4IS2A

Crystal structure of the apo form of a 3alpha-hydroxysteroid dehydrogenase (baia2) associated with secondary bile acid synthesis from clostridium scindens vpi12708 at 1.90 a resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
245
structure length
215
Chain Sequence
MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTMLEPEEIANVYLFLASDLASGITATTVSVDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bile acid 3-alpha hydroxysteroid dehydrogenase
publication title Crystal structure of the apo form of a 3alpha-hydroxysteroid dehydrogenase (BaiA2) associated with secondary bile acid synthesis from Clostridium scindens VPI12708 at 1.90 A resolution
rcsb
source organism Clostridium scindens
molecule tags Oxidoreductase
total genus 72
structure length 215
sequence length 245
ec nomenclature ec 1.1.1.395: 3-alpha-hydroxybile acid CoA 3-dehydrogenase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4is2A00
4B4WA 3FN4A 3LLSA 2GO1A 2ZK7A 3WWYA 1N1EA 1F8GA 1JKFA 1KBZA 3AUUA 3KOUA 1Y8RB 2FOIA 3MJTA 4ROSA 2DUWA 3RC9A 4AJOA 4CR6A 3PK0A 2VHVA 3GVCA 2IYPA 1C1XA 1XU9A 2HJRA 3TF5A 4I5EA 4R4JA 4QSMA 3A1NA 3W4KA 4KTVE 2P68A 4YJGB 3W8DA 7ADHA 4P4NA 3WICA 3UXYA 4GGPA 3DTTA 1M76A 3HN7A 4PLCA 1AGNA 1QYWA 4DYDA 3ZNNA 3IL2A 1WNTA 2O3TA 1V3TA 3JD1A 4WUVA 4XGIA 3ICPA 5IDQA 1HRDA 3D0OA 3ITKA 1DXYA 1Y7TA 4RORA 4QFCA 1PJQA 2Q3EA 1ZSNA 2BI8A 4E5YA 2P5UA 4GX2A 4D0RA 4AICA 4FC7A 4XWYA 4WASA 2I66A 2IDZA 4CLRB 5MGBA 4HV4A 1Q7CA 5H81A 5KWEA 5BSGA 5JMWA 2HCTA 4UREA 2QRLA 4XRRA 1PJ3A 4Z0HO 4EUEA 3MJSA 4BO3A 4B3HA 2CF5A 3HB5X 4AJJA 1WXDA 4FBGA 1VE9A 4TKMA 3M2TA 1BXZA 1Y8QB 2WYUA 4MKRA 1WDMA 4IDAA 3RU9A 1N2SA 3MJVA 3AI3A 1DOHA 1ZW1A 2Y66A 3M1LA 3PDJA 4AJPA 1YOVB 4JJGA 4OOEA 4WEQA 4Q3BA 1WP4A 1Q7BA 3CEAA 4DQXA 2CD9A 1UUFA 1QKIA 4U0JA 4HUJA 3LSYA 4XGKA 4CR7A 5BR7A 4E32A 2W2KB 1G0NA 1R0LA 4GKVA 4K1LA 1BXGB 4IXWA 5G4KA 3VAZA 1Q0QA 2W8ZA 1KYQA 2G82A 1N7GA 1SOWA 5HS6A 4L73A 4WLOA 4CPDA 3BMCA 2VUUA 3QRWA 3WNVA 1ZEMA 4CM7A 4R16A 1L7DA 4J2OA 2JCXA 1I36A 2P9EA 3I52A 3JCZA 5JY1A 1E92A 4YJHA 4IJKA 4IZIA 3FPLA 4E2XA 4XB2A 4YDRA 1Z7EA 3JQ9C 3N7UA 3COSA 5T64A 1EFLA 3GNTA 4TRJA 4D0SA 5L9AA 5DOVA 1I10A 3ON5A 2H9IA 2D8AA 4D7AA 4OO3A 3CZMA 3LU1A 4S1VA 2QQ5A 1Z6ZA 1PL7A 3BIOA 1XQ1A 2X0IA 3JQ6A 3RQSA 3PLNA 3HB4X 5THQA 4B4OA 3ONEA 3L4SO 1CQIA 1B8UA 2D4AA 4NU6A 2BGLA 1DAOA 3EGOA 1PU2A 4OQYA 3AOEC 4ND5A 3WGIA 5L4LA 3ZWVA 3ZU3A 1PR9A 4KUEA 1NAHA 4E12A 4J2HA 1KEUA 3GZNA 1EZ4A 1GPJA 1NM5A 3DOCA 1U3WA 1DIGA 5G0WA 1ZXLA 1B8VA 1XA0A 5KOIA 3P19A 3S1LA 3QV1A 2RHCA 5HA5A 2P9CA 3Q2KA 1CWUA 3PQEA 3CUKA 3LK7A 3JTMA 1F0YA 3OH8A 5ES3A 1NQTA 3B6ZA 3JQAB 1H93A 4FJ2A 1LDYA 1E1KA 1LQUA 5JS6A 3GN1A 2VTEA 2FR1A 1KY5A 2OHXA 2WD7B 4F45A 4OYRA 4IDDA 2WJPA 1NPTO 4NPCA 3VOSA 3OJLA 3JD4A 1HDZA 1ENOA 1JAYA 5B4UA 2DTDA 3IQDB 4RL6A 3HHPA 4BKQA 2VZ8A 3WGGA 4CM9D 3CKYA 3UAGA 1EE2A 1Y5RA 4IXTA 4OQZA 1FDSA 3PWSA 2B4TO 4BV8A 4PVDA 3OBBA 1DFGA 2E37A 3PIDA 5TQVA 1LX6A 4LRSB 2CVZA 4TROA 4J9VA 3E03A 4E21A 3ADPA 5LDHA 2NSDA 5DCYA 4CM3A 2AG5A 4NK5A 1P3DA 5L4SA 4MVJD 2CDAA 4KQWA 3EK2A 4CM8A 2EF1A 1M66A 4CM4B 1EE9A 2TMDA 3DONA 4NBTA 3UUWA 1KVQA 4AJIA 3D5TA 2P91A 4E13A 3SBOA 4EEZA 1E3SA 1LRKA 2NU9A 4H3VA 2IODA 1HEUA 2EEZA 3V1YA 1I5RA 2VTDA 4PLWA 1P1KA 2YZ7A 4LMPA 5U1PA 3AM5A 4DQVA 1VL8A 2VYVD 1F12A 4EBFA 4EJ0A 1IOLA 1T2AA 3GR6A 4ZHSA 4IDGA 3GVIA 3ZH2A 3OFSA 3ZGYA 2Y1DA 4UVGA 2Q1WA 2B69A 3TN7A 4WNCA 2GN8A 2FPIA 3MOIA 5A5FA 2HK7A 1IHXA 1K0UA 2PGJA 1GUYA 5L7TA 1QMGA 1JQBA 3RAJA 3A06A 4J1SA 1PGOA 4FDAA 1XGKA 4BO6A 4Y8VA 1DB3A 3WYCA 3HG7A 5G4KB 3Q9UA 1O94A 3RU7A 1T4BA 1MA0A 2HU2A 3T7EA 2DU8A 4N5MA 4XQ9A 1LC0A 2E49A 4PZEA 4L74A 4PCVA 4BOYA 1GADO 1GQ2A 1NAIA 3M1AA 4Z9FA 4KWHA 3NYWA 3SC4A 1IYZA 4PRKA 2I65A 4YCAA 2EKQA 2HK9A 1DC6A 1DRWA 2NV6A 2BFPA 2X5KO 2OP0A 4FC6A 2BMAA 3VTFA 2P5YA 3IS3A 3TL3A 5LDGA 2Y68A 3BTSA 4D79A 1DHTA 3D4PA 3TOZA 3CTMA 4WLVA 3EHEA 2EGGA 2VOEA 3JD3A 3ETEA 3EZYA 4ALJA 2PA3A 3GMSA 3B20A 3QVTA 1M67A 3WTBA 4JN6B 1HDOA 1KS9A 3U62A 2AXQA 3NKLA 1NASA 3VH4A 4CL3A 3WLFA 1Z7BA 5L7WA 2Y67A 4I5FA 1N92A 1NP3A 3RFTA 4BNTA 3DZGA 2J3IA 2JFGA 1FF9A 2BGKA 2O3UA 3WBFA 2GN4A 1U2GA 1AXEA 1WZIA 1OZAA 3NUGA 1C1DB 3RVDA 3NTQA 3AY3A 3QWFA 4EUHA 2PWZA 3W1VA 3DMTC 4BNLA 2DLDA 1YGYA 3LYLA 4NZ9A 4M55A 4PIVA 3L07A 4GWKA 3F5SA 1F8FA 1D1SA 1QORA 2Q49A 2QRKA 2UUOA 2GERA 4EW6A 5L7YA 4MO2A 3JQFC 4ALIA 1LDNA 4Z6KA 3I6QA 3UF0A 3JD2A 4BMVA 1SCUA 3RBZA 1B2LA 2PD4A 4WJZA 2HDHA 4R5HA 2A9FA 4RVFA 2B4QA 2VT2A 2VYNA 3MCVA 4ZA2A 1EBFA 4O59O 2XXJA 2I6TA 3F1KA 2HUNA 1PWXA 2VN8A 4WCDA 4UUOA 4IBOA 3K92A 3RUAA 4YJFB 3DR3A 5AXCA 1LSSA 3WIDA 1TT7A 2ZATA 4CV1A 1YDWA 5TS3A 1ZKMA 1O5IA 2X9NA 3AM4A 2I9PA 2DPHA 4L75A 3QY9A 4YT2A 1FDVA 3KYCB 1ZCJA 2GZ2A 3H65A 3CH6A 3GOHA 1MC4A 3SJUA 3GRKA 3V2HA 3AFMA 1E7RA 4TZKA 2UDPA 4II2A 5AXDA 2VRCD 1Q1NA 3K73O 4E6PA 4CMIA 1O89A 2VHZA 3RFXA 1KVRA 2QIOA 3PJEA 4CMKA 2O50A 2GPTA 3FPCA 4FB5A 2WD8A 3WQRA 4PG8A 2QZZA 1DFHA 3O38A 3G49A 4W99A 1NVTA 2DUUA 2FPGA 2O3RA 4YB8A 2WE7A 3WDSA 1VJTA 5IDYA 4BHTA 2I3AA 3U9LA 1Y81A 3QVOA 1ZFNA 2W2LD 2ZKLA 3BXXA 3WQSB 4EEXA 4YT4A 1RYEA 1T2CA 3EYWA 