4IS2A

Crystal structure of the apo form of a 3alpha-hydroxysteroid dehydrogenase (baia2) associated with secondary bile acid synthesis from clostridium scindens vpi12708 at 1.90 a resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
245
structure length
215
Chain Sequence
b'MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTMLEPEEIANVYLFLASDLASGITATTVSVDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bile acid 3-alpha hydroxysteroid dehydrogenase
molecule tags Oxidoreductase
source organism Clostridium scindens
publication title Crystal structure of the apo form of a 3alpha-hydroxysteroid dehydrogenase (BaiA2) associated with secondary bile acid synthesis from Clostridium scindens VPI12708 at 1.90 A resolution
rcsb
total genus 72
structure length 215
sequence length 245
ec nomenclature ec 1.1.1.395: 3-alpha-hydroxybile acid CoA 3-dehydrogenase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4is2A00
3SJ7A 3PHLA 3OEYA 4MVJH 1JN0A 1CERA 2XXJA 1SB8A 4B4VA 1KBZA 3AUAA 2P68A 2DT5A 1E3WB 5JC1A 1OOEA 3GZNA 3GUYA 2W2LA 3QJ5A 1WWKA 4J0FA 4D46A 2W2KB 2HDHA 3PZRA 3IDSA 1IYZA 1Z73A 2OHXA 3V5NA 3AI3A 1MLDA 5TJ9A 1HE5A 3IMFA 1ENPA 2X4GA 1DSSG 3D1LA 2VZ8A 4MVJM 3TRIA 2A92A 2QZ9A 4MIOA 4PGFA 4PCVA 5L95A 3DBRA 1JW9B 4PZDA 1HTBA 1GD1O 3L4SO 3VKVA 3WQSB 4IS3A 1X14A 2GASA 4CL3A 3JQ7B 1U3UA 3U4IA 1N7GA 5L45A 5CPBA 4AJPA 1ISFA 3TNLA 3WWYA 3L6OO 2YJZA 3D3WB 4CLXA 1U1IA 5KVCA 4XQ9A 1N5DA 1NP3A 3PLNA 1V8BA 5DP2A 4X54A 3HFGA 1SNYA 1K6XA 3AFMA 3PIDA 2VOEA 1RM3A 4CLOA 4UEOA 4ID9A 4ND4A 4HNHA 4OOEA 3GDOA 5JYEA 3ZWYA 2VHVA 1WVGA 3QLJA 1M2WA 2UAGA 4KUHA 1TI7A 2EW8A 1UXJA 4KWIA 1EBFA 5B4UA 2J3KA 4XQCA 2VWPA 5EERA 3K31A 3JYNA 1A5ZA 3O4RA 4UEKA 3NDIA 2Q45A 4YB8A 3ANLA 2FRDA 4Y6PA 4GKVA 3KYCB 1VC2A 1P9LA 1NWCA 4E5YA 2NVBA 1L7EA 3CH6A 2NADA 2EV9A 3W4IA 3RBXA 1NQ5A 4XGKA 4WNIA 1BDMA 3I9MA 1DIGA 2QRLA 2WSBA 1M6HA 1Y8RA 1SEPA 2E37A 5CP8A 4TRJA 5DBGA 4YXFA 1GUYA 4CODB 3WB9A 4I9UA 3G49A 4XB1A 5T64A 3WGYA 3FI9A 2VYVA 4BO0A 3HN2A 2NU8A 4FDAA 4BO8A 4P4LA 1IY8A 3PQDA 3AI2A 4L9RA 2UUOA 2O3RA 1WLYA 3V1UA 2I76A 3PEFA 4J90A 2G17A 1ISIA 1C0IA 2EF1A 5U9CA 3C85A 2BGMA 3WNQA 2WDZA 3CIFA 4OH1A 4QXMA 1LC3A 1YL7A 4YT8A 4TZTA 3PPIA 3ZU5A 5A5FA 2PZKA 1ONNA 5EN4A 4M54A 4RVHA 5H82A 2IYOA 2OFPA 5THKA 4EUEA 4FB5A 4O59O 1DIHA 1FF9A 3ROPA 1G6KA 3LVFO 3NDRA 4J91A 3EVTA 1MC4A 1OAAA 5A06A 4I5EA 2J3IA 4ZQHA 4URFA 5G0TA 2GO1A 2BH9A 4YJFA 5JE8A 4EW6A 5IDWA 3NT2A 2EIHA 3ABIA 4YJHB 3ZWOA 1XLTA 4F6CA 5CDTA 4QUKA 5KJFA 3HDYA 4O63O 3I9LA 4D3DA 3FN4A 1PQUA 1X13A 5IXYA 5KJ6A 4LRSB 3W1VA 3AUTA 5I9NA 1T4BA 4K6FA 5JPIA 1QYVA 3AY7A 3CZRA 5I7EA 1DLIA 3G79A 4R01A 4AFNA 4H16A 2P4QA 5IFLA 1YBMA 4MVJI 1T2DA 4RO0A 1P3DA 3IJPA 1NBOA 1ZSVA 2JD0A 2DUUA 4JGBA 3GEMA 3DHYA 1DJNA 4R68A 1E3SA 2X23A 1X15A 3ENKA 4OHUA 4LSWA 1KIFA 5KVVA 3IC5A 3BMQA 1JAXA 4J49A 3E9QA 2JKVA 1WDLA 3TN7A 4NPCA 3A14A 3FTPA 1YQXA 5TC4A 1PL7A 1T25A 1A72A 5CDUA 1NQTA 2XPCA 3GAZA 4AJJA 1UJMA 1TA4A 1Z6ZA 2WYVA 1GYPA 4A2CA 1B8PA 4A26A 1EUCA 1ZBQA 1ARZA 1QRRA 3F1KA 5AXBA 1N1GA 3L9XA 3GDGA 3OA0A 3OJLA 4PLPA 3PWKA 2X22A 5ENVA 4RF2A 3TZQA 3IS3A 4R5HA 4PZCA 1M75A 1ENOA 1ADFA 4E5MA 3OETA 3OEWA 4B3HA 5THQA 3QSGA 4AVYA 3VDRA 3ZNNA 4IGEA 4GI2A 4ZRMA 3RD5A 4IJVA 3CMMA 4RVDA 2R00C 3GFGA 1YL5A 2B83A 2R6JA 4YRDA 4WPGA 1EUDA 4XDYA 4E5NA 2Y1EA 4JJIA 4WCFC 3T4EA 3WDSA 3H9GA 4G5HA 3RAJA 4OQZA 1GFSA 3H9QA 2NVWA 4HFRA 4XX0A 4CM8A 2C29D 3INRA 3PFFA 5ICMA 3QVTA 3ZDFA 2XXBA 3GA0A 3CXRA 4CUZA 3HWRA 1P45A 4AJHA 2O3JA 4TQGA 3RC9A 2I66A 1EZ4A 3GEDA 1BSVA 2EJWA 3CPSA 4D41A 1QR6A 1LI4A 3JQGA 4FJ2A 1OFGA 2V6MA 2HU2A 1YBAA 2E49A 2ZB7A 3MOIA 1U2DA 2C54A 2FSSA 4ZRNA 4BGVA 5C3MA 4AJOA 3U09A 1YVEI 3I1JA 1RM4A 2A9FA 3U62A 2O3UA 2V65A 4HX5A 1WXDA 3EZLA 4IXTA 1OC4A 4EJ6A 3F1LA 2VRCD 1K89A 4HADA 1GTMA 3KLMX 1TT5B 2H63A 1A4UA 2V7PA 3ANMA 1DRWA 1I3MA 1I10A 2NTJA 3DONA 1YONA 3SVTA 4WK6A 2WJPA 3K2EA 1HF3A 1SMKA 3QA9A 3M6IA 1JWAB 2VCYA 4BOYA 3VZQA 3DHNA 3Q2KA 4OSOA 4AJ2A 1SC6A 4J2OA 4CMIA 5G0VA 3ZU4A 3P5SA 1HE4A 3OMLA 1O0SA 2GGSA 3GOHA 4P38A 1ONPA 1C1XA 4I9HA 3DZHA 1S6YA 2D4AA 2OP1A 3JQDA 3INGA 2Q2QA 2P9EA 2FZEA 4GSLA 2UDPA 4W6ZA 5DT9A 2DTXA 3KYDA 2YV1A 1XU7A 4RLHA 3DBRB 4ND2A 1C1XB 1ENZA 1UR5A 4QFCA 5LC1A 4QECA 3CMCO 1ZKMA 5TT0A 2OORA 2WWRA 3TF5A 1IUKA 1VSVA 3AM4A 2LDXA 4QO8A 2ZB4A 4XB2A 3EMKA 1EK6A 