4IRWA

Co-crystallization of streptavidin-biotin complex with a lanthanide-ligand complex gives rise to a novel crystal form
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
123
structure length
123
Chain Sequence
b'GAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Co-crystallization of streptavidin-biotin complex with a lanthanide-ligand complex gives rise to a novel crystal form
rcsb
source organism Streptomyces avidinii
molecule tags Biotin binding protein
total genus 28
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 4irwA00
2C4IA 2A5BA 3PK2A 4Z28A 4JNJA 3VHIA 4BX6A 4OKAA 2G5LA 3SZIA 3RDUA 3RDSA 3VHHA 1NC9A 1SLDB 1LCVA 1SRFA 1IJ8A 1VWLB 2RTBB 2RTRB 2FHNX 5IRWA 1SRIA 1RXKA 3WZQA 3WZNA 2GH7A 2IZJA 2C1SA 2IZKA 5K67A 1VWMB 1SREA 4CPHB 1SWQA 4GD9A 2BC3A 4CPEA 1Y52X 1HQQA 2AVIA 1Y55X 3T2XA 1SWFA 1VWKB 4IRWA 4Z6JA 4BJ8A 1SWSA 2RTHB 1STSB 2RTLA 1SWCA 3RE5A 1NQMA 1RXJA 4GGRA 2A8GA 1STRB 4DNEA 3SZHA 2RTEB 3VHMA 3WYQA 1SWJA 2RTOB 1KL4A 1SWBA 2CAMA 1VWEB 2RTJA 2IZIA 1HXLA 1AVEA 1LDQA 3WZOA 1N9MA 1RAVA 1HXZA 1LCZA 1VYOA 1Y53X 1MEPA 2OF9A 4BX6B 4Z2VA 2JGSA 2UYWA 3T6LA 3WYPA 1VWGB 4EKVA 4I60A 1RXHA 1SWLA 1KL3A 1VWCB 3RDQA 3RE6A 2ZSCA 3X00A 1KL5A 3MM0A 1SWDA 2Y3EA 5CSEA 1LUQA 5F2BA 1NDJA 1LELA 1VWBB 1WBIA 4Z2PA 5K68A 3T6FA 1MK5A 3RDOA 2IZHB 2F01A 4U46A 4GDAA 1SRJA 2IZLB 2RTCB 1DF8A 1SRHA 2IZBA 3RY1A 1VWPB 3EW2A 4JHQA 1VWQB 1SWUA 1VWNB 1SRGA 2OF8A 3RY2A 1N43A 3VGWA 3WZPA 1LCWA 4BX5A 1PTSA 4BBOA 4GJSA 1SWOA 2RTMA 5IRAA 1VWRB 4GGTA 5CHKA 4GGZA 4Y59A 2RTQB 4CPFA 2RTIB 3SZJA 4Z2OA 4YVBA 1VWHB 5L3YA 1SLEB 1VWAB 2UZ2A 2RTPB 2RTAA 1SWEA 1HY2A 1SLGB 2IZCB 2RTNB 2QCBA 1VWFB 3RDXA 4BCSA 1VWIB 1SWPA 1AVDA 2C1QA 2IZEB 1SWAA 2FHLA 3MG5A 4Y5DA 1VWDB 3FDCA 1MM9A 4CPHA 1N7YA 5JD2A 1SWKA 4Z27A 1NBXA 1SLFB 2IZAA 2RTDB 3RDMA 1SWGA 4GJVA 1I9HA 2OFBA 2WPUA 1STPA 5IRUA 1SWRA 3T2WA 2MF6A 1VWOB 2RTFB 1SWNA 1VWJB 5B5GA 1N9YA 2IZGB 2IZDB 1LDOA 1KFFA 2RTKA 4BX7A 1MOYA 1SWHA 2RTGB 3EW1A 2Y3FA 4BX5B 5B5FA 2IZFB 1N4JA 2OFAA 1RSTB 4CPIA 2Y32A 1NQNA 1RSUB 4JO6A 1SWTA 4BX7B 2A5CA
chains in the Genus database with same CATH superfamily
3FR2A 1YWAA 2C4IA 4O3XB 3DSZA 2L67A 3PK2A 5DPQA 3VHIA 1W4TA 1VYGA 2WQAE 2KD2A 1KT3A 1ZNHA 3MVFA 3NBXX 1FEMA 1I06A 4XMGA 2CM4A 2YG2A 3HWDA 4IMNA 2JU3A 2VFCA 4XMCA 1YIVA 1QFTA 1QQSA 4YH0A 5AJBA 5D4AA 1BJ7A 1LCVA 2OL6O 3O2YA 1NP1A 4HPBA 1JYDA 1NGLA 4QRLA 4Y0PA 2FHNX 4AZMA 5D8JA 2JW1A 2FTBA 1OEEA 2LB6A 2WR6A 2IZJA 3ZUOA 5BVTA 2IZKA 1ERXA 3ZUIA 1LF7A 3HTYA 5EZ2A 4GETA 2K62A 2LBAA 4ZR2A 3VG6A 1Y55X 5HCEC 5K06A 2QO5A 4Z6JA 1A57A 3B2JA 2X32A 4WHIA 3RDSA 4I95A 2A8GA 1STRB 5LKFA 1GGLA 3SZHA 3KFHA 1Y9LA 3T1DA 2FS6A 1DZJA 2FR3A 2RTOB 3B2HA 4CSBA 3TGCA 1KL4A 2IFBA 1VWEB 2RTJA 3OJYC 1A18A 4MVLA 4NLJA 1GT1A 3FYFA 4ON1A 2KTSA 2FGSA 1CRBA 1NP4A 1CBIA 1KT5A 2DJGA 2OL7A 3HPEA 3PH6A 4LKTA 5HA1A 4A1HA 4Z2VA 4KC8A 2WEXA 3MX7A 1QY1A 1RXHA 4KT5A 1IW2A 1OPBA 4I6SA 4YMYA 5HCDC 3MM0A 5JR8A 3BS2A 2JOZA 5H9NA 4ZCBA 3GAQA 1LPJA 5HZ5A 5B11O 1CBRA 1S2PA 1MK5A 5EDBA 5KIDA 3T6FA 2QOMA 1GX3A 1HBPA 2F01A 2AT0X 2KT4B 4U46A 1EIOA 2IZLB 2RTCB 1PBYA 2MM3A 2WUTA 2L68A 2IZBA 1E00A 2FLJA 3QKGA 1D3SA 1W5RA 3EW2A 1O1UA 4AYHA 3CKFA 1MVGA 5AEOA 2GJ5A 3RSWA 4QAEA 3RY2A 4IAWA 1N43A 3VGWA 4BX5A 1OPAA 1X8NA 3NQKA 4L1NA 4PJ2A 3STMX 3U9PC 4CDDA 5HZ9A 4GJSA 3VPJE 1BLRA 2OY7A 4BOEA 1B0OA 2AT5X 