3QLJA 4YT5A 4ZQHA 4DGSA 4PZDA 4NJMB 3I9LA 3NRCA 5AQ1A 2YHIA 4DIBA 4E0BA 1E6WA 4U0KA 4IPTA 4DRYA 4YAGA 4NFHA 2Y1FA 1H6CA 1A7KA 4PG5A 2NQ8A 1PR3A 3H4VA 4PZCA 1BVUA 1ADCA 1DDOA 2BFMA 2Y0EA 1K3TA 2Q4EA 3DBHB 3I4CA 3KYDA 3K31A 5H82A 4RZHA 3ZNPA 4BGIA 4CQMD 3C8MA 4GAEA 1BMDA 3F4BA 4BNZA 2R00A 4R1UA 4QFDA 2W4QA 1EEHA 5MDHA 2FMUA 3GAFA 2R00C 4G5HA 3RFVA 4I9UA 3AUAA 4GSLA 4OL9A 4DA9A 3ROMA 4XYLA 1FK8A 4PFJA 1VKNA 4YACA 2CDBA 3PWZA 2DC1A 3KETA 1NWCA 3ETDA 1FDWA 4Y6PA 3AI1A 3L0DA 3IJRA 1ADFA 4H7PA 3WYEA 1TA4A 1ZIDA 5EINA 1G6KA 3E48A 3WGTA 1SB9A 1I3MA 4IGFA 3VDRA 3C85A 4NU5A 3JQGA 3DBLB 3F3SA 3LLVA 3SLGA 2C07A 4RVDA 4BNNA 4FOOA 5IDWA 1E5LA 3C1AA 2HMVA 3TL2A 1ML3A 2ZTUA 3DFZA 1N9GA 4RF2A 3TOXA 3NX4A 1V8BA 2J6IA 1LLUA 2A92A 1PL8A 2EERA 3NJ4A 1DIHA 4XKJA 3DAPA 3CINA 3ZDFA 4IUYA 4FW8A 2YFHA 4K9DA 4XQGA 3CZRA 9LDTA 4Z0TA 2FHSA 1EVZA 5JAQA 3GEGA 3RC7A 2POQX 3D7LA 4J1TA 2D0IA 3K30A 4J43A 4D43A 3A9WA 3OA2A 1QXSA 1HTBA 3A28A 5T67A 1BG6A 2C2XA 2Y1GA 4BO8A 5FWNA 2NTVA 4CM1A 3GNQA 4KMSA 5ILGA 1NVMB 4R1TA 4TRMA 2PK3A 4GX0A 2JL1A 1E3WA 5KCZA 1R4MB 1O8CA 3IOYA 1P0CA 3PLRA 5JYEA 1YXMA 3HNPA 3HZZA 3R6DA 2I5PO 2V6FA 2PKQP 3ZHXA 2EHDA 2PZJA 3P7MA 4TSKA 4LVUA 1ISMA 2BGMA 5GZ1A 5CP8A 3HFGA 1D7OA 2X8LA 4UVIA 2P9GA 3WGQA 3W8EA 2O3JA 4Q3CA 4KDEA 5T8KC 4LISA 4WPGA 2YV2A 2NU6A 4TRRA 4BL5A 1I8TA 3WG9A 3RWBA 5BNIA 5CHEA 4E5MA 4CLEA 3RUFA 2GLXA 1DFIA 3ADOA 4O0LA 4DPLA 3GAZA 5IXSA 3HUDA 3UICA 3ZW8A 4G65A 1ONOA 4A2CA 5HRUA 5AOVA 3QA9A 3V2GA 5BT9A 4AJLA 2B36A 2GRAA 1OOEA 3U0BA 1FDTA 5IFLA 4MIEA 1I30A 3GK3A 1YB4A 3AM3A 3RUDA 5AVOA 1EBUA 1Y5MA 1ZXBA 4DIOA 3ANLA 3K5PA 3PZRA 1LSJA 4RF3A 2ZCUA 4NG5A 3H9UA 3OSUA 3ZWNA 5JCJD 2J3KA 1GYQA 1VJ1A 3DHEA 3E5MA 1CRWG 3AWDA 4CV2A 1YH3A 3NT5A 2RH4A 5EJ2A 4LMRA 3TZHA 3WIEA 4OM8A 4XR9A 2JJYA 3JQEA 3WNQA 2AG8A 4GL4A 3JQ7A 1DHRA 4XYBA 3TFQA 4BQRA 1JLLA 2XXBA 4OKIA 1P45A 4NDNE 2OP1A 1GD1O 2JFFA 3I6IA 1X13A 2CDCA 2JKVA 4MIOA 2O2SA 3QWAA 4OXYA 4JLWA 4U6QA 4J16A 3S2GA 3WX0A 4FFOA 1FDUA 2QYSA 5CEJA 3GHHA 2A94A 4Z0PA 4B4UA 2IYOA 1DRVA 5G0VA 4DBZA 2VUSA 2PH3A 4L4XA 4LSWA 5BNTA 2DFDA 1H0KA 1HYHA 3VKVA 3ZWMA 3AY6A 3INGA 5JYDA 1ISJA 4OOFA 3KZVA 4GQAA 4R3NA 1YQXA 2FSVA 2CMDA 3R0IA 4J0FA 5TC4A 4MVJG 3LZ6A 4FJ0A 1MB4A 3GDGA 4J0EA 2JFHA 4E31A 1J5PA 4I9NA 5JE8A 2QW8A 4Y6RA 1LRJA 1HLDA 2CZCA 1QG6A 2FSSA 1LLQA 4PLZA 4XZ3A 4D41A 1RM0A 3ENKA 1AHHA 2PR2A 4D46A 5KVQA 2GR9A 1ADGA 3CSDA 1N9GB 3OJ0A 1ARZA 1ORRA 1U1IA 1OI7A 3KVOA 3PP8A 4MDHA 4OIMA 4TMFA 4XIJA 2FRDA 8ADHA 1LJ8A 5EL0A 1FXSA 4E2WA 2BELA 4FFPA 4YXFA 2IZZA 4GSKA 3PRJA 4PVCA 4J7XA 2RHRA 4LSMA 3RUHA 1YO6A 2G0TA 4KDFA 3GGGA 3VVCA 3ONFA 4UEOA 3JQAD 3KUXA 3U4IA 2BFOA 4TZTA 5I7VA 5L45A 1J6UA 1T4DA 3G1TA 4PLHA 3P5SA 1N8KA 4CMBA 4U7WA 3W4IA 4GBJA 3EC7A 3A14A 1ONNA 3HE3A 3GVXA 1M6WA 3SJ7A 3JQ8B 1DJQA 1E7WA 2H6EA 4IQ8A 2O7SA 2VNAA 4CMJA 5DBFA 2AA3A 4BO2A 1D3AA 3C24A 5KJCA 2NVWA 2YQ4A 5HTOA 2GDZA 3O26A 3D64A 3IC5A 1A27A 1MXFA 3LC2O 4E3ZA 6LDHA 3MWEB 3F46A 2HAEA 3KV3O 1MX3A 3B1JA 2A35A 4EJ6A 2UUPA 3AUSA 4UULA 3FCOA 1D8AA 4NQZA 1PS0A 4J6FA 1GUZA 3U49A 3F9IA 2VUTA 2B37A 1KC1A 1OC4A 3ZWOA 3DZKA 1I24A 2WTBA 4QXMA 4Y6SA 3I4FA 4RQUA 3KB6A 1E7YA 1HF3A 1K5HA 2PKQO 3KSUA 2DTXA 2BI7A 1YL7A 3H7AA 4W82A 4DQUA 4E30A 3H5AA 4LW8A 4I5DA 3ZU2A 2I76A 2I67A 2ZB7A 1OFGA 5KKAA 1DIRA 3R3SA 1U4OA 4BNGA 3C1OA 4OHUA 1ZEJA 3BMQA 1B0AA 1Y9AA 3INRA 5EESA 1PJSA 4XJTA 4ZJUA 4B7XA 3RUEA 2A4KA 3FBTA 5JLAA 1CERA 4CODB 4O5OA 1UJMA 5CDSA 1YE3A 1HDGO 1Z82A 1R66A 1DC4A 4E5NA 3PHIA 4WLFA 1P77A 4ALLA 5F1PA 3FNGA 2X0RA 4B3IA 2AEJA 1X15A 3DAGA 1BDMA 2Y1OA 3K2EA 3TDKA 3IP1A 5COAA 1TEHA 3UVEA 3EAGA 3H2ZA 4DLBA 1SOVA 4J9UE 4CUJA 3BHMA 5TRTA 1IPEA 1E1LA 1E3LA 1U2DA 2QZ9A 4HFJA 4XYEA 3IKTA 2LDXA 1W4ZA 2BKAA 4K6CA 4BNIA 3ONDA 5ILOA 2IZ0A 1W0CA 3GT0A 3FTPA 3MTGA 4A03A 3DHYA 3WTCA 5IZ4A 3DO5A 4D44A 3OIGA 1HXHA 2G1UA 1MV8A 3PHJA 3H6KA 3Q9NA 3QVWA 4F6LA 3NGLA 1LDEA 3C1TA 4AG3A 2JAHA 1RKXA 3AUTA 1GTMA 3UOGA 1NFRA 2ZYGA 3DDNA 4J7CA 3JQBA 4F6CA 1JA9A 1WLYA 1ZK3A 3I9NA 4HFMA 1WVGA 3JV7A 2BH9A 2NNLD 4L0QA 2FR0A 1EQ2A 1DLJA 2PH5A 1ENPA 5DT9A 3JYLA 1NFQA 2AHRA 4PLGA 3C7AA 5IJZA 4CM6A 1BW9A 1UP7A 5K6AA 1S6YA 1ZK4A 4U8GA 5EN4A 2PNFA 2VWGA 3O4RA 1SPXA 3FD8A 5JY6A 1I33A 3OJFA 4QX6A 5FF9A 3X2FA 3OICA 2QYTA 4GMGA 4NJOA 4OXNA 5KNLA 5JW6A 2GN6A 1EK5A 4JJFA 1PZHA 1ZK0A 2B35A 3O9ZA 3ZNOA 3ABIA 1GAEO 1U3TA 3I9OA 1NBOA 4I1IA 1GQYA 1V35A 1VLLA 3O8QA 1ZNQO 4L9RA 2OGUA 3KEOA 1C1XB 5ER6A 2PFGA 2DBQA 3ASUA 2CF6A 2EW2A 4LN1A 3U4HA 2Z1NA 4LK3A 5A9TA 4BO7A 1I3KA 1SNYA 3PHGA 5I7FA 1C0LA 3RKRA 3VHRA 4Q3EA 3INTA 4QQRA 1UAYA 4BS9A 4MVJI 4P38A 1GY8A 1R16A 3OEYA 3A4VA 1XSEA 4C4OA 4CM5A 3H9JA 2BHLA 5JMPA 4HKTA 3PJFA 4XRGA 5CAEA 2ZYDA 3BHJA 4KUHA 4YRBA 3UN1A 2CVQA 1P31A 1QSGA 1AN9A 3RBVA 3E8XA 4E5PA 2O4UX 3FSRA 3QIVA 2BLLA 2PZLA 3ITDA 4NIMA 3BTOA 2DTEA 3WYBA 4MKZA 4MPDA 1P9LA 4Y9DA 3UW3A 2B4RO 4A0SA 5DN9A 1HDCA 4CUZA 1XIVA 2GSDA 4C7KA 2PKRA 4FSHA 1Z45A 1LSOA 4Q3NA 4ID9A 4XDZA 3TFOA 1T1RA 5A3VA 4FFMA 2HMTA 2PZKA 4RDIA 2VCYA 5FI5A 2VYVA 4IJVA 4JGBA 4RVUA 4RVGA 2PD3A 2C5EA 2GF2A 3NT2A 1XEAA 9LDBA 2Y05A 4BO5A 3TZ6A 1KEWA 4DYVA 4K6FA 3WGHA 4PLYA 1E6EA 