3VC7A 3I52A 5JAZA 5ILOA 5ER9A 2YV2A 1U3TA 4FJ0A 4E5KA 2Y05A 4TKLA 1J0XO 2B35A 5A3JA 1XG5A 3MWDB 4LCEA 1ZK0A 4TVOA 1KEWA 1DIBA 1GEEA 3H9EO 4U5QA 4I5GA 1QLHA 2AQHA 3GHHA 1E1MA 3FNHA 3LT2A 4PLTA 3RFVA 1YWGO 1NR1A 3FBGA 3NT5A 2BF7A 3F4LA 4XJSA 5BT9A 3WGGA 5T67A 1ADGA 1T2AA 5ITVA 3JQAD 1YS4A 1P31A 4PG5A 1MFPA 5GY7A 1UAGA 2PA3A 1P74A 4E2ZA 1AXEA 4CLHA 3OBBA 2RCYA 2PGDA 1S7CA 4RJTA 3ICCA 1PJTA 3T4XA 2HKIA 4EJ0A 4RDIA 2OO5A 4XYLA 3OA2A 1YDEA 3HE3A 1MV8A 3QY9A 1MGOA 1T2CA 3LZ6A 3MEQA 3PHHA 2FMUA 4R9SA 3WTCA 4BKQA 1WZEA 1P1KA 2X86A 1F06A 1CRWG 2DVMA 5H81A 1NX6A 3O38A 3LYLA 2Z1MA 3ASUA 3OJOA 1U7HA 1HLPA 3RCBA 1JTVA 3PDUA 1PJSA 3ORFA 4R3WA 4P22A 1E1KA 3FWNA 4E0BA 3KSUA 3O8QB 4B3IA 4YJDA 3WGHA 2VHZA 2Q1SA 3CEAA 4NJMA 5BSFA 2O2YA 2CF6A 3KYDB 3PIIA 1RPNA 1X7DA 1UP4A 3Q0EA 2C5EA 1JLLA 4HKTA 4KP7A 3PWSA 4CQMD 3NAQA 5IF3A 2D0IA 2PFGA 2VWGA 3DDNA 4DQUA 4E2WA 4N5NA 4J7XA 2W90A 3WQRA 4BO2A 3DQPA 3NGLA 2CDBA 3BZUA 3I5MA 1PGOA 1DDOA 5DF1A 4EZBA 2P5UA 1CQIA 2OL4A 4H7PA 4IDEA 3UCFA 2RH8A 3SXPA 1YBVA 1QV6A 3HJAA 2YQ4A 1UUFA 2CY0A 1E1NA 3S8MA 1T24A 4KMSA 4BNGA 4BO3A 4GGPA 4XGIA 3KOUA 4U0KA 1WDKA 4AL4A 4BNVA 1H9AA 1UAYA 1ZNQO 4I9NA 3H5NA 1V3TA 4Y98A 1Q0QA 3FNEA 1I36A 3RQSA 1V0JA 4IMRA 3B70A 4OIMA 5KKAA 5KKCA 3GY0A 5I8WA 3KUXA 4YACA 5EQFA 4XQGA 4WLUA 3RSHA 3ZHXA 3A1NA 2QIOA 3ASVA 3JQ8B 4Q3AA 5L3ZA 3W6UA 3TJRA 4RLSA 4PLGA 4BMNA 4WJZA 3E9NA 4ALMA 3ITDA 1ULSA 2Q3EA 2O50A 3MJSA 3ZW9A 3D5QA 1V3VA 2NV6A 3MZ0A 4N54A 2G82A 4NR0A 4BGUA 5C37A 3DTYA 4LMRA 1LDMA 4E33A 4E12A 3BYZA 3WFJA 4RGBA 3FCOA 5J23A 2AQKA 4U7WA 3VPHA 2Q99A 3DR3A 3GAFA 4KTTE 3VZRA 2QW8A 3UAGA 5A05A 4JNKA 4JLWA 4JK3A 4GLOA 4IDDA 4OKIA 4J4HA 1CJCA 1HT0A 3UCEA 2PGLA 5KJCA 1XEAA 2AW5A 4I5DA 5T8KC 3KYBA 1HDRA 3DC2A 1DBVO 2ZJ0A 1K3TA 2FHSA 1BRMA 4E31A 5JNLA 1PGJA 3WX0A 3JQGB 3WGZA 4BNLA 1XYGA 1O8CA 2O2SA 5B12A 3DAFA 3GF4A 4AJKA 1D7OA 2IZ0A 4NDNE 5L7TA 2HK9A 2VZ0A 2AEFA 5JAIA 3PRJA 3E5RA 2HK8A 2WYUA 2AE2A 3HNPA 3DOCA 4CQLA 3I9JA 5JO9A 3JQFC 4H3VA 4CUJA 1TXGA 5ILGA 2X58A 3UW3A 3FTNA 2JFGA 4BUCA 4EEZA 2ZTUA 1AN9A 3ANNA 2X5OA 3H5AA 4IDBA 4J4TA 4IIUA 4N5MA 2ZATA 3ADPA 3RU9A 1YH3A 2GZ2A 2Q2VA 3WBBA 4DRYA 2EHDA 3PYMA 1KEPA 1RM0A 5KVSA 2EG9A 3TDKA 1X7GA 1LX6A 4HXYA 2QX7A 3RUEA 2VWHA 2SCUA 4J1SA 4OO3A 5B1YA 1QSGA 4TZKA 1NNUA 1XDWA 2W2LD 1IHYA 3WYEA 1DJQA 1T4DA 5L51A 1VI2A 2C2XA 3ROMA 1EE9A 4R69A 3AWDA 1E3WA 1LLQA 3OM9A 4CM6A 3KXDA 1W4ZA 4O1MA 2OUIA 1HEUA 4RVSA 2IEDA 2HRBA 2JL1A 1ADCA 1PTJA 3X2FA 1E3IA 2ZCUA 3K30A 4BS9A 4IIVA 2WM3A 1NAIA 1K0UA 3GVPA 4PLYA 4Z3DA 3RBZA 4K26A 2DM6A 4WASA 4FFNA 2GLXA 1PJLA 2HK7A 3GG9A 4II2A 1ZSYA 5EPOA 4ZHSA 3DAGA 4KZPA 3UICA 2YW9A 1LUAA 3OIFA 3U0BA 4L0QA 5JCXA 4MKRA 4Z3KA 2VTEA 5TJHA 1HZZA 4WCFA 5HTOA 4RV9A 2FPPA 4QO7A 4FS3A 3JQ7A 4GQAA 4AICA 4EUHA 5BSGA 2PZJA 3DHEA 1FDTA 3FBTA 2PKQO 4QTZA 2W8ZA 4HP8A 1SBYA 1EE2A 2BFOA 4UVDA 3ZW8A 1BXGB 2ILTA 1GPDG 2HUNA 3L77A 1U3VA 4AJEA 1RWBA 1Y8RB 1EMDA 4BMSA 4CQMA 1DC4A 2NU7A 1MA0A 3COSA 3DZJA 4WOKA 2ZTVA 5A02A 4DPMA 1ID1A 3DXFA 3TOXA 3VKUA 2PD6A 1X1TA 3JQCA 1O5IA 2Q4BA 3PJGA 4XZ3A 3SBOA 1BWSA 4B4UA 4ZGWA 3O26A 5CAEA 4IINA 5TIIA 1A7KA 2VT3A 2C07A 4NK4A 2EKPA 3BTUA 5CDGA 4OXKA 4DIOA 4IS2A 4UVGA 1OMOA 2Y1DA 2RHRA 1JVSA 4YR9A 2PD4A 1I30A 4IDCA 5ICSA 3JQAA 4YWJA 4BL5A 5KTKA 4TRRA 1LDEA 3ZCXA 4MIEA 3WIEA 4R16A 3GPDG 1BXKA 3VHRA 4PRLA 1IL0A 1VSUA 1NWHA 2B0JA 4PLFA 1F8GA 3DO5A 4YPOA 2Q1UA 1E7RA 4RPGA 3ST7A 4WLEA 3JQAB 4FFRA 3ZV6A 1LDGA 2ZYAA 3OJEA 2EERA 2O4UX 4XEHA 3T7EA 5IJZA 5MDHA 1EVZA 2BHLA 1YDWA 5JY1A 4P4GA 3FPLA 4A27A 5B4TA 5GZ1A 1U5CA 1PJCA 1H9BA 3I4FA 3G1UA 4CV1A 4R1NA 1E7SA 1ZEMA 4E6PA 3OIGA 3NX4A 1X0VA 3HHPA 2E48A 5ES3A 3W6ZA 4D79A 3UKOA 2PTGA 1T2EA 3INTA 4GH5A 1PQPA 2FY8A 3QIVA 3VTFA 2QYSA 2LDBA 5BNFA 3ROKA 2GNAA 4R3NA 3LC7O 5EIOA 1XKQA 4RPLA 3TZ6A 2O7QA 4NBUA 1YQGA 4DVJA 4FOOA 2DTEA 3JQ9A 3A06A 5JO0A 3D5TA 4RZIA 5I7SA 1LDNA 5HS4A 5LCXA 1T2FA 3EYWA 5G0UA 2I9PA 1PU2A 1P1RA 3ZWPA 4CUKA 4CMGA 3U4CA 3FSRA 3U4HA 3E8XA 5I9MA 5I7FA 2D59A 2D3TA 3HN7A 3K8ZA 1FDWA 3TQHA 4LVUA 1EUZA 4Q3NA 1EQUA 4ND3A 1T26A 1HYGA 3CE6A 1H93A 4JIGA 3B1KA 5H83A 3F6YA 4TROA 1E3LA 3MJVA 6LDHA 3R6DA 1GQQA 2B4RO 3OF2A 4GKBA 1NHWA 1LLCA 1A4IA 2YHIB 1P1FA 4BNYA 4NQZA 2FN7A 4GX0A 2DBRA 5DDIP 4QEDA 1Y5MA 2CNBA 4Y67A 1E3EA 1Z82A 1B7GO 4OXNA 2WEKA 3WMXA 2B69A 4H15A 3NRCA 1MX3A 5T8KA 4PG6A 3BMQB 4Y9DA 