5IRAA 1VWRB 1AB0A 1JV4A 2X56A 1LIBA 1B56A 4XMHA 4QGVA 3P6FA 2LA7A 3WJEA 1JBHA 2NNDA 3NX2A 1QY2A 4YVBA 5IO6A 3AKNA 3JS1A 4TKJA 1E5PA 3FA8A 1SWEA 3UEVA 3CBSA 5AJCA 3ZW0B 2OVAA 5CYBA 2OYBO 1AELA 5LKEA 1SY2A 1VWIB 1SWPA 2A13A 1AVDA 3IFBA 4O3ZA 4BCSA 4Y5DA 3WJDA 1LIFA 3BRNA 2BT9A 1SLFB 2RTDB 1SWGA 4GJVA 5B10O 3MBTA 2WPUA 3QQ2A 1SWRA 5IRUA 2MF6A 1VWOB 4TKBA 1SWNA 5HTEA 3H3IA 1JJJA 3APUA 1KFFA 2RTKA 4IB9A 4HPDA 2MO5A 2RTGB 3KVNA 1LKEA 1KT4A 2Z4HA 3PECA 2QM9A 2OL8O 4B55A 4ZJ0A 1XKIA 2A0AA 1K24A 2OFAA 1RSTB 3FELA 4CDFA 2X55A 4CPIA 4CV7A 2X4MA 4CDEA 4JO6A 5HZ6A 5LJHA 1U17A 3ZW1A 4LZVA 3VG5A 4Z28A 4I9SA 4FQBB 2L5PA 3FW5A 3SZIA 3RDUA 4LKPA 3APXA 3VHHA 1NC9A 2R74A 3V8UA 3BLGA 4WFUA 2NNEA 5C0NA 3TGAA 4YKOA 3F9DA 4NYQA 4ORSA 1GX8A 3F6ZB 1SY1A 4QGXA 3VE2A 4QYPA 1ZNGA 4ZHDA 1KQXA 1U0XA 1RXKA 1ADLA 2RCTA 4MVIA 3WZQA 1X8UA 3U0DA 3FENA 3AUMO 3ZW2A 4C5PA 4O9SA 4ORXA 2GTLO 3TZSA 4IB7A 1SWQA 1OBPA 2BC3A 2JU7A 1QY0A 2AVIA 5HZ8A 4HWMA 5B3MO 4YKMA 4BJ8A 2RTHB 1BM5A 2X46A 2RTLA 1HMSA 1AVGI 3RE5A 3STKA 1RXJA 2A3FX 3P6GA 3FMZA 2GTLN 1IFBA 3AKMA 5D45A 3VHMA 4COTA 4DNEA 4DQ4A 4EQAC 1Y9TA 1QWDA 4U8UN 4ZHFA 1O8VA 1U18A 1AVEA 3UEXA 3CQNA 1E02A 1N9MA 2QOSC 3C76X 1VYOA 1DC9A 1MEPA 1T68X 3D4RA 3VU1A 3FEPA 3F8AA 2Q2PA 3JQOA 2YMSA 2HYSA 3BDRA 1SY3A 3T6LA 3FA6A 3P6DA 3WYPA 2Q4NA 3FA9A 1ZNKA 1YWDA 4AZPA 1VWCB 1VYFA 5B27A 1DFVA 1E2TA 4YGGA 3P24A 1JYJA 1KL5A 3CR6A 3BX7A 1SWDA 3Q6LA 5HA0A 4IMOA 3ZW0A 1EW3A 1LUQA 3FR5A 1R0UA 5F2BA 1OBUA 1PBOA 1GM6A 1WBIA 1SMPI 2VFBA 2WEWA 4I3CA 5BVSA 1KZWA 3TF6A 2FRSA 2IZHB 5FENA 5HWZA 4R0BA 3O22A 3LTWA 4QZTA 1HBQA 1CJ5A 1MUPA 5LJDA 2R73A 1H91A 2GTLM 2OFRX 4I3BA 4JHQA 2AH7X 4GNYA 3P6EA 1SWUA 5HAEA 3SLOA 4NNSA 2OFMX 4U8UM 2QO4A 1ZNLA 4OMWA 3KFGA 4YBPA 2X34A 3NQ9A 1PTSA 1BEBA 1UZ2X 4ALBA 1T0VA 3NQ3A 2OY8A 4GKCA 4BBOA 1SWOA 4CK4A 1KT6A 2BHVA 5CE4A 1EQDA 4DCBA 3ZI8A 4TJZA 2X8SA 2Q9SA 4IBAA 2ACPX 4CPFA 2RTIB 2CZTA 4EDEA 4AZOA 4Z2OA 5BVQA 2N93A 4NLIA 4OS0A 4LZUA 4O3YA 5F7GA 3UAQA 5L3YA 4IB8A 2R56A 1G5WA 4YDBA 1CBQA 1HY2A 2DJFA 2IZCB 4O4SA 2RTNB 4GH7A 4U3QA 5IXGA 1DF3A 3RDXA 4N7DA 1G7NA 2NNQA 3PPTA 5LJBA 3MG5A 1SWAA 1UYOX 3FDCA 1MM9A 2BSZA 3D97A 5JD2A 4Z27A 5BYPA 4YDAA 5L8NA 3JSQA 2IZAA 1FENA 3NR3A 1I9HA 1Z24A 4ORWA 1STPA 3WJCA 4EXZA 4XMEA 1Y0GA 1N9YA 3ZZVA 1EIIA 2IZGB 1JZUA 2IZDB 1LDOA 1ZNEA 3P6CA 4AW8A 3WJBA 3FW4A 3VG7A 1SWHA 3EW1A 1S44A 4NP1A 1MX7A 2HZQA 2AKQA 5F58A 1N4JA 2Y32A 1NQNA 1SY0A 1LFOA 2I5VO 2ZAIA 1LNMA 4YFQA 4BX7B 4YGHA 5LJKA 4OS8A 5F6BA 4JNJA 3WVMA 3L4RA 2G5LA 3HOEA 4BVMA 3IA8A 4ZGFA 1X89A 1TXLA 1P6PA 1SXWA 3STNA 4YBUA 3PEDA 1VWLB 2RTRB 5IRWA 3CWKA 1BSYA 1IFCA 1QABE 3BY0A 4MISA 2HNXA 3D9WA 1L6MA 4YGZA 5FQ8E 1KT7A 4GDZA 4GE1A 2E4JA 3WOVA 5K67A 1HMTA 1VWMB 4EFGA 3U03A 2W2FA 5IO5A 1Y52X 3VG4A 1G74A 3T2XA 1SWFA 2HZRA 4IB6A 4IRWA 4IAXA 4A1YA 4ZGUA 2HMBA 1ICNA 5F1EA 1STSB 1YP6A 4TLJA 5B2AO 1LIDA 2HLVA 1NQMA 3PQSA 2AT8X 1EI5A 1KOIA 1GT4A 4BQUA 2I5ZO 1JJUA 4Y0RA 1SWJA 1LICA 1RBPA 2XSTA 3Q34A 1TW4A 4ODDA 2X45A 1SWBA 2W2BA 2CAMA 2OVDA 1IKEA 1HXLA 4NV8A 1LDQA 1GT3A 1B8EA 1I04A 3BU1A 3EBKA 4GRJA 2MHDA 1GXAA 3C78X 3P02A 3D95A 1HXZA 1LCZA 1GKAB 5B29A 1W6FA 3BX8A 4O3WA 3EC5A 3FIDA 4HFOA 4BX6B 2JGSA 2UYWA 1FELA 3RWXA 5FAZA 1VWGB 2CBRA 1DV9A 4EKVA 1X8OA 1EUOA 1PMPA 3B2KA 2F09A 3RDQA 4TQ2A 4Y0SA 4ZFXA 5HTDA 1AQBA 4FBVA 2Y3EA 2OY5O 1I78A 4CDCA 5IO7A 5LJEA 