1N7HA 1XLTA 2WE8A 5G0UA 2J3HA 3Q11A 4FCCA 3MEQA 4RVSA 3H9EO 1YJ8A 3GUCA 4LCEA 4HFRA 3DTYA 1GYRA 4M49A 3NTOA 1X7HA 2E82A 3BMCB 1Y1PA 4UVEA 1PGNA 1O95A 1F06A 1RJWA 4J1NA 4OSPA 5I9NA 1X0VA 4RLHA 1C0KA 2X5OA 4GMFA 1Y9EA 4KTTE 1KVUA 1PJ4A 4YJHB 3VVBA 2X22A 1I2ZA 5IAAA 1E1NA 1HE4A 2D59A 4ZQFA 4W7IA 5I9LA 5A9SA 1KC3A 4GPD1 4IDFA 5C5IA 3D5QA 1HDYA 1P1FA 4WEOA 5EPOA 3GVPA 3DBVO 2YDXA 2VWPA 4UEJA 3RD5A 5JDIA 3KLPX 1BGVA 3PQFA 2WEKA 4UVHA 2GN9A 3VPGA 5JDIC 1A72A 4HNHA 3ZHYA 2VWHA 3GGPA 4M8SA 4FGSA 4GLOA 1ENZA 4R1NA 4N7RA 2OFPA 1PGJA 2HKIA 3GFGA 4R01A 5LC1A 4BB6A 4PLPA 4DPKA 2O3QA 4NBWA 4ZQEA 2Q1TA 2VT3A 1YS4A 4KQXA 1LC3A 5A05A 3ZZNA 1DO8A 4DC0A 5JNLA 1K6XA 1R12A 3GZNB 1GL3A 1D4FA 2H63A 1LLDA 5DP1A 5ENVA 1UXKA 3VC7A 4R51A 5HWSA 4XYGA 1MG0A 3DZBA 2C59A 1MC5A 2OOSA 3EY4A 4ESOA 3EW7A 3KM0A 1DEHA 5IN4A 1EDZA 3L77A 3SVTA 1VJ0A 4AJEA 1PWZA 3B1KA 1TT5A 3MZ0A 2GUGA 4CLXA 1PS9A 1B26A 5T57A 1Z73A 4ZQBA 3GG2A 2UYYA 3ZV3A 2JD1A 1PJTA 3ZWPA 3BHIA 5JSFA 3QW2A 1EQUA 1T2EA 4CLDA 5C3MA 1WZEA 3B1FA 2RCYA 3I5MA 3K9QO 2O48X 3MJEA 3DHNA 1I3LA 4MVJM 4U5QA 3F6YA 3VTZA 2GASA 4IGEA 2J3JA 4EUFA 3DZIA 4XEHA 3H9QA 5BSEA 4IMRA 4W7HA 2G17A 5AYVA 4DREA 4RDHA 3ZV5A 2E6UX 4I9HA 4J49A 3UKOA 5A03A 4TVOA 1T1SA 4EDFA 1NHGA 3VKUA 1BWSA 3JD0A 3VZQA 3ZWAA 5DP2A 5I8ZA 3QWIA 3S55A 2VOJA 4AJ1A 3U4DA 1B3RA 2F00A 4RPHA 1W73A 2WM3A 3I9KA 1ZJYA 2IXBA 5A5EA 3R1IA 1LDBA 3CIFA 1MXHA 1V3UA 4P4GA 1E7QA 3OIFA 4CQLA 4BKOA 1HZZA 1EK6A 4CM8B 2AW5A 1QRRA 4BMSA 3OJOA 1H6AA 4CV0A 1M6HA 3GLQA 3IAHA 4HFNA 1TB4A 1ZBQA 4CLHA 1XHLA 4A73A 2CNBA 2GNAA 2VRCA 4IDBA 4OSOA 4YBZA 1KERA 4XQCA 1U3VA 4R3WA 2H5LA 3D3EA 4AJ2A 1QV7A 3PEFA 4NR0A 2J5KA 3CMCO 1JVBA 1EVJA 4L8VA 3ENNA 3WGOA 2WSBA 1X1TA 1Z75A 1A9ZA 2CVOA 4YAEA 4GWGA 5JBIA 5KJ1A 5JXWA 5B4VA 4JBIA 4RF4A 1A5ZA 1E7SA 1ZK2A 2W2LA 4FS3A 1ZUD1 5FEUA 2X4GA 4WKGA 2PGDA 4FD3A 4DC1A 1B15A 1CYDA 2FZWA 1E3JA 4PG6A 3FNHA 3VH1A 1GZ4A 1YL5A 4RLSA 5LCXA 1A9YA 1JKJA 3OHSX 1GZ6A 3BMNA 3MJCA 3VZPA 4OKNA 3RC1A 1HDRA 4P22A 1MFZA 3L4BA 2EKPA 1UZMA 4J91A 4CQMA 1LUAA 1P33A 4Q3DA 5COQA 5A04A 1Q7GA 4FGWA 4BNXA 5CDTA 1H2HA 3I23A 1NQAO 2P2SA 4O6VA 3FNFA 4YVFA 5H83A 2J5RA 3EUWA 3PJGA 2AQIA 3OF2A 4N5LA 1IUKA 2CY0A 2PY6A 1NWHA 1ENYA 3ULKA 5TT0A 4XCVA 4M86A 2WYVA 1LA2A 1UR5A 4HXYA 2OMEA 1QYVA 3V1UA 1RYDA 5A9SB 3KTDA 4ND1A 1VPDA 1EMDA 1U5AA 2PGLA 1LXCA 1A4IA 1LRLA 1YVEI 1IE3A 3WWZA 5A9RA 5KTKA 2VWQA 1PJCA 3QP9A 1GEEA 3ASVA 1QP8A 3UH1A 5C7OO 1KIFA 3HDYA 5CPBA 4DLAA 4ALMA 4B8WA 4UUNA 5CDUA 2YFQA 5KVSA 3DC2A 3HQ4O 3ROKA 1RPNA 1WPQA 3NTRA 4ND3A 4CUKA 3ORFA 1V0JA 4NHEA 3Q1LA 3CPSA 4JK3A 3WGZA 3LVFO 2JD2A 4EI2A 1PGQA 3VPHA 2JCYA 3I9JA 3IJPA 3V2UA 4XQEA 1LQTA 2IXAA 4R9RA 4Z3KA 4XA8A 3GPIA 4ZGWA 3QE3A 1WDLA 3L6DA 1X7DA 4NBUA 3VPFA 5F1OA 5IN5A 4ALKA 1XELA 4WLUA 1PJBA 2YHUA 2X58A 3NJ8A 2CSUA 1G0OA 3BTUA 1Y8RA 3WB9A 1UH5A 4OJNA 3WJAA 1E0DA 1ZK1A 4O1MA 5DF1A 3LDHA 5T5QA 4ALNA 5B1YA 4BKRA 1U3UA 3JYQA 3NDRA 4DLLA 5JAIA 3UCXA 4RVHA 4UEKA 3OECA 3RROA 2B0JA 5B37A 1U4SA 1ID1A 2RH8A 2E48A 5K0ZA 5BNFA 2FR8A 1YRLA 3KLMX 3RUCA 3G79A 1WAMA 5L40A 4IIVA 4HY3A 3Q2IA 3T4XA 3GN2A 3OP4A 4FFNA 4R69A 4QTZA 4B79A 1E1MA 4IS3A 3PTZA 1NHWA 5THKA 4Z9XA 1X0XA 4KOAA 4URFA 3R3JA 3LQFA 2AEMA 1Q0HA 4ZICA 5IZCA 3SXPA 2FPPA 2YJZA 3SX2A 1SC6A 2C29D 2Q50A 5IXYA 2EJWA 3WBBA 1A7AA 4YQZA 2HLPA 4GVLA 4B7UA 1IULA 3ZU4A 4WOKA 3FTNA 4CMIB 4JIGA 5CDYA 5TLSA 5L3ZA 4LGVA 3QVSA 3DB2A 2YW9A 3OQ1A 4WNIA 1KVTA 3OA0A 2FN7A 3F1LA 1PTJA 1PSDA 5KJFA 3H5NA 1LNQA 1WMAA 1QR6A 4H16A 1O9BA 3O03A 1K89A 1BSVA 3DBRA 1HSOA 3V8BA 1YOVA 2C82A 1GU7A 3QHAA 1DC5A 3ICCA 1GFSA 4UVDA 3TSCA 3KBOA 4ITUA 1O0SA 5FI3A 4G2NA 2YHIB 1J4AA 3G1UA 3QWHA 4NMHA 3GA0A 3BAZA 3C3XA 3OQBA 5A1TA 1N1GA 3KXDA 1WW8A 3WSWA 3RCBA 2IEBA 2ZB3A 2FY8A 3KYDB 3ZI0A 1DRUA 4J4HA 1QYDA 2HK8A 2JHFA 3G3EA 3HDHA 3RJ9A 3ANNA 3S8MA 5JDCA 2IE0A 3TZCA 3P2YA 2V6BA 4EZBA 2DVMA 1U8FO 2GZ1A 4JQCA 4R1SA 4AL4A 4IZHA 3WR5A 5JFOA 3VH3A 3GY0A 4WLEA 4EYEA 2EXXA 4JP2A 4FJ1A 2NU7A 2V7PA 1ADBA 1B3BA 1RM5A 2HMWA 1BVRA 1R0KA 3ZCXA 3SEFA 1JWAB 4IQ0A 4D45A 2Q1SA 4R68A 4N5NA 1YONA 5ITVA 4HWKA 1E3EA 4PN3A 4BNYA 2G5CA 3U5TA 5IDXA 2DM6A 1H9BA 1NPDA 3IKVA 4KWIA 1F14A 3JYPA 1ZSYA 3GF4A 3JQGB 4WE3A 1LLCA 1XYGA 2O7QA 2W90A 2V6MA 1L1FA 5A02A 5G4LA 3BYZA 1JN0A 4PG7A 4GX1A 1HE5A 4QO8A 5JAZA 1HETA 1N5DA 4RV9A 4LCJA 1GDHA 4IDEA 4P8RA 2Q2WA 4PLVA 4CMAA 2NTNA 4BGVA 4Q9NA 2YV1A 3KEQA 5KJEA 4MVJE 3PIIA 4HNGA 2Z95A 3GMDA 2UVDA 1D1TA 1P1JA 1PGPA 2NM0A 4UUMA 4CMHA 4BO0A 3GG9A 5K9ZA 4FN4A 1ONPA 2GZ3A 1UDAA 3E9NA 1GPDG 1OC2A 2AMFA 4BNJA 2C7VA 3QJ5A 1BDBA 1E3WB 3RASA 3H9GA 3AU8A 3AI2A 2F1KA 3VZRA 1GCOA 4DBVO 5G0TA 2DBVO 2O2YA 1YBAA 2NTJA 4FFRA 1U7TA 4GVXA 3W4JA 1XG5A 2FP4A 2X86A 4FQ8A 2WDZA 4AVYA 2GGSA 2WD7A 5JO9A 2E4AA 2Y0CA 1VSVA 3GHYA 1XQ6A 1GYPA 5TNXA 2NLOA 3RC2A 3RSHA 4I8XA 3EVTA 5DDIP 2V65A 1VL0A 3GEDA 3Q0EA 4MVJF 1YDEA 1AHIA 2JHGA 3MWDB 4FFLA 3WMXA 1PQUA 1VSUA 5ITWA 4BNHA 1ZH8A 5KVVA 4R54A 5I9MA 4XDYA 3TZKA 4RQTA 1RM4A 4PLFA 1CEQA 4ZRNA 1FMCA 4CM4A 3S2IA 5JC8A 3ETGA 2B5VA 3WJ7A 4BNUA 5F21A 1OBFO 4A27A 2AQKA 2Q46A 3LT2A 2WWRA 1H2BA 4RPGA 1V6AA 4I5GA 5F5LA 1TXGA 5HBRA 4S3MA 4L4RA 2R2GA 