4IRUB

Crystal structure of lepb gap core in a transition state mimetic complex with rab1a and alf3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
170
structure length
170
Chain Sequence
b'EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LepB
publication title The Legionella pneumophila GTPase Activating Protein LepB Accelerates Rab1 Deactivation by a Non-canonical Hydrolytic Mechanism.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase/hydrolase
total genus 53
structure length 170
sequence length 170
chains with identical sequence D, F
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4iruB00
2R6FA 2V9PA 3SYNA 3AVVA 5EZ6B 4LC0A 2AHOA 1HV8A 3JZMA 4BGDA 1E9BA 1SVSA 3NC1C 1Q1EA 2R44A 4MGIR 3I4LA 2IYSA 4UJ5A 4DLWA 4TMXA 3KL4A 3O8BA 1KDPA 4AD8A 3KTAA 1T9HA 4E07A 1P75A 5FI1B 4MH0R 1KI3A 3BH7A 1PJRA 1UKYA 4YDHB 4A2WA 4UNQA 3KQNA 4B33A 1VECA 1W4RA 1XJ0A 3K8YA 1U8YA 2A5JA 4MDEA 1YZGA 3THWB 2H57A 3AF1A 2QTHA 2HXSA 2W2XA 4GMXA 4TTQA 2JLXA 1WQ1R 1ESMA 1G4UR 3QKRA 3ZZUA 1OV4A 2GK7A 2PCJA 2ATVA 3V4FA 4AIIA 5FL7D 1HE1C 2FJUA 3EW9A 2ORIA 5CIQA 2ZU6A 4PC3A 5HE8A 2OXRA 5KSPA 3EZ9A 4PO9A 1A82A 4BFXA 1E9AA 1OXVA 2WKPA 4AI6A 3K09A 4IDQA 3CRW1 1GP2A 3KKNA 3BERA 4BUJA 2WSSD 5BYJA 3RRZA 5KSYA 1JB1A 1S8FA 3VKWA 1TU4A 2FPLA 3RANA 2W6IA 3ONWA 5DI9A 3LBIA 3H2YA 1Z0FA 2ZJ8A 2ZRAA 2YVUA 4TMZA 4Q4HB 5FPYA 5AUOB 3BFXA 1ANKA 3LXXA 4RY2A 2IF0A 2CVFA 3SU8A 1F5NA 2CHVA 1ZC4A 2ANCA 2V8OA 3KJIA 2P67A 4MKGA 2PX3A 1DPFA 4URWR 4XH9B 2FDCA 2IS4A 2Z4SA 521PA 3TMKA 4NYJQ 1MR3F 2EFEB 2HJGA 4RD3A 4DIEA 3BIFA 4RJLA 5FR2A 4ASUD 3I62A 1F60A 3GLHE 1UJ2A 5JECA 1G8YA 2PL3A 2G0TA 2DHRA 5EP1A 1N2CE 1XB2A 2QMUA 3LLUA 1T3LA 4TQAA 2OLKA 1U94A 2F9LA 2TMKA 3GJ7A 1LFDB 1OSNA 1DAFA 1XTQA 4TLCA 2VQSA 4PC7A 5E4FA 4JVMA 1OF1A 4GL2A 3TE6A 1FP7A 3ADDA 3QXSA 1LB1B 3GLHB 1FX0A 1J8MF 2B7CA 1NSFA 1O3YA 1Z0AA 1W36C 1D5CA 3ASYA 3MFYA 2VHQA 3MWKA 3P26A 4LC1A 4YXWA 3RLFA 3TRFA 3UK6A 2QAJA 1Y63A 3CLVA 4XTCS 2FN4A 1VG1A 1F3OA 1VMAA 1Q1ZA 3C16C 1KIMA 3K0AA 5DSZA 4FWIB 3GEEA 5JSZB 3MG9A 4Q19A 4C7OA 1E1RA 4XTRA 1GM5A 5G3YA 4XVUA 1RVDA 4TL6A 4ERNA 1Q0UA 2GCOB 4IOLA 4Z8YA 1W2GA 1XD9A 2C9CA 1YR6A 3BB3A 4MKIA 4HDCA 421PA 3AEZA 3DOEA 4PO1A 5KPDA 2ZJYA 3KJEA 3B78A 1E0SA 1GNRA 2ZRDA 3KQKA 4M8NE 2O8BB 2A5FA 1GRRA 1AKYA 2OFWA 2QT1A 3OFND 1VCNA 4KBGA 4PZYA 2ZJ5A 4EQ6B 1XJQA 1GITA 4JKIA 3ZQ6A 3IUYA 1F48A 2JLWA 2SHKA 2AKYA 2QP4A 3KKMA 4B6FA 4DT1B 5JI2E 2WJJA 4NKRA 3ND8A 3C5HA 3HU3A 3ZJYA 2Q0HA 4AY2A 2ORWA 1WCV1 3EIEA 1KO8A 2KBEA 2QPOA 2QORA 1XCGB 3PCRB 1S1MA 3FWYA 3HPRA 5H8WA 2RGGA 5BWMA 3AV0B 5FUWA 1HT1E 1YR9A 3IKJA 2R6AA 3ZZ0A 3H86A 4PQRA 4URYR 2HXYA 3KKPA 4BZXA 4C0HA 4B48A 5TARA 3EZ6A 1Z22A 3VR5A 1XTRA 4KFSA 2GJSA 4NCJA 2IT1A 1VYTA 1CJTC 1Z2CA 3U60B 4CDGA 1COWD 1E9SA 1A2KC 5TMPA 121PA 2R6GA 3DEFA 3EC2A 1TF2A 1G7RA 1UF9A 1OIXA 3PV0A 3CWZA 1ZIPA 2JIZD 3PJRA 3U3MA 4Q1FA 3X1YA 2FH5B 5JHGB 4V0OA 1G21E 4Q1AA 3NDPA 2CL6X 5FFMA 3S1AA 4C0AC 4QBHA 1QHSA 4DLYA 5FUVA 3BAFA 3DDCA 2XOKA 4NCIA 2BBOA 2GEVA 5FTNA 5EQTA 3VR1A 1W36B 1ZD1A 1XNJA 2HJVA 1S0UA 1IJEA 3CNNA 4EAQA 821PA 1DAIA 5FBRB 5TV2A 4JS0A 3D7MA 2RGAA 3SC3A 2DB3A 2FV8A 2FSGA 1SVMA 2C95A 2JCSA 2XITA 4P3YA 5JS7A 3EARA 5G3ZA 4PX9A 4EJSC 1NSTA 1QHHB 1X8JA 2WKRA 5CK5A 1AS3A 3G5UA 5A4JA 2PEYA 2HV8A 2J9RA 1J99A 1Q3HA 5ANRB 3QXCA 4D80A 5J4KA 1W0JD 3FB4A 2RCNA 1P7CA 2BVNA 2D3WA 2Q6TA 3Q3JB 5EXSA 3K70C 1RIFA 3QF4B 4D0LB 3V4RA 2O8DA 1XD8A 2W0MA 3OF5A 1KSJA 1SHKA 5G40A 1GRQA 2HDNB 1SXJC 4A6XA 1R2QA 1U98A 3ZS9A 2UZ3A 2YV5A 3KKQA 2J46A 3FKSD 2ZPTX 3GLHA 1GG2A 1BKDR 3EG5A 1VG0B 2JLYA 1W44A 2AR7A 4JL8A 3IBYA 4PAMA 5J4LA 3QJYA 2BJWA 5JEDA 4Q1CA 4IOMA 1GKYA 5CYOA 5CITA 1LW7A 2BM0A 1IXSB 5KOYA 4IEEA 5IK2D 4RFVA 1IY1A 1U8AA 2NO1A 2ANBA 4N1AA 4TL7A 3PEWA 3BOSA 2JJ2A 4HLCA 4DDUA 4OJQA 4HLUC 2FSHA 1E2KA 3Q7QA 2C77A 3GLGE 1DAMA 3A37A 3PUZA 1G5RA 2OE2A 1CEEA 4B3XA 1AZSC 2IX3A 2WWXA 2GVZC 4TZ6A 4B73A 1QBKC 3QQ5A 5JWRA 1XEXB 1N6LA 1F2UB 4QL3A 4EQ6A 1A2BA 4URXR 2P65A 2FU5C 1HQYE 4OI1A 2X2FA 5FH9A 4DCSA 1OXUA 2IK8A 4EPXA 4N3NA 3BXZA 5HCNA 2CVHA 3ZIAD 5JRJA 1UKVY 3ZDQA 4I1VA 2OCBA 2CJWA 2E9SA 2R6DA 5BYKA 1SVIA 3GLGB 3FPAA 2GWHA 2EFCB 2Q3FA 4KHZA 3SJZA 2AD5A 1AK2A 4DBLC 2J0SA 1OFIA 3P27A 4EKDA 3CR7A 5J47A 3GD7A 4JT2A 4JVNA 3IGFA 4CIDA 4P4TA 2CL7X 1G3QA 1G8FA 1OHHA 1MO5A 4MA4A 4Q48A 2BEKA 3PEYA 4JLBA 3R20A 3WMGA 3M4YA 4D81A 1EWQA 1M6NA 4LPSA 3UG6A 5P21A 1SXJE 2GETA 4CRWB 3SFZA 1JALA 4LJ6A 4EJSB 1ZCBA 4RD6A 1P4SA 3LDAA 1E4YA 1GUAA 4LYHA 1XXHA 3W90A 4TLBA 5EE3A 3LNCA 1NBMD 2H18A 1IXZA 5AJYA 2A5DA 5FPKA 1RZ3A 4M22A 3K70B 1XMJA 1KTVA 3AH8A 4RZ3A 2QENA 3JVVA 4Q18A 1E96A 4TZ0A 1T8UA 1US8A 3LX8A 3X2SA 2GK6A 5EUMA 2OBMA 5BN3A 1SXJB 2ERXA 4PAOA 1JR3E 4Y0VA 3REGA 2C03A 4FMBB 5LB2A 3EIHA 3KX2A 1E4VA 4R2HA 1UBEA 3GJ3A 1BH2A 3QOFA 2YWHA 1P73A 1KAGA 3RS7A 1W4BA 4F93B 2XZPA 4KI0A 1WF3A 2H1LA 4TL9A 1FTNA 3TR5A 4LOAA 1CTQA 4AYXA 3A1UA 4DCTA 4B43A 4PTLA 2BOVA 2Q3HA 1G41A 1TQ4A 3QF7A 1TF7A 3SHWA 4UNNA 2CCGA 1TUEA 1BS1A 5FPSA 1LS1A 1OH7A 1IM2A 2XGJA 2QGZA 1Z6TA 5KYKA 3V00A 3HDTA 3QVUA 2ZREA 2VLIA 4NP6A 2D74A 