1U3WA 2YHIA 3W8DA 2TMDA 5A3VA 1PJ4A 1UXKA 5IN4A 1C3VA 4ZQGA 2DBQA 1JU9A 1GADO 1NASA 2OBYA 1YRLA 2PD3A 3DTTA 4U6SA 3VVCA 2HMSA 1LSJA 3GN2A 3ZGYA 2G5CA 3LT4A 4R1UA 4IDGA 5IDQA 2V6GA 3ETEA 4LW8A 1TT7A 4UVIA 4BV9A 4RVUA 3VPXA 1R4NA 1DAOA 4BNFA 3RFTA 4ZQFA 4XKJA 4XR4A 4IBOA 4NK5A 2BFMA 1P0FA 3G1TA 3WNVA 3LDHA 4WEOA 2DLDA 3PGXA 2CSUA 2Y93A 2GN4A 2J8ZA 4MVJP 5ER6A 3WGIA 3V2GA 5HRUA 1IOLA 1Q2XA 4BNHA 1NM5A 4CM4A 3KV3O 2GPTA 1AE1A 3GVHA 2ZTMA 1NVTA 3NYWA 2AG5A 3DEYX 3K2BA 4MVJD 1CEQA 1E6UA 4JP2A 1UP7A 3VZSA 1BDBA 2XOXA 5IZCC 1K5HA 3GR6A 3PHIA 4WLFA 1FK8A 4XWYA 2PLAA 4BO5A 3QVOA 1BVRA 2VRCA 4DBZA 2P9CA 2DAPA 4Z0HO 4BKUA 2DQ4A 4S1VA 4JP3A 4ZN6A 2WD8A 2FWMX 1ZJYA 3QV1A 1ZO8A 3PK0A 2YDXA 1DC6A 4Z9XA 2DFVA 1EBUA 4BNZA 2B4TO 2O3SA 4AJIA 4YTEA 1GUZA 1WW8A 3UVEA 4BB5A 4OXYA 5F1PA 4IM7A 4PLZA 1J5PA 3GVIA 3SLKA 4J4BA 5U1PA 2W98A 3WS7A 5EESA 1ZUD1 1YKFA 1SAYA 3FR8A 2AA3A 1H94A 3HDJA 4QX6A 4ESOA 3NUGA 5FYDA 1O9BA 2AQ8A 4NFHA 4W9NA 4WKGA 1ZEJA 1B0AA 1J4AA 1C1DB 1VE9A 3AU9A 4BNTA 1NFFA 5JYDA 1SO8A 5BR7A 1NVGA 4TSKA 3OQ6A 3WG9A 5IN5A 2YY7A 1BGVA 2E6UX 5CHEA 4HUJA 1ISMA 3EC7A 2OZPA 4WCFB 1GPJA 2AG8A 5DN9A 4IGFA 4A0SA 5JY6A 1BXZA 1EDOA 1LC0A 5EMHA 3RFXA 1N9GB 3RUAA 3ZU2A 3KO8A 3U3XA 4E2YA 3KEOA 3WQQA 3WWZA 2C7GA 1PX0A 4DBVO 3GMDA 4OOFA 4NU6A 3E5MA 2OBNA 3LC1O 4JCOA 2AEMA 5AOVA 3QVSA 2FSVA 5HS6A 2E82A 3K6JA 3H2SA 4IQ0A 4CQMB 2VNAA 3GC6A 4BKPA 2NSDA 1HE3A 3PJEA 4GMFA 4NIMA 4XRRA 4BO4A 4ITUA 2NQ8A 2IE0A 4TVBA 1R37A 1P1IA 5TQVA 5IZCA 1VL6A 1C14A 3GRPA 1Z75A 1NFRA 2CFCA 4CM1A 2OGUA 4NU5A 2H5LA 4NH4A 4PLVA 4W4TA 3TL3A 1HZJA 4CJXA 2QG4A 1EDZA 2Z95A 1BHSA 4E5PA 2DTDA 3HDQA 4DLBA 1Y9EA 4YAGA 3S2EA 3FRJA 5F3RA 4XYGA 2VYNA 2ZJ1A 3MTGA 3OHSX 5C7IO 5F1OA 1EFLA 4CLEA 1KEVA 4YAEA 2NTVA 4IY1A 3IP1A 4OL9A 1ZMOA 1VJTA 2X9GA 9LDTA 1XQ6A 4CM7A 1PEDA 4B79A 3JD3A 1ZJZA 3AU8A 3FHLA 1HRDA 3F3SA 1EK5A 1V6AA 4RF5A 4DMLA 5F5LA 3BA1A 4WCDA 4JXKA 3NJ4A 3TZCA 5T5QA 3PFWO 4J1QA 3ON5A 2FPGA 4KQXA 3WGOA 3RBVA 4OKNA 1I5RA 1W0CA 2Y1CA 2YDYA 3AFNA 9LDBA 1GZ3A 3D7LA 1NPDA 4ZQBA 2PZLA 3NDJA 4CMBA 4A10A 3PYLA 3ZH2A 4L73A 1M6WA 5CDYA 2HMUA 4CMJA 2BELA 3C1OA 4MVJE 1MXHA 4TRNA 3NEPX 1AXGA 3EDMA 1QXSA 1Y6JA 4JBIA 1Q0HA 5BNIA 1NPYA 1KETA 3GLQA 2GUGA 3FNGA 4RF3A 2I65A 3UN1A 2Y68A 1LSUA 3S55A 3WSVA 2HMWA 3ZWMA 4BGEA 3F5QA 3PI7A 3WOHA 1GL3A 3GUCA 3NGXA 2GD1O 2FR0A 3GG2A 2W4QA 4GAEA 2OP0A 3W8FA 4CPDA 4Y8VA 1L1FA 1XA0A 2NTNA 4Z9YA 3I83A 3W4JA 1HL3A 1WDMA 2YFQA 2P4HX 3AM5A 3IIEA 3TWOA 3I9OA 1LJ8A 1P77A 4N7RA 1MG0A 3DZFA 1NYTA 1TVEA 3CKYA 3E03A 7MDHA 2DC1A 4Z9FA 3IKTA 3I9NA 4M1QA 4CM9D 2VOJA 3GQVA 1ML3A 3FF4A 3ZNOA 4CL8A 1IHXA 4RQTA 4ZU3A 4HNGA 4R5MA 1YO6A 2B4QA 4TKMA 1R4NB 1JKIA 4CMHA 2Y66A 1PL6A 4DA9A 3JQBA 3ADOA 4DMMA 1OZAA 4LGVA 4XDZA 4Q39A 1K6JA 2C5AA 3QE3A 3W4KA 5L4SA 1A9ZA 1HXHA 4PVDA 3LLSA 4C7KA 2GF2A 1YJQA 4BNUA 2OMEA 3K9QO 3H2ZA 4BMVA 4FJ1A 3CTMA 5C7LO 5JCJD 1U2GA 1FXSA 1PJBA 1I3LA 1Y8QB 3JQEA 4YT2A 1YJ8A 1E5QA 2BFPA 2EP7A 4L76A 1U28A 4NG5A 4QFDA 4JJFA 5KOIA 1N9GA 5JLAA 1BTOA 4BKRA 1C0LA 4CM3A 4DWVA 1JKFA 1MUUA 4PFJA 2O4CA 2J6IA 3PDJA 2RH4A 1XQ1A 1JVBA 1U8FO 5HWSA 2GDZA 5F1KA 4LISA 3BMNB 1RJWA 4R51A 4RVFA 5C7OO 3BIOA 3QWHA 1XU9A 1QYDA 3LT0A 3JQFA 4MP6A 1D8AA 1G0NA 1E1LA 2BI8A 3SLGA 1U5AA 3ULKA 4LRTB 4IDAA 2J5RA 1X1EA 1R4MA 1HDOA 4BNIA 5K6AC 1LRKA 2DFDA 5JW6A 3D3EA 5TGDA 4GWKA 3MOGA 1SPXA 1ZK3A 1QYCA 2HMVA 4IMPA 5A9RA 5KNLA 2XAAA 4CV0A 4L4SA 4XA8A 3K5PA 1I3KA 4DYDA 2Q46A 3JQ8A 4DREA 3ZWNA 1IZ9A 1E6EA 4UAGA 3U5TA 3Q3CA 5JDIA 2ZIZA 3SX2A 3LQFA 2FR1A 5ENDA 2EKQA 4EJMA 1VKNA 3UFXA 4QQRA 5BSEA 4NFSA 4CR6A 4B4WA 1IB6A 2E4AA 2IXBA 5HA5A 5KCZA 3X2EA 5JAQA 5ITWA 3ZV3A 4BIIA 3C7DB 1HYHA 5DULA 4XD2A 1KVTA 5JAMA 1H2BA 3S1LA 4TMFA 2J5KA 2RAFA 4DUPA 4I8XA 1IPFA 4RPKA 1KVUA 4L4RA 2C59A 3F47A 1N92A 2J5QA 4M49A 2QHXA 1HDYA 4DPKA 3DZGA 1M66A 2JFFA 2JD2A 1MB4A 2DUWA 3O03A 5U4QA 1PS0A 1B14A 3L6EA 3TL2A 4ZICA 3GZ4A 3O8QA 1B3RA 5EINA 4MJLA 3WICA 3DZIA 1ZFNA 5FWNA 1A71A 2JAPA 5A4DA 3RI3A 3ETGA 2P5YA 2NVUA 1GU7A 3KRTA 3NT4A 4PG8A 1WMBA 3K73O 5DBFA 2VYVD 2RHCA 2NU9A 5L4LA 3AUSA 1ZCJA 1NAHA 4K1LA 5L7WA 5JMPA 3R3JA 2D5AA 1F8FA 2HMTA 1DC3A 3NV9A 4PIVA 5COBA 4A73A 3STHA 1X0XA 2IODA 1Q7GA 3A9WA 5FI5A 3ZU3A 1VPDA 4RCVA 2PK3A 5L40A 3ZHYA 4W99A 2HCTA 2X0NA 3BHMA 1GEGA 3HSKA 4B7UA 4I08A 3E1KA 3H65A 1R0KA 3IOYA 5EJ2A 4FR5A 3O9ZA 4FD3A 3WBFA 4CV3A 2X9NA 