2NUAA 4DWVA 3FR8A 1LSUA 2Q99A 2EW8A 3N58A 4QEDA 5TJHA 1QYCA 1J49A 1XCBA 3JQDA 3PXXA 3DBRB 4II3A 1A71A 2VZ0A 4WGGA 2Z1MA 1U5CA 5CFZA 3PGJA 4LVCA 3JQ7B 3H5RA 5I7SA 5J23A 1NNUA 1PEDA 5TF4A 1X1EA 1OAAA 4IS2A 3ZNQA 4A26A 3C7CB 3W6UA 2ZJ0A 2C20A 3UGKA 4GI2A 5C7IO 1SAYA 2ZB4A 1A4UA 1ULUA 1DC3A 3CMMA 1UXHA 2GD1O 4QECA 1NR1A 2JD0A 3ZWYA 4RCVA 4BO1A 1XDWA 1IHYA 2ZTMA 4OH1A 3UHAA 5GMOA 2V6GA 3TJRA 1T2DA 3GC6A 1PZEA 2OBNA 3H8VA 3UCEA 4RPJA 3AY7A 4EGFA 2J8ZA 2RAFA 1DLIA 1UXIA 3JQ9A 4E33A 2UV8A 3E1KA 2YV3A 2DQ4A 6ADHA 1P74A 1T25A 3D4OA 3JQBC 3MJ4A 2OBYA 3RJ5A 4IIUA 5BSFA 2CFCA 1J0XO 1H5QA 1HWYA 1I01A 3RIHA 3I1JA 3GQVA 2ZQZA 2X9GA 1DPGA 4XIYA 1DAPA 2Q1UA 1GZ3A 2Y0DA 4MVJH 5K6AC 3AOEA 4MINA 1M2WA 5KKCA 2Y93A 3LC1O 1H6DA 4RF5A 4TVBA 1CETA 1LBEA 3QVXA 2CUKA 1U7HA 1K6JA 2Y1EA 3DOOA 5HS4A 1XU7A 3N74A 1YL6A 5DCUA 2DBRA 3GNSA 1TI7A 3TZQA 4NH4A 1HZJA 1XWFA 3L9WA 1C0IA 1NVGA 1C1DA 1RM3A 3H2SA 1EUZA 4AJ4A 4YYZA 2WMDA 3DEYX 1P1IA 4HBGA 3LT4A 4KP7A 3V5NA 3ZW9A 1PL6A 3S2EA 4R5MA 2DKNA 4JBHA 3HADA 5A4DA 2B5WA 1DIBA 1F17A 2OUIA 1JVSA 4FR5A 3QQPA 4GKBA 1VC2A 3PYXA 3RKUA 3JSAA 4RPKA 2RBEA 2X9VA 5CEFA 2G76A 3PYLA 4NK4A 3PGXA 1SEPA 5EERA 2C0CA 2D1YA 3G0OA 2IRWA 3Q3CA 1LTHR 4W9NA 4CM9A 1EVYA 5G2OA 5BQFA 4W9NC 4GGOA 2R6JA 4XGNA 1U28A 4UUPA 2AQHA 3BZUA 3F47A 5BSHA 3CXRA 1VM6A 5TSDA 3PZBA 4A10A 2OZPA 2YQ5A 1GCUA 2VHYA 3OEWA 2VHXA 4YJFA 1LEHA 4MVJA 4J4BA 4ONEA 2HRBA 4ZN6A 4HADA 4TQGA 4IMPA 4ZU3A 1GEGA 2J5QA 1DIAA 3ROPA 1CJCA 3VH2A 3IDSA 3KYCA 1E7MA 1R37A 3GGOA 5GZ6A 5GY7A 4AFNA 1UXGA 2PZMA 1VL6A 4UAGA 5I7EA 4ILKA 2NADA 1GV0A 2OORA 1SZJG 1LDGA 1QLJA 4WK6A 3F5QA 3BMQB 3GEMA 3UCFA 3WFJA 3IIEA 3KSZO 2Y99A 4RZIA 3ZWXA 4CMCA 4YAIA 1XR3A 2HSDA 3NGXA 3QSGA 4BNMA 4YR9A 3HJAA 3FRJA 3VDQA 3NT4A 4JNKA 4PRLA 2ZIZA 2XAAA 3GDOA 2HJSA 1IB6A 4R9SA 4BNKA 1I32A 3E18A 2ET6A 2GCGA 5KIAA 3GDFA 4WCFA 4GX5A 5TJ9A 1MFPA 4WCFC 3DAFA 1JWBB 2I3GA 4NJMA 2OXIA 2ZB8A 1YB1A 4JCOA 2ZYAA 5ICMA 3HDQA 2AE2A 5CG1A 1X14A 3RI3A 3TRIA 5EMHA 1EUDA 4AJHA 2QX7A 1GQQA 4YT8A 2DT5A 4BVAA 3OMLA 5I8WA 2QHXA 3DBHA 2SCUA 3K6JA 3KRTA 4BO4A 5TIIA 2EV9A 4ND4A 4YAJA 5B12A 5DBGA 1H6BA 7MDHA 3PFFA 1AE1A 3LF2A 4Z3DA 1BXKA 1Z74A 4QUKA 5F1KA 4J1QA 1CF2O 4XR4A 2VQ3A 4ZQGA 1ZVMA 1QLHA 2EG9A 2Q45A 1EUCA 2O4CA 3DMYA 3PI7A 1I0ZA 4FIZA 3PJDA 3QWBA 3NDJA 5FFFA 1VRWA 4DL9A 2BF7A 2NQTA 4A7PA 3AOGA 4J3FA 4OMUA 1FJHA 2X5JO 3DWFA 1M75A 3OM9A 2NVBA 5EQFA 4EJMA 4IM7A 3FWNA 3PHHA 1GR0A 3LT0A 4CL8A 1NQOA 4BKPA 2H1SA 3DBLA 3NEPX 4TRNA 4U6SA 3W6ZA 3NAQA 1PQWA 3EDMA 3I83A 3FI9A 4QO7A 5DBIA 1NFFA 1C14A 5L4NA 4PG4A 2LDBA 3CE6A 1YBMA 2HMUA 2XF8A 3IP3A 1HSZA 2NVUA 2W98A 2I99A 2X23A 1KVSA 3G17A 4DXHA 1UZNA 1BW9B 3LT1A 2XPCA 3M2PA 2Y1CA 5DCWA 3U3XA 3L9XA 1JDJA 4HX5A 1HLPA 1PIWA 3PHLA 4DPMA 2EIHA 4IQGA 3OETA 1IZ9A 5DNAA 3FBGA 3RUIA 2EJVA 3FHLA 4ZD6A 3H3JA 3K2BA 4CMGA 4D3SA 3DL2A 4H15A 1PS8A 2D3TA 4BB5A 1LDMA 1ULSA 3HDJA 1C0PA 3JYNA 3TPCA 3V1TC 4O63O 3DMTA 1BTOA 3ANMA 3O8QB 3WXBA 1R4MA 1YB5A 3PVZA 1L7EA 3BMOA 4IJWA 3E6AA 3ZWWA 1MLDA 3B70A 1R15A 4FPXA 5C37A 4NI5A 3BA1A 1B7GO 4ZVVA 4BMNA 4E4YA 4JJIA 1ISFA 1P0FA 2C2YA 2JAPA 4XJSA 3U4CA 2VRBA 3JQFA 3RBXA 1G1AA 3E5RA 3NV9A 4JP3A 2VYND 1DJNA 1U9JA 2ZTLA 4OXKA 4MJLA 1R6DA 4D3FA 1MP0A 4R41A 4CLOA 1UAGA 4DUPA 3GPDG 4YAKA 3H3FA 5COBA 1SBYA 3W8FA 4MP8A 1UXJA 2D5CA 5ICSA 3L6EA 1SB8A 1NQ5A 4Q39A 4FOSA 2D5AA 4E2ZA 1NTOA 4JX8A 3WLEA 4MKXA 1EFKA 1OMOA 1HT0A 4BNWA 3UFXA 1YQDA 4BIIA 3DFUA 2OO5A 3P2OA 4BUCA 4WECA 5JCXA 5IF3A 1QYXA 4WLNA 4YJDA 3ROQA 2VHWA 3X2EA 4N54A 4JROA 4XD2A 5AXAA 4NBRA 5JC1A 3D3WA 1B8PA 5A3JA 3DZFA 1JW9B 4RPLA 5CPFA 2EP7A 1JTVA 3ZWBA 3FWZA 1H94A 2IZ1A 4C7JA 4NFSA 3IMFA 1MUUA 3T7CA 2B83A 2O23A 4ZRMA 4CV3A 2QRJA 3AFNA 3HFSA 4CMEA 1HYEA 2PTGA 1E5QA 4CMEC 4MOWA 3VPXA 5ADHA 2DPGA 2WYWA 3ZHZA 1I2CA 4IINA 4MIYA 3IUPA 2FWMX 1UZLA 3LF1A 3BTVA 4BGEA 1PX0A 4WCFB 1PJ2A 1K2WA 3JQCA 2EKLA 4MVJP 2X1HA 3I3OA 4J7UA 4W4TA 1I3NA 1LU9A 1V9LA 3L4BC 4M87A 3WOHA 4YPOA 1AUPA 3GH3A 3WGYA 1HE3A 2FZEA 2VZ9A 4YA6A 4OGWA 3AK4A 3F4LA 4MP6A 3OIDA 3FNEA 1ISIA 2DFVA 2ZTVA 4BQPA 5U9CA 8LDHA 1R4NA 1YWGO 4A5OA 4YRAA 1HYGA 1WMBA 2HQ1A 3DZHA 1WDKA 1SMKA 1CQJA 4TKLA 4B3JA 4BNVA 1W6UA 1ZSVA 3OQ6A 4BKUA 2Q2QA 4YWJA 4CJXA 3GVHA 3ZWCA 4XYMA 3WS7A 3GUYA 4G81A 5JO0A 4E5KA 1KEVA 4LRTB 4Y98A 2HRZA 1CIVA 1KOLA 4DMLA 1DBVO 1E6UA 3FF4A 1TVEA 2NACA 3JYOA 3L6OO 5G0SA 2JCVA 2HMSA 1X7GA 4KUGA 2PLAA 4N18A 2QG4A 1HE2A 4Y67A 3WFIA 2YYYA 3KYBA 5EIOA 5IG2A 1S7CA 1E3IA 4INAA 5F5NA 2YUTA 2DBZA 3HWRA 2NVUB 1PZGA 2BD0A 3EZLA 3NDIA 2NWQA 1U8XX 3E9QA 5DOZA 3S2FA 1YKFA 3TQHA 1E77A 1R0SA 1TT5B 4K26A 2ILTA 1JU9A 4D3DA 5FYDA 1YQGA 4MP3A 2PD6A 1BRMA 2X0JA 3K96A 2UAGA 1JKIA 4BO9A 2DAPA 3EVNA 5CG2A 5CEEA 2YDYA 4WOJA 1LI4A 5KVCA 2ZJ1A 1I2BA 4X54A 2IEDA 3TWOA 2PV7A 3JQ8A 2P4HX 4K28A 1P1RA 4IDCA 3BMOB 4YJGA 4M1QA 5U4QA 4PGFA 4AJNA 4AJKA 2Q4BA 4ND2A 3LC7O 2EWMA 5TT1A 2TMGA 5DULA 3AU9A 2AE1A 3DXFA 3I9MA 4JXKA 4F46A 4CR8A 4HP8A 1B14A 1HDXA 1BHSA 1QV6A 3E82A 4NNJA 4CLOB 3U09A 4P4LA 2NU8A 5T8KA 3C7DB 5IZCC 2VNSA 4JBGA 4CLRA 3ZV6A 4CQLB 2ZQYA 1H9AA 2RIRA 1T2FA 1GV1A 3HN2A 3AW9A 2BFAA 4B7CA 4B8ZA 4GLLA 1HKUA 1HL3A 5L95A 3VPSA 