7VA 3OKFA 3LS2A 3PRYA 3P0JA 1A9ZA 2KJQA 1I2BA 4B46A 1PJRA 1P61B 2EL7A 2JFPA 2JLQA 4X44A 5JARA 3HZRA 1XZHA 1S7GA 1SOAA 2JGMA 1PS9A 1TMYA 2WJAA 4II7A 4V0RA 1CQZA 3TGPA 5CFQA 1YVPA 4R2KA 2KE5A 2FKNA 3TBKA 5HWSA 1BKDR 5KDDA 3CPJB 3BWEA 3HKBB 1G21A 2AFIB 3G13A 4DDTA 1PWZA