2PH5A 3BMOA 1HWYA 3LF2A 3DOJA 4OJNA 1HDCA 1B26A 1RKXA 1EVJA 1WMAA 4FN4A 4F45A 4II3A 4RDHA 3QWIA 5IXSA 3HUDA 4YVFA 4R9RA 4CMAA 1NTOA 1A7AA 2EW2A 1RYEA 1E3JA 4GSKA 3PHGA 3RROA 4K9DA 4ND1A 4W7IA 3IL2A 3VVBA 2AXQA 2FOIA 2CD9A 3QWAA 3HDHA 3KETA 3KLPX 4MIYA 3C7AA 3OJFA 4M55A 2X0RA 2HAEA 3S2GA 1IPEA 1YL6A 2B37A 4MDHA 2O3QA 4WGGA 1VJ0A 4GWGA 4LCJA 4MP8A 1JWBB 4NMHA 1H5QA 3TZHA 1AGNA 4ONEA 4WUVA 1LDYA 1Y9AA 1UDBA 1I24A 2H1SA 1OC2A 1HYEA 3DFZA 5TSDA 3WJAA 3SJUA 3B20A 2IYPA 4J2HA 3ICPA 4NFYA 5TNXA 4BO9A 1H0KA 2C0CA 1N8KA 1YOVA 3QHAA 4W9NC 2A4KA 1MG5A 2FPIA 1H6AA 1LSSA 2VHXA 4XR9A 4WNCA 4M87A 3TFQA 1YB4A 5IG2A 4D42A 4YT5A 4KTVE 3L4BA 3RUIA 4W82A 1WPQA 2OXIA 1XSEA 5JXWA 3L6DA 1ISGA 4F3YA 3AY3A 3V2UA 3OIDA 3BTSA 3QRWA 5COAA 1CIVA 2QRJA 2HO5A 1LBEA 3GH3A 3JQBC 5CEEA 3VZPA 5BNTA 3EGOA 1FDUA 3QWFA 1EVYA 2RBEA 4TRMA 3DL2A 3BAZA 4OGWA 4G65A 3BMCB 1H2HA 2Y67A 5AQ1A 2PZMA 4HBGA 4ALKA 1NXQA 4N5LA 4GX2A 4L74A 3WYBA 3D64A 1H6CA 5G0WA 3GMSA 1KY4A 1LRJA 4Z0PA 3GGOA 1VKOA 1XR3A 1SCUA 3HZZA 4E2XA 4EYEA 3IUPA 4FC6A 5KJEA 1P0CA 3HADA 4YJGA 1R15A 1UDCA 4DIFA 4LK3A 1PZEA 4F6LA 2UUPA 2O48X 4YEDA 2QQ5A 4XRGA 1BG6A 4J1NA 3KYCA 5L9AA 2Q50A 3UH1A 4PLHA 1QLJA 1YOVB 2IZZA 2P9GA 4M86A 3FPCA 3GVXA 2X7HA 5A5EA 2EEZA 1B8VA 1KVRA 1BW9A 3JQ6A 4GMGA 3ZV4A 3PYXA 3H3FA 4Q3BA 1I2CA 1QG6A 3AK4A 3T7CA 4HWKA 1VJ1A 2P91A 1JQBA 3DWFA 3PQEA 4BNJA 3AJRA 5FF9A 5IDYA 3C8MA 1OI7A 3AOEA 4D7AA 1GV0A 2IZ1A 4NI5A 4XQEA 1P1JA 4FW8A 5IAAA 4ND5A 3IAHA 2DPHA 2DBZA 3WSWA 1ADBA 3FD8A 1GR0A 1O94A 2AQIA 1E92A 2PR2A 4NZ9A 4YJFB 3VH2A 4WE3A 3VPGA 2O7SA 4CR7A 1QP8A 1LA2A 3ROQA 5AVOA 3OECA 4D3SA 1FDSA 3GNTA 5LDHA 3Q1LA 4L8VA 8LDHA 3E6AA 3AOGA 5KJ1A 4DL9A 3ITKA 4CMKA 4E32A 4UULA 1KVQA 1FDVA 1U9JA 3B1JA 3GHYA 4ZVVA 3U9LA 4QT0A 4AJNA 2CMDA 2I3GA 1I3NA 4RPJA 2NNLD 3BMCA 4D43A 1IE3A 8ADHA 4PLWA 1YB5A 2GERA 4FGWA 1X7HA 4GPD1 4LN1A 3ZHZA 4B7CA 1Z74A 4IJUA 1ZXLA 2ZQZA 3M2TA 3SC4A 4ALLA 3IQDB 1QKIA 5DBIA 3RJ5A 4CLRB 1QMGA 2BRUA 1C0KA 1I2ZA 5F5NA 3A4VA 1F12A 3I23A 4NHEA 1HKUA 4GL4A 4NBVA 2H9IA 4O6VA 1WAMA 1JA9A 4Y6RA 1XWFA 4DC0A 1GZ6A 3DBLB 4EITA 2X8LA 3H4VA 1CYDA 5KWEA 2H6EA 3D4OA 4FCCA 4QSMA 2QYTA 2W2KA 3ETDA 4KQWA 4Q3CA 3WLFA 1B15A 3VPSA 3M2PA 4O5OA 2AHRA 2IDZA 2PKRA 4OSPA 1ZH8A 4I1IA 1EQ2A 2EWMA 1O6ZA 2HQ1A 2NU6A 3RJ9A 3QVXA 1VM6A 3HFSA 4CQLB 3WGTA 5CEFA 1LEHA 2NQTA 4R1SA 2C82A 2FZWA 4FQ8A 2VHWA 4YQYA 2CDCA 4R54A 2AEJA 1NPTO 2YFHA 4XJTA 3M1AA 2C20A 1PWZA 4RPHA 5TT1A 2OOSA 3I6IA 3OSUA 1YQDA 4KOAA 4BNKA 1VLLA 2AE1A 2JCYA 3PWZA 4BO1A 5IDXA 1R4MB 1GQYA 1LLDA 4J9UE 4JJGA 3EK2A 5KVQA 2EXXA 3F46A 3EAGA 4CMEA 1O95A 4CMCA 4CLRA 3N58A 4PN3A 3HB4X 3RIHA 3FR7A 1KVSA 2NLOA 3K92A 4IJWA 2GZ1A 1CF2O 3D0OA 1C1DA 4BV8A 3WGQA 4DQXA 2ET6A 1E0DA 5DCUA 4RQUA 5G4KB 3MWEB 1PGNA 1XGKA 4BGIA 1LU9A 3GFBA 4CM5A 4DPLA 2TMGA 4RORA 3RUHA 1PS8A 3P7MA 3ZZNA 3I6QA 1PR3A 3EW7A 4DLAA 3RKRA 3P19A 2Q1WA 4BKOA 4CM4B 1FJHA 5LDGA 5T6BA 3UUWA 5K6AA 1EEHA 1OBFO 3EY4A 1U7TA 3UF0A 1DHRA 3Q11A 3NJ8A 5CG2A 4B8WA 1E7MA 1KEUA 3WR5A 3RUFA 3ZWWA 2BLLA 3HG7A 2G0TA 5JDCA 1A27A 1I2BA 2CVOA 1F17A 3I9KA 5L53A 4DIBA 4BO6A 2BGLA 2X0IA 1PGPA 2I3AA 2CZCA 4WLVA 5ADHA 1GCUA 1PJ3A 4NBRA 2Y1OA 3KSDO 2ZQYA 4RVGA 4D0RA 3KZVA 3BXXA 3AUUA 1ZSNA 2JFHA 2O3TA 4MINA 3Q2IA 1LXCA 2NVUB 1DOHA 2JJYA 4GGOA 1GAEO 3EHEA 4A7PA 3RWBA 3LU1A 2VYND 1DEHA 2I67A 1I0ZA 3OICA 4D45A 3H9JA 3OQ1A 1TT5A 3DMYA 1NFQA 4ZD6A 2HRZA 4Q9NA 1CDOA 4FGSA 1KERA 4GBJA 1DC5A 5A9SB 2C7VA 1HETA 1ZMTA 4BQRA 4K28A 3BTVA 2FP4A 2HSDA 4PLCA 1ZIDA 4B4OA 4FFLA 2CUKA 3JSAA 2Y1FA 1NR7A 4TWRA 2UYYA 4CV2A 3CSDA 4FFOA 2IXAA 3TZKA 2VRBA 3ZV5A 4WOJA 2DU8A 3CUKA 4RF4A 3JYPA 4PG7A 1GCOA 2ZB3A 4GVLA 1HDZA 4D44A 1QV7A 1PSDA 3DZKA 1CWUA 4S3MA 3LC2O 3IJRA 4ZQEA 5DNAA 4UEJA 1D1SA 1DFIA 2O23A 3MJTA 5DZSA 5JMWA 4WLNA 2FR8A 3MJ4A 3VAZA 1G0OA 3ONDA 1XELA 5JSFA 1C0PA 5B4VA 1LDBA 3ZWXA 2ZKLA 1DO8A 1Z7BA 4GX5A 2BD0A 4FC7A 2PV7A 3ZWCA 1V9LA 3H9UA 3RKUA 4J43A 3WYCA 4OQYA 4F46A 1SOVA 2NUAA 2Y0CA 3N74A 3PJFA 4NJMB 2Q49A 3QW2A 1J6UA 2GZ3A 3EVNA 2PH3A 4JROA 1MFZA 4CMIB 2QZZA 3JD4A 1N2SA 1HLDA 4YDRA 3JQ9C 1PIWA 3DBVO 4J6FA 4J3FA 1FMCA 3DOOA 1ZK1A 1HDGO 1R6DA 1ULUA 4L75A 1PZFA 3S2FA 6ADHA 4HFMA 2IEBA 2POQX 4HY3A 3DBHB 3R0IA 2I99A 4EUFA 4GLLA 5KIAA 1ENYA 3VTZA 3RVDA 1KY5A 3P2OA 5CEJA 4ALJA 3PHJA 3DB2A 2J3JA 2ZB8A 2VUUA 4XGNA 2ZCVA 1ZK2A 2NWQA 2VZ9A 4IPTA 4OYRA 1R0LA 4ZA2A 