1UP4A 1MGOA 1KY4A 2X6TA 3DOJA 3WSVA 5KJ6A 5GZ3A 1AXGA 3MOGA 1Y8QA 4L4SA 3OJEA 1NYTA 1Q0LA 1ZMOA 3KHUA 3GZ4A 5AXBA 3K8ZA 4I08A 4EITA 1NR7A 2OL4A 3DZJA 5EQDA 5JCJA 1KETA 1V3VA 3D3WB 1WWKA 1ZZEA 3STHA 2O3SA 2AQ8A 2X7HA 4PLTA 4J4TA 1SO8A 1W8DA 4BNFA 4J90A 4DIFA 4E2YA 3GRPA 4RJTA 1UDCA 2GYYA 1MG5A 4TWRA 1RWBA 4L76A 4M89A 4RGBA 5A06A 1ISGA 4B4VA 2W2KA 4M54A 4Z9YA 3SLKA 3HSKA 1BXGA 4BV9A 4D42A 1UDBA 1JAXA 1P44A 2EGHA 3EMKA 5DZSA 2EP5A 2C5AA 3DQPA 3E9MA 1ISHA 3MTJA 3PYMA 2C7GA 5JPIA 1CDOA 1GUFA 3BMNB 5JDCC 1PZFA 3KSDO 3Q6IA 1P1HA 1ZJZA 1C3VA 4CQMB 3WMWA 1YJQA 4YTEA 3ZHBA 2Q2VA 3ZV4A 2XOXA 1EDOA 4W6ZA 2P4QA 2Z5LA 3WQQA 4KZPA 3PPIA 5F3RA 4YQYA 1YBVA 1XKQA 3AJRA 1IL0A 1O6ZA 1UP6A 5JAMA 4XX0A 1SEVA 4RO0A 4YRDA 3GFBA 3PDUA 4XB1A 4QT0A 1IZ0A 5T6BA 1Q2XA 1K6IA 2C54A 1R4NB 4IJUA 1TLTA 5TGDA 2YY7A 5TX7A 4DVJA 1IY8A 3FR7A 2D2IA 4GH5A 1VKOA 1NPYA 4BGUA 4DTIA 3ZU5A 2ZCVA 5ENDA 5L53A 4NFYA 1B16A 1NX6A 5C7LO 1PQPA 3KO8A 5B4TA 1T26A 4IY1A 1NXQA 2BRUA 1KEPA 1T24A 3VZSA 3IUSA 5ER9A 5CDGA 3D1LA 4YEDA 1ZMTA 1DSSG 2HO5A 3PFWO 3D4NA 4OAQA 1Y6JA 3ST7A 3PQDA 3T4EA 4DMMA 2X0NA 5HM8A 1IPFA 4NBVA 3PWKA 3ZN2A 1VI2A 4F3YA 1EVIA 1ZO8A 4Q3AA 2AEFA 3TNLA 3M6IA 5L51A 1PJLA 3JQAA 3SC6A
chains in the Genus database with same CATH superfamily
3TD6A 4GYYA 4HMQA 3C3DA 1JTEA 3FN4A 4M1MA 2GO1A 3WWYA 4Q93A 3DEAA 4C4TA 1V8OA 4TV8F 1JKFA 1KBZA 2KBEA 1NBAA 3CF4A 3D0QA 4BRUA 4ROSA 3RC9A 3PNVA 4Z54A 4Q3KA 3Q2OA 5C32A 2CWWA 1TC1A 3LBIA 3VPDA 3WVNA 1GQRA 1AC5A 3H05A 4TYNA 3L6UA 3S44A 3V1NA 1E18A 4K9NA 2H2FA 1ODTC 1XU9A 2HJRA 4L8LA 3RABA 4P5PA 3FUWA 3I39X 3IV6A 4I5EA 3DB1A 4O2RA 4AZ0A 2F4NA 2QBYA 1FSPA 2IOFA 3O4HA 4DQ0A 3UPUA 5DPMA 2OG2A 1KFKB 4KTVE 1PBNA 4OLBA 1FLVA 2P68A 4NJEA 3TX6A 2QE7A 3VR6D 1JEDA 3HB7A 4H7HA 2EVWX 4M6WB 4A8JA 2I54A 5LA6F 4QEKA 3HN7A 4UUQA 5JVDF 1QP0A 4KQEA 3M5PA 4R71A 4JJ4A 3AJ9A 2VZLA 4Q82A 4L15A 4WINA 3VRHA 2IHZA 1F6WA 2GD6A 2VSQA 4FN5A 3SQNA 4EPYA 1MB0A 1Y7TA 3SFTA 2GPWA 2LPMA 4OF4A 3EXAA 3BL8A 3ZH9B 2Q3EA 1P9WA 1SIBE 2AZTA 4X66B 1L7AA 2P5UA 1RE0A 2FPPB 4D0RA 3V8QA 1V47A 2E2WA 3NWJA 2Z8YA 4LG1A 3T94A 1JYEA 2SHKA 3BD6A 4WASA 3JWJA 3GUZA 4CLRB 3B7PA 4IXDA 5AI9A 4LXTA 2WZCA 3R76A 3T7DA 2VATA 4P3YA 4RA9B 3QELA 1KJNA 4KO2S 3SQDA 3NTLA 2OILA 4Z0HO 3P0EA 4R3UC 2XCOA 4MUIA 2IITA 1Z25A 2HC9A 1T2UA 4P4TA 5FI1B 4UU8A 4AJJA 4FBGA 1QRDA 1VE9A 1L8LA 3SP1A 1BXZA 5EWMB 2WYUA 5BMVF 4IDAA 2GCOA 2JLBA 3LGSA 2BMVA 5EZSA 2JJMA 3T1QA 4CKXA 3QKTA 3L7KA 3DLBA 1G3RA 4HRYA 2JK0A 5JANA 2W6JD 3M1LA 1AKYA 3W79A 5LYJF 3AUYA 3E1GA 1GT6A 3M81A 5ARDA 4YR7A 1T6BY 1QK5A 3H2KA 1Y80A 1U0OC 2XCTB 4PTZA 3D8NA 4M1ZA 2FEAA 3EOBI 4OEHA 4U0JA 3DT8A 4GLJA 3EFOB 3EQ9A 3DE4X 4PX9A 2QIPA 4XGKA 3DKVA 3LSYA 5HCUA 3ZEAA 5IU6A 1L7NA 1Z4KA 3NHBA 2W2KB 1RSZA 2FLVA 2BTQB 3CB4A 1BXGB 3K0AA 4Q0MA 5TV2A 3VAZA 3W2EA 1JHVA 1YUBA 2FSFA 2IPMA 2ON6A 2W8ZA 3EZFA 1D03A 3GW8A 2KQUA 3MPUA 4WKNA 5FNVB 3WLKX 1TIPA 1N34B 1BDIA 4YRZA 3D8UA 3IQZA 2PJDA 3OIUA 4FX2A 1XKLA 4YV2A 1QRSA 1G63A 3L0OA 1FFYA 2ORYA 3PFBA 2AJLI 1L5FA 2Q5JA 1N5OX 4J76A 2ALJA 2JCXA 3ZX5A 2O20A 2AOTB 4K9KA 3ZWKA 4G89A 3LSTA 3WWPA 3HXQA 3AF5A 3TLBA 3UM9A 1J21A 1XZJA 1ISRA 2IYSA 2H2IA 3M4NA 4ZVQA 2ZANA 3JQ9C 1EM6A 1PQYA 5EJGA 5J1TB 4DV1B 3GV0A 1THTA 1L4UA 4D0SA 3NFYA 3UJCA 1PLKA 1E98A 1IHDA 1S5PA 3N07A 3IOMA 4D97A 5HF6A 2QX8A 4IDQA 1EWVA 3FYDA 4HVTA 3ESAA 4RJ2A 3W5VA 2NYVA 1Z6ZA 3E9RA 3HY3A 3BIOA 1XQ1A 4MPPA 2WT9A 5EZYF 2FHPA 1HOXA 3COVA 5THQA 3ONEA 1P2TA 3OO0A 3L4SO 4X95A 1B8UA 2NNWB 3OUUA 2AJ8A 3AOEC 4RXMA 1PT7A 4YN3A 1VI6A 2M6KA 4M38A 5BWLA 1OAOC 3A8TA 3ZWVA 5CDFE 1G5FA 2QDKA 3OUZA 1PR9A 1OLSA 2FEXA 1QO7A 4JLDA 1P2BA 3EXHB 1EZ4A 1GPJA 1W0JA 2PN1A 3IHTA 1L6IA 1DIGA 3RAPR 5AW4A 1B8VA 1E4YA 1XDGA 3CE9A 2IQIA 2ZYWX 4Q48A 2J0QA 4JJZA 2PSSA 3S1LA 4Z0NA 2RHCA 2V5AA 2WUGA 1Z83A 3F5MA 5EP4A 2XGJA 5JPDA 3PQEA 1USWA 3W0LB 1WBBA 3JTMA 1TCUA 3AGPA 2XZOA 1WHTA 4D0LB 2AJBA 3DT9A 4D0NA 5AVUA 2VK1A 3B82A 4BJHB 5F7ZA 5IJAA 2HF8A 4FJ2A 4LF4B 3BJRA 2FX2A 4K9MA 2QJOA 5K51A 4CDGA 5IVPA 4F8JA 3K9GA 3HP4A 2IT1A 1EFCA 1KJIA 1NONA 2RARA 2C2ZA 3GN1A 2VTEA 2AIRA 3DPUA 4NESA 4YIKA 3OQVA 2FP4B 4WJLA 4H18A 2PM8A 2FUCA 2OHXA 2CCJA 2IGTA 4F45A 1HYBA 3OLVA 4RGVA 1UINA 2XT6A 4C2TA 3C3YA 3N2YA 2WJPA 1N0WA 1MJFA 4QOGA 3VOSA 3JD4A 1GN9A 2HB6A 2QLMA 3TE7A 4XWKA 2DTDA 2Q9BA 3LRXA 3IQDB 3ME5A 1E2NA 5DKFA 3U9TA 3HHPA 4R0VA 5CA0F 5MN4A 2P2CA 3P32A 4CM9D 1PEKE 4RKRA 1WUHS 2PX6A 3KD3A 3I72A 4DCMA 4OQZA 4BQFA 1FDSA 5G40A 1JHPA 1OI4A 1PR4A 1Q1GA 2N42A 3KFVA 2OZVA 3OAAA 1V1MB 1ZRMA 1YS7A 2C5BA 2PUWA 1RBMA 2E37A 3I28A 2VBGA 4WN3A 5TQVA 3YASA 3ADBA 1LX6A 1VG9B 1SZDA 1UPCA 4FYWA 3KQVA 4JDUA 4J9VA 3R8CA 3ADPA 1VL2A 1ZA1A 3RK1A 4N76A 2AD1A 1CTQA 3HV2A 4TV9A 3SZLA 1P3DA 2QA5A 3CU5A 3I76A 3P1JA 3NKVA 3R3XA 4QFBA 1H0RA 4QGFA 5KAMA 1XPOA 1ECBA 1MOZA 1M66A 3NHSA 2ZS7A 4NBTA 5FB3A 2IUEA 2OV1A 2WU1A 4E13A 1M1NA 1K92A 2B1QA 3TTWA 3N0TA 4G07A 1FX1A 4EEZA 4XH9B 1IOVA 1LRKA 3EIEA 5AVSA 2GPSA 5HJ5A 3DE2X 3JR7A 5HGJA 2K2WA 2QLNA 3L7AA 1UBSB 2RHJA 2E5WA 4OY3A 1L4YA 2ZJZA 3AM5A 3KZ1E 4Z9AA 3DAOA 1MNAA 1VL8A 1F12A 2JLSA 3B51X 4ZO9A 4EJ0A 3E15A 3BGVA 2X2OA 7AT1A 1Y4SA 1ORWA 