3GLFE 1HEIA 2JASA 3PITA 3IPXA 1VTKA 1QHYA 1IOZA 1MO3A 3R8CA 4CW7A 4URZR 5FR1A 1PUIA 4OHZA 2H7VA 4V0ME 3NVAA 4NL4H 2GRJA 4ZCMA 1AA9A 1I4DD 2ODBA 3GJ0A 1NF3A 4TLEA 3NIBA 3L0SA 1TL7C 5JEEA 3CH5A 2F43B 4M9ZA 3WHKA 4DRZA 1FOEB 2Z5FA 4WIAA 1KAOA 3FFBA 4DZZA 4JMPA 3B60A 3RRYA 1SVLA 3DHWC 3EASA 4M1MA 2KWIA 2ZITA 2QAGC 3OEEA 2IS6A 4BEJA 1JEEA 5GJBA 1DVRA 1AGPA 4HUQB 3TQFA 1XZQA 3KXIA 4L9SA 1SKQA 2WJYA 3EWAA 1XDBA 4RCYA 3JZAA 4NH0A 4F91B 3ICQB 2G83A 2A5YB 1KI2A 1II0A 5E7IA 2CCJA 1FUUA 1XEXA 5A0FA 1F2UA 1E1RD 4D0NA 3VTKA 2C99A 4DDTA 4TMVA 3A4NA 1AJEA 3OIWA 1U0JA 3QKSA 1KY2A 2FFBA 4MUAA 4Q03A 4PPGA 1G5PA 1W7AA 1TQ2A 4DJTA 1UKZA 4NMMA 1C4OA 1MT0A 2JLRA 1ZNZA 4B3BA 1MO4A 5HCIA 5C4GB 4G01B 2NO0A 1GDDA 1B0UA 3KFXA 1E0JA 2OCAA 4D4LA 2DWQA 2VSFA 3C7KA 1KMHB 1WDTA 1RC8A 3MWJA 2H17A 4QNMA 3OAAA 1M8PA 1DBSA 3LVQE 3WXMA 3RS4A 5F9HA 4G3XA 1HQCA 5TY0A 1CBUA 3L0IB 2ZVQX 5D3QA 2ZRGA 1FPMA 2F1HA 3NKVA 4RD0A 1NN0A 1VG8A 4HAWA 5CIWA 1P2SA 3QEJA 5CJPA 5J40A 4E22A 1G8HA 4YMUA 3H0KA 4JLKA 1UFQA 4RD2A 3QENA 1K6MA 1Z29A 1YR7A 3LWNA 3N2IA 1WBBA 1JEDA 1HY3A 2EYUA 2ZRJA 3HYTA 3LA6A 3OIVA 4AYTA 1E2LA 1JR6A 2O5VA 2MMCA 5EE1A 4DHEA 1KK0A 1IQPA 1TNDA 1W0KA 1CR0A 2EYQA 3F0TA 3QKTA 5AJZA 4BLSA 2XJ4A 1JJVA 1G291 1GNQA 3MJHA 1D6JA 4LPKA 4UNSA 2OXCA 4NE2A 4TYPA 4A0GA 1G6HA 2BDTA 4M9SA 4KXFB 3T5GA 1TX4B 1P5ZB 1N0VC 2EVWX 2GILA 1WBDA 1WB9A 1E2QA 2GESA 2F1RA 2GXQA 2HF8A 3KQHA 5M04A 3IIMA 2JJ1A 4I4LA 4DIDA 3QXXA 4KSCA 2ZUBA 1KNXA 1OT3A 1ZP6A 2W0SA 5AUNB 3TUZC 1E94E 2QAGB 4XOIA 2JAQA 2XOKD 1Q1BA 1XMIA 2ODNA 5CJ2A 2QNRA 3VNVA 3EX7C 2XSZA 1G64A 2G1JA 1CLUA 4FMDB 1PZNA 3NDBB 2VSXA 2Z0MA 2V4ZA 1GSIA 3GPLA 4LJ7A 4YMVA 1FNNA 3DKPA 4HZIA 1ZM3A 1SQ5A 4WZAE 2ZAMA 5BW8A 1RRCA 1R4AA 5F3WB 3CX7A 1CU1A 3VAAA 1VCMA 2O8FA 3CZQA 5L3RA 3SI7A 2V7QD 1E9RA 1FUKA 1MRNA 4Q4AB 4CEIB 1E6CA 1UDWA 3FMOB 4BLRA 3ASZA 5LD2C 1Q3TA 2OSBA 5D3MB 2VEDA 3SEAA 5L3QB 4AKGA 2WKQA 2YWGA 4A1FA 3RWMB 3R8FA 2NO7A 2IS2A 3ZVNA 3C5CA 2RGDA 3WNBA 5FOSA 1FW6A 1XZPA 4A82A 3THXB 1OE0A 4FMDF 3FHCB 1SVOA 5L8VA 1NVUQ 4PO8A 4M1YA 5GADl 3DL0A 2P5SA 5IDVA 4NCKA 2FE4A 2VHTA 1F6BA 1ZD8A 3ZVLA 3FHTA 2WVJA 4KFTA 4XVQA 4EPYA 1NRJB 4US0R 3VR2A 2ZRPA 1NN5A 4A9AA 1S9HA 4D82A 4KFRA 5DN6D 1G1MA 1KI8A 2IYZA 2PZFA 4JLOA 5FOTA 5TB5A 3WBJA 4ABYA 1NLFA 3ADKA 1MOZA 3LW8A 3LXRA 2ZRKA 1G4AE 4LHYA 3WYFA 5HZKA 2H5EA 3CX6A 1TF5A 2BKUA 3PR1A 1NY5A 3QY0A 4OHVA 3L0OA 3SYKA 2YOFA 1CP2A 1ZNWA 1R5OA 4BLTA 5J4YA 1E9CA 1E2JA 4QRHA 4ZPXA 3TSWA 4C0QC 2V1UA 3ADBA 4D6PA 3G82C 1EWRA 5IRCD 4I1UA 5DO9A 4DDWA 4A4DA 2VIIA 4EPTA 3DM9B 2WSMA 2OFXA 1BMFD 1E1QD 3I5XA 4HYYA 1Z83A 2ZQ5A 4FD2A 4LV5B 3R7WB 4Q47A 2O8EB 1A4RA 2OZEA 4XWKA 2FMXA 1KMQA 4EPWA 4LHWA 3RS5A 5HKKA 4BFTA 1NLYA 1XBTA 2OT3B 2XNDA 4QHYA 1T5IA 4P4SB 4B3DA 4MGZR 3C8UA 4HAUA 2C9YA 2HEIA 4TLDA 1P9RA 3P1JA 2RGNA 3B7GA 2W00A 2RGEA 1Z5ZA 3T34A 5DHFA 3OEHD 1MABA 3U7FB 2GJKA 2D7CA 2GZAA 1FTSA 2OBNA 5TXGA 3SS8A 5JWOA 1XU4A 2WAXA 1G3MA 4NYMQ 4O2LA 4JYCA 2QBYB 5CB6A 4FW9A 1SVWA 2P2LA 4ZCIA 3T1VA 2YOHA 4Q01A 4C0LA 2BWJA 4YMSA 1W5SA 4O2RA 4ZDIA 3QI2A 4IW3B 3RSOA 1JQJC 1E9EA 2GBLC 5EP2A 2QPTA 4OQNA 5LD2B 2RAPA 2QA5A 4YQFA 4LY6A 1F2TB 2ZJ2A 1E69A 4JVLA 4A2PA 1DARA 4JSTA 4NYIQ 4RZUA 5CM9C 4QNRA 2CHGA 2JA1A 1LVGA 1T5LA 3BD9A 2CXXA 3T35A 3WP0A 4HZUB 1KGDA 4LJ8A 5C1BA 4LYAA 4PR0A 4DWJA 5E95A 2JEOA 3LV8A 3H4MA 5KDLA 1H8ED 1NLZA 2QQ0A 4O3MA 3LVRE 3RWOA 2QAGA 3FMPB 3RS2A 1GL7A 1VHTA 2AFIE 2G88A 2GAOA 4C0BA 2WZQA 2BBWA 2IYWA 2XTNA 4IVPA 4TQUS 6Q21A 2A78A 2FGKA 2B7BA 5CDFA 3I3SR 2QU8A 1EFCA 2FWRA 3WRYC 3BWDD 4A0FA 1AIPA 1XRJA 4JSYA 5GVSA 4D0GA 4W5HA 2BMEA 2DCUA 2CHQA 3AVTA 4Q9KA 3I72A 1E2PA 4CEIA 4Q1DA 1UKEA 3EPJA 1WRBA 1ZD9A 2NTYC 5H68A 3ZVRA 2A5GA 3HYRA 4M0LA 3MWLA 3HJNA 2QRNA 5L3QA 4V0KA 5HE9A 1NVVR 5H70A 2QQEA 3GLIA 1ZMXA 4TYNA 2I4IA 1IONA 1AS2A 5F2EA 3A8TA 3B2EA 4GP7A 4LBVA 5GJVC 3O8CA 3GEIA 2AK2A 1XWIA 4AG6A 3FE2A 1GOTA 1ZUIA 4CZ2A 2XX3A 4DB4A 2BHRA 4UXIA 1II8B 4I81A 5L3SA 1R0XA 5B30A 1CJKC 5JMTA 4PPQA 4IDOA 3CNOA 2GF9A 2J87A 3BB4A 4HLQB 3MJRA 3I32A 4M9XA 5KO2A 1NN1A 2JDIA 3T5DA 1LF0A 4BLPA 1HYQA 3GJ6A 2CNWD 4HB2A 5FPTA 4D4JA 4LBWA 4DCUA 3GP8A 3QIAA 1ZM2A 1Q57A 1JECA 2VP9A 4Q9IA 1QVAA 4XWAA 2GTPA 5AUPB 4HAVA 4L16A 2AXNA 2ZR0A 1YVDA 2V6JA 4HAYA 2VP4A 2XTZA 2D4HA 4B34A 4P32A 2KJQA 4LBYA 4WZBE 1P9NA 4CEHB 2XJ9A 2O8CB 2JLUA 1Z6AA 1YZKA 2ZI9A 4RD4A 1ZIOA 4DXAA 2O8EA 3R7WA 1GKUB 2ZRLA 1GTVA 4QHTA 3UANA 3LBHA 1Q44A 3GMTA 2Q9BA 2VSOA 1EX7A 4ZIRA 1FQJA 5E7JA 4NTZA 4KITB 3GJ8A 5DLQC 1O87A 4FCWA 1KK1A 2Z4RA 1VHLA 4MDFA 4KODA 3CPEA 2J7PA 5EP4A 1Z0JA 3ZGXA 3OHMA 4KO8A 5EJEA 2QT0A 3U44B 5FPHA 2WWHA 4YC7A 5DGXA 1M7HA 3B9PA 2CLDX 4M1WA 2W6JD 3N5CA 1T3SA 3TGPA 2W2TA 2QBYA 1P62B 2X1VA 3RRMA 1UBGA 4URUR 1R0WA 1K8RA 1U0LA 4GMDA 3ZZTA 3LH5A 1CS4C 4Q02A 4ON9A 1QDEA 4MYHA 1EX6A 5F9FA 3QPWA 3B13B 4MRVA 4ZDWA 4N0EA 2A3RA 1OH8A 1I2MA 4NONA 1PV4A 2B8TA 2F1JA 2R9VA 4DDVA 3THWA 3DZ8A 4A15A 3IDQA 1F2TA 2C96A 2A30A 2YKGA 2ZRMA 4JT4A 2WOJA 1EFRD 3FOZA 4AURA 2XEXA 3W6PA 3AVUA 2ZAOA 2VP2A 1IY0A 2A7QA 2P6RA 3E2IA 2OAQ1 4W7SA 4MQBA 3LW7A 1DG1G 2ZSFA 2OHFA 3KFVA 3VU9B 