5CG1A 3EUWA 5COQA 4AG3A 3PGJA 2BGKA 3E48A 2VQ3A 2Y99A 2DPGA 2X1HA 4XIJA 4M8SA 4FIZA 1Y7TA 5AYVA 4R1TA 3G0OA 3UHAA 1QYWA 1ZVMA 2GYYA 5JCJA 3C7CB 4ALIA 5A9SA 2YHUA 2I5PO 2JAHA 1Q1NA 1Q7CA 1ORRA 1M67A 2CVQA 1YB1A 3M1LA 3Q9UA 1B8UA 2F00A 3DAPA 2HLPA 3RASA 3FWZA 4U8GA 1T1RA 4AJ4A 4CR8A 4CM8B 1UDAA 1QYXA 4WECA 4DLLA 3Q9NA 3MJEA 1GV1A 1DB3A 1L7DA 1I32A 3D4NA 5CPFA 1Y1PA 1AHHA 5K0ZA 1HE2A 1R12A 3NTOA 4ROSA 1H6BA 3VPFA 2PGJA 4B8ZA 3QP9A 3RUCA 2QRKA 3BMNA 4BB6A 4XYEA 3VH4A 1Y5RA 4YAKA 2UVDA 4OMUA 3LSYA 1KC3A 1SB9A 1BW9B 1R16A 4J16A 1D1TA 1Z7EA 2VUTA 3KSZO 4YCAA 2WD7A 4YA6A 1HSZA 3DZBA 4K6CA 3GNQA 1N7HA 1NVMB 4PRKA 1P33A 3UOGA 1J49A 3VDQA 1JKJA 1PL8A 1D4FA 3MJCA 1W6UA 4IZIA 5GZ6A 2HJRA 4UUNA 3DBLA 3LF1A 2WD7B 1SEVA 4UUMA 3OP4A 4J0EA 4J7CA 1UH5A 1VRWA 3K96A 3SC6A 1K2WA 5A9TA 1UZMA 1H6DA 4M89A 3LT1A 4MKZA 3WXBA 1HDXA 2ZTLA 4BVAA 4MOWA 1BMDA 3RC2A 3V1TC 1UZLA 5EQDA 5K9ZA 1W8DA 3GN1A 1E7YA 3KTDA 4GX1A 1F14A 1PJ2A 3P2YA 4KWHA 4XYMA 1KYQA 3PLRA 4INAA 1CQJA 1DRUA 2YV3A 4JQCA 3I4CA 3L07A 4MO2A 2EGHA 1XIVA 4UUOA 3KEQA 2PWZA 3JTMA 4ILKA 5CFZA 4KUEA 2GR9A 3VH1A 2WYWA 2JHFA 4LSMA 3F4BA 2VN8A 1D3AA 1SZJG 3ZN2A 1U4SA 3BHJA 3H8VA 3TPCA 5DCWA 1UXGA 2CF5A 4JX8A 3GPIA 2Y0EA 4D3FA 4EBFA 1E7WA 3C1AA 1ZK4A 4IDFA 1UXIA 3KBOA 1PS9A 4RZHA 1KC1A 5TF4A 1Q7BA 1U4OA 1A9YA 1PQWA 1Q0LA 4B3JA 4C4OA 4E4YA 1VL8A 5I7VA 3PXXA 1NHGA 4G2NA 5DOZA 4YAIA 5G4KA 3A28A 2R00A 1I01A 3NTRA 2Q4EA 4KDEA 2X9VA 5B37A 4HFJA 1TEHA 3R3SA 4Z0TA 5A03A 1P1HA 1XCBA 1Z45A 4W7HA 1LQTA 2VTDA 1KOLA 3FNFA 4IUYA 3UXYA 1ISJA 3MTJA 4PG4A 5G0SA 4MVJF 2A94A 5FEUA 4P8RA 1EVIA 2AMFA 2X6TA 2J3HA 3E82A 3HQ4O 5AXCA 3IKVA 4UVHA 4UREA 3AOEC 4ALNA 2G76A 5F21A 1O89A 3V8BA 2JCVA 4LMPA 5IZ4A 2X0JA 2WE7A 1RYDA 2B5VA 3ENNA 4RL6A 1GQ2A 4EEXA 3C1TA 3GEGA 3TSCA 5BQFA 4WEQA 2EGGA 2XF8A 3D4PA 5GZ3A 3BTOA 3GVCA 1WNTA 2RIRA 3LLVA 1GYRA 2VUSA 2DBVO 1DIRA 3WLEA 2YQ5A 2VNSA 3CZMA 1DAPA 2Q1TA 3D3WA 3I3OA 5AXAA 1BVUA 1E5LA 2HJSA 1TB4A 3OJ0A 4FFPA 3ONFA 3OQBA 3QQPA 3ZWAA 3UGKA 1MC5A 4JBHA 3N7UA 5JDIC 4UUPA 2I6TA 3NTQA 3L4BC 5L4NA 1AUPA 2GN8A 3F9IA 1PGQA 5TS3A 5TRTA 4BQPA 4DXHA 4ZJUA 2V6BA 2IRWA 3SEFA 2JCXA 4NJOA 1DPGA 4JBGA 1LTHR 3F5SA 4J9VA 4U6QA 5I8ZA 3L9WA 3JYLA 3ZNPA 1P44A 4AJLA 1GUFA 3ZI0A 3GRKA 5L7YA 3JCZA 4E3ZA 5EL0A 3C24A 2NM0A 1IULA 3UCXA 2PY6A 3B6ZA 4N18A 1B2LA 4CMEC 2JD1A 1Y8QA 2B5WA 5T57A 1I33A 4IZHA 3JD0A 4D0SA 4BNXA 3VH3A 2WE8A 1R0SA 4EI2A 2ZK7A 3U49A 3WMWA 3RC7A 4DQVA 3ZHBA 3DMTC 4HFNA 1Y81A 1E6WA 3DFUA 1LNQA 2EJVA 3KVOA 4O0LA 4R4JA 4J1TA 2X5KO 3ZWBA 1UZNA 4FBGA 3JYQA 4XYBA 2EP5A 2G1UA 4DTIA 4DC1A 1W73A 3OH8A 3V1YA 4EDFA 1LRLA 3PQFA 3V2HA 5C5IA 2Y0DA 1I8TA 1YXMA 2GN9A 3LK7A 4XCVA 3Q6IA 5CDSA 3BMOB 2PKQP 1AHIA 5DOVA 5A1TA 4BHTA 3WTBA 2F1KA 2UV8A 3L0DA 4B7XA 4E13A 2YZ7A 2D5CA 1G1AA 1UXHA 4DGSA 3ZNQA 1K6IA 5A04A 1U8XX 2A35A 4R41A 1HSOA 4L4XA 3CINA 2VT2A 3H3JA 5MGBA 5BSHA 2D2IA 2R2GA 4P4NA 4Q3DA 5JS6A 5TLSA 1QORA 4YAJA 4YT4A 2BMAA 4YJGB 3WIDA 1LLUA 2YYYA 4MVJA 1B3BA 3U4DA 1PJQA 3WFIA 3S2IA 7ADHA 4IQGA 4FPXA 4Q3EA 1KS9A 4BNNA 4C7JA 5G2OA 2NACA 3AM3A 1DFHA 4YJHA 1LQUA 4KDFA 3QWBA 3AW9A 1JAYA 4MP3A 4DYVA 1UP6A 3IP3A 4CLDA 3KM0A 3E9MA 4MVJG 1V3UA 4G81A 3GT0A 4PZEA 3PJDA 5DCYA 3TOZA 4CLOB 4FFMA 1PR9A 2Z5LA 4Y6SA 4YRAA 4BNWA 1R66A 3DBHA 5JFOA 2CVZA 2D1YA 2BKAA 3BHIA 5FI3A 4PVCA 4BO7A 2ZYDA 1CETA 1DLJA 4IXWA 4OAQA 1TLTA 3GNSA 4NBWA 1WP4A 3C3XA 3B1FA 3JV7A 4FOSA 1VL0A 3DMTA 1NQAO 4HV4A 5JC8A 1V35A 4OM8A 1DHTA 3RU7A 1YE3A 3WJ7A 5JBIA 1XHLA 3R1IA 4IQ8A 2X5JO 4FSHA 3RUDA 4WLOA 3MCVA 1NQOA 3KB6A 1DXYA 1MP0A 4AJ1A 2C2YA 2D8AA 2BI7A 3GDFA 1E7QA 2VWQA 2GN6A 1SOWA 3NKLA 1JDJA 1YGYA 4NNJA 4E30A 2ZYGA 2WMDA 1DRVA 2PNFA 2VHYA 2V6FA 5I9LA 1DFGA 3IUSA 1EFKA 3GGGA 5DP1A 3PP8A 5GMOA 3PTZA 1PZHA 1ISHA 1N1EA 2YUTA 2P2SA 1BXGA 3GK3A 4XIYA 1GZ4A 1MXFA 3EZYA 5FFFA 1DIAA 2EKLA 4I5FA 1ZW1A 4UVEA 5G4LA 1GY8A 4YQZA 4KUGA 1T1SA 3HB5X 2Q2WA 3H5RA 3RC1A 4YBZA 4MKXA 3E18A 4A03A 1GDHA 1ZZEA 4YRBA 3H6KA 1LSOA 4GVXA 1ZXBA 3W8EA 4EGFA 3VOSA 3ZWVA 1ONOA 1M76A 3JD2A 4NBTA 1B16A 2CDAA 3QVWA 2Y1GA 1WZIA 2DKNA 4YYZA 2GSDA 5TX7A 3JYOA 4LVCA 1RM5A 2WTBA 1PWXA 3PZBA 3KHUA 2BFAA 4MPDA 3G17A 2GRAA 4CM9A 5HM8A 3G3EA 5HBRA 1E77A 4A5OA 3AY6A 4JN6B 4J7UA 3TFOA 4BNMA 3PVZA 1GYQA 3H7AA 3JD1A 2B36A 3AI1A 5AXDA 1IZ0A 2GCGA 4U0JA 2Z1NA 1F0YA 1PZGA 3ONEA 4Z6KA 3OFSA 5JDCC 4E21A 2JHGA 3GGPA 4IJKA 3GZNB