1T2AA 5C18A 3WLPA 3NCTA 2I03A 2Z9CA 4KN8A 4R9NA 4FGJA 5G3YA 1H2WA 1JUDA 2AZMA 4JJ8A 1U8UA 2B69A 4LX8A 1OXBB 2GN8A 1NG1A 2PA0A 1CS4C 6PFKA 2HK7A 2PMKA 4U7PB 3BRQA 3NTXA 2JCSA 3CZCA 2ZAGA 5L7TA 3RAJA 2PUHA 3A06A 5CBKA 1PGOA 4FDAA 2P62A 4MRRA 3QTLA 1P0IA 3ASZA 2YWEA 3ND8A 1GFZA 1J2RA 3BM5A 3HVUA 3K0AB 4DMHA 2WUVA 4ENPA 1NIPA 3IGFA 1P18A 3RU7A 1T4BA 1RWNA 2AVNA 4TX1A 2J1LA 2P3SA 3DP7A 4EY5A 4P34A 1O94C 1TA9A 3S40A 1LC0A 2E49A 4RZXA 4PF1A 5AWFC 4CU5A 4EABA 1IY1A 1GADO 3M1AA 4RMHA 2YMQA 2X0EA 2YV4A 3U3DA 4A0GA 8MHTA 2GZSA 2QE6A 3FNBA 1GTRA 2HK9A 2YJ5A 4IZOA 1PT5A 1L6RA 2NSYA 4JL5A 4AWAA 3AVWA 3OTIA 2NV6A 1HUQA 3ZJUA 3LW8A 1RJGA 1U7OA 2X5KO 2OP0A 5LN1A 4JNCA 3HYTA 4HAOA 3FNRA 2V96A 3TL3A 5KNDD 2ZRCA 4MMYB 1TF5A 3EG5A 1NZDA 4KCGA 1YGPA 1MPXA 3BTSA 3QNWA 1RADA 4JBNA 3O74A 1DHTA 1Z29A 4B76A 1Y6FA 2OK8A 4RESA 1M8PA 2LCIA 3N5KA 4IR7A 2XB6A 3PWTA 5EZ5A 4NPAA 4ALJA 5EE0A 2VJQA 3LJKA 3C5HA 3FFTA 4AKEA 2IS1A 2C00A 1AZLA 2OSVA 3T9CA 4MS4A 3U62A 1JFSA 2XXAA 2VS1A 2D74A 4LY6A 1KZYC 3ZBPA 5ISMA 2RD2A 2JHCA 3BE5A 5H3HA 4REQA 3WLFA 5CBPA 2Q0QA 2VEDA 1YFKA 1B00A 1K7EB 2W6OA 2M6RA 4BNTA 1RHJA 4RMGA 3H11A 5AOCA 2BGKA 4UCFA 3ZS9A 3O2SB 3C6ZA 1P7WA 4PSCA 1U2GA 1WZIA 3ZDQA 2DE0X 1OZAA 3M34A 1C1DB 1Z5OA 3OWXA 3NTQA 4JDPA 5IH3A 3WK7A 5EJAA 1HDEA 2RGNC 1XZEA 2RK3A 1XYVA 4NMXB 5AKEA 3W1VA 3DUFB 1N2CA 3ANYB 3HYCA 5DSXA 2XV1A 4AS2A 4JOQA 1JHYA 2DLDA 4R8MA 5LB2A 2EOAA 5FUQA 2QV7A 2AUMA 3G2QA 5CNIA 3ROEA 4CWAA 2ZBFA 2P67A 4Y2HA 4RW0A 2GCPA 1YCGA 1CSEE 1FRVA 1K8RA 1QORA 1R9JA 2IXGA 2QRKA 2UUOA 4WN9A 4EW6A 1KSFX 3CLUC 1C30A 1GAQA 3HS3A 1V16A 4TV8B 1H4QA 4BMVA 5HTKA 1P91A 4WXPA 4JJKA 2WK1A 3FY4A 3MHPA 4I4TA 3L0PA 4RL4A 2YMMA 1B23P 2V74B 1M8JA 2L18A 2GN0A 3U7HB 4ZA2A 2B4QA 2VT2A 2VYNA 4ZXPA 3A27A 1X7ZB 1EBFA 3CLUD 2P9BA 2DHQA 1YI8A 2B8TA 4MI9A 5AK0A 1GTZA 1KH2A 3GFOA 3F1KA 2P6PA 2H1RA 2EQBA 5CDFA 5CFRA 4UUOA 3H7IA 1IK6A 4YJFB 3LA6A 1JB1A 3KAKA 3WIDA 1TT7A 1ZU4A 2R6AA 1W34A 5JVDB 5LA6B 3T15A 2C2MA 2ZATA 4F2WA 1YDWA 5TS3A 3E5HA 2FZGA 1ZKMA 4KU4A 4TN5A 3AM4A 1WETA 2QMYA 5LPNA 2IYTA 3NHZA 1FDVA 3S8YA 2R6ZA 2QUJA 2GZ2A 2ZJOA 1ULAA 5HVNA 4MWZA 3GOHA 1FXWF 2HV9A 3KT8A 1E7RA 4IVQA 1JDZA 4OJKA 4TZKA 5ESRA 3A7EA 1ZCBA 2X76A 3K73O 4CIBA 3QH4A 4MR8A 3MHTA 4LRQA 2AMYA 2C83A 4YALA 3SHFA 5HUHA 2GESA 5ERGB 4DV2B 5DEIA 3CA8A 1DFHA 4FR2A 3G49A 4E3WA 3C3KA 2O3RA 2WE7A 1CDEA 1PWYE 2H3EA 3OT1A 4MWDA 4JXXA 3CBQA 3T6KA 3VAAA 1Y81A 2QSUA 3NHKA 3I1IA 1ZFNA 2J9XB 2W2LD 2CVHA 2P5SA 4W5TA 5KZMB 1SIUA 3WR5A 4EEXA 3KKZA 4C7XA 5I45A 5BMVB 1RYEA 1LF0A 1NNLA 2JIRA 2HX1A 3LY5A 4PZDA 4NJMB 3BRSA 4DDWA 1Y1QA 2YHIA 4DIBA 5KHAA 3BB4A 1AG9A 3QEMA 4F72A 1LKZA 1K4MA 1A7KA 1JZTA 1PJ8A 2XA2A 2Y1FA 4PG5A 1WJGA 2PWPA 5LYJB 3FKJA 2D7JA 3OFND 1PR3A 5BPHA 2HIGA 3P45A 5E3HA 3WAGA 1BVUA 1ODFA 2HR1A 2JNWA 1M10A 3SQXA 2H7VA 3I4CA 4UTVA 1P81A 3EPRA 2ZI6A 1OLUB 2P11A 2Q6KA 4RZHA 1NJ8A 4OQMA 3ZHTA 3FAZA 1P9RA 4GAEA 3HKBA 2CNOA 2FZ4A 2R00A 4ZT5A 5H5JA 4AJ9A 3ORSA 1KFBB 2PSJA 2WLTA 4HTFB 3EXEA 4I1OA 1TQHA 1WF6A 2OYSA 4G5HA 4I9UA 2WB2A 1NW7A 1US8A 4YV1A 4PFJA 1EUCB 4H1TA 4M0UA 1C9MA 1VKNA 3WC4A 1TQ4A 4HDMB 3D5EA 2C98A 3L93A 4JGGA 4B6SA 1GTG1 1TEVA 4P3OA 3O0DA 4FMCF 4NYIR 2IV7A 4H7PA 3Q7RA 1IAVA 1NI5A 2JCBA 2JDID 2IUUA 5JFTA 1G6KA 5D7BA 5EKDA 4US2R 3BIFA 2WUWE 1WKVA 4CF7A 3E48A 4ZO8A 3WGTA 1DBWA 3I45A 4GP6A 3L46A 3WADA 5C1BA 5AUOB 1Y8ZA 1HV8A 5EEHA 1Y7PA 1O03A 2WJWA 2HU5A 1SOUA 3Q0TA 2QNIA 3ZKAA 3F3SA 1INLA 3OTHA 4RVDA 3TXYA 4BNNA 2QN2A 5IDWA 2JGFA 3TECE 1X8LA 3OZUA 2PL9A 4TWBA 3TL2A 2ZTUA 4WFQA 3SSAA 1C9KA 2PUGA 4RF2A 4LE0A 4L95C 1U2PA 1V8BA 1XD2B 3I53A 2QJFA 5JALA 1LLUA 2A92A 2AZ4A 1KAGA 4W1RA 3WNCA 3NAGA 1PL8A 2GEDA 3HH8A 1DIHA 3DAPA 4MS4B 3ZDFA 5LB4A 4K9DA 3CJQA 5EZYB 4O08A 3CNHA 1JDNA 3CZRA 1FUEA 9LDTA 5TMPA 1GZ7A 1W96A 3LHKA 4HLUC 4YMGA 4ZI7A 2ZJ2A 3H11B 1Q20A 4MUMA 2O07A 3A58B 3A9WA 2J32A 3OLYA 1BG6A 1HFEL 3UJ7A 5FWNA 3UAVA 4Z4EA 1M2KA 4NX2A 1HPLA 4CM1A 3GNQA 3AEUA 2DWQA 1W88A 1GUAA 4R1TA 4TRMA 4MQ5A 1KYXA 3KWFA 1TU3A 5CIWA 3KJEA 3QPDA 4S1OA 2BT4A 1DT5A 1GCGA 4PWZA 5JYEA 5LJIA 1YXMA 3R6DA 2E18A 3AEZA 3AINA 3UAZA 1W5BA 2R1VA 4YCNA 5ILOA 1D6MA 3WL6A 3ANTA 2PZJA 4B31A 4TYYA 4ZEVA 5IEBA 1GARA 3MVEA 3PD7A 5INTA 1D6JA 2IPLA 2WABA 4ABYA 3K4PA 3KALA 1G19A 3E2PA 3E9YA 4HGQA 3PFNA 2UXBB 1C8LA 5KWVA 2G4VA 1GG8A 1FVHA 3KX2A 5T8KC 4WPGA 3EXIA 3K71B 3MRSA 1JDBB 2NU6A 4D4HA 4TRRA 2FFHA 1P8AA 4V3BA 3FOZA 3L0CA 2V8BA 5CHEA 4EY7A 1SVMA 3V7FA 5CA0B 4M8KA 2O1XA 4ESHA 2GLXA 3H0CA 3M6UA 4I3GA 4YLGA 3OESA 4YWHA 2W58A 5E9WA 1TM4E 3AFHA 3ZCUA 4EG0A 2ZBPA 3UFXB 1ATZA 4HAZA 4QOSA 3L43A 4X61A 5IXSA 4HZGA 1JI0A 1VE5A 3C41J 2CL5A 3KKMA 4O2AF 3ZW8A 4G65A 4A2CA 2OO7A 3QA9A 3V2GA 4AJLA 4W8OA 4Q15A 3CJTA 4HAWA 4RK6A 2Q5OA 3U0BA 5LQJA 2Z8ZA 1N0HA 1D0SA 1S4QA 1VJDA 1I30A 2F1JA 3C3WA 3HSYA 4GYKA 4TT3A 3RUDA 2GAIA 6CHYA 5IHPA 1IN1A 3CWZA 3JVDA 5DTQA 4DIOA 3D2CA 4UM9B 6REQA 1Y6GA 2X4IA 2CKDA 3NANA 3OSUA 2HN9A 2VLIA 2J3KA 3WDMA 4G4GA 5AVRA 4RXTA 4FHEA 2E4ZA 5JQWA 2I9KA 1XEXA 1BJKA 1G2IA 3AWDA 4C0QC 4F8YA 6AT1A 1FBTA 2RH4A 5FHRA 5F1YA 2Z56A 1XPUA 2OHHA 1TVMA 4NCHA 1AGPA 2AG8A 4ZQCB 2XIJA 1DHRA 4BQRA 1N6OA 