4GNWA 4U8UO 1VWBB 4Z2PA 3AEHA 4RUNA 3FA7A 1D2UA 2KTDA 3K3LA 4DQ3A 1HQPA 2RCQA 4GDAA 1FJ1E 2OVEA 1DF8A 1DZPA 1MDCA 1HN2A 1SRHA 2NP1A 1VWPB 3RY1A 3SLJA 3WJFA 2ZAGA 4HPCA 4TNNA 3BSZE 4ALOA 4AZQA 1O1VA 4KC7A 1YWBA 2ACOA 3WZPA 1OEJA 1XCAA 1GT5A 1SXYA 2CBSA 3S60A 2L9CA 3D96A 1KQWA 2RTMA 1K3BA 3KZAA 2X8FA 2A2GA 2PY1A 2WWPA 5D48A 4U9CA 3CQRA 3LHNA 1B4MA 4HPAA 5H8TA 5LJGA 4GGTA 5CHKA 1ERBA 3CKGA 4O4UA 4Y59A 2Q39A 4O49A 1IKJA 2G79A 1LIEA 3SZJA 3B2IA 1E06A 2GTFX 3NADA 1YP7A 2PI3O 3B2LA 4AZRA 5KICA 1G85A 1VWAB 2ALLX 2RTPB 5AQ6A 2FKGA 5L8OA 2RTAA 4GZVA 4ORRA 1SLGB 5HCCC 1OSPO 2QCBA 3NP1A 2WQ9A 3CBCA 4A60A 1VWFB 3FR4A 3EYCA 2CM9A 2C1QA 4ORYA 2FS7A 4GK9A 1VWDB 1BSQA 1X71A 1N7YA 2G78A 3DTQA 3EBWA 1NBXA 4ARHA 1OBQA 1JQPA 2O62A 3RBYA 2OFBA 3WJGA 2HKDA 3OD9A 4GU8A 2AT6X 3T2WA 3WBGA 2X8TA 4IABA 4YCEA 2W2AA 2A2UA 4OMXA 2RD7C 3S5XA 1EALA 2FWVA 1MOYA 4D6AA 3SLTA 5B5FA 4ID2A 4UU2A 1KGLA 1KXOA 3WZOA 4PSQA 1BRQA 2BS6A 2P8GA 2ANSA 3FEKA 4NNTA 1RSUB 1UREA 1SWTA 4I9RA 1GKAA 1YWCA 2A5CA 3APVA 4K19A 4Y0QA 2A5BA 3PQUA 4ES7A 4ZHGA 4BX6A 4OKAA 3ZWEA 1SLDB 1SA8A 5LJCA 1SRFA 3ZW1B 1IJ8A 2RTBB 2RA6A 2RN4A 4O4OA 4TKHA 2QMIA 1SRIA 3WZNA 2GH7A 4ML7B 3WXQA 4KCAA 1ZNDA 2C1SA 4OS3A 4FGIB 1EPAA 3FLLA 1SREA 1I4UA 4I3DA 5D47A 4INNA 4GD9A 3I17A 5DG4A 3RKGA 4KH8A 3S26A 1HQQA 1X8QA 1OEKA 1VWKB 3EM0A 3LV4A 3PDFA 4EEJA 1SWSA 2JN3A 1SWCA 5F6ZA 4GGRA 3P6HA 2POAA 3BU9A 1TOWA 5FQ6E 1N0SA 3WYQA 2RTEB 1RLBE 3VG2A 1HMRA 2AMMX 4MVKA 5EEDA 1I05A 4ORUA 4ZH6A 5L8IA 4CPHB 2IZIA 4AZNA 4YFRA 1RAVA 5HBSA 1Y53X 2OF9A 3GE2A 3VE1A 1KZXA 1A3YA 3HWEA 3RZYA 2RQ0A 4WFVA 1DZKA 1EXSA 3ELXA 2OVSA 2FR2A 4I60A 1SWLA 1KL3A 3RE6A 3X00A 2ZSCA 4QNIA 3PP6A 3NPOA 1DZMA 1X8PA 3APWA 4M7MA 5FFHA 1BRPA 1GX9A 5CSEA 1NDJA 1LELA 1CBSA 3HK1A 4ZH9A 2MJIA 2BS5A 4NYRA 5K68A 1PEEA 4M6SA 1A2DA 3RDOA 1SXXA 3SAOA 4MIRA 1QG5A 2F73A 4GUZA 4QYNA 4WBKA 2BLGA 1SRJA 2DM5A 1QFVA 2FT9A 2Q2MA 4O4XA 1MX8A 3E3CA 1ML7A 4LQZA 1BWYA 2WSJA 5HZQA 5KHPA 1VWQB 2LFOA 1TOUA 1VWNB 1SRGA 5H9KA 2OF8A 4L3RA 2ASNX 4D6BA 1JIWI 3I0AA 2OZQA 2XKLA 1LCWA 1ALBA 1WUBA 5H9LA 5H9AA 3EMMA 1FDQA 4KIIA 3ELZA 1BBPA 1VPRA 2G7BA 2OY1O 3HOLA 3O19A 4QGWA 2EU7X 4UU3A 2MWHA 3OBLA 2Z4IA 4MEEA 4QQ1A 1ICMA 4GGZA 2FKJA 1PM1X 5EPQA 1S7DA 1T8VA 2RTQB 4YFPA 2JU8A 2K23A 3KQ0A 2VDFA 1VWHB 3UEUA 4ZHHA 4JGLA 1SLEB 1TVQA 2M4LA 2UZ2A 3KFFA 4NV7A 4RUUA 3NX1A 4NW4A 2CZUA 4XMDA 4FBOA 4YCHA 3UEWA 3PH5A 1IIUA 4XMFA 4OELA 1ACDA 4OEMA 3KFIA 3OE3A 1EPBA 2IZEB 3VG3A 2FHLA 2GC9A 1SXUA 3ZQ3A 4CPHA 1BSOA 3SOTA 1FTPA 1SWKA 2JMBA 2QO6A 5EEEA 2KW1A 4MVEA 3RDMA 3FIQA 4N7CA 4ZHCA 2LBVA 2RTFB 2AT3X 4QZUA 1VWJB 5B5GA 2LKKA 3C77X 1JMZA 5EDCA 1UYNX 4BX7A 1YUPA 2AF5A 4BGFA 1FE3A 2Y3FA 4BX5B 3N91A 3S5VA 2AL0X 3TGBA 1JMXA 2IZFB 3HWGA 5FQ7E 4A8ZA 3HWFA 4FBRA 3CMPA 1JJXA 1ZRYA 4CPEA 3G7XA 2G8CO
chains in the Genus database with same CATH topology
2C4IA 2A5BA 3PK2A 4Z28A 4JNJA 3VHIA 4BX6A 4OKAA 2G5LA 3SZIA 3RDUA 3RDSA 3VHHA 1NC9A 1SLDB 1LCVA 1SRFA 1IJ8A 1VWLB 2RTBB 2RTRB 2FHNX 5IRWA 1SRIA 1RXKA 3WZQA 3WZNA 2GH7A 2IZJA 2C1SA 2IZKA 5K67A 1VWMB 1SREA 4CPHB 1SWQA 4GD9A 2BC3A 4CPEA 1Y52X 1HQQA 2AVIA 1Y55X 3T2XA 1SWFA 1VWKB 4IRWA 4Z6JA 4BJ8A 1SWSA 2RTHB 1STSB 2RTLA 1SWCA 3RE5A 1NQMA 1RXJA 4GGRA 2A8GA 1STRB 4DNEA 3SZHA 2RTEB 3VHMA 3WYQA 1SWJA 2RTOB 1KL4A 1SWBA 2CAMA 1VWEB 2RTJA 2IZIA 1HXLA 1AVEA 1LDQA 3WZOA 1N9MA 1RAVA 1HXZA 