1E9DA 4UXJA 1I4LD 1G19A 4L4UA 4CYMA 1E2IA 3RABA 1OH6A 1AN0A 3NC0C 4GOJA 5K8UA 1NP6A 4RSGA 2REOA 3VKHA 5UKDA 4Q4HA 2JJ1D 4H1VA 3K1JA 1RKBA 3PVSA 5SZHB 3UXMA 1KJWA 4HDOB 4BPBA 4OYHA 4BRWA 4QGHA 2QGNA 3AF2A 5BN4A 721PA 1FMJA 2XSZD 4GDFA 2KBFA 2ZTSA 5DH9A 3U5ZB 1DAHA 5FBLB 3TSOA 4QXAA 4TLAA 3RNLA 5KDDA 1VYVA 1XD2B 3I5YA 1G17A 1E2GA 4XWOA 3VR6A 2GHIA 3CX8A 1KOFA 2LKCA 5JWHA 4PHGA 2O0HA 1J70A 3CR8A 2VHUA 1FP6A 1JAHA 1Q20A 3U61B 4DSTA 3AUXA 4EPVA 3E1SA 1JPJA 3QSYA 4HB0A 1ZBDA 3U6KA 3PIRA 2XZLA 1RYFA 3AF4A 4Q4JB 5C4MA 4FMCB 1N6PA 4MKHA 1KDTA 3GQBA 4RKEA 3IHLA 4IFBA 2PBRA 3Q7PA 4XD7A 4TMKA 1X3SA 3X1DA 1X8KA 2OO7A 1H65A 3SBEA 1QZXA 4B3FX 3CF6R 1V5WA 4UQOA 5CK4A 2B8WA 1EXMA 3WHLA 2NPFA 2J0UB 5JSZA 1L4YA 3B1WA 3I73A 4QJ5A 5J5CA 2J41A 4M53A 2WJHA 2O8CA 2ZUCA 3CM0A 5HR5A 2BMDA 2DFTA 2GCOA 2OBLA 4KBFA 5IT5A 3OIUA 2GJ9A 2VBCA 3FFAA 1ETUA 4FMCF 2O0KA 1OYWA 2ZYTX 4W5WA 1KKLA 4G5GA 2ZRCA 1M34E 3QPVA 2IYQA 4PXAA 4BEBA 2O8BA 4I1OA 3RS3A 4OQFA 1ZJ6A 1ZM9A 1R7RA 1TUIA 1GL9B 1XMSA 2VP0A 4NYJR 1PLKA 5TDHA 2FFHA 1CJMA 1N6KA 1Z0DA 4OJKA 2I1QA 3KJHA 2N1BA 3FTQA 4Q1EA 1ZU5A 4TTPA 5AJXA 4DT1A 1DEKA 2J1LA 3ZLJA 5EE0A 2WHXA 5EE9A 2REBA 4AWXA 4ILEA 2GNOA 3R9XA 4BZQA 1HH4A 4CF7A 4BRUA 3CWQA 1ZNYA 2CL0X 1HURA 5TVKA 4LK2A 1W4CA 1ZUNB 3KXLA 1RRGA 2P6UA 2XNDD 4RZXA 4EDHA 2PT5A 3B9QA 3CO5A 1AQYA 2WPDD 4DEYA 2YOGA 1OH5A 1BOFA 1XEFA 4Q7LA 1SVKA 3MAAC 4WXRA 5FUXA 1GL6A 2BBTA 3EZFA 2MSCB 5AR1A 1D2NA 3PEUA 4FI3C 1NMZA 1CR4A 1FMLA 2KE5A 1BYIA 1ZU4A 1N25A 4TWZA 4F4JA 1NKSA 2XTMA 4IDHA 1K5GA 2ZRNA 4HLDA 2LWIA 3I8SA 4QHSA 2CEAA 4E09A 5FOWA 4Y0AA 5EXTA 4P0TA 3J81k 1WA5A 3UIEA 1JJ7A 2KI5A 4LJ4A 1LS6A 2P3SA 1H8HA 1OKKA 4JLNA 1IN5A 4Q4LA 3NH6A 5K8LA 3CH4B 3MLEA 2P0EA 1EFTA 3AUYA 3C4JA 2JGNA 5JJKA 3Q8XB 4PHHA 3NBXX 4G5QA 3AVOA 3TBKA 2WJIA 1KI6B 1XEWY 4M21A 2D7DA 2QMEA 4GOXA 2H92A 1Y3AA 4PQYA 5GJCA 2WIAA 2RGCA 2AL7A 2HYIC 1UEJA 3REFA 4G0NA 4OI4A 2AD1A 2BC9A 3UWKA 3U7HB 3BS4A 3NBFA 1G9XA 2IYVA 3CZPA 4U5XA 5FL7A 2XB2A 3B1VA 4PHFA 2NOAA 4ZDKA 2QM8A 3F8TA 2ZETA 2YC2C 1TQDA 2W6ID 3AVXA 2C8VA 2RGBA 1CXZA 1HE8B 2R2AA 3C41J 4MRRA 4RD1A 3W3ZB 1QHHA 2Q9AA 4A8JC 2PZEA 4DLXA 4FWTA 4EPRA 5JCPA 2ZI7A 2QL6A 5EE5B 3QF4A 2HYDA 4GT1A 1PLJA 1D8TA 4LX0A 1ZUHA 2RGXA 1T4GA 2QP3A 3AGQA 3EIQA 5FTMA 4Q4JA 1X8LA 4QM6A 1W47A 1CR2A 1KDRA 2HLDA 4D4MA 4MGYR 3DMNA 2WMNB 5K8TA 2Q3MA 4IFEA 1DAGA 1NVXQ 4IXNA 4GI7A 3W5IA 3GLFB 4O0MA 4RZ2A 4ASUA 3K9LA 3CRMA 2D2FA 1XMVA 4OBEA 2WBLC 3ZS8A 3OE7A 4B35A 1IXRC 1XTJA 1NMYA 3F3YA 4IDNA 4IEIA 3SN6A 3A36A 5J4VA 5EXPA 1S3SA 2ZSDA 2BEJA 4A0RA 1GZSA 2H8KA 4AK9A 2ZI4A 4CT4B 4YXWD 2I3BA 3NWJA 1UAAA 3P4XA 5BN5A 4J0QA 2CK3A 4ARZB 2ONKA 1U99A 1AS0A 2RB4A 2VYFA 3GEHA 3Q5DA 4E03A 4FCTA 5SZKB 1N5IA 2OCYC 3PXGA 5FL3A 1ESNA 4NCHA 4DUGA 1YRAA 4KLZA 3GLGA 3K09C 4DSOA 3TK1A 1TPZA 1J7KA 1W2HA 3LLMA 1KI1A 3AKYA 1M74A 1SULA 2ZS9A 3TVDA 3ETLA 1G3RA 4MRPA 1NJFA 2GEDA 2QSYA 3DOFA 4OK6A 3U3OA 3WMEA 4KCGA 2IHBA 2IS1A 1RFLA 4R71A 1KO1A 3T06B 1AQUA 2C2HA 1FNMA 1CRPA 1KJZA 3W3AA 4U00A 3NH9A 1S4QA 2F7SA 4B3CA 5HPYB 3VR3A 2J7PD 4MKFA 1S1CA 3RRNA 1T91A 3OFNA 2PLRA 2G1KA 2VRWA 1N6IA 3AP3A 1OIVA 2ZYVX 3AKEA 4YMTA 4C4PA 1NNEA 3IILA 4EJSA 4HAXA 5DISB 1YQTA 3B1XA 1EFUA 4C0KA 4A8JB 2JLSA 3IIKA 4DVGA 1XX6A 3AF3A 2REXB 1P60A 4WAUA 2NGRA 2QG6A 4TQ9A 2WTUA 4EFMA 4DSUA 4ZKDA 2NQ2C 4KFUA 4C30A 3IEVA 3FKQA 4QM7A 4AKEA 3UKDA 5BXQC 4TMWA 1SXJA 1NBME 4OQXA 2WWIA 5LBIA 3DMDA 2WWYA 1MH1A 4IVQA 5GVRA 3LD9A 1KO5A 4ZO4A 1KI6A 2V55B 5FBWB 3E5HA 3NXSA 2ZSBA 4BFVA 2B21A 2J7KA 2YYZA 1P9WA 2G9NA 2BJVA 3BK7A 3MWYW 1QHIA 2ZANA 5IHPA 4C2TA 3WMFA 1GAJA 1QRAA 1COWA 2CLSA 2CMKA 2GZDA 2FSFA 2LKDA 2WJGA 3QNUA 4PZZA 1JR3A 4JLDA 1AM4D 1LV7A 3L43A 3EA0A 3PG5A 4HLUA 4LDJA 4QJ3A 3TNFA 1M7GA 2DWPA 4IJMA 2JIZA 2ODWA 4DC9A 4LJ5A 1G8GA 2FEOA 3LAWA 3ICEA 2ZS7A 4QG7A 4GP6A 2FFAA 3VX4A 4YONB 2XXAB 3QKRB 3NG1A 3QXHA 4JL5A 3OIYA 2ZJZA 4Q1BA 2OCPA 4Q9JA 3W9YA 3M1IA 2N46A 3D6TB 5FOVA 3JVUA 1CJUC 4JJZA 1ELOA 1JXMA 2QP9X 4M2LA 1Z8FA 2EQBA 5JS8A 1DO0A 3AVWA 3MD0A 2V54A 3N2EA 3K0CC 1UDXA 1N6HA 4B2LA 3CRVA 1NIJA 2EWVA 1HUQA 4G5SA 3HR7A 2PMKA 2UVQA 2FG5A 2NIPA 1TMKA 3GJ4A 3KZ1E 3SFVA 1S9DA 2F43A 2IYUA 2ORVA 4MGKR 3ZYCA 4B32A 3GLFA 4CGZA 2NO9A 3RHFA 1Z07A 2FPKA 3R9WA 3I92A 3H84A 1YU9A 3A6PC 2WOOA 1IN8A 1M7BA 1CRQA 4MRNA 1YJ5A 5HTKA 2X8AA 4V0NA 1W0JA 1VKJA 2WWGA 3IEUA 2GAAA 1AZTA 3PUXA 4V0MA 1PUJA 5C46F 1YKSA 2CBZA 4OHXA 2FFQA 4HUQA 4Z1MA 3BBPA 1XFAA 4XD7D 1RPZA 4BQSA 3LQQA 1SZPA 2Q21A 3A4LA 3LBNA 1T8TA 4WW0A 2CCKA 1GNPA 3FKSA 1GVNB 1UBFA 2Z43A 5KNCA 1W46A 1Q12A 2QY9A 4A0HA 3LQRA 2JJ2D 3H1TA 2ZJAA 5B57C 1UADA 1P3JA 4C3ZA 3FDIA 5FTLA 2GCPA 4BWYA 5K8IA 2E87A 4DLTA 4OHWA 4K46A 5IK2A 4DLZA 3PQCA 1IBRA 1L4UA 4LJ9A 4F38A 2LCFA 1NJGA 4IDPA 1FX0B 1EG7A 3U3JA 4AKIA 4IOKA 1KMHA 1XTSA 2OG2A 2ZM5A 4A92A 1XEWX 5CB8A 4Q9HA 2KSQA 1E2EA 4M4SA 3W5JA 1CULC 1VPLA 5L3VA 5KDOA 3BRWD 1XPRA 2GF0A 4GFDA 4TT3A 3IBGA 3EPLA 1BYUA 1T3HA 2IEYA 4XSGA 2W58A 3ZIAA 1Q22A 4A8JA 1QHNA 4OQLA 3T15A 2BBSA 5FUYA 1OHHD 3PUWA 4HB3A 1ZM4A 3AF0A 1KHTA 1N0WA 1RYHA 1T6NA 2GZHA 1DG3A 3BJIC 3Q85A 3DZDA 1LF5A 2FZ4A 5GJWC 