chains in the Genus database with same CATH superfamily
4YECA 2JIRA 3WV4A 3EG9A 4KRXA 4MVJH 1E62A 4YCDA 3SFTA 2CLIB 3CX8A 1JB1A 5KYYB 4F12A 4BXOB 1DZIA 2I62A 5AUNB 4DADA 1EJ2A 4V39A 4CKBA 5FTKA 4YUYA 2OYRA 2QV7A 3PUVA 4Y9RA 1BGXT 4BQSA 2LKCA 2M1XA 3SC3A 2HDOA 1FRVA 3CZQA 3GZNA 5MGNA 4OI0A 3D31A 3LPCA 3QJ5A 3R0ZA 4UATA 3DLPX 3TS1A 3ROEA 3OCVA 5G40A 1S89A 2WB4A 4IQ4A 3PZRA 2J87A 2PZGA 1BE1A 1IYZA 2OHXA 3IDSA 2OQVA 3FSGD 1X8LA 3DPIA 3K9WA 3V8RA 4F21A 5FI1B 2XKKA 2WILA 3SS7X 3QF4A 3IMFA 4IX1A 2VZ8A 5LA6A 2FW8A 2VL7A 2QZ9A 4MIOA 4PCVA 5L95A 3HA3A 2GBPA 5NULA 3UT5B 3NGMA 2NO9A 3TEMA 5E7IA 4XFJA 4PZAA 5TVKA 1BQEA 2XLCA 4C0XA 1HQKA 3MUFA 4IV0A 4CL3A 4DUGA 4N7JA 4ZO4A 1TECE 5ICGA 3U4IA 5EVCA 4O3FA 3B5EA 5A4KA 5CA0B 5CK4A 2EBUA 5L45A 5CPBA 4AJPA 4LNUA 1RNLA 1ISFA 1NW6A 1QYRA 4X61A 3BGOS 3UAXA 4BN5A 2A1IA 2YJZA 3QNUA 1U1IA 4ZKDA 4TS9A 5I48A 2JLZA 4UM8B 1KFJB 3PLNA 4A5SA 1LBIA 1P8JA 1TZ2A 1UC5B 4N7BA 2IHYA 3JALA 3Q7TA 1S9DA 4JBWA 3BB4A 4CDRA 5CYGA 4CLOA 5EHZA 4UEOA 4EUKA 2V7UA 4RTRA 2MSEB 1OLSA 4ND4A 3Q3JB 4H6WA 4HNHA 2DOKA 3ZIAA 3S1SA 1PZNA 5EAIA 1QUEA 3T9EA 1G3RA 2FX3A 2VHVA 3A1UA 1KYYA 1TQ2A 2GZHA 2P11A 5EKSA 4C22A 3R7DA 5CVEA 4BQNA 3A6ZA 2DKFA 1TI7A 1E9SA 2AZ4A 1XK7A 3IQHX 4POOA 5B4UA 3KLNA 4H7HA 2QV0A 4GKJB 2J3KA 2CLEB 1FJGB 5LYYA 3H04A 3H5IA 4JLUA 3SIRA 4EY7A 3JYNA 1A5ZA 4UEKA 2NO1A 4YB8A 4LI0A 1VLMA 2QPLA 2OO5C 4C14A 5B58C 4QL3A 2XT6A 1VC2A 2XRFA 1G5HA 2JGIA 1L7EA 3QEOA 4WKNA 5JD5A 1FVXA 2EV9A 5B64A 2NZXA 3LDFA 2Q6IA 1NQ5A 1UM8A 1JILA 1XXHB 4XGKA 1AVTA 3KR2A 2AJTA 5CFQA 4MKFA 3RIYA 3I9MA 1DIGA 2FRVA 4UZSA 5EIBD 1Y8RA 5D5HA 4IVPA 3SIXA 4HQOA 5JBNA 1GA4A 4LIPD 2Z4TA 3KB8A 2Q3HA 2FSIA 1YUBA 3F5FA 4P83A 4QU5A 4BPRA 4CODB 3CZPA 4F2GA 3FPGA 4FYMA 1QE0A 3IAUA 4UNPA 3AR9A 1NVDA 2JI4A 4BO0A 3HN2A 2EBHX 4FDAA 1K9SA 4Q1CA 3TE6A 3ZCRA 5E7MA 4BFVA 2ZYTX 4NCAA 2VBFA 4YRJA 5LXTF 2ZJYA 2IC5A 2UUOA 2IPOA 3NBAA 2RGDA 4X7RA 3V1UA 3OPVA 3W6OA 3I76A 3ENVA 1L3CA 4NOKA 2DR3A 4J90A 3CH4B 1NG9A 1JDTA 2A0YA 4IUCS 2EF1A 1U8AA 4LYJA 4UMVA 3C85A 4Q9JA 5CFRA 3WNQA 2CXHA 2R6R1 3CIFA 5ARDA 4DSAA 4B3RB 2WPDD 1NSFA 1YL7A 2QAIA 5IBCA 4NFLA 4TZTA 2ZWVA 3FOEC 3HSYA 4C0AC 4IXDA 4M54A 2OFPA 1XLWA 4O59O 2XWSA 2ZR9A 4DMHA 4N8DA 2JVIA 1U98A 4IHAA 3P32A 4ZKEA 3TD6A 1FFHA 4EECA 1PK8A 1MC4A 1OAAA 3DTVA 4AF7A 2J3IA 5A06A 5JALA 5KSYA 3EPLA 3N8HA 4GBED 4DBLC 2EG5A 2GO1A 3QX3A 1OX4B 1KZ9A 3B9RA 3C3EA 1T8TA 3RTCA 1M8FA 2FUNB 1FCJA 5CTAA 4K03A 1ZHFA 3KJEA 4QUKA 4A0QA 4Q1DA 1C1HA 4O63O 4DXAA 3I9LA 4H59A 2WVHA 3CISA 1ZS9A 5EPEA 1XZJA 4WOPA 1RMYA 3EXG1 3DD1A 1QWOA 1T9HA 2C8KA 4LRSB 1DAKA 3GFRA 3IEKA 3C6MA 5I9NA 2D1TA 5JPIA 4FP9A 2PKWA 4AJ9A 4XAQA 2QPOA 2J32A 2GPSA 4Z2AA 2J67A 1EX1A 3G79A 4AFNA 5FBVB 2WQZA 2JGNA 3W5CA 1YBMA 3GCDA 3NTXA 1Q83A 1T2DA 3B6IA 5CIWA 4ZARA 3IJPA 3UG7A 2ODPA 3C8HA 4X3CA 4F1KA 3JVEA 4R2KA 4KNYA 4PZUA 2FVXA 3BG5A 3P2IA 1KIFA 4CI0B 1YNOA 3IC5A 5KVVA 4FZ3A 1AUQA 1JAXA 2NO0A 4P3NA 4PIPA 4Z53A 2DWQA 4NAVA 1PJ8A 1XYVA 1F2UA 3MMPA 3AUFA 2GD2A 3MS2A 3TN7A 1AH2A 2B1JA 1VLVA 3TW8B 5K09A 3NP9A 3WGKA 2ZGVA 3U4AA 1UQUA 2QD3A 4XASA 2GBCA 3NC0C 3TQQA 3DYVA 1UJMA 1BE6A 1TA4A 2OV3A 4OJKA 1PV4A 1T6NA 1F0PA 4CKEA 1QRRA 3FUVA 2C03A 3NANA 4G0UA 1II0A 3D54D 3L9XA 2FUKA 3AC0A 3AXSA 3BSWA 2JLQA 3OA0A 3PF9A 4JLBA 3RWOA 3BF8A 1A98A 4QODA 1EFTA 5ENVA 3I45A 1ZPDA 3ACDA 1ZKDA 3N8DA 3F74A 4OFZA 3VR5A 2JARA 4KC0A 1OBOA 1YASA 4HOYA 4CT0A 4HRAA 1DCTA 2OVFA 4QD3A 2FFJA 3JQPA 3OCJA 1IJKA 1HPLA 1QH1A 2D5BA 4OQLA 1P9NA 2QVYX 2G9RA 3W3AA 2Q7XA 1G9TA 3OZSA 3EIQA 1K75A 5TPZA 5KWIA 3OFJA 4YRDA 3TQIA 2R1TB 4E5NA 4ZT7A 5JWRA 2XYHA 4JJIA 2IS1A 2IYLD 2OILA 1OAOA 3AF3A 1P3Y1 3WDSA 1WSWA 2AR0A 3IB6A 3IJEB 4G5HA 4WACA 2CJYA 3COJA 1JPNA 1E89A 2QZJA 2HTFA 4K9KA 4L5JA 3D3KA 5EJ5A 3OCYA 2OCIA 4MQBA 4RV5A 4HFRA 2F3SA 4EZIA 1XLTC 1MQAA 1Q7EA 4TMYA 2VK2A 3PFFA 5G53C 3ZHRA 4CM8A 5ICMA 1SXIA 3CXRA 4CUZA 2NZWA 3HWRA 4N3BA 4A1OA 5DV9A 1XQYA 4X63A 1RLJA 2XUOA 4M7RA 2EJWA 2ZAIA 3CPSA 1LI4A 1EFVB 2ZAMA 3NBUA 1OFGA 2AXEA 2MYNA 1Y1TA 1SU6A 4HUQB 5DMXA 4A3SA 1HL7A 1QH0A 2BFDB 2I7DA 1E32A 1XTBA 1YBAA 2E49A 4HS9A 1U2DA 3ZI4A 1JDVA 2FSSA 3VC3A 2O1EA 2PX2A 4ESEA 1V6CA 2A9FA 2B7LA 4HEA1 3U39A 5FAXA 5ALEA 2R79A 4LRWA 1QUFA 5CW2A 4Z54A 1QU3A 3F1LA 2C5LA 1WMSA 2CJXA 3JXEA 5IHPA 1WO8A 3KLMX 4HADA 5BMOA 3D6NB 3HCRA 1JHDA 1L5MA 2FPUA 2C84A 2V7PA 3CRW1 5EXDA 