1LCZA 1VYOA 1Y53X 1MEPA 2OF9A 4BX6B 4Z2VA 2JGSA 2UYWA 3T6LA 3WYPA 1VWGB 4EKVA 4I60A 1RXHA 1SWLA 1KL3A 1VWCB 3RDQA 3RE6A 2ZSCA 3X00A 1KL5A 3MM0A 1SWDA 2Y3EA 5CSEA 1LUQA 5F2BA 1NDJA 1LELA 1VWBB 1WBIA 4Z2PA 5K68A 3T6FA 1MK5A 3RDOA 2IZHB 2F01A 4U46A 4GDAA 1SRJA 2IZLB 2RTCB 1DF8A 1SRHA 2IZBA 3RY1A 1VWPB 3EW2A 4JHQA 1VWQB 1SWUA 1VWNB 1SRGA 2OF8A 3RY2A 1N43A 3VGWA 3WZPA 1LCWA 4BX5A 1PTSA 4BBOA 4GJSA 1SWOA 2RTMA 5IRAA 1VWRB 4GGTA 5CHKA 4GGZA 4Y59A 2RTQB 4CPFA 2RTIB 3SZJA 4Z2OA 4YVBA 1VWHB 5L3YA 1SLEB 1VWAB 2UZ2A 2RTPB 2RTAA 1SWEA 1HY2A 1SLGB 2IZCB 2RTNB 2QCBA 1VWFB 3RDXA 4BCSA 1VWIB 1SWPA 1AVDA 2C1QA 2IZEB 1SWAA 2FHLA 3MG5A 4Y5DA 1VWDB 3FDCA 1MM9A 4CPHA 1N7YA 5JD2A 1SWKA 4Z27A 1NBXA 1SLFB 2IZAA 2RTDB 3RDMA 1SWGA 4GJVA 1I9HA 2OFBA 2WPUA 1STPA 5IRUA 1SWRA 3T2WA 2MF6A 1VWOB 2RTFB 1SWNA 1VWJB 5B5GA 1N9YA 2IZGB 2IZDB 1LDOA 1KFFA 2RTKA 4BX7A 1MOYA 1SWHA 2RTGB 3EW1A 2Y3FA 4BX5B 5B5FA 2IZFB 1N4JA 2OFAA 1RSTB 4CPIA 2Y32A 1NQNA 1RSUB 4JO6A 1SWTA 4BX7B 2A5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C4I A;  2A5B A;  3PK2 A;  4Z28 A;  4JNJ A;  3VHI A;  4BX6 A;  4OKA A;  2G5L A;  3SZI A;  3RDU A;  3RDS A;  3VHH A;  1NC9 A;  1SLD B;  1LCV A;  1SRF A;  1IJ8 A;  1VWL B;  2RTB B;  2RTR B;  2FHN X;  5IRW A;  1SRI A;  1RXK A;  3WZQ A;  3WZN A;  2GH7 A;  2IZJ A;  2C1S A;  2IZK A;  5K67 A;  1VWM B;  1SRE A;  4CPH B;  1SWQ A;  4GD9 A;  2BC3 A;  4CPE A;  1Y52 X;  1HQQ A;  2AVI A;  1Y55 X;  3T2X A;  1SWF A;  1VWK B;  4IRW A;  4Z6J A;  4BJ8 A;  1SWS A;  2RTH B;  1STS B;  2RTL A;  1SWC A;  3RE5 A;  1NQM A;  1RXJ A;  4GGR A;  2A8G A;  1STR B;  4DNE A;  3SZH A;  2RTE B;  3VHM A;  3WYQ A;  1SWJ A;  2RTO B;  1KL4 A;  1SWB A;  2CAM A;  1VWE B;  2RTJ A;  2IZI A;  1HXL A;  1AVE A;  1LDQ A;  3WZO A;  1N9M A;  1RAV A;  1HXZ A;  1LCZ A;  1VYO A;  1Y53 X;  1MEP A;  2OF9 A;  4BX6 B;  4Z2V A;  2JGS A;  2UYW A;  3T6L A;  3WYP A;  1VWG B;  4EKV A;  4I60 A;  1RXH A;  1SWL A;  1KL3 A;  1VWC B;  3RDQ A;  3RE6 A;  2ZSC A;  3X00 A;  1KL5 A;  3MM0 A;  1SWD A;  2Y3E A;  5CSE A;  1LUQ A;  5F2B A;  1NDJ A;  1LEL A;  1VWB B;  1WBI A;  4Z2P A;  5K68 A;  3T6F A;  1MK5 A;  3RDO A;  2IZH B;  2F01 A;  4U46 A;  4GDA A;  1SRJ A;  2IZL B;  2RTC B;  1DF8 A;  1SRH A;  2IZB A;  3RY1 A;  1VWP B;  3EW2 A;  4JHQ A;  1VWQ B;  1SWU A;  1VWN B;  1SRG A;  2OF8 A;  3RY2 A;  1N43 A;  3VGW A;  3WZP A;  1LCW A;  4BX5 A;  1PTS A;  4BBO A;  4GJS A;  1SWO A;  2RTM A;  5IRA A;  1VWR B;  4GGT A;  5CHK A;  4GGZ A;  4Y59 A;  2RTQ B;  4CPF A;  2RTI B;  3SZJ A;  4Z2O A;  4YVB A;  1VWH B;  5L3Y A;  1SLE B;  1VWA B;  2UZ2 A;  2RTP B;  2RTA A;  1SWE A;  1HY2 A;  1SLG B;  2IZC B;  2RTN B;  2QCB A;  1VWF B;  3RDX A;  4BCS A;  1VWI B;  1SWP A;  1AVD A;  2C1Q A;  2IZE B;  1SWA A;  2FHL A;  3MG5 A;  4Y5D A;  1VWD B;  3FDC A;  1MM9 A;  4CPH A;  1N7Y A;  5JD2 A;  1SWK A;  4Z27 A;  1NBX A;  1SLF B;  2IZA A;  2RTD B;  3RDM A;  1SWG A;  4GJV A;  1I9H A;  2OFB A;  2WPU A;  1STP A;  5IRU A;  1SWR A;  3T2W A;  2MF6 A;  1VWO B;  2RTF B;  1SWN A;  1VWJ B;  5B5G A;  1N9Y A;  2IZG B;  2IZD B;  1LDO A;  1KFF A;  2RTK A;  4BX7 A;  1MOY A;  1SWH A;  2RTG B;  3EW1 A;  2Y3F A;  4BX5 B;  5B5F A;  2IZF B;  1N4J A;  2OFA A;  1RST B;  4CPI A;  2Y32 A;  1NQN A;  1RSU B;  4JO6 A;  1SWT A;  4BX7 B;  2A5C A; 
#chains in the Genus database with same CATH topology