1KKMA 4QBGB 4DLVA 3AVQA 4HSEA 2AN9A 4LUCA 1E32A 4II7A 2VH5R 3FMIA 3D3QA 2VL7A 2ZJOA 1DAKA 1SHZA 2IL1A 3U4QB 2B92A 4BLQA 1TADA 2ASEA 4ZDJA 2IBMA 5JFGA 3VHLB 1H8HD 4ITRC 1OKKD 4LJAA 4US1R 2OUKA 4JIMA 5JLJA 5A5GA 2DYKA 2ERYA 1N5LA 4LWZA 2F1IA 4KVAA 2ODEA 1CR1A 1QG4A 2YINC 4DKXA 3EPHA 1YZLA 3QBTA 1R0ZA 5CYPA 1NBMA 2IYYA 1Z47A 4PHTA 4JLAA 5C2JB 3K53A 3SJCA 2YHSA 2JLZA 1W36D 4AG5A 2F55A 3DO6A 3TAUA 4P4UA 1OW3B 2D2EA 2IF2A 1OFHA 1QHGA 3THOA 1ZRHA 4OKSA 2XXAA 1DTSA 3KUCA 1G16A 1P72A 2HUPA 3TR0A 2BMFA 2L0XA 4JLMA 4O25A 4KSBA 1T0JB 1KI7A 3KUDA 3QXJA 1G7TA 4PPFA 1HTWA 1JQLB 4Q4AA 4FCVA 4F4CA 5LB4A 2FNAA 4C2UA 3BB1A 2QMOA 3MUFA 1E3MA 5D3MA 2EW1A 1MRSA 3TW4A 1Z0KA 3S1AB 2OEPA 2CE7A 2VO1A 3FVQA 1P61B 3I61A 1LNZA 5B2ZA 3ZH9B 2EFDB 2WWWA 3N70A 3K0FB 2IUUA 3THXA 2IXEA 4HEJA 1WMSA 4JBYA 1E2MA 1YZNA 2OESA 3CUEF 1JAIA 5KNBA 3GJXC 4OK3A 3AVPA 5G53C 2HLDD 2WJVA 4K8OA 4V02A 3CBQA 4FINA 1KY3A 3A4MA 1OFUX 1KJYA 2QTFA 2RKOA 2Z6VA 4HB4A 3B8HA 2HT6A 3U3KA 5C18A 3T1QA 1IN6A 2CE2X 4NU0A 2ZUDA 2J5XA 4LV6A 4MUBA 4B2IA 1OYYA 3HPQA 4G1UC 2UKDA 4G5OA 2G6BA 3OE7D 1DO2A 2ZVPX 3OEED 4GBMA 1KI9A 2N42A 2QROA 1NMXA 3TSZA 1MV5A 2O8DB 2F3RA 1P2TA 3P32A 1P2VA 3UATA 3TKLA 5SZJA 1U90A 2AWNA 2IW3A 1R5NA 3MMPA 2B6HA 4B74A 2CK3D 4BFZA 3HU2A 1UBCA 2JATA 2EU8A 3DVLA 3P4YA 3E70C 5KUTA 3A1VA 4Q21A 1DE0A 3SZRA 4RKFA 4BLOA 2BCGY 3U7EB 4L5BA 3QEOA 4LHXA 1E2NA 2D06A 4Q7JB 1AGRA 4RFSB 4WBSA 1QHXA 2FX3A 2IWHA 4UNPA 2QE7A 4IOJA 4DUGD 2ZR7A 1Z6XA 4P4SA 1NIPA 4BE7B 2DFLA 1KK3A 4S35A 2W2VA 3UMFA 3O8RA 2VP6A 3IQXA 3K0SA 4P33A 2J0VA 2ZI5A 3TLXA 4FN5A 3TUIC 2ZYWX 1E98A 3OAAD 3CW2A 4LSGA 1UM8A 4H9GA 1Q21A 3U6BA 1A5TA 3A1TA 1OB2A 3BORA 2VP5A 1U9IC 5FBVB 1C9KA 3SDZA 1KSGA 3ZVMA 4JL6A 1KI4A 4IRUB 4TSFA 1R8QA 1HA3A 4M1SA 4A36A 4L8GA 4I1SA 3O8DA 3I8XA 3L8YA 4QBIA 4G5RA 4POAA 2DWOA 5LDDC 3U4QA 4ZKEA 4TMTA 3IQWA 2CJWB 3BFKA 3K0CA 1GKIA 3KJGA 4X8HA 4JZKA 4YMWA 1OXTA 1XTIA 5FI0B 5HZHA 3K70D 3WNCA 2X2EA 3I1FA 1XXHE 4HZUA 5DI3B 3GFPA 5KSOA 5DYGA 5J4HA 1W0KD 2RMKA 2JLQA 1QG2A 1SXJD 3SNHA 3GFOA 1WXQA 5E7MA 3TW8B 2G3YA 4LRWA 3WBKA 3BE4A 3NEJA 2I1VB 3BH0A 3WY9A 4EIWA 5EUQB 2BM1A 4UJ3A 4XJXA 2NG1A 2QRZA 3K9NA 2GKSA 2ZYUX 1OIWA 1JNYA 8OHMA 1ODFA 2RHMA 3MRSA 3PEVA 2JLVA 2FA9A 3TQCA 4ESVA 1XXHB 1QVRA 2GVDC 4JBXA 1NY6A 2FF7A 5KU1A 2F6RA 4A6PA 2ZS8A 2NMVA 1JR3D 4JBWA 3KB1A 3IO3A 4AYWA 3X1XA 2EWWA 3SQXA 1OLOA 5F98A 1US8B 1TTTA 2NZ8A 2YJTD 3T12A 4NYMR 1E79A 1TEXA 3PENA 1N6NA 3NTUA 3K0FA 2AX4A 4MYUA 1EESA 1G5TA 4FIDA 2AK3A 1S3GA 4ZI3A 1MO6A 1GWNA 5E3HA 1YR8A 3RC8A 3DM5A 1OJLA 3UMSA 2AFHE 2PT7A 1CF4A 2DFKB 1HT2E 1II8A 2A9KA 4NPHA 4TYQA 2C78A 4ZI2A 2XB4A 5B64A 5CLLA 3RYTC 4C0JA 4QOSA 3ADCA 4F7WA 4NYIR 1G7CA 2BIFA 3NHAA 3B6EA 4KU4A 4A2QA 2V7QA 3HU1A 3HP1A 4WA7A 1W49A 4CVNA 1OXXK 2IYLD 4M9QA 1A7JA 4C9BA 1BIFA 4NCNA 1DELA 1ZVQA 4ZV4A 3ZQJA 4WXPA 3IHWA 4LCBA 4Z1MD 1ZW6A 1DS6A 1N6RA 4TYYA 2ZXUA 4NDZA 3UMRA 2ZE5A 4LBZA 3AVYA 4CEHA 2GBLA 3M6AA 2FSIA 1JBKA 3SQWA 1CIPA 1KSHA 5FTKA 1E2DA 2OLJA 1RW4A 1TAGA 4Z54A 1NG1A 4JYBA 4RFSA 3SHFA 2W83A 4LJYA 4S2EA 5DN6A 3THYB 1IJFA 1DOAA 4TTRA 1J8YF 5IF9A 1PVOA 2KB0A 3C15C 2YC4C 3SJAA 1CKEA 2QI9C 4PPNA 2O52A 2ZI6A 2OM2A 2WAYA 2YNMA 2FOLA 4C0SA 3QVVA 2C9OA 2NO6A 3GJ5A 3FGNA 1EGAA 4PC6A 5AUQA 2VHJA 4QFMA 4W9MC 2MSDB 3U44A 4KLNA 3WRXC 2ZIAA 3LX5A 3CPJB 5JI3E 1R6BX 1X1RA 2R6CA 5HKKD 4E5UA 2ZRBA 3B82A 3U2QA 1RRPA 1JXOA 3LO5A 4QGGA 2XNSA 1BMFA 1E1QA 2EFGA 5ELXA 2IHYA 2JJ8A 4Z51A 1PLLA 4TT3D 1ZM7A 2PEZA 3O47A 3AM1A 1L2TA 4BECA 3AGPA 5JJIA 3WP1B 4CEJB 5AK0A 4QGFA 3QKSB 1R5BA 2D62A 3LY5A 4M1TA 1VCOA 1GILA 3K9GA 4M1OA 1S96A 3AQ4A 3FMFA 3FYHA 4Q66C 4ACAA 2IXFA 2UZIR 1OFTA 3RSLA 1Z6GA 3OEHA 5DI3A 3QG5A 4X8MA 3R9IA 3PFIA 4QBFA 1YZQA 5JBQA 1X6VA 3B1ZA 1G20E 4GOKA 3VU9A 3Q5EA 2ZJBA 1J90A 4P31A 4OQMA 2XZOA 2J3EA 5DYIA 1G6OA 1U0HC 1KSFX 5KSZA 2GDJA 4JKYA 2GA8A 3BH6A 1G18A 4TYWA 4N0DA 1EK0A 2CDNA 2ZSEA 1BO6A 2DY1A 3CPHA 1QF9A 1Q1QA 3L82B 3EPKA 2YWEA 2AWOA 2HCJB 4LYFA 4RCZA 5JRZA 1YZUA 3EAQA 4LZZA 1JPNA 4QGAA 3SR0A 4B2PA 2FZLA 4UKDA 1B23P 2VA8A 2GXUA 3W8NA 3FHOA 2ZRHA 1VIAA 1FQKA 4KVGA 5JHHB 1U81A 3T1OA 2PMDA 2GCNA 2WIBA 1EFHA 4OL0A 4I99A 2PCLA 1XD2A 4TN1A 5DE3A 3SBDA 1H8EA 4OI2A 4WOPA 3Q9LA 2QM7A 3EA5A 4EFNA 4D25A 2VTKA 4RVCA 3SYLA 1T0HB 1TU3A 2WSSA 1E2HA 1KYIA 4PSKA 2NPIA 3RAPR 2AKAB 3L8ZA 4KV9A 4Z8XA 3WNDA 3CNLA 4GZLA 3CKLA 3TUJC 1YE8A 1RRFA 2XAUA 1KO7A 3PUYA 4PAQA 2FEMA 2RGNC 4PC2A 3WYAA 4TL8A 1ZINA 1MKYA 4YDSA 4DCVA 3QBVA 1W4AA 4UXHA 4AKHA 5DIFA 5DNYB 4OHYA 3K9HA 1G3UA 3RVBA 1LTQA 2HF9A 4LHZA 2OILA 4LGMA 3VR4A 4JLJA 4GPTA 2R8RA 1IN4A 4LHVA 1FL9A 2IUSA 4V03A 1U9IA 2GEUA 3NBYC 2VF7A 2YWFA 2V6IA 3EXAA 2J0UA 3A1SA 4XIGS 3W8RA 4BFWA 4HUTA 2ZROA 3PUVA 3AB3A 5KHOC 2O8FB 5EP3A 1E0KA 2CLCX 2JDID 3WYGA 4UNRA 2Y8EA 2DPXA 2RH5A 4CT5A 3M0EA 1J2JA 4W5JA 3GFTA 3KDSE 3OESA 2PX0A 2EFHB 3UWOA 3IPYA 4B75A 4PFSA 3CB4A 1W5TA 2QSZA 2V1XA 3QE0A 1R8SA 4Q9LA 3W6NA 1P2UA 3THYA 3VMFA 3BC1A 3EWSA 3TH5A 3W6OA 3SJBA 1ZYUA 3AP2A 1R10A 2CNWA 2R65A 4XSHA 5FBQB 4BASA 1II9A 5KPJA 4B76A 4F92B 1XCMA 1XJCA 5EZ5A 1IHUA 4JVSB 3K0EA 3L0PA 4FXPA 4K81B 