1XTSA 1P2VA 3U1VA 2P6OA 1HF3A 1SMKA 3QA9A 1C50A 3UWPA 3M6IA 3QE4A 1UEXC 1MW8X 1V8PA 2VCYA 2NPFA 4RK5A 2EOAA 4ECAA 2P0AA 3VU9A 2RHTA 1ZHOA 3V6MA 3ETLA 3O5AA 4HEHA 5G0VA 5SZKB 3OMLA 4BB9A 5CW1A 5L3SA 4MVYA 4PFSA 1B6RA 4I9HA 2JLYA 4DS3A 5LXTA 2GXUA 2BTOA 3N2LA 3INGA 3O3OB 2P9EA 5CB8A 3GFFA 4UHCA 1DAFA 3JX9A 5TEVA 1ODJA 4JVLA 3ZCQA 3AETB 2C7PA 2DTXA 4JC4A 1ML4A 2YV1A 1NVEA 2GX6A 4P33A 4YMWA 2JFPA 3WKCA 3K1TA 4ND2A 2OBFA 1C1XB 1ENZA 3HUUA 5KCMA 5F33A 2AFHB 3SHWA 1ZKMA 4Q01A 5H7XA 2QJOA 3V7NA 5LKAA 4X0EA 4B0PA 3TF5A 1OQAA 3B78A 1EDDA 4FMPA 1N7IA 1EK6A 2H2IA 4Y9UA 4MS4A 4RX1A 5AVXA 4PC1A 4INJA 2Y05A 3RVMA 1Z68A 1ZGHA 4C6TA 2B35A 4QOSA 4E07A 4WZAA 1QK4A 1UCFA 3MWDB 1ZK0A 4TVOA 3K16A 2YN0A 5F23A 1PT6A 3GJ7A 1IK4A 1PD1A 3WAJA 2JGKA 4U5QA 2IA5A 2XCOA 5AKZA 3FNHA 4DCSA 3CUTA 2ES4A 1YWGO 5FJIA 1NR1A 4RETA 5FLXA 3NT5A 2L2QA 2Y0PA 3P94A 2EHJA 2AH5A 1S3SA 1ZCAA 2LBPA 1MB9A 1FIUA 4EEKA 3NALA 1QO0D 2PRSA 3G82C 4GICA 2Y27A 3Q15C 1T3GA 1R8XA 1MFPA 1FMTA 1SHUX 2O0HA 3BXGA 3CLUC 4R2MA 5HF6A 5C35A 2PA3A 4OMCA 3NUZA 2PGXA 5E0OA 5AT1A 3SHFA 3USZA 2GTPA 3OBBA 2IS6A 3IP5A 3EQ8A 3VPBA 3ICCA 4IILA 3FTQA 3T4XA 1ZRNA 3HBJA 2OO5A 5EWMA 1JLSA 1X19A 1E64A 3OA2A 1YDEA 1UKAA 5K3FB 3GLSA 1EDEA 4MULA 4G37A 1PG2A 1T2CA 4NHOA 2AKAB 4DXDA 5L3QA 5FL7A 1IVSA 4O8CA 3B1XA 4TS1A 2WUVA 5BQ5A 1ZICA 3A27A 3PXGA 3MFQA 4FW9A 1SBCA 3A1DA 4V0OA 5AJWA 3QELB 2X86A 1W5TA 5A4FS 3C4QA 5LBUA 2FWAA 1ODKA 2GYUA 1GVHA 3G5MA 3R8FA 1YR3A 1QBGA 1ZWLA 3L6BA 3ASUA 3A6PC 2DCUA 3A70A 1JTVA 1AT1A 4R2WA 2GAIA 3R74A 3B9BA 1I2MA 5KYKA 2V0CA 1QB7A 3KZ1E 2WJHA 4P22A 4W5HA 1VA4A 1XALA 4RELA 5HPYB 4KR3A 3R7SA 4DV7B 4U6NA 3WGHA 3DTNA 1MJFA 2A7XA 3D0RA 4NJMA 3FYUA 5HVNA 2EIXA 2HQSA 3BCUA 3F90A 2QNRA 4FB4A 2JAWA 1P19A 3KYDB 3PIIA 1RPNA 3Q0EA 2ZRJA 1LWNA 4Y2TA 4FEGA 4X92A 4F8JA 2ZWIA 3IV6A 2Q5LA 3I09A 2JZNA 2VDKB 3NAQA 1ABBA 4MV3A 4LKOA 2J0UA 4C20A 1YZYA 5DGHA 4DQUA 2XCIA 4PGMA 4J7XA 3WQRA 1ZQ9A 3LIPA 4JH0A 3DQPA 3ZKAA 4AMYA 1WW2A 2NUTA 1X8XA 2FRXA 3M6XA 4CF5A 4TV9F 3I5MA 5DF1A 1DDOA 3CN9A 1E2DA 3PXAA 4EZBA 1CQIA 1T5BA 3EIFA 4H7PA 3PE6A 1NNLA 4LNAA 2WTAA 2QWXA 2ZETA 3HL0A 3UCFA 1V8FA 4BX3A 4CFZA 3QZUA 3BWXA 1UUFA 1NI4A 2CY0A 1T24A 4HLUC 1YZKA 2XY4A 1CQPA 4XGIA 2HWXA 4HQLA 3RW9A 2CMHA 2W6MA 3NIWA 1ACJA 1GPBA 4YV1A 1YJBA 1KYXA 4JV5B 3MYYA 4I9NA 1TKAA 1Z8DA 3IXLA 4OYHA 1TNDA 1TTQB 2BKXA 4Y98A 4ZOEA 1EZ1A 1XA4A 2IT1A 2P9TA 1I36A 2R6FA 4JDUA 4QEKA 3RQSA 5DSZA 4QXQA 4H0NA 1LPOA 2VHEA 5I4BA 1U90A 5EQFA 2VEDA 3ZUGA 1T36B 2D1QA 4RTPA 4FZ5A 1WB4A 3H9BA 3QLUC 2QIOA 3JQ8B 3THWA 3W6UA 4Y7DA 2L17A 2VP5A 1S2DA 2WKRA 1CDEA 4J2TA 1P4SA 1W46A 5J63A 3R9KA 4BMNA 1TOAA 1ULSA 1EFDN 3ZYZA 2O50A 5KNBD 1ZVQA 3ZW9A 1V3VA 4GQBA 4L07A 4ZZ1A 1RXVA 2Q7OE 3DTYA 4LMRA 1S4MA 4F84A 4W5NA 3BYZA 3DVRX 1JR6A 4F2DA 4PAGA 1M6NA 1QHIA 4RGBA 1AGYA 1LPPA 2ZDHA 3TX2A 1GNVA 2AQKA 5J23A 2PO7A 2E1RA 5TY0A 1W87A 1J8VA 2ZRDA 3F3KA 5AO9A 3SYKA 5HW0A 4GRIA 1PYOA 3ZWKA 5K0FA 4KTTE 1SVOA 1ZUNB 4ZAGA 2V59A 4Y2JA 3HBNA 3HDVA 2RCNA 5PNTA 3KS9A 2GJ4A 3D2LA 3W5VA 4ZCLA 2FA9A 3M7IA 4QM7A 3OOEA 4J4HA 4OKIA 3LCVB 1VKRA 4RMJA 1FFXB 1HT0A 1C7EA 1Y63A 1ZXXA 2PGLA 1JHMA 4KXVA 3UCEA 3UXMA 4DARA 2WP8J 2ZYRA 3EBPA 1ZJWA 1HDRA 3FHTA 1OU0A 4E31A 2ZRKA 3O4VA 5H4GA 4QVKA 5JNLA 2H5IA 5B3KA 3PFIA 4OU4A 3V00A 2HFKA 4BNLA 5BURA 1XYGA 3L92A 4EY6A 3S0JA 1O8CA 4O2LA 2IXGA 4F9EA 3GF4A 1D7OA 3CLTD 2PGIA 5DLYA 5ELLA 1FQOA 3C5HA 4MUEA 5L7TA 2VLBA 2VZ0A 4R71A 3DDSA 2JEYA 1J9GA 2IYTA 1BN6A 2J41A 2OOKA 2QX4A 4MYRA 5DXFA 4COKA 2VP4A 4F7DA 2HXGA 3BDIA 2BM9A 2QP9X 4HTAA 4ZXPA 4B40A 1JYSA 3DOCA 1U0EA 3KR9A 4S35A 5DK4A 5IMSA 2HV9A 5JO9A 5F64A 4UJ3A 2OBLA 4H3VA 2IUFA 1NKVA 4I55A 4EEZA 3FTEA 1AN9A 3H5AA 2X5OA 4FYPA 4IDBA 2NX2A 4IIUA 4J4TA 4LPSA 4KPEC 3B6KA 3U37A 3ADPA 3V4PB 1YH3A 1CEXA 3VC2A 3E8SA 2Q2VA 5IKOA 2ECPA 3GRYA 2EHDA 1VJDA 5B2ZA 3PYMA 4MR7A 5EHNA 3RUEA 3HS3A 1V48A 4C5AA 3HVHA 3L40A 4J1SA 2H1HA 4TZKA 4TTSA 1NNUA 3DE4X 4KPGA 2GEVA 5IBPA 3WYEA 4MW0A 1KEEB 1T4DA 3OKFA 5K3EA 5BWNA 4L0CA 3ND8A 2P9ZA 3T0FA 1D0SA 2P90A 3A2NA 5IP5A 1QE5A 3OM9A 2CMGA 5IANA 1E5VA 4DNXA 1QRSA 1W4ZA 3SR4A 2HREA 1RAIA 1RPTA 2BDTA 2OUIA 3NKFA 2DJ5A 4O1HA 4KKXB 2H31A 4RVSA 3W2IA 4DZZA 2GARA 2A9QA 4LZAA 2Q62A 4OYLA 3I0NA 4R1OA 2QR3A 4P93A 2IGBA 1NAIA 1N5JA 3PITA 1APBA 1ZH6A 3GVPA 3H5TA 4G2TA 4PLYA 1N34B 3RBZA 2Z5FA 2YXPX 4ZYXA 4WASA 5CBKA 3K4QA 