 3FR2 A;  1YWA A;  2C4I A;  4O3X B;  3DSZ A;  2L67 A;  3PK2 A;  5DPQ A;  3VHI A;  1W4T A;  1VYG A;  2WQA E;  2KD2 A;  1KT3 A;  1ZNH A;  3MVF A;  3NBX X;  1FEM A;  1I06 A;  4XMG A;  2CM4 A;  2YG2 A;  3HWD A;  4IMN A;  2JU3 A;  2VFC A;  4XMC A;  1YIV A;  1QFT A;  1QQS A;  4YH0 A;  5AJB A;  5D4A A;  1BJ7 A;  1LCV A;  2OL6 O;  3O2Y A;  1NP1 A;  4HPB A;  1JYD A;  1NGL A;  4QRL A;  4Y0P A;  2FHN X;  4AZM A;  5D8J A;  2JW1 A;  2FTB A;  1OEE A;  2LB6 A;  2WR6 A;  2IZJ A;  3ZUO A;  5BVT A;  2IZK A;  1ERX A;  3ZUI A;  1LF7 A;  3HTY A;  5EZ2 A;  4GET A;  2K62 A;  2LBA A;  4ZR2 A;  3VG6 A;  1Y55 X;  5HCE C;  5K06 A;  2QO5 A;  4Z6J A;  1A57 A;  3B2J A;  2X32 A;  4WHI A;  3RDS A;  4I95 A;  2A8G A;  1STR B;  5LKF A;  1GGL A;  3SZH A;  3KFH A;  1Y9L A;  3T1D A;  2FS6 A;  1DZJ A;  2FR3 A;  2RTO B;  3B2H A;  4CSB A;  3TGC A;  1KL4 A;  2IFB A;  1VWE B;  2RTJ A;  3OJY C;  1A18 A;  4MVL A;  4NLJ A;  1GT1 A;  3FYF A;  4ON1 A;  2KTS A;  2FGS A;  1CRB A;  1NP4 A;  1CBI A;  1KT5 A;  2DJG A;  2OL7 A;  3HPE A;  3PH6 A;  4LKT A;  5HA1 A;  4A1H A;  4Z2V A;  4KC8 A;  2WEX A;  3MX7 A;  1QY1 A;  1RXH A;  4KT5 A;  1IW2 A;  1OPB A;  4I6S A;  4YMY A;  5HCD C;  3MM0 A;  5JR8 A;  3BS2 A;  2JOZ A;  5H9N A;  4ZCB A;  3GAQ A;  1LPJ A;  5HZ5 A;  5B11 O;  1CBR A;  1S2P A;  1MK5 A;  5EDB A;  5KID A;  3T6F A;  2QOM A;  1GX3 A;  1HBP A;  2F01 A;  2AT0 X;  2KT4 B;  4U46 A;  1EIO A;  2IZL B;  2RTC B;  1PBY A;  2MM3 A;  2WUT A;  2L68 A;  2IZB A;  1E00 A;  2FLJ A;  3QKG A;  1D3S A;  1W5R A;  3EW2 A;  1O1U A;  4AYH A;  3CKF A;  1MVG A;  5AEO A;  2GJ5 A;  3RSW A;  4QAE A;  3RY2 A;  4IAW A;  1N43 A;  3VGW A;  4BX5 A;  1OPA A;  1X8N A;  3NQK A;  4L1N A;  4PJ2 A;  3STM X;  3U9P C;  4CDD A;  5HZ9 A;  4GJS A;  3VPJ E;  1BLR A;  2OY7 A;  4BOE A;  1B0O A;  2AT5 X;  5IRA A;  1VWR B;  1AB0 A;  1JV4 A;  2X56 A;  1LIB A;  1B56 A;  4XMH A;  4QGV A;  3P6F A;  2LA7 A;  3WJE A;  1JBH A;  2NND A;  3NX2 A;  1QY2 A;  4YVB A;  5IO6 A;  3AKN A;  3JS1 A;  4TKJ A;  1E5P A;  3FA8 A;  1SWE A;  3UEV A;  3CBS A;  5AJC A;  3ZW0 B;  2OVA A;  5CYB A;  2OYB O;  1AEL A;  5LKE A;  1SY2 A;  1VWI B;  1SWP A;  2A13 A;  1AVD A;  3IFB A;  4O3Z A;  4BCS A;  4Y5D A;  3WJD A;  1LIF A;  3BRN A;  2BT9 A;  1SLF B;  2RTD B;  1SWG A;  4GJV A;  5B10 O;  3MBT A;  2WPU A;  3QQ2 A;  1SWR A;  5IRU A;  2MF6 A;  1VWO B;  4TKB A;  1SWN A;  5HTE A;  3H3I A;  1JJJ A;  3APU A;  1KFF A;  2RTK A;  4IB9 A;  4HPD A;  2MO5 A;  2RTG B;  3KVN A;  1LKE A;  1KT4 A;  2Z4H A;  3PEC A;  2QM9 A;  2OL8 O;  4B55 A;  4ZJ0 A;  1XKI A;  2A0A A;  1K24 A;  2OFA A;  1RST B;  3FEL A;  4CDF A;  2X55 A;  4CPI A;  4CV7 A;  2X4M A;  4CDE A;  4JO6 A;  5HZ6 A;  5LJH A;  1U17 A;  3ZW1 A;  4LZV A;  3VG5 A;  4Z28 A;  4I9S A;  4FQB B;  2L5P A;  3FW5 A;  3SZI A;  3RDU A;  4LKP A;  3APX A;  3VHH A;  1NC9 A;  2R74 A;  3V8U A;  3BLG A;  4WFU A;  2NNE A;  5C0N A;  3TGA A;  4YKO A;  3F9D A;  4NYQ A;  4ORS A;  1GX8 A;  3F6Z B;  1SY1 A;  4QGX A;  3VE2 A;  4QYP A;  1ZNG A;  4ZHD A;  1KQX A;  1U0X A;  1RXK A;  1ADL A;  2RCT A;  4MVI A;  3WZQ A;  1X8U A;  3U0D A;  3FEN A;  3AUM O;  3ZW2 A;  4C5P A;  4O9S A;  4ORX A;  2GTL O;  3TZS A;  4IB7 A;  1SWQ A;  1OBP A;  2BC3 A;  2JU7 A;  1QY0 A;  2AVI A;  5HZ8 A;  4HWM A;  5B3M O;  4YKM A;  4BJ8 A;  2RTH B;  1BM5 A;  2X46 A;  2RTL A;  