3VX3A 4KYIB 2IYXA 2PLFA 5KTYA 4B6EA 4KYUA 3Q72A 4YLGA 2ZRIA 3RC3A 2IYTA 1NKTA 2ZE7A 4DLSA 1WP9A 1R0YA 1Z08A 2IC5A 2QE7D 621PA 1Z0IA 1P6XA 4PZLA 1UEIA 3TVTA 4Q5IA 4DSNA 1G8PA 3SE0A 4EFLA 1ZC3A 1RJ9B 2BMJA 3VFDA 1KK2A 3T1TA 2F3TA 2QEQA 4JLPA 2PZGA 4LYJA 4D4KA 3HWSA 4IKEA 4MRSA 4CEJA 3TJZA 3VNUA 3KB2A 4LV8B 2Q9CA 3X1ZA 4F4IA 2IXGA 5FOUA 1TQ6A 2C5LA 4NHOA 1G3IA 3ECCA 3X1WA 4BZPA 3RS0A 1JI0A 1YZTA 2QTVB 2OFOA 2YZ2A 3NBZC 4TSFD 2ZE8A 1XF9A 4PANA 1E9FA 1U2RA 4R98A 1TEVA 2MMGA 2IYRA 3VQTA 1VG9B 1VYUA 2W6JA 1XTKA 2PH1A 1G7SA 4NBSA 5H1YA 2WWFA 2DR3A 4B3GA 1SKYE 4M1KA 3IIJA 4GSYA 3KXKA 3RDPA 1WE2A 1D9XA 3G0HA 4B47A 2ZRFA 3CRQA 3DKVA 3MGCA 4MYCA 4PSAA 3CRRA 4HATA 1NN3A 1MABB 4DCNA 1C1YA 3EZ2A 4IVRA 1NL3A 1Z63A 3A1WA 2GJ8A 1NVVQ 1KZGB 2F9MA 3NEYA 3B1YA 1CJVC 3QKUA 2BCJQ 4ESHA 1YRBA 3B85A 3CF2A 5SZIA 1GFIA 3BFVA 1EFRA 3KTAB 4DLUA 2RHDA 3AKDA 1SKYB 2HCBA 3C14C 1YHNA 3UPUA 2AXPA 2ZU0C 4DLRA 3GCGA 2VF8A 1E0AA 1W48A 5DHAA 1AKEA 5AJWA 2G77B 5AJVB 4GNKA 4KJZA 4L9WA 4BFSA 4DEXA 1L7VC 2GJAA 3TAHA 1X1SA 1NVWQ 4HDQB 3KKOA 1ZAKA 1LY1A 4R9UC 5CDFE 5JJLA 1N0UA 5G41A 3A58B 1XP8A 1N5KA 4AC9A 1N3BA 3TIFA 4XVRA 2PJZA 2WMOB 3U7GA 1UPTA 1I2DA 2BV3A 4QC2A 1OXSC 2FGJA 2QUZA 4IXMA 1IN7A 2ZE6A 4PSVA 4DB2A 2IA5A 2OAP1 3OZXA 1XPUA 1D9ZA 1E79D 2ZI3A 4D26A 1Z2AA 4OK5A 4H1UA 4B71A 1K5DA 4MITA 3B5JA 4NZYA 4MYTA 1IAQA 2ECKA 1VCIA 221PA 5FOXA 3CONA 3U3RA 2IUTA 2GXAA 2K5UA 3MSXA 1VDZA 3GLIE 2J0QA 3AKCA 1E2FA 2V3CC 4QKQA 4US2R 3T61A 4BFYA 2P5TB 3D8BA 1NG9A 1KZ7B 1D2EA 1D2MA 1N5JA 1Z3IX 2WM9B 2O0JA 2VHCA 2C04A 1SGWA 2FPMA 2OV2A 4PQFA 1L8QA 1KDOA 4HI0E 3CF0A 2BKEA 3SOPA 3L2OB 4LI0A 4U02A 4JJKA 4ZCLA 1S2MA 5CLQA 1IY2A 3AP1A 4BFUA 2P6NA 3P20A 2H16A 3GLIB 3MCAA 1FFHA 2HT1A 4D2IA 3ZD6A 1N6OA 5EXXA 3LFUA 1RE0A 4ARZA 3KQLA 2GXSA 1FZQA 1OPXA 4Q7MB 1OB5A 4EUNA 4WVFA 2QPAA 1I4TD 3V9PA 3VKGA 2VPPA 4X8LA 1M1YE 4V0LA 4GZMA 4JLVA 4IHQA 3QPUA 3LRPA 3KQUA 4R7ZA 2X19A 1M2OB 4WZ6A 5L3SB 4ACBA 2X77A 3VHXA 2MSEB 1Z6YA 1Z28A 3IO5A 4QJ4A 2ZEJA 1NI3A 2DFNA 2QMHA 4URVR 1Z06A 4U7DA 1VIYA 2ATXA 4PC1A 4Q00A 4B44A 3ND9A 2PJRA 2QZ4A 2IWRA 4L15A 3W34A 2J59A 1GRNA 1RJ9A 2ONJA 5CM8B 2QN6A 3F5FA 3K0AB 1XPOA 1ZCAA 1U8ZA 4C7OB 3EZ7A 2G0NA 3UG7A 5JZVA 1E99A 1KO4A 3NHBA 2R62A 5KNDA 2J45A 3HR8A 4X8OA 1V43A 4OI0A 4R2IA 1X86B 3CIOA 5AWFC 2C98A 5LPNA 1ONBA 3QG1A 1DADA 1W1WA 2DBYA 2IEZA 2Z83A 3BGWA 3QUSA 4GRAA 4KAXA 5B58C 2WICA 1ZNXA 2ZR9A 2WV9A 2E1RA 4Q7KA 3EC1A 3ZD7A 2A2ZA 2ZSAA 1KNQA 4ZIRB 3DPUA 5FTJA 1A1VA 1GIAA 1XCPA 1DAEA 2WPDA 3D31A 4HAZA 2NZJA 5JCZA 5BQ5A
chains in the Genus database with same CATH superfamily
2DUJA 3PHCA 5HFAA 1ITZA 2CNBA 3SYNA 1Y6ZA 5EJAA 4LY0A 5E6RB 2C5BA 2QR3A 4CKBA 2ZUFA 1B2LA 3JZMA 4MUMA 1ZH6A 3JATB 4Q12A 3U7IA 4V1CI 3SC2B 4PICA 1Q1EA 3VDRA 5ECYA 3AF5A 4MGIR 3NTRA 4NFYA 1H1DA 4BMNA 2IYSA 3U7QB 3HZHA 4RMGA 3KKLA 4DLWA 4TMXA 4EZIA 2PQ6A 1XWWA 3KL4A 4AJEA 3JARB 3GUHA 1XN4A 1FP4A 2IX9A 3TTUA 3V97A 4AD8A 4B2YA 4ENVA 4Y9RA 5FI1B 4ESOA 1KI3A 5G02A 3OC0A 2ZDGA 5B2EA 4FYHA 1DEOA 3BQMB 5CDUA 2ECOA 4BY9E 1PR4A 2G08A 4ZYXA 1VECA 2V7WA 4OKIA 3OQ1A 5DYYA 3ISVA 5A4IS 5JZSA 2D0DA 3PJEA 2OHVA 1L4FA 2ZSIA 3E9CA 3AF1A 3V7NA 4PO3X 4FR2A 5JS1A 5ALSA 3CN7A 1J23A 1ESMA 5AVWA 1J1UA 3NVMB 1CUBA 1G4UR 3QKRA 2PSDA 1OV4A 4MW4A 4NH4A 1TO1E 4ROSA 5TQ2A 1Y9DA 5FL7D 3V4FA 1HE1C 5KINB 3PXBA 5CIQA 4P4LA 4EJFA 2FPOA 3EXIB 4EB0A 5DOZA 4IIHA 2I4OA 1MJGM 4HGOA 2XUAA 1MF7A 5E4JA 2ZB8A 1Q7BA 1CUZA 4AI6A 1EPUA 3LXMA 1GXSA 2BGUA 3BERA 4R8RA 1XYVA 1CRWG 2WSSD 5BYJA 3RRZA 5K3AA 3CVOA 4BUJA 3RANA 2W6IA 5DI9A 2JA2A 3H2YA 1V1RB 1QP7A 1CZNA 5C1DA 1RVV1 2ZJ8A 4UEJA 4TMZA 3AR5A 2JFVA 2Q6LA 1O5OA 1A76A 3BFXA 3CJRA 4R6WA 2JGAA 3LXXA 5AUOB 1AKRA 4RY2A 4Y2XA 4CV0A 1IHOA 3AB8A 3SSNA 2CHVA 3KJIA 5BN4B 1T4MA 1TCCA 1XIVA 2A1TR 4TKUB 4RLQA 1DPFA 4OYLA 3AK4A 1N4DA 5HOQA 2Z4SA 1MQ9A 521PA 4NYJQ 3VR4D 4AB1A 1AB6A 1YS1X 2AHRA 4DIEA 1IUNA 2DU8A 3LTNC 4RA6A 4QOEA 3BIFA 3JQAB 4KEAA 3GRPA 4H16A 3IDSA 5AW5A 4GYJA 4ASUD 3D4LA 4YRJA 2XYGA 2CUZA 4BU0A 5BQOA 3TI9A 1QRTA 5JECA 1FFXA 2P6MA 4DMKA 1JSRA 2PL3A 1GGEA 3JRNA 3S99A 2EC5A 4JP1A 1DUIA 1VKHA 1XB2A 3LLUA 3OCWA 1IYZA 1T3LA 1ZVMA 2OLKA 1QRRA 2HQ1A 4FKZA 1G2OA 4CETA 1BG6A 5FI3A 1KFJB 1M2OA 4TLCA 4ER6A 4XX0B 1N9ZA 1OF1A 4XQ0A 3K4QA 2WKWA 1O4WA 1FP7A 2Z2IA 4QVGA 4ROTA 4DRXA 5B6IA 3O1IC 2Z8ZA 1L7RA 5HIJA 1OX4A 1VBKA 3KALA 5F33A 4RMNA 4CFZA 1ISIA 2VUIB 3I6IA 4MWTA 2JIRA 1SXHA 1Z0AA 2BFBB 2IEDA 4REQA 4HN2A 1M1YA 2ZAIA 9ATCA 2B98A 3E5NA 3P26A 1MJGA 2CWWA 4YXWA 3Q9NA 1Y63A 2P1RA 3JASA 4F11A 3LA8A 1K9SA 5EQDA 2FN4A 2IHKA 1F3OA 4Q0MA 3EJ6A 4FWIB 1YA8A 3FM9A 4QODA 2VBFA 4Q1AA 3MG9A 4Q16A 2ODAA 1GM5A 2C2XA 4BV9A 4XVCA 5TIIA 1MN6A 2WA1A 4P54A 1Q0UA 3L7AA 4Y9TA 3VBCA 3EA4A 4IOLA 4WFQA 3AU9A 3EVEA 3SJ7A 5HIAA 3MB8A 2R7AA 3AHIA 1I2BA 3FY4A 3I5MA 3DOEA 1M8KA 3G85A 5KPDA 7MHTA 3B78A 1E0SA 1GNRA 2ZRDA 3I0NA 3HUEA 3KJQA 4G2NA 4M8NE 1Q7GA 2P41A 1M75A 4EQ6B 1FVXA 2K7ZA 2R96A 2Y68A 1GITA 2I65A 4KQ2A 4GLFA 1KQNA 3IUYA 1IHPA 1LPAB 5LQMA 2HRCA 3WDSA 2SHKA 4YA6A 4HFMA 3UKOA 5E6RA 4K6GA 3OIFA 2F90A 3DE3X 3BAZA 1XHEA 3ND8A 3QVLA 5EHQA 3C5HA 