2KS6A 4LOAA 3CW9A 4OKIA 1UANA 3FMIA 4JT2A 4LBYA 2LWIA 2H7XA 3QPVA 1N5IA 4EJSC 3V8RA 4GM1A 5CNMA 1NMEA 2O2SA 3PNLA 4C5AA 4HH4A 3IVCA 3WX0A 2CXSA 1FDUA 2EU8A 5J5AA 3ZZMA 2ZU0C 1J5EB 3JRXA 4ZHSA 2IIQA 4FE7A 1DRVA 1R64A 3TCXB 3BJZA 3CEHA 1FU8A 4KIGA 2VUSA 1UBGA 2ZREA 2PH3A 2R8PA 2R6CA 1IRIA 4L4XA 4LSWA 4PHFA 4RV5A 1YI1A 1ZX1A 4Q24A 1CQJB 1HYHA 3U7RA 3VKVA 8ABPA 3SCZA 4DDKA 3INGA 3QLVA 5FOTA 1JAHA 2JLCA 2G83A 5TPWA 3VBCA 1ECLA 2QUAA 1RI3A 3EGXA 3KZVA 1Y8AA 4OOFA 4R3NA 4E46A 4D96A 1RI2A 2ZULA 4HPWA 4IDOA 3L4EA 2D0PB 2PXHA 1W5AA 2EL7A 3N28A 4HX9A 3K94A 1BX3A 2H9YA 4J0FA 4MUNA 5TC4A 3RRZA 2RH5A 4KXYA 4EW2A 3OZTA 4J94A 3TI9A 2PL1A 1FPQA 3LZ6A 2QI9F 5E8JA 1U0TA 1EIZA 1MB4A 3VR6H 4AT1A 3PX3A 5KOHA 4QGAA 1A96A 3K9HA 2UZAA 4WDQA 3SF8B 1CUDA 2ZJFA 4Y6RA 5AM5A 2VF8A 2RB5A 1LRJA 1HLDA 1NU6A 3NBKA 1OWNA 1W93A 2FSSA 1KXJA 4LPSA 1KKLA 1YJBA 3EHDA 3EIOA 5IYZA 1TIKA 1ZOSA 4D46A 2PR2A 2UYCA 3V4RA 1LCIA 4V38A 1ADGA 3UK2A 2CMKA 1DKRA 3HY6A 4OIMA 1OI7A 4TMFA 1KO8A 3LYHA 4WRRA 1UMKA 1WXXA 1ZW6A 2FRDA 2QTAA 4XIJA 4NEHB 1Z5NA 3Q6NA 5HFAA 1K7CA 4FFPA 2IZZA 1E1QD 4MUYA 4PFSA 1EVEA 1S8NA 3ECAA 4Z49A 1OFTA 4JZYA 2RHRA 2QQ0A 3RUHA 1SVLA 2ZB2A 4X1OA 2CMFA 1C2TA 1CNEA 1WW3A 4PR0A 3WKBA 1B6GA 2ZRFA 2BFCA 5EAIA 4QOIA 1XD9A 4O8CA 4PCLA 3HCAA 3QW4B 4FR0A 4DB2A 1TTHA 5MF6A 1J6UA 3P5SA 4V2UA 3F3KA 4GW3A 3ETNA 1RHQA 1GLNA 4GBJA 1WG8A 3EC7A 1ZH0A 2UYOA 3Q12A 2C4WA 2ES4A 3GVXA 1M6WA 3LCRA 2Z2JA 1PNVA 2J6BA 2JB9A 1DJQA 1E7WA 2H6EA 1R8XA 2YHAA 1JS1X 2HU7A 4A8JC 5JAOA 3GO4A 4NAVA 4XARA 2W6IA 3E9DA 3KSMA 4PYQA 3ZXUB 2XQJA 2HEGA 4Q5IA 1LFDB 2IP1A 3WYDA 2NVWA 2YQ4A 4NONA 5KJCA 1AXRA 4ZAGA 2CFRA 3LHSA 1JZQA 1A9SA 5B3KA 1JJFA 2VQ6A 2GDZA 1QIEA 3OPMA 5FH9A 2QE7D 5KC8A 5BUQA 3U44B 1Y98A 1TM1E 3LC2O 3IAM6 4N03A 4E3ZA 6LDHA 1PFWA 3F46A 4YUVA 3ACDA 4Q6BA 2XKJE 2AK3A 1YOBA 5BMOA 3D6AA 1K8XB 1ZAYA 4TYPA 2UUPA 4GOOD 3TLEA 3EXIB 3PLAE 1YIOA 3EISA 4EX6A 3O4IA 2GD0A 1GUZA 3DMGA 2QL6A 4JVOA 5T7BA 3OMXA 3R6TA 3IPAA 1H05A 3VC3A 4PR3A 1E7YA 1HF3A 3KSUA 1H85A 3ZYCA 2WU8A 4W82A 1SD5A 3LC0A 1YRHA 3GT4A 3K20A 4WK4B 4BQOA 4LYJA 1OFGA 1HY3A 5KKAA 4W9MC 1E64A 2H0AA 4CG0A 1RRMA 1U4OA 2QSZA 3C1OA 5A7FA 3EQ6A 1QF9A 5BV0A 3BMQA 2B3TA 3AW8A 1VHLA 1C3OA 4HUQB 4M1WA 1B0AA 3RSCA 4ZDIA 1Y9AA 2JGMA 2VHQA 3OEEA 3PUXA 4ZJUA 4YMLA 2CHVA 4PQEA 4KLZA 3L8HA 1RZVA 4JASB 4HDSB 4QHTA 1DAFA 3FBTA 1F2UB 1S1MA 1E89A 1QHYA 1CERA 3EGIA 2X41A 5I7HA 1DDIA 2XYRA 3N2KA 4RTJA 5C46F 2WMYA 3WA6A 1THGA 3ZY3A 3GUHA 1Z82A 4ZEWA 3BRWA 3BPSA 3LS2A 4OAOA 4C87A 4I50A 2IBSA 1JG1A 4U2DA 3FOBA 2POCA 3GDHA 1QOPB 1IUNA 1Z6AA 4XUEA 2ZBEA 3MERA 1WLSA 4MVYA 2X9QA 3R5KA 1O6BA 1DCMA 1X15A 2EFHB 2VHCA 1GRNA 4BCCA 4TTRA 1U9YA 1H1LB 3IP1A 3TAXA 2K4MA 4EGSA 4NENB 2RG7A 2CD7A 3GP3A 4GYJA 1T9DA 4L8FA 2DR3A 4JLNA 3OQJA 3F9RA 2DJIA 2R97A 3T9AA 5A4MS 2HXSA 1N5MA 1W2HA 1FP2A 4N47A 3BHMA 4ZZ0A 4JKOA 3I62A 4MQ4A 4XYEA 4Y9UA 2LDXA 1W4ZA 2AMVA 5GJBA 3GT0A 4A03A 3FTPA 4D98A 1MH9A 1KH3A 1T29A 4HGYA 4P82A 2XUDA 1LTQA 1MV8A 1M83A 3H6KA 5EXXA 1Z2CA 5BV7A 3Q9NA 4V0OA 5F33A 3KOXA 2A0FA 3ABOB 3QF7A 2JAHA 4QC2A 3O47A 4BTVA 1NZFA 2N75A 3PQ2A 1JSRA 3J7AC 4FDLA 3BSSA 4FMCB 4AP5A 1ESNA 3PUWA 1FY2A 1P75A 3CG0A 3IPRA 1ECGA 1IONA 3BGOS 1C29B 2ICAA 3A9TA 1JA9A 2A0UA 5IT5A 3F8TA 4DMCA 1X7XA 4P4SA 2VPYA 2WJIA 4HTAA 4EUKA 1CEEA 1FNSA 3FROA 5JTTA 2NNLD 4L0QA 3ZVNA 1EQ2A 1PHRA 2J9GA 2O1SA 3BXEA 5DB4A 1XQVA 1ZVKA 3SIWA 4R84A 2HJGA 1BW9A 2ZJ4A 5IJZA 4BEBA 1S6YA 2Q3HA 5K6AA 2ZROA 1FW6A 4IEEA 3ADDA 3ZIDA 1ND5A 3CRZA 3OKPA 1Z4NA 2CBZA 3KTOA 4U8GA 2ORVA 2PNFA 3H99A 3JW8A 3UB4A 5C8ZA 3L7LA 1SPXA 1AQJA 2QTMA 3NNDA 2IUTA 3AVUA 3OJFA 4QX6A 3OICA 2QYTA 3O8OA 4NJOA 1XRMA 4B7ZA 2BEUB 5CITA 3PC7A 1KI1A 4OHKA 3VVMA 5ES4B 1X1BA 1W36C 4I1PA 1KKMA 1K06A 4PZAA 4EW3A 4AUKA 3CLVA 1E2QA 1GQYA 3BL6A 3QMPA 1XZKA 1C1XB 2L2QA 3ASYA 1FSSA 4JOSA 4H60A 4LK3A 4JMPA 4Q4AB 5I7FA 3FWPA 3PHGA 5CT8A 5CH5A 3PUHA 3QBJA 1EWRA 2ID7A 4F3CA 5BWNA 3U7JA 4KGDA 3ZD6A 1CDDA 3NP7A 2OCPA 4Q3EA 4F85A 3B7WA 2QOEA 5DNCA 1Z28A 4N3NA 2IV3A 1GPWB 3NM5A 1H0SA 1QLWA 4BQIA 2KJQA 1GPUA 1SVOA 1JJAA 4BJ5A 4E1VA 1FXUA 3A4VA 4C4OA 2RHWA 3GMIA 4RTRA 3FAKA 3MGBA 3P9QA 4HKTA 4XRGA 2NT4A 5CAEA 2P6UA 4KUHA 5F9FA 5K0BA 1AU9A 3OAAD 2XR1A 2UXDB 4MQLA 3N53A 1T0PA 3HO1A 2IOYA 3E8XA 3GEPA 3VNBA 1UC8A 1YB7A 1ZIOA 4E5PA 1CS0B 1YRYE 1MQ9A 2BLLA 3A1SA 3ITDA 3QPBA 1NA5A 1B43A 4FYMA 4M0LA 1PFVA 4NIMA 2DTEA 5DK6A 3UMYA 2IHVA 1I14A 4IO1A 3BJIC 4D8YA 3ZK7A 1JNXX 5CCEA 3DPIA 2QRZA 4A0SA 3W5IA 4INJA 4LJ8A 2F8LA 3T0IA 3WQHA 1LVGA 4QJBA 2AN1A 2OEPA 4FSHA 4UBOA 1Z45A 3TOSA 1IUPA 1DUSA 1JVNA 3BIXA 4Q3NA 5AI0A 4ID9A 1T1RA 5BOSA 2QTVA 3G5UA 4M2LA 1JR2A 1KYYA 4IV8A 2VCYA 2CE7A 2X1MA 3MJRA 4O2AB 2PGXA 3L01A 4ZVOA 2VYVA 4EKNB 1QS0B 1QH8B 5IH7A 1L4NA 2I2FA 5CIYA 3NWOA 4R1OA 1PK9A 3BD9A 2PD3A 2C5EA 1SK8A 3NT2A 4EGJA 9LDBA 1SQ0A 1T9CA 3MTBA 4R2MA 2WJ4A 3UENA 4OBEA 3SZMA 2R48A 3RSZA 5HEKA 1U0RA 3IBCA 1LBQA 3H2JA 3N2KB 4K6FA 5HCIA 3WGHA 4C0AC 3TBFA 3L7BA 1E6EA 2WE8A 1THZA 1UJCA 5C31A 4ZHQA 4D82A 1YVDA 3C74A 1SG9A 1CF9A 3QG1A 4A5SA 4AAYA 4LZPA 3HM9A 4L07A 4RVSA 2DPXA 4ZK6A 3SHQA 4Q1EA 3DTYA 4UPDA 2HREA 4GBED 4D4GA 5JI2E 3TIFA 5FXMA 