1HMS A;  1AVG I;  3RE5 A;  3STK A;  1RXJ A;  2A3F X;  3P6G A;  3FMZ A;  2GTL N;  1IFB A;  3AKM A;  5D45 A;  3VHM A;  4COT A;  4DNE A;  4DQ4 A;  4EQA C;  1Y9T A;  1QWD A;  4U8U N;  4ZHF A;  1O8V A;  1U18 A;  1AVE A;  3UEX A;  3CQN A;  1E02 A;  1N9M A;  2QOS C;  3C76 X;  1VYO A;  1DC9 A;  1MEP A;  1T68 X;  3D4R A;  3VU1 A;  3FEP A;  3F8A A;  2Q2P A;  3JQO A;  2YMS A;  2HYS A;  3BDR A;  1SY3 A;  3T6L A;  3FA6 A;  3P6D A;  3WYP A;  2Q4N A;  3FA9 A;  1ZNK A;  1YWD A;  4AZP A;  1VWC B;  1VYF A;  5B27 A;  1DFV A;  1E2T A;  4YGG A;  3P24 A;  1JYJ A;  1KL5 A;  3CR6 A;  3BX7 A;  1SWD A;  3Q6L A;  5HA0 A;  4IMO A;  3ZW0 A;  1EW3 A;  1LUQ A;  3FR5 A;  1R0U A;  5F2B A;  1OBU A;  1PBO A;  1GM6 A;  1WBI A;  1SMP I;  2VFB A;  2WEW A;  4I3C A;  5BVS A;  1KZW A;  3TF6 A;  2FRS A;  2IZH B;  5FEN A;  5HWZ A;  4R0B A;  3O22 A;  3LTW A;  4QZT A;  1HBQ A;  1CJ5 A;  1MUP A;  5LJD A;  2R73 A;  1H91 A;  2GTL M;  2OFR X;  4I3B A;  4JHQ A;  2AH7 X;  4GNY A;  3P6E A;  1SWU A;  5HAE A;  3SLO A;  4NNS A;  2OFM X;  4U8U M;  2QO4 A;  1ZNL A;  4OMW A;  3KFG A;  4YBP A;  2X34 A;  3NQ9 A;  1PTS A;  1BEB A;  1UZ2 X;  4ALB A;  1T0V A;  3NQ3 A;  2OY8 A;  4GKC A;  4BBO A;  1SWO A;  4CK4 A;  1KT6 A;  2BHV A;  5CE4 A;  1EQD A;  4DCB A;  3ZI8 A;  4TJZ A;  2X8S A;  2Q9S A;  4IBA A;  2ACP X;  4CPF A;  2RTI B;  2CZT A;  4EDE A;  4AZO A;  4Z2O A;  5BVQ A;  2N93 A;  4NLI A;  4OS0 A;  4LZU A;  4O3Y A;  5F7G A;  3UAQ A;  5L3Y A;  4IB8 A;  2R56 A;  1G5W A;  4YDB A;  1CBQ A;  1HY2 A;  2DJF A;  2IZC B;  4O4S A;  2RTN B;  4GH7 A;  4U3Q A;  5IXG A;  1DF3 A;  3RDX A;  4N7D A;  1G7N A;  2NNQ A;  3PPT A;  5LJB A;  3MG5 A;  1SWA A;  1UYO X;  3FDC A;  1MM9 A;  2BSZ A;  3D97 A;  5JD2 A;  4Z27 A;  5BYP A;  4YDA A;  5L8N A;  3JSQ A;  2IZA A;  1FEN A;  3NR3 A;  1I9H A;  1Z24 A;  4ORW A;  1STP A;  3WJC A;  4EXZ A;  4XME A;  1Y0G A;  1N9Y A;  3ZZV A;  1EII A;  2IZG B;  1JZU A;  2IZD B;  1LDO A;  1ZNE A;  3P6C A;  4AW8 A;  3WJB A;  3FW4 A;  3VG7 A;  1SWH A;  3EW1 A;  1S44 A;  4NP1 A;  1MX7 A;  2HZQ A;  2AKQ A;  5F58 A;  1N4J A;  2Y32 A;  1NQN A;  1SY0 A;  1LFO A;  2I5V O;  2ZAI A;  1LNM A;  4YFQ A;  4BX7 B;  4YGH A;  5LJK A;  4OS8 A;  5F6B A;  4JNJ A;  3WVM A;  3L4R A;  2G5L A;  3HOE A;  4BVM A;  3IA8 A;  4ZGF A;  1X89 A;  1TXL A;  1P6P A;  1SXW A;  3STN A;  4YBU A;  3PED A;  1VWL B;  2RTR B;  5IRW A;  3CWK A;  1BSY A;  1IFC A;  1QAB E;  3BY0 A;  4MIS A;  2HNX A;  3D9W A;  1L6M A;  4YGZ A;  5FQ8 E;  1KT7 A;  4GDZ A;  4GE1 A;  2E4J A;  3WOV A;  5K67 A;  1HMT A;  1VWM B;  4EFG A;  3U03 A;  2W2F A;  5IO5 A;  1Y52 X;  3VG4 A;  1G74 A;  3T2X A;  1SWF A;  2HZR A;  4IB6 A;  4IRW A;  4IAX A;  4A1Y A;  4ZGU A;  2HMB A;  1ICN A;  5F1E A;  1STS B;  1YP6 A;  4TLJ A;  5B2A O;  1LID A;  2HLV A;  1NQM A;  3PQS A;  2AT8 X;  1EI5 A;  1KOI A;  1GT4 A;  4BQU A;  2I5Z O;  1JJU A;  4Y0R A;  1SWJ A;  1LIC A;  1RBP A;  2XST A;  3Q34 A;  1TW4 A;  4ODD A;  2X45 A;  1SWB A;  2W2B A;  2CAM A;  2OVD A;  1IKE A;  1HXL A;  4NV8 A;  1LDQ A;  1GT3 A;  1B8E A;  1I04 A;  3BU1 A;  3EBK A;  4GRJ A;  2MHD A;  1GXA A;  3C78 X;  3P02 A;  3D95 A;  1HXZ A;  1LCZ A;  1GKA B;  5B29 A;  1W6F A;  3BX8 A;  4O3W A;  3EC5 A;  3FID A;  4HFO A;  4BX6 B;  2JGS A;  2UYW A;  1FEL A;  3RWX A;  5FAZ A;  1VWG B;  2CBR A;  1DV9 A;  4EKV A;  1X8O A;  1EUO A;  