3JATA 5CXQA 4L7VA 1XQYA 1FTQA 3U4GA 1CZKA 1XKLA 2Q0HA 2XMBA 3F7NA 2ORWA 1YCGA 4UQPA 3H5NA 5EYPB 3D1VA 3OLXA 3C3MA 2HKIA 3QVSA 3U7QA 1RYDA 1H9BA 2KBEA 2PLAA 2QPOA 3BWVA 2QORA 3EXG2 4LRXA 3PCRB 3JARA 3FWYA 3PHHA 4U3JA 1L7XA 3D6AA 3GWGA 1L5SA 4BNNA 3RTCA 1G59A 1HT1E 5JJ5A 1B0AA 3FRHA 3GCZA 1INLA 3H86A 3PBKA 3LDFA 4G5FA 4MWSA 4PQRA 3HACA 2JKYA 3QFFA 3UGQA 4C0HA 4BFLA 3WGYA 4B48A 2VSYA 2PGJA 1FIUA 3LQYA 4H17A 1L5MA 4KFSA 4NCJA 4EVRA 5B2FA 1EXWA 4KAAA 3W8FA 3O92A 1GG8A 3JALB 1KIFA 4OFXA 1JZTA 3ITKA 3VKVA 3U60B 1JT9A 3EVBA 5HK8A 1G9TA 1OX6A 3O4JA 5AI9A 1A2KC 1KYZA 5JBIA 2R6GA 2P6OA 3D81A 1QYXA 2PH3A 2F4VB 3EC2A 1TF2A 3KJNA 4W82A 1QAMA 2WT9A 1DIBA 1VP9A 1EUCA 1Z6QA 2P9BA 3Q40A 4F9TA 3GMSA 1EP9A 1JG7A 1FDSA 5CFMA 4DNXA 1Z38A 4BP3A 1WX1A 2JB9A 2FH5B 4MR7A 4RTLA 3MRXA 3REQB 1HNNA 4BJ1A 3S1AA 3I5UA 3EXEB 1P74A 4UAJA 5BSMA 3SLRA 2Q0XA 5DTEA 3UH1A 3CW8X 1V1RA 2ST1A 2JGDB 3DDHA 4WMLA 4BBJA 1KEEB 5FTNA 4E21A 1FYXA 1ZD1A 2EP5A 1XNJA 4DJ5X 1B0PA 2EBWA 2OCKA 1TTPB 5CA1B 1DAIA 4JS0A 5LOVB 4QULA 1DOHA 4GZ5A 3O9ZA 3FNHA 4TKUA 1H2WA 1Y8CA 3V4LA 1C0PA 4JJAA 3ZU2A 3EARA 3AEKB 4EJSC 1C29B 5K5EA 4M7WA 1QCCA 2QR5A 5ALPA 2C0QA 4ZOQI 1G0OA 1I1OA 3OJEA 1T2AA 5ITVA 4FOTA 4IKOA 2ZZMA 2NAFA 2HV8A 2DBRA 3BVPA 1J99A 5WRFA 4B17A 1B3RA 1O6BA 1WEHA 4JBLA 1B16A 4N0QA 4N65A 1X39A 5J2UB 2Z1NA 4C07A 3R3YA 4J9VA 2HSDA 1U2ZA 1XZHA 5EXSA 2POQX 2PT6A 1CUUA 2QF7A 4K28A 3N58A 3TLKA 1G66A 4ZT2A 2VQFB 5CEJA 5ES4B 3GPIA 3ZE9A 2V7UA 5CA1F 1ISJA 1DC3A 3I2KA 3VMMA 1E1LA 1SXJC 5D7BA 1PV1A 1IZ7A 4DOMA 3ET4A 1X1AA 4PLHA 4FDTA 3A1DA 2DQKA 1L4BA 4QAJA 3FKSD 1KH1A 2ES4A 3A04A 5AO9A 4AZ0B 1VG0B 4HQKA 1W9MA 5LJLA 5AOBA 2D2IA 1P9OA 1REQB 3U17A 5BNZA 2IPMA 3ZWWA 2X0FA 4Q3EA 2YWJA 3KTOA 3OHSX 4DYHA 3QJYA 5JEDA 3T4EA 2F9FA 5TPWB 4ALIA 3BILA 1Y5IA 1ECGA 2FUKA 5J2UF 4BVBA 4UTZA 3BCHA 3KU4A 1RR6A 4JITA 3AHCA 4AY6A 4U2BA 1F17A 1YK0A 4HQNA 4N1AA 3ZWNA 2YY5A 2JJ2A 4N0MA 5K01A 1QHFA 3HL4A 4HLUC 4UVGA 3O21A 2FSHA 4J16C 4EKNB 2Y76A 4RMHA 5FWDA 2H51A 4ZU3A 3GLGE 1ZOIA 2WK1A 2PRYA 3SHVA 3A28A 2B1GA 3E3AA 4DY4A 2WWXA 3RYIB 3RB8A 3T7EA 1BMDA 4TZ6A 1YCFA 4YP5A 3OFVA 1F1BA 1T35A 1K75A 3L7KA 5FLEX 2Q6IA 3S7ZA 5JWRA 2ZWOA 1N6LA 5LN1A 2V6MA 3NTOA 4LE0A 3TLJA 4EQ6A 5B4UA 2FU5C 1M66A 2HNAA 4F60A 3P0JA 1OXUA 2IK8A 2BGIA 1C4WA 2JW5A 3IP5A 4DCSA 2VDOB 2PUCA 5HCNA 1AUOA 3K15A 4X5OA 4EGJA 4CL2A 5JRJA 5COQA 3K71B 4W99A 1WDLA 2ISCA 1PDVA 3ANNA 4GR9A 4HDNA 1IPHA 3GLGB 3U9SA 2GM4A 2EEZA 3UJDA 5ALUA 2EFCB 2Q3FA 4KHZA 4YJKA 3SJZA 4Z53A 4DBLC 2J0SA 2F3PA 4OY3A 4DR4B 1OFIA 1H4TA 3P27A 3CR7A 2Z3WA 4JT2A 4S0XA 2JF0A 2IEGA 3NU1A 4MW1A 1WXEA 2MSWA 1SHJA 3H17A 3IGFA 3OECA 4QUIA 13PKA 5B1DA 3S6JA 3ZHZA 4EKYA 1EHYA 4FWBA 1MO5A 2ZQZA 3INYA 2G82A 3UCXA 3OD5A 3WMGA 3M4YA 4D81A 2ZIZA 1YWGO 1BS2A 3KVVA 4URHA 1SXJE 1U02A 2GETA 2DFDA 2Q99A 4N5IX 5P21A 5SY9A 4D7AA 4EJSB 2G1UA 4JZYA 3WJ2A 1GT91 3K8ZA 1CERA 1LGYA 2FAXA 1MAAA 1NYLA 1QM5A 4AJIA 2G0AA 3CTMA 1T3GA 5AVQA 1RBZA 2AR9A 1NBMD 2H18A 3LNCA 3ZWOA 2A5DA 3BSYA 1CF9A 2WYUA 5EN4A 1A8UA 4Z0NA 1J2UA 4JWTA 3IURA 3R0IA 1XMJA 4IIGA 4L6CA 4YQYA 4NFLA 5KCMA 3TEMA 2PAFA 4DWOA 4EP1A 4CG3A 1VE6A 3BL8A 2MR5A 1KC1A 3FH0A 3FLEA 3JVVA 3OLYA 4JJ8A 5IYZB 3LX8A 3ZR4B 4RK7A 3REQA 1FFSA 1SXJB 1DJQA 3CH7A 1JLHA 4UE3S 3VC2A 2VRNA 4BXOA 3A27A 2C03A 3REGA 3O9VA 4JIGA 5BR7A 3ABRB 2BZGA 3H18A 4Y18A 4UTXA 2BL4A 5G1OA 5JANA 1TA9A 3IT2A 2YWHA 1P73A 1KAGA 2F8MA 4Z0HO 1GTJ1 2ID7A 3RS7A 3UB2A 5ER6A 1U0EA 4QOIA 2Z2XA 3A6LA 3L6DA 1CPYA 2O3SA 4JLUA 4K7JA 3KTDA 4RTQA 5CA1A 3TR5A 4HBGA 4LOAA 5LOVA 1CTQA 4ZREA 2Q27A 1V47A 3CO0S 2PE5A 3SIRA 4TS9A 1ESZA 4RS4A 1IG0A 3V4ZA 3SHWA 3GZJA 3G7SA 5IYZF 4NCAA 1F0YA 4FS8A 3VJMA 5KVSA 1TUEA 4CQNA 4GLJA 1ARZA 1BS1A 4C08A 1R4NB 1ZKMA 3QI7A 2ETXA 1OH7A 1SCUA 1UM9B 3PPXA 4N3CA 4RQUA 4XIIA 1APBA 2X42A 2I2AA 1KAEA 1ZK3A 4LOIA 3V00A 2W2QA 4DBLE 4FIZA 4LRTB 3GIWA 4N49A 3UHPA 3FBGA 5KYWB 4NP6A 1TYAE 1ZK0A 4NJOA 5AVSA 1EUZA 1F6WA 3V42A 2JASA 1UAGA 4RM2A 3ESQA 1VTKA 1GZVA 3W04A 3CIFA 1T13A 1ULZA 5ERYA 1URPA 2GEFA 2YMQA 3R8CA 5M7EA 5TQ0A 2PUGA 4YCJA 2QZJA 3TFWA 4BUCA 1GPDG 3NVAA 2XMZA 4AZ0A 3OLVA 2JAPA 4H60A 4KO4S 1MENA 1XVIA 3GJ0A 4TLEA 1XALA 3NIBA 1H1TA 1TL7C 1VB5A 2ONZA 2W11A 2XQJA 3EGIA 2Z5FA 4IX9A 4ZOLF 5CBPB 3UV6A 1PSWA 4G1MB 1BDMA 2AFVA 1KAOA 5AESA 4M83A 4R9NA 5I8PA 1ML3A 1O5IA 3HGQA 4IR7A 3DHWC 5IG2A 4R9SA 4OSEA 3CRNA 4P8RA 3TIGA 3QV1A 3A9WA 1UWLA 3TQFA 3W5VA 3KBBA 4Y9SA 3EWAA 1XAHA 3HBNA 4AF7A 1E3LA 2HAEA 4UE2A 4QPJC 4GX0A 1QQTA 4Y6RA 3MGAA 1NQAO 2IYAA 5GGYA 1L5NA 3RYIA 2WYWA 5L7WA 2JS7A 4E5VA 4P3OA 5J2TB 1UMCB 4LW8A 1FUUA 3ZE1B 4DWWA 3O83A 5JARA 4IZIA 4RLHA 1DC7A 4Y2GA 5FULA 1Z82A 4HFJA 3AETA 4O2AB 1Z45A 3IP7A 1RKVA 3ACCA 3A4NA 4M7OA 4TMVA 1O0BA 3OIWA 1LQTA 1HE5A 3HV2A 2FFBA 1SQ0A 1P0MA 1G5PA 1W7AA 1KVRA 2A9RA 1TQ2A 1P4JA 2E7ZA 3CPSA 4HRYA 1UBHS 4YRSA 3QY9A 1PSDA 4B3BA 2IU3A 3NM6B 3PFKA 5HCIA 5C4GB 3PHIA 2LGJA 4G01B 2Z2ZA 1GDDA 1NR1A 1ZG3A 5EVJA 4BL5A 3PSAA 4GXRA 5DXAA 2CNLA 1E62A 1W88B 3K6KA 3P0IA 2G6TA 4K1LA 1KMHB 1WDTA 3NORA 4ZD6A 1USIA 1RC8A 2EX4A 4KE6A 4YRDA 4IUBS 3OAAA 4C78A 1OOEA 3BXHA 3P45A 