1Y1PA 5HMMA 2G9RA 3TBHA 1MENA 1TKCA 2TMYA 3PB3A 1U0FA 1EX1A 5IAGA 2DQSA 1YZYA 5BSTA 3H9CA 4RLHA 2NYAA 3GLVA 3PNKA 1N2ZA 4TTAA 2ZYUX 4GMFA 1EH5A 2JBAA 5JQGF 3ZR4B 1PJ4A 4YJHB 5E6SB 4WVLA 3VVBA 1E1NA 2D59A 1BQ3A 3QZUA 1V96A 4JLVA 3GLIA 4HVCA 4F9EA 2LXNA 1KC3A 1PFUA 2J4FA 3EGEA 3G2OA 4H0FA 4OREX 4ZYLA 3D5QA 1IDN1 3IBYA 1P1FA 1ZBDA 5EPOA 1A76A 1F1BA 3A1DA 5SYAA 3DBVO 2YDXA 3RD5A 4QM6A 4BFLA 3KLPX 1V39A 1OT3A 1SCJA 3PQFA 5TXGA 4ARUA 2P8SA 3D8RA 4WXYB 2GEKA 3ZQKA 2V7XA 2J33A 3PUIA 5M3BA 5KPDA 3Q7PA 4FGSA 5ALSA 3RS7A 4N0DA 1ENZA 1XRQA 4R1NA 3NYIA 3NB0A 4G24A 2XSZD 1D4OA 1OJLA 3GFGA 3V4OA 2HKIA 4R01A 4MUJA 2HRDA 4QM7A 2Q2OA 2AVDA 4BB6A 1N78A 4RS4A 4TXNA 1RAEA 4NBWA 1JTFA 2Q1TA 3M6AA 1JWLA 4QREA 2N46A 3D9QX 1LC3A 3OOYA 5D8DA 2VLBA 3RBAA 4JC8A 1A8QA 3GFTA 1L5ZA 1MQSA 1R12A 1ZICA 3NC1C 5IK2A 2B2XA 3SSOA 1JFTA 1Z2OX 2A14A 4YNBA 1OXVA 1X7XB 3AETB 3VC7A 5ENVA 4UZFA 2XWPA 1NVWQ 1E60A 3REQB 2DPMA 4L5AA 1ODIA 4XYGA 3DVSX 1Q57A 3DZBA 1U2GC 5HBGA 3WBKA 4YLYA 3VI4B 4ESOA 5H4HA 4Q1BA 3KM0A 4IUDS 4GXRA 3RODA 4LQDA 1D7AA 3NHUA 4POOA 2WDPA 5IN4A 2Z58A 3B9PA 5LZ5A 1KSJA 1VJ0A 1XCOA 1L5HA 3TINA 5A4KA 5EIFA 2WZDA 2O8FB 1TT5A 3MZ0A 3NI2A 1BS2A 1ZL2A 4JJEA 4IIXA 3VU1A 4P3PA 4N9WA 5T57A 4E1AA 2JANA 1KP2A 2UYYA 2YN2A 3CX8A 4M9UA 2JLXA 4IH9A 4F7WA 4R40A 1F4VA 2QRMA 1QYIA 4DY6A 3ZWPA 5JSHA 1U1FA 3BHIA 3K9NA 2H4ZA 4QQNA 3VYWA 4CLDA 4ZVTA 1K8QA 3UJ3X 1IOWA 3MJEA 2FVYA 1I3LA 3KFLA 1ULBA 3H1AA 4U5QA 1OLXA 4EVRA 3BC1A 1IEVA 2J3JA 3DKRA 1GG9A 1SBQA 1PZMA 4B71A 3DZIA 1IJEA 4XEHA 2BJVA 1XTZA 3ZZ1A 3I1FA 2JFPA 4IGIA 2E6UX 2CW5A 3FZGA 4KQ1A 5B6PA 2O2GA 3LHFA 5A03A 5DO9A 1T1SA 2DGDA 4RJLA 2UXCB 1NHGA 4H1UA 1BWSA 1C3JA 3TQCA 4BAZA 3KPJA 3PEUA 5CX1A 3S55A 3NIWA 3U4DA 1B3RA 2W83A 2GYWA 4PC2A 1CNFA 1S8OA 3TG8A 1ZJYA 1ILWA 2IXBA 4TXMA 4D6XA 2PS1A 1PUIA 3GRCA 1UT5A 1HEYA 5EHXA 3U6BA 3NIGB 1JT9A 2FUG1 4HNAA 4ZZIA 3HRIA 5I51A 3MYYA 4BKOA 4DM4A 1HZZA 1TYZA 4UQLA 4XVQA 2WINI 3GD5A 2BTEA 4UE2A 4NS1A 3OJOA 4COOA 1KDOA 4CV0A 4LY0A 1K5PA 1TB4A 2UZ1B 3EXG2 3F9CA 3IPLA 4UARA 2AJTA 4PX3A 2ONCA 3L8FA 5J40A 1YZVA 1BCSB 1KERA 1M6YA 3TIIA 3V8NA 1U3VA 1T3TA 2H5LA 3D3EA 4R3WA 5H8WA 2DQKA 1GTL1 2OC4A 4E07A 1QV7A 5LUBA 3K9WA 4NR0A 3CTPA 4UM9D 2W2TA 4GPZA 1VP3A 3P9IA 1Z75A 3H75A 3LQRA 2JEYA 4BIMA 1RBZA 4GWGA 1NXTA 2V4MA 4JBIA 4RF4A 4AY5A 3DKKA 1R5BA 2AN5A 3OJXA 3BWVA 4FINA 3FWHA 4J6EA 2F8TA 1U3CA 5LQAA 1QE0A 2FAXA 2P2LA 2A0YA 2FZWA 1CYDA 4XOUA 4B87A 4DY4A 1DAIA 3EIWA 3AONB 2ZRPA 2J3LA 4KB5A 3DC7A 1DX9A 3HCWA 3LTEA 2Z3WA 4Y2RA 3G2MA 3DDWA 1Z4PX 3PE6A 2NO1A 3OI7A 3QENA 4WADA 3Q0IA 2A3RA 2HU8A 1GZ6A 3HM2A 3GYBA 5IT4A 3RC1A 1L8XA 1M54A 4GXNA 3FMFA 1OWMA 2EKPA 3C6MA 4GPTA 5COQA 3RV3A 5FR1A 4PPNA 1Q7GA 4RWEA 4GMXA 1PNTA 1ZD8A 2Z2IA 3K4QA 4PBRA 5AHRA 4YVFA 1WXQA 3IIKA 2Z9BA 5CVEA 2WTUA 1SVIA 2XB9A 3K05A 3MTQA 3OF2A 3PR3A 4N5LA 2O59A 1J33A 2PY6A 5PNTA 5EFZA 3ULKA 1TA0A 3F7OA 5AIAA 3TRKA 4M86A 2V5VA 2WSYB 3QUBA 1UR5A 1II8A 3A3KA 2OMEA 1N8NA 5A62A 1QYVA 4DM3A 4U9HS 5JSYA 1V45E 5I7OA 4ND1A 3IPYA 1JP7A 1KDTA 4JLOA 3PKJA 5K45A 3VO2A 1HG0A 3NATA 1JHQA 2ZI4A 1R8JA 2WJJA 1FZTA 1WPRA 4G0WA 3ZU6A 5JS6A 1IE3A 4L16A 4K9QA 3WWZA 2PUEA 4TUYF 4G2TA 3HCBA 4EKGA 3R5XA 1JMKC 1PJCA 1HR0B 5E4YA 2Z5GA 3ASVA 1QP8A 2HSZA 1NXSA 1GAWA 5CPBA 4Y2TA 5CDUA 4UUNA 2YIJA 2YFQA 5I9SA 3DC2A 4YX9A 2R8OA 5KVSA 2B8WA 1I94B 3NS7A 4ND3A 5D01A 2H1HA 3TG2A 5K0CA 4IJ6A 2B21A 2ID9A 2KM1A 2SKCA 3VO9A 1PVVA 3G0CA 5J58A 3C70A 3WGZA 1UK8A 2PIDA 2JD2A 4EA6A 1FYWA 4MS3A 4HQOA 4KEAA 1P80A 1SC9A 3VPHA 2VDJA 1BH2A 4XQEA 5I4CA 1LQTA 2IXAA 2O6HA 5LLSA 2H5IA 3DSRA 3SHOA 1A2KC 2QG6A 4C03A 3O75A 4OLFA 5D6NA 5FOVA 1L5HB 3HBMA 5F1OA 3TB6A 2O2ZA 2JW5A 3BWDD 1PJBA 3NV7A 3IR5A 4F5WA 2YHUA 4HB0A 3NJ8A 3NKFA 4FSDA 4U6NA 3RNLA 3HV0A 3C39A 3G89A 2GBFA 4QDOA 3TTYA 3KELA 3LPMA 2IBTA 3DYBA 1E32A 3IXMA 5T5QA 4ALNA 3GQBB 3MB5A 1PNQA 1GFIA 1AM4D 2IUYA 2YNMA 3EVDA 2HHCA 3DLHA 5CX4A 1QQBA 3ZV7A 2B0JA 1NN3A 1V9CA 3EGDA 5C35A 2RH8A 3LA8A 2HF2A 3T9EA 3HA2A 2MSEB 3HO6A 5DM2A 5J47A 5K0ZA 3MWDA 4PHTA 1YRLA 3JAWA 3KLMX 1QHNA 2C4VA 3LUHA 3B5EA 4DV3B 1WAMA 3KKEA 2PRYA 4P81A 4HY3A 1NC1A 5C8YF 3UOWA 1P6QA 1K4KA 1NV9A 2FCAA 3HSSA 3OP4A 3Q40A 5A6SB 4FYVA 5EA2A 3T4XA 3TTTA 2B0CA 3PTZA 5AESA 5CX1B 2YS6A 3CHYA 3R3JA 4YAFA 3NU1A 1N1MA 1ZUHA 4G5SA 4QYXA 2H07A 2NPFA 1PG5A 2C29D 1OA1A 4HNAB 1JKXA 2EJWA 4KO3S 3II6X 3RVOA 1A7AA 1J07A 1QC5B 2HLPA 1F8UA 2P1RA 3GA7A 4H3HB 4HYQA 1F0NA 3D3JA 1A8PA 1IULA 3ZU4A 2W2XA 3ERCA 3HU1A 3ZVRA 1E2HA 3CSUA 4CMIB 3DB2A 4YP1A 4D3YA 1XNQB 1NN0A 1KVTA 2FWBA 2FN7A 2GEJA 2QSJA 3GELA 4PIPA 4ZOAA 5AVKA 4O5AA 4PO9A 5BYJA 1PTJA 3RUPA 1PSDA 2Q3JA 5CXXA 1JDUA 5KJFA 1LNQA 3EXFB 2YYAA 1D07A 1Z0JA 4TT3D 3F7MA 4OHRA 5K3EA 5JS2A 4AMZA 2I22A 2VA8A 1J8DA 3ESBA 3PQ8A 3RE1A 3VR5D 4LI3X 3V8BA 4HLNA 2C82A 1PV1A 4R2WA 3BULA 4AK9A 1GFSA 1W25A 2HPVA 3FTFA 4X5OA 4PXAA 2GAAA 3GPBA 3KBOA 4GPIB 3EF3A 1U90A 1PFGA 2IIPA 3TSAA 1VHJA 1DU4A 4MV6A 4U63A 4DGQA 3C3XA 4L8YA 1SOAA 3ZHVA 5HF8A 5A1TA 1T5OA 4KSYA 5JWOA 1G4AE 4J4HA 4FSXA 2JHFA 2YWJA 5IDVA 1Q7RA 3RJ9A 3S8MA 4JSYA 1A0OA 1IJFA 1M2OB 1O87A 3K32A 3P2YA 5IP5A 1QGDA 1Q7TA 1U8FO 2M98A 2V4UA 3OSZA