1PMP A;  3B2K A;  2F09 A;  3RDQ A;  4TQ2 A;  4Y0S A;  4ZFX A;  5HTD A;  1AQB A;  4FBV A;  2Y3E A;  2OY5 O;  1I78 A;  4CDC A;  5IO7 A;  5LJE A;  4GNW A;  4U8U O;  1VWB B;  4Z2P A;  3AEH A;  4RUN A;  3FA7 A;  1D2U A;  2KTD A;  3K3L A;  4DQ3 A;  1HQP A;  2RCQ A;  4GDA A;  1FJ1 E;  2OVE A;  1DF8 A;  1DZP A;  1MDC A;  1HN2 A;  1SRH A;  2NP1 A;  1VWP B;  3RY1 A;  3SLJ A;  3WJF A;  2ZAG A;  4HPC A;  4TNN A;  3BSZ E;  4ALO A;  4AZQ A;  1O1V A;  4KC7 A;  1YWB A;  2ACO A;  3WZP A;  1OEJ A;  1XCA A;  1GT5 A;  1SXY A;  2CBS A;  3S60 A;  2L9C A;  3D96 A;  1KQW A;  2RTM A;  1K3B A;  3KZA A;  2X8F A;  2A2G A;  2PY1 A;  2WWP A;  5D48 A;  4U9C A;  3CQR A;  3LHN A;  1B4M A;  4HPA A;  5H8T A;  5LJG A;  4GGT A;  5CHK A;  1ERB A;  3CKG A;  4O4U A;  4Y59 A;  2Q39 A;  4O49 A;  1IKJ A;  2G79 A;  1LIE A;  3SZJ A;  3B2I A;  1E06 A;  2GTF X;  3NAD A;  1YP7 A;  2PI3 O;  3B2L A;  4AZR A;  5KIC A;  1G85 A;  1VWA B;  2ALL X;  2RTP B;  5AQ6 A;  2FKG A;  5L8O A;  2RTA A;  4GZV A;  4ORR A;  1SLG B;  5HCC C;  1OSP O;  2QCB A;  3NP1 A;  2WQ9 A;  3CBC A;  4A60 A;  1VWF B;  3FR4 A;  3EYC A;  2CM9 A;  2C1Q A;  4ORY A;  2FS7 A;  4GK9 A;  1VWD B;  1BSQ A;  1X71 A;  1N7Y A;  2G78 A;  3DTQ A;  3EBW A;  1NBX A;  4ARH A;  1OBQ A;  1JQP A;  2O62 A;  3RBY A;  2OFB A;  3WJG A;  2HKD A;  3OD9 A;  4GU8 A;  2AT6 X;  3T2W A;  3WBG A;  2X8T A;  4IAB A;  4YCE A;  2W2A A;  2A2U A;  4OMX A;  2RD7 C;  3S5X A;  1EAL A;  2FWV A;  1MOY A;  4D6A A;  3SLT A;  5B5F A;  4ID2 A;  4UU2 A;  1KGL A;  1KXO A;  3WZO A;  4PSQ A;  1BRQ A;  2BS6 A;  2P8G A;  2ANS A;  3FEK A;  4NNT A;  1RSU B;  1URE A;  1SWT A;  4I9R A;  1GKA A;  1YWC A;  2A5C A;  3APV A;  4K19 A;  4Y0Q A;  2A5B A;  3PQU A;  4ES7 A;  4ZHG A;  4BX6 A;  4OKA A;  3ZWE A;  1SLD B;  1SA8 A;  5LJC A;  1SRF A;  3ZW1 B;  1IJ8 A;  2RTB B;  2RA6 A;  2RN4 A;  4O4O A;  4TKH A;  2QMI A;  1SRI A;  3WZN A;  2GH7 A;  4ML7 B;  3WXQ A;  4KCA A;  1ZND A;  2C1S A;  4OS3 A;  4FGI B;  1EPA A;  3FLL A;  1SRE A;  1I4U A;  4I3D A;  5D47 A;  4INN A;  4GD9 A;  3I17 A;  5DG4 A;  3RKG A;  4KH8 A;  3S26 A;  1HQQ A;  1X8Q A;  1OEK A;  1VWK B;  3EM0 A;  3LV4 A;  3PDF A;  4EEJ A;  1SWS A;  2JN3 A;  1SWC A;  5F6Z A;  4GGR A;  3P6H A;  2POA A;  3BU9 A;  1TOW A;  5FQ6 E;  1N0S A;  3WYQ A;  2RTE B;  1RLB E;  3VG2 A;  1HMR A;  2AMM X;  4MVK A;  5EED A;  1I05 A;  4ORU A;  4ZH6 A;  5L8I A;  4CPH B;  2IZI A;  4AZN A;  4YFR A;  1RAV A;  5HBS A;  1Y53 X;  2OF9 A;  3GE2 A;  3VE1 A;  1KZX A;  1A3Y A;  3HWE A;  3RZY A;  2RQ0 A;  4WFV A;  1DZK A;  1EXS A;  3ELX A;  2OVS A;  2FR2 A;  4I60 A;  1SWL A;  1KL3 A;  3RE6 A;  3X00 A;  2ZSC A;  4QNI A;  3PP6 A;  3NPO A;  1DZM A;  1X8P A;  3APW A;  4M7M A;  5FFH A;  1BRP A;  1GX9 A;  5CSE A;  1NDJ A;  1LEL A;  1CBS A;  3HK1 A;  4ZH9 A;  2MJI A;  2BS5 A;  4NYR A;  5K68 A;  1PEE A;  4M6S A;  1A2D A;  3RDO A;  1SXX A;  3SAO A;  4MIR A;  1QG5 A;  2F73 A;  4GUZ A;  4QYN A;  4WBK A;  2BLG A;  1SRJ A;  2DM5 A;  1QFV A;  2FT9 A;  2Q2M A;  4O4X A;  1MX8 A;  3E3C A;  1ML7 A;  4LQZ A;  1BWY A;  2WSJ A;  5HZQ A;  5KHP A;  1VWQ B;  2LFO A;  1TOU A;  1VWN B;  1SRG A;  5H9K A;  2OF8 A;  4L3R A;  2ASN X;  4D6B A;  1JIW I;  3I0A A;  2OZQ A;  2XKL A;  1LCW A;  1ALB A;  1WUB A;  5H9L A;  5H9A A;  3EMM A;  1FDQ A;  4KII A;  3ELZ A;  1BBP A;  1VPR A;  2G7B A;  2OY1 O;  3HOL