3UUFA 3OLQA 4F1JA 3TSYA 3AUFA 1K66A 1DI0A 1EJ6A 1CIVA 2ZBEA 3G2PA 2Q1SA 3L0IB 4O2AF 3A2KA 1FMTA 2ZRGA 2F1HA 2YV1A 3NKVA 4FGWA 1VJGA 4MUYA 1NN0A 5EY5B 2HA3A 3W5UA 4AJKA 1WTAA 4E22A 4FEGA 2FOIA 3FUWA 4NPCA 5GAJA 1KC3A 5AM0A 5B1EA 3I34X 2Z57A 1F51E 3AO0B 2UZAA 1LLQA 4Q39A 2QW1A 3SXUA 1KORA 1K4MA 1YR7A 3B38A 1SWWA 4RWEA 2C54A 2HLNA 4WXEA 3VOAA 4W8HA 1OCEA 1L4MA 2D0PB 2ZRJA 3LA6A 4L07A 1RAAA 1JR6A 2O5VA 4G81A 2MMCA 3ENZA 1UAYA 1HKHA 2FX2A 1TNDA 5EJ7A 2IYEA 2HZ7A 4EPWA 4BLSA 3F4KA 2IY7A 1G291 4IUCS 4AULA 4A0GA 1PYDA 2X5XA 2VCYA 3BX1A 4M9UA 2ZBRA 1H9AA 2PL5A 3H04A 1GGJA 2WIFA 3D0RA 3B3AA 1TX4B 3LUBA 2GZMA 3N2KB 3RU3A 1P5ZB 5MN4A 1YR2A 1KYXA 3SWWA 3RFFA 2GILA 4QT4A 1KEWA 2SKDA 1W1IA 2HO4A 3A11A 4INZA 3WIUA 1NAIA 3KBOA 2D5IA 2F1RA 1WCIA 1Z7EA 3MM4A 4LXYA 3CLHA 3G5AA 4I4LA 4EW3A 5BRNA 1PL8A 1IK4A 1J0CA 2K2WA 1KNXA 3DMHA 3QXXA 2W0SA 4DJDC 1GQQA 3GH1A 3TKAA 1KZ6A 1N0HA 5AUNB 4XOIA 2XOKD 3ABQB 3O94A 5ICGA 1D1PA 2ODNA 2JIMA 2HJ9A 2R1TA 2XSZA 1VHJA 5I9SA 3UGKA 4DV5B 3MT9A 3L8FA 4UEOA 4K5QA 3T9CA 3VJLA 1RWKA 3HO6A 4ZAZA 4HADA 2BHLA 1F12A 2VSXA 3V7FA 3BICA 3BMQA 1XFDA 5KQLA 3CLTC 1BCRA 4KIGA 1GSIA 4QNNA 1DTEA 4LJ7A 3MQ4A 3WGZA 1ONPA 2BEVA 3DKPA 1JQDA 3GR6A 4N6OA 1SQ5A 4JT8A 4QICA 1NX6A 3CX7A 3QJGA 4L28A 3CZQA 1MRNA 5AI4A 3BYZA 5E6SB 1PD0A 2EJWA 3EUWA 3WK4A 2OQIA 5LD2C 2WHQA 3LRTA 2GRAA 2H7XA 2NO7A 2WV7A 4OJNA 2IS2A 3C5CA 4WJLA 5HZMA 1L5ZA 1W2WB 3NVDA 4IZOA 2XNCA 1SY7A 2OWEA 3GH3A 1H4QA 3C3PA 4I4IA 4XASA 5EA2A 3T3PB 1JHMA 3FHCB 2AXEA 3T0GA 1MD9A 3N05A 3OBBA 1WXDA 4PO8A 5AK5A 5A3JA 3DL0A 1GGMA 1NW9B 2P5SA 4FYKA 1KP3A 2JIOA 4PCUA 4OH7A 5T3UA 3UF0A 2FE4A 2OA0A 4AMGA 3U4DA 4YALA 2WNIA 5TMBA 4OXXA 3SR3A 5I7RA 1SKBA 2IZZA 3F6RA 2WVJA 2P78A 1TEHA 5H4HA 3KYCB 1NRJB 1L7AA 1VPDA 4LRSB 3SF8B 2ZRPA 3VR2A 2DHCA 2WYIA 5JLAA 4EG4A 1XZKA 5TB5A 3BJMA 3TLZA 1TMGE 2ZBFA 2VYVA 1LV8A 3ANMA 1GG5A 3BL6A 3THRA 1GAWA 1G4AE 4LHYA 3RREA 2Q5OA 3MC1A 5J2TA 3AHJA 3CX6A 1PAUA 3BIXA 3LWZA 4J7CA 2BKUA 2WQZA 3PR1A 2PX4A 2DR0A 4OHVA 3WNZA 2YNMD 4RIEA 1CP2A 1ZNWA 4HQLA 5A0VA 5FPQA 4PYLA 4QRHA 2AZDA 3S7TA 1TK3A 2CW5A 1Z17A 3AZQA 2G63A 1WU7A 3LOPA 5IRCD 4E6EA 4I1UA 4DDWA 1RKXA 2G67A 5E38A 4ISCA 5J63A 1EJBA 2HPZA 4EPTA 5HX7A 3JYHA 3IAHA 3EF3A 4YAUA 4JQZA 5T4BA 2AN5A 4Y6GB 3M5CA 2C94A 3R7WB 2AVDA 2OZEA 4DXDA 5FWNA 2XMQA 4Z2YA 4MQEB 1KMQA 3LCJA 5DRTA 4KQFA 5BV1A 5IWCA 5BR8B 1O94C 2O5RA 4TSKA 1AQLA 2PO5A 3KZOA 3V33A 5BQPA 3ZDFA 4HAUA 1ABBA 2HEIA 3RYFA 1TTHA 1HWYA 4TLDA 1JG1A 2YXEA 3TLGB 2CV1A 5DX0A 4S1VA 3B7GA 1D1SA 3T4UA 2RGEA 4BLWA 4ETIA 5EJ6A 3HM9A 2QZPA 2HSEA 2IPAB 4KR9A 3IAFA 3O3NB 2AQ8A 5JQWA 1SK9A 4B83A 3LMKA 3EXG1 5ISMA 5AHRA 4ZQIA 1C7EA 2WAXA 1G3MA 1YUBA 3N1UA 4NYMQ 1VJ0A 4G8BA 5A3SA 1YS6A 2PZBA 4C0LA 4NZPA 2ODTX 3FNEA 3H5RA 3DG9A 2JFBA 2UZ1B 3LX6A 4J0KA 5TC4A 2PWAA 3FZEA 1N2GA 1H0HA 3LF1A 2Y6VA 2OKCA 2JFXA 3RSOA 4F71A 3V1LA 3HVHA 1VGRA 3T7DA 2QPTA 4OQNA 4FC6A 3CZ5A 1A71A 2RAPA 3DAYA 4FHDA 4PBSA 3EPJA 5LD2B 4JP8A 2P68A 2HX1A 3A26A 4UVEA 1F2TB 5KVAA 2W7TA 1D2GA 2FUG6 5AW4A 4RH1A 4NDNE 3ZNQA 3WZ2A 2PR7A 3K30A 1U7XA 1XLUA 4YRNA 3T1YB 1WDWB 1XZIA 2ZJ0A 3D8HA 3EFHA 4LJ8A 5C1BA 4V1CA 3KELA 1RMTA 4E3ZA 2VR1A 3LSTA 4PR0A 1S3IA 2P90A 1RLJA 4QQFA 5KDLA 3AF6A 1R9JA 1H8ED 1OI3A 2BGKA 2QQ0A 3QZUA 1NWCA 2DPLA 2I54A 3DL7A 4Y1GA 1U2SA 3FMPB 4J7UA 4QFCA 1NVMB 2AFIE 2G88A 4GXNA 1M6HA 4L5CA 1HM5A 4L9AA 4WL0A 1I0IA 2A0YA 6Q21A 1FNSA 2FGKA 4XR9A 3LC7O 1O8CA 4G0YA 3NOQA 3TSAA 3WYNA 5A03A 3AFOA 2WJZB 1AIPA 1XRJA 2R7MA 3FBTA 4YACA 5DBFA 4DG9A 5GVSA 3BGOS 2AYXA 2DCUA 4CF3A 4MEJA 5DMXA 4OGKA 1FMCA 4Q34A 1GYQA 3WDMA 4O59O 4A6EA 4ID9A 2X0IA 3CUKA 1B3BA 3E3OA 4EHNA 1RXUA 1ZD9A 2OV4A 3N9IA 2AFIB 4MGHA 4Z99A 5H68A 3I28A 2YUIA 2CLHB 3HJNA 3HV0A 2QUHA 3GNTA 2P11A 3A9SA 3MILA 4J1TA 1NVVR 2GUGA 1KQGA 2QQEA 3CMMA 4TYNA 1IONA 2EXXA 2D5BA 2ZB7A 1SM4A 1DB3A 5HMLA 4OQ4A 3NPMA 5GJVC 3O8CA 1WVIA 5AFSA 3IPLA 1Z56C 3OZBA 4DUPA 3S2EA 2AK2A 2QLFA 3KQWA 4AG6A 4CM3A 4AJ2A 4D4GA 5GY7A 4X64B 1GLVA 1FEZA 4DB4A 2PZ8A 2P79A 2Y3IA 3SQDA 4IO1A 4PV7A 3ZOZA 3FWHA 4G9GA 1Q0SA 4IDOA 2GYWA 4PPQA 4YFVA 4QBKA 1FFWA 4HS4A 3W2IA 3WLSA 1C0EA 5KO2A 1NN1A 3U0VA 1NRWA 1PE0A 4X3OA 4LF5B 5L4SA 1W85B 4LIPD 4BKQA 4ZT3A 8ATCA 1AURA 3WGJA 2RAUA 4BLPA 4BNKA 2ZUEA 1BGVA 2RB5A 4H18A 2R7KA 3ADPA 5FPTA 4LBWA 3NJ8A 4LGVA 3U7JA 1KH2A 4E5DA 1Z2OX 1ZM2A 2YWRA 3QIAA 1JECA 4I19A 4YP9A 3P9NA 1QVAA 4JI8B 4ZI5A 4C7BA 1G8SA 2R00C 4Y2QA 4I8DA 5GMOA 3D54D 1OBOA 3Q7IA 1ZOPA 2K4MA 4TS3A 1JSXA 2VP4A 1PGNA 2D4HA 5CVEA 4M7PA 2QTLA 1LU9A 4A3SA 5HILA 4Q4CA 1P9NA 1S8AA 2B9EA 3I0ZA 4Q3CA 1J9ZA 3NHLA 3NDRA 2EIXA 3JQ8A 3R4VA 2BP7A 1BFKA 4NPAA 2ZI9A 3K73O 5B58C 2AOTB 4HEA6 2ZTVA 3ANTA 4U7JA 3R7WA 5DM2A 2ZRLA 1GTVA 2Y27A 5FO0A 4NSNA 1H0RA 1Z4PX 4YJ3A 5CYFA 4TXMA 3V4OA 3GUCA 4U6QA 1ZH4A 1JXQA 4MKXA 4FB4A 5AXAA 2XNJA 1EX7A 4JEMA 2FFJA 5H81A 3SSMA 2HRZA 4UZSA 4H77A 4YQEA 1Y6JA 4KITB 3GJ8A 4UZEA 1DEXA 2GEJA 3UXEA 4OFWA 2I91A 3TLGA 1KK1A 2VPIA 2Z4RA 1QLHA 1VHLA 3GYBA 3QBJA 1PJ2A 4EKGA 1U6KA 2PS3A 2A1IA 2RJNA 4D9GA 5EJEA 3U44B 3R9XB 4S1PA 1B74A 2D1QA 2HA0A 1XROA 2XB8A 4GWKA 4M1WA 1Q6ZA 1ZZEA 3N5CA 