A;  3O19 A;  4QGW A;  2EU7 X;  4UU3 A;  2MWH A;  3OBL A;  2Z4I A;  4MEE A;  4QQ1 A;  1ICM A;  4GGZ A;  2FKJ A;  1PM1 X;  5EPQ A;  1S7D A;  1T8V A;  2RTQ B;  4YFP A;  2JU8 A;  2K23 A;  3KQ0 A;  2VDF A;  1VWH B;  3UEU A;  4ZHH A;  4JGL A;  1SLE B;  1TVQ A;  2M4L A;  2UZ2 A;  3KFF A;  4NV7 A;  4RUU A;  3NX1 A;  4NW4 A;  2CZU A;  4XMD A;  4FBO A;  4YCH A;  3UEW A;  3PH5 A;  1IIU A;  4XMF A;  4OEL A;  1ACD A;  4OEM A;  3KFI A;  3OE3 A;  1EPB A;  2IZE B;  3VG3 A;  2FHL A;  2GC9 A;  1SXU A;  3ZQ3 A;  4CPH A;  1BSO A;  3SOT A;  1FTP A;  1SWK A;  2JMB A;  2QO6 A;  5EEE A;  2KW1 A;  4MVE A;  3RDM A;  3FIQ A;  4N7C A;  4ZHC A;  2LBV A;  2RTF B;  2AT3 X;  4QZU A;  1VWJ B;  5B5G A;  2LKK A;  3C77 X;  1JMZ A;  5EDC A;  1UYN X;  4BX7 A;  1YUP A;  2AF5 A;  4BGF A;  1FE3 A;  2Y3F A;  4BX5 B;  3N91 A;  3S5V A;  2AL0 X;  3TGB A;  1JMX A;  2IZF B;  3HWG A;  5FQ7 E;  4A8Z A;  3HWF A;  4FBR A;  3CMP A;  1JJX A;  1ZRY A;  4CPE A;  3G7X A;  2G8C O; 
#chains in the Genus database with same CATH homology
 2C4I A;  2A5B A;  3PK2 A;  4Z28 A;  4JNJ A;  3VHI A;  4BX6 A;  4OKA A;  2G5L A;  3SZI A;  3RDU A;  3RDS A;  3VHH A;  1NC9 A;  1SLD B;  1LCV A;  1SRF A;  1IJ8 A;  1VWL B;  2RTB B;  2RTR B;  2FHN X;  5IRW A;  1SRI A;  1RXK A;  3WZQ A;  3WZN A;  2GH7 A;  2IZJ A;  2C1S A;  2IZK A;  5K67 A;  1VWM B;  1SRE A;  4CPH B;  1SWQ A;  4GD9 A;  2BC3 A;  4CPE A;  1Y52 X;  1HQQ A;  2AVI A;  1Y55 X;  3T2X A;  1SWF A;  1VWK B;  4IRW A;  4Z6J A;  4BJ8 A;  1SWS A;  2RTH B;  1STS B;  2RTL A;  1SWC A;  3RE5 A;  1NQM A;  1RXJ A;  4GGR A;  2A8G A;  1STR B;  4DNE A;  3SZH A;  2RTE B;  3VHM A;  3WYQ A;  1SWJ A;  2RTO B;  1KL4 A;  1SWB A;  2CAM A;  1VWE B;  2RTJ A;  2IZI A;  1HXL A;  1AVE A;  1LDQ A;  3WZO A;  1N9M A;  1RAV A;  1HXZ A;  1LCZ A;  1VYO A;  1Y53 X;  1MEP A;  2OF9 A;  4BX6 B;  4Z2V A;  2JGS A;  2UYW A;  3T6L A;  3WYP A;  1VWG B;  4EKV A;  4I60 A;  1RXH A;  1SWL A;  1KL3 A;  1VWC B;  3RDQ A;  3RE6 A;  2ZSC A;  3X00 A;  1KL5 A;  3MM0 A;  1SWD A;  2Y3E A;  5CSE A;  1LUQ A;  5F2B A;  1NDJ A;  1LEL A;  1VWB B;  1WBI A;  4Z2P A;  5K68 A;  3T6F A;  1MK5 A;  3RDO A;  2IZH B;  2F01 A;  4U46 A;  4GDA A;  1SRJ A;  2IZL B;  2RTC B;  1DF8 A;  1SRH A;  2IZB A;  3RY1 A;  1VWP B;  3EW2 A;  4JHQ A;  1VWQ B;  1SWU A;  1VWN B;  1SRG A;  2OF8 A;  3RY2 A;  1N43 A;  3VGW A;  3WZP A;  1LCW A;  4BX5 A;  1PTS A;  4BBO A;  4GJS A;  1SWO A;  2RTM A;  5IRA A;  1VWR B;  4GGT A;  5CHK A;  4GGZ A;  4Y59 A;  2RTQ B;  4CPF A;  2RTI B;  3SZJ A;  4Z2O A;  4YVB A;  1VWH B;  5L3Y A;  1SLE B;  1VWA B;  2UZ2 A;  2RTP B;  2RTA A;  1SWE A;  1HY2 A;  1SLG B;  2IZC B;  2RTN B;  2QCB A;  1VWF B;  3RDX A;  4BCS A;  1VWI B;  1SWP A;  1AVD A;  2C1Q A;  2IZE B;  1SWA A;  2FHL A;  3MG5 A;  4Y5D A;  1VWD B;  3FDC A;  1MM9 A;  4CPH A;  1N7Y A;  5JD2 A;  1SWK A;  4Z27 A;  1NBX A;  1SLF B;  2IZA A;  2RTD B;  3RDM A;  1SWG A;  4GJV A;  1I9H A;  2OFB A;  2WPU A;  1STP A;  5IRU A;  1SWR A;  3T2W A;  2MF6 A;  1VWO B;  2RTF B;  1SWN A;  1VWJ B;  5B5G A;  1N9Y A;  2IZG B;  2IZD B;  1LDO A;  1KFF A;  2RTK A;  4BX7 A;  1MOY A;  1SWH A;  2RTG B;  3EW1 A;  2Y3F A;  4BX5 B;  5B5F A;  2IZF B;  1N4J A;  2OFA A;  1RST B;  4CPI A;  2Y32 A;  1NQN A;  1RSU B;  4JO6 A;  1SWT A;  4BX7 B;  2A5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...