4Q37A 4AMBA 4KWCA 2X1VA 1YA4A 1W0CA 1U04A 4S2UA 2AJCA 3ZBQA 1C0KA 4LDNA 4RY8A 1JSCA 4OQYA 4X6UA 3O8LA 1RI5A 3VVBA 4ON9A 4EITA 4MYHA 1VI2A 5D5HA 2PNJA 5EKDA 1I2MA 1OH8A 4NONA 3QEAZ 2B8TA 2DUWA 2AZMA 2PS1A 3KQOA 1JN0A 5KAMA 1LH0A 4N8EA 4RDXA 2EKZA 5IJ9A 4U2GA 4A15A 5DP2A 1F2TA 2A30A 2QYOA 3I9LA 2YKGA 2JAUA 4JI7B 1J2TA 1NXTA 1DC5A 1TK9A 1X0XA 1Z2EA 2JZOA 3H9EO 4JT4A 3PA6A 1YR1A 3OBIA 4JLSA 4CM8B 4LZLA 3KWJA 2XRFA 5TR9A 4UVDA 3WLQA 5JIBA 4CUJA 4ZOEA 3T9AA 3K32A 1GRCA 2H5JA 3OX3A 4R1TA 4XRGA 4H4EA 4ZVSA 4WT7A 5NULA 2F59A 4KYTA 5FFNA 4GM1A 1MC5A 2B1JA 3LW7A 1DG1G 2OY0A 2ZSFA 3VSBA 3D3KA 4U7PB 2C2GA 1GJRA 2VAPA 2IOQA 1I4LD 1G19A 1MIOB 2ENUA 2I4RA 3KL2A 4L4UA 2JIQA 4OXRA 4JX9A 4CYMA 1GPLA 5E4YA 1OH6A 1IB0A 4J94A 4N40A 3P96A 1CY6A 3NC0C 1NP6A 3KFLA 4RQTA 3T8YA 3VKHA 5LBTA 1KS2A 2HIMA 4DMFA 3K1JA 1CVIA 4BB5A 1FVOA 2YCBA 3GP3A 2FPIB 3UXMA 1KJWA 4JJEA 1H6BA 4A8PA 2EQ5A 4RF2A 4Y98A 2ZQYA 2H4ZA 1YQGA 2QGNA 4C4TA 721PA 1FMJA 4Y1FA 1WUKS 2DHDA 2KBFA 4BHTA 2ZTSA 3U5ZB 1DAHA 3G9XA 1ISHA 3NYRA 4FFRA 1PYOA 4TLAA 1VYVA 3DO8A 1XD2B 2V96A 5ALXA 5LYJB 1PL6A 3JYNA 4KACA 1SHTX 1SCKA 1T9DA 1W75A 3OTHA 4GXQA 3W0LB 4ITVA 3VH4A 2IH2A 1SHUX 3GEPA 5JWHA 2O0HA 5LKRA 1J70A 3IDZA 4GSLA 1JAHA 1XRLA 1Q20A 2NM0A 5ALQA 5EQFA 1FCJA 1O94A 1R6UA 4EPVA 2MCFA 4ZGBA 1LRKA 1L7MA 1QTQA 5HFJA 2NZYA 2PTGA 2CXUA 1RYFA 2GZRA 3DBIA 4OKNA 4FMCB 5ITZA 1T36B 3TRKA 1KJJA 4NBUA 5BNTA 2QDKA 1PFVA 3IHLA 4YRTA 3T9EA 3KDAA 1GFZA 1UDBA 3VOSA 1X3SA 2YS7A 3EDYA 4IMIB 5LYJF 1V4BA 4MICA 3I6MA 1WWKA 4A8HA 2OO7A 5JSQA 4L73A 2FX5A 3G8DA 3N0WA 5HOEA 4D9NA 2FEAA 5CK4A 4Q7EA 5EJMA 3R09A 2J0UB 5JSZA 1KAHA 3A6KA 2PZAA 3M33A 5CFQA 2Z95A 3GG9A 1M5RA 2YBDA 5EUCA 4M53A 2HSJA 4PNPA 2OCGA 3FPLA 3G6WA 4X7PA 4ZYLA 1FFBA 2PU5A 4A5OA 5HR5A 2GCOA 2YV2A 1XZDA 4PIMA 1QIKA 4LGYA 1GNSA 3FFAA 3IB6A 3ZE6A 1ETUA 4FMCF 3I39X 2X8LA 1WB5A 1U31A 4UAUA 3NBQA 1OYWA 4W5WA 1KKLA 3RKSA 1U7PA 3BCUA 2RHRA 3QPVA 4ND6A 2IYQA 4PXAA 5AI8A 2O8BA 5KSWB 4OQFA 2A5LA 2EDCA 1TO6A 4KR3A 1XVLA 2OTCA 3QYFA 4NYJR 5JALA 1AXRA 1N6KA 2HTEA 1PRYA 3HDJA 2I1QA 1XPUA 5AJXA 1ZU5A 1H6DA 4OHUA 5AMXA 4AP9A 4Z2AA 1H9CA 1LBHA 5CLFA 1UINA 1SUCA 1E59A 3ZWXA 4AKSA 2IV7A 4AMVA 3E58A 3CVXA 4AWXA 4B3RB 3R9XA 2GTHA 5F78A 4BZQA 2MT9A 3CWQA 4R2JA 4XCVA 3OT1B 2ACEA 2GBGA 4MJXA 1YXMA 1ZUNB 4K3UA 1RRGA 3GWZA 2XNDD 1DJOA 4RZXA 2PT5A 3FZNA 2E4AA 1AQYA 2Y93A 5A4MS 2VZ0A 1I94B 2VAXA 5TMEA 4Q7LA 1UUFA 5CB0A 3UT0A 4NOJA 2WTBA 4DIMA 4WXRA 4I3HA 2FMTA 1PD1A 3CFYA 2BBTA 2MSCB 5BT8A 2BLLA 1IBCA 1CR4A 1FMLA 1ZGAA 2JFHA 1QGZA 1JVNA 2LPMA 3SJUA 2XTMA 4CR6A 4BV3A 1ISRA 2OMKA 4BTEA 3PFBA 4CM8A 4BDSA 5HS4A 3J81k 4Y0AA 4P0TA 4B6RA 2JRCA 4ES6A 2BTEA 1LWOA 3NO4A 5C53B 1T9GS 1HFEL 1JTEA 2CUNA 4C3UA 3R6DA 1H8HA 4COKA 3OD1A 1KU0A 1IIBA 5LR6A 4J0EA 1N1GA 4YMGA 3CH4B 4BVJA 1UPUA 3ECAA 1G8MA 1J9GA 3HHEA 2G76A 2YX1A 1MIOA 1CEYA 3ZY5A 5CPBA 4U2DA 4HFRA 3WYDA 2ZZNA 2WJIA 4M21A 4RXUA 4TRJA 1A8HA 5CDGA 3ITEA 1QV9A 3H8JA 1W4LA 1Y3AA 2A4KA 2AR0A 2B78A 5GJCA 3L4JA 4DV2B 1Q0RA 1X7WB 1NI5A 4AIRA 4DV7B 5KVVA 3UWKA 3A31A 2YJ6A 1K6IA 3NBFA 4X1KB 5JY1A 3L8HA 2YW9A 1X77A 3J80A 4FBMA 4F3RA 4OGWA 1L0BA 1SEVA 1JEAA 1DKRA 1M5UA 2WT4A 1TQDA 2W6ID 2YC2C 3AVXA 3QPCA 3A1FA 1I2ZA 4I5GA 4RD1A 1QHHA 5T7BA 5D3ZA 1DMRA 5A6VA 1R6TA 2PZEA 2UYQA 4QYTA 3ZQ4A 1U2GA 3QBEA 3WB9A 4DLXA 3PYMA 5K6AC 2PSJA 5AYVA 5DTJA 1KJ9A 3ZLBA 5ESDA 3BA1A 4KLAA 5EE5B 2HYDA 3VVMA 4GT1A 5KWJA 3FMVA 1AKUA 4E70A 1D8TA 4LX0A 4WI1A 1IJBA 3F5SA 3K2EA 2ZBQA 1WZ2A 1BX3A 1YONA 3GA0A 5MGNA 4ZCPA 4R1SA 3HDYA 1C9JA 5FTMA 3CC8A 3E4DA 3JZIA 4JC8A 4C4SA 1RZRA 3QH4A 1O6GA 3EVDA 2AJLI 1Z6ZA 4JB8A 4ZVTA 4D4MA 1WPQA 2FYTA 3LUAA 1J2YA 4E08A 3ANLA 2GD6A 4K2AA 1CQIB 2AA3A 3I2JA 1Y89A 4HDMB 4IMJB 3AINA 4WERA 5CLGA 1B8UA 2IEAA 2Q3MA 3N2LA 1TD1A 4IXNA 4GI7A 4O0MA 4RAQA 2WINI 1Z13A 2R1VB 4Q82A 4YWHA 5BUZA 1U0FA 2PUBA 1POXA 3CRMA 1MNAA 2IQIA 4DNQA 4DV1B 6LDHA 4FDAA 1IXKA 1SR8A 2ILVA 2ZDHA 4GO1A 5ALTA 3OE7A 2L19A 3I2IA 1WW3A 3CF4A 1K86A 3KOMA 1NMYA 3H5LA 4IHJF 3WK9A 1I7LA 2O59A 1SVUA 4BQRA 5E3IA 4KAJA 4Q3OA 2PBFA 3QMVA 1YHZA 3WIBA 1THGA 1JWLA 1N36B 2ZI4A 2HBRA 2G17A 3RM3A 4YXWD 2L2QA 4J2TA 4RL6A 2IHVA 3W8EA 1W1UA 4YR9A 1CE8A 1UAAA 4H35A 4YCDA 3SDSA 4ARZB 1E5XA 2CK3A 3UAGA 5CG2A 3RJTA 1YDFA 1JA1A 2RB4A 4C6RA 1I3NA 1DSSG 4FCTA 4TTJA 4D6YA 1T0UA 4I36A 4OLAA 3PXGA 2I9KA 1PL7A 2HBQA 3PD0A 5FL3A 3EFEA 2PZKA 1YRAA 5CH3A 2P9EA 1K88A 1DWUA 2NAPA 3L5OA 4GKBA 4DSOA 4HWRA 2F3UA 1W2HA 1KI1A 3AKYA 2B30A 4TTAA 2R4QA 3AY0A 3OT1A 4QU5A 1DIGA 1JUDA 3ETLA 1QH1B 2NVUB 1ZUNA 3DOFA 4MARA 3U3OA 2X7XA 1LWNA 4QZVA 1I9GA 5AKEA 2M6LA 3N0XA 4I55B 1FSFA 2AC2A 1EBBA 4WOBA 1AQUA 2C2HA 3O8QB 4GZ3A 3T54A 3V7YA 3ES9A 1XZEA 1VSVA 4U00A 5B7NA 4DJJA 1F4LA 1ESDA 3CZRA 4MVWA 4H7JA 3VR3A 3ZNOA 3KKKA 3CNBA 2VRWA 3AP3A 3OFNA 1PEYA 3K1AB 3ZLUA 3N0VA 4RGQA 2HH9A 1TDJA 1Y7HA 2ZYVX 1Q95A 3CT4A 3N59A 4NR0A 4WJZA 1N7HA 4K8RB 4N54A 5DISB 2Z1DA 4RANA 1YQTA 3DLIA 3GC6A 3B1XA 3PT5A 1U0NA 1OFGA 1T10A 1XLVA 2IRWA 2JLSA 3NP7A 1OWOA 1E7WA 1Y81A 4G8CA 3M82A 4TXHA 2REXB 4BTVA 3FTEA 2F4NA 1QIIA 1QMGA 2FPXA 4LF7B 2W4IA 2XWPA 4WAUA 2WQ6A