1S1MA 4NCJA 3D8SA 1E63A 3WHKA 2QMOA 4II2A 5EE1A 1ZSYA 1X7WA 3RC8A 4A1FA 1JQDA 3FKQA 3GOQA 3HA5A 2AI1A 3NAGA 1UFOA 1M2KA 1HZZA 2B0CA 4FZRA 3UO8B 4YY3B 3LT5A 3H4MA 5HTOA 3HJGA 2FPPA 4QO7A 1H2YA 1RKVA 4FS3A 3OVMA 3EY9A 2VA9A 2BI4A 2FQXA 2PZJA 3DHEA 5BSGA 2B4KA 3VBCA 2XVZA 1G17A 2I1WA 3V32A 5HIAA 4MXDA 4QTZA 4DJEC 3TIGA 3ZW8A 2BFOA 1TMOA 1XL1A 1MMFB 3HDTA 3O8OA 4U7GA 1U2ZA 3L77A 3BGWA 3PUKA 1Q12A 3I5UA 1WQ3A 2CEKA 3EAFA 4DNQA 5CCEA 2QTNA 3DZJA 5JFTA 3FYTA 1T3TA 1XI2A 1W2WB 3L41A 1XPOA 3E58A 3PEVA 3GARA 1XKLA 3DXFA 3TOXA 3VKUA 3IT3A 4QC2A 1X1TA 5I51A 3PGA1 3EDRA 2O8DB 3PJGA 2ZJFA 4UDXX 1GZ5A 5FUVA 1ZN8A 1U7DA 1RCTE 1Z38A 3QOYA 3E9EA 1A1SA 4IYRA 3RVNA 4YRLA 4I55B 5J3JA 4NLLA 1UMCB 1A7KA 1DBQA 1LWOA 1PUJA 2DHRA 2GMWA 2VT3A 4QPJC 2EKPA 5DHTA 3RS2A 4B32A 2HPVA 5CDGA 1D04A 3A3OA 4OXKA 2I8LA 2W2PA 2Y1WA 1F20A 3AUKA 4P5EA 4ZV7A 1E2GA 1E9BA 1IBMB 3UQYS 3VNVA 1JVSA 2EJBA 5DYNA 2VKTA 2PD4A 1I30A 3D59A 3JARB 3LQYA 4IDCA 4REMA 3VDXA 4BUJA 1STOA 3JQAA 3LFHA 4KSBA 4YWJA 4P98A 4BL5A 5KTKA 1H5NA 5EWMB 4MUKA 4WVLA 3AF6A 1PO7A 1BIFA 1BS9A 4QATA 5KS2A 2VDQB 4EF4A 2QTZA 3WWPA 3WI7A 3SD7A 1PEKE 1M0TA 2FZ4A 1LX7A 1A8SA 1E1RD 2O2DA 2VC2B 3DO5A 2Q1UA 3L43A 1T34A 3OPYA 4PLFA 3AB3A 4E4TA 5I4KA 1FFGA 4JB3A 3GRFA 5GOTA 4YPFA 4FFRA 1VMAA 2NZYA 3ZS8A 5MFZA 4JJ6A 2EERA 4XEHA 1V25A 3K32A 3MILA 2GILA 1YKGA 1WTCA 2WFLA 4J03A 4C4SA 5I5EA 1VL2A 4M46A 1UFVA 1XMXA 1QHHB 3QXXA 5LLTA 4MWSA 3WLMA 2H18A 5GZ1A 1H9BA 1CP3A 1RADA 3H1GA 2WZDA 3I4FA 4HX9A 4R1NA 4E5DA 4YMTA 4WIAA 5BWMA 1J5EB 3MWEA 1QGUA 2O8BB 4KO4S 4UBIA 4Q1AA 1U0FA 3QI2A 2Q5CA 1VCNA 1M2EA 2J85A 2QSJA 3A37A 5ES3A 3VX3A 3IOMA 2IUTA 2PTGA 3PB3A 4HQNA 4PQYA 5EJEA 2FY8A 4KW7A 3FOAA 1FLDA 4DEVA 4R3NA 3LC7O 5LUBA 4CN9A 1XKQA 2JBAB 4PO3X 1YQGA 4FOOA 1KPHA 1DKPA 2MSWA 2DTEA 2R60A 4MV9A 3ZQ6A 1XTIA 3FETA 4KGXA 3VRHA 5JO0A 1UT6A 2E4YA 4I2NA 4F11A 2CBXA 5HS4A 1F4LA 2AYZA 2H3EA 2IYXA 3MINA 1F4PA 5F7JA 1T2FA 4MGKR 3ZWPA 1WD7A 1KMHA 5HZGA 4CMGA 5KNCA 3FSRA 5IH3A 8OHMA 2OM6A 3U4HA 1OPXA 1NW4A 1ZESA 5E9QA 2D3TA 1YQEA 3OTWA 2OHIA 5DX0A 5IMBA 1IN4A 1FDWA 4GR5A 4RQBA 1EUZA 1EQUA 1ZD5A 3GMIA 4X6XA 5F77A 4DA4A 2YY6A 1J0DA 1MX5A 3FM9A 3PEUA 1HYGA 4UC0A 3CVYA 3GLVA 4DJAA 1V9CA 3N0VA 2IF2A 4ARVA 1O0CA 2BKEA 2M32A 5GVRA 3WBJA 3ZY5A 1E3LA 5KUTA 3MJVA 6LDHA 3H11B 1G1MA 3ETHA 2WLTA 2OBMA 2P3OA 2B4RO 1NHWA 1LLCA 3A3PA 4C5CA 1P1FA 5F78A 3HVUA 3RS0A 2DGDA 2FN7A 3E84A 5CA1A 2D00A 4RMHA 2ZTSA 4BWFB 4BE9A 2RG1A 2WEKA 1EUYA 3M8KA 3HKCA 1TAUA 4P7FA 4B3GA 1P9RA 1DGQA 3NRCA 2W6NA 4LJ5A 2JGAA 1R4ZA 1PF7E 4IGAA 1CJUC 2AN9A 2JCBA 3GW8A 2FUEA 2ZRGA 1RXIA 2QBYB 5D51S 1PJ4A 4ZAYA 2QN3A 3G0GA 1JR3D 1E2FA 1DBWA 1CIJA 1DRKA 2WI8A 1BX3A 3H7IA 4IIJB 4YUAA 1Z6AA 2PD3A 2VDWB 4W8HA 3LCMA 3OT5A 3TUJC 1XMVA 1IFXA 1Z6XA 4R1UA 1J8FA 1CCWA 4PGAA 3ETEA 2R44A 3JAWB 2WKSA 2RGCA 1TT7A 1PEYA 1D7AA 3RVPA 4UVIA 2GD0A 2XA1A 4QAJA 1HQDA 3TJMA 5T4FA 3VPXA 1XV5A 4CFYA 4YUZA 3ETJA 2POCA 5B3LA 1QB8A 3TJZA 1KI4A 2P6RA 1VJ5A 3RFTA 1IMJA 4EG4A 3L7NA 3ZHQA 5AKJA 5CLJA 5LQNA 2XCRB 2R1VA 4MQ5A 1FMFA 1V16B 3VU0A 5KAPA 4N4AA 4BMDA 2BM0A 2UU9B 2JEOA 1J07A 4MV7A 2VHUA 4WD3A 5E2BA 4I4CA 2BFMA 2M6RA 1P0FA 4YRZA 3PQCA 3WL7A 3KXPA 4NXMB 1CS0A 2YVUA 3LDHA 1YQWA 2BEWA 2P0YA 2DLDA 4HH4A 4WEOA 4X41A 2FN3A 2J8ZA 4GLBA 4JFRA 1PL0A 4MVJP 2HA3A 5ER6A 1RQLA 1OTXA 3M89A 5IVKA 3NOQA 5HRUA 4N12A 4WZBE 5DM0A 1OH6A 1VBKA 1NM5A 3ND5A 4BNHA 4BFYA 5ANRB 2G71A 3RU2A 4CM4A 2J7PD 1AE1A 2UXCB 2ZTMA 5T7BA 1IZYA 3KB2A 3L5OA 4EX7A 3QVGA 1EFHA 5D87A 2GUWA 5KYXA 1JT9A 3UXEA 1OKKA 1GA1A 1U80A 2W11A 3BJEA 4GRAA 1GXSA 4JBXA 4JUBA 2QBYA 4RXUA 2OWDA 5FQNA 2FEPA 2H4FA 2EL9A 3EXHB 1FK8A 2PLAA 4JUDX 3SM9A 3KQNA 2DAPA 1R64A 2A5JA 1AQ6A 1ODCA 3O0TA 2FB9A 2ZT8A 4JP3A 1WA5A 2FWMX 1ZJYA 4JB2A 4NATA 1JHYA 1AZLA 1U8UA 1HLFA 4YTEA 5I7AA 1XX6A 3QBEA 3ZKWB 2UZ4A 9GPBA 2NYAA 2JI8A 3QW4B 4IG4A 4MJ3A 1W47A 4OXYA 1Y3HA 4OP2A 2OCXA 4XOUA 4TSRA 3KEMA 3FUTA 4FLFA 1UPBA 1YT5A 2PWAA 2V1XA 3K2QA 3KQSA 4D82A 1B8NA 1D1PA 2CB0A 3P2JA 3PHCA 5FA8A 3SLKA 3IBFA 5BY2A 2PEYA 2ONZA 3UJ6A 3N8IA 3WS7A 5EESA 5HKBA 1SAYA 3MWDA 3RGWS 1KZ4A 2MMCA 3LNCA 2YNMA 4F60A 1QPZA 2Y2VA 3OTQA 5JVDB 5JZMA 3ZLJA 1H94A 3Q72A 3FDFA 4J0HA 2BC9A 2PZEA 3OMXA 1NN3A 2E0IA 2Y8EA 4ZVNA 4M9RA 4BE7B 5J2UF 5HIKA 2AQ8A 4ND8A 2ZXFA 1QIKA 1JG1A 3NQ41 3ZQ4A 4DKJA 3AU9A 5DSXA 2X9QA 4R31A 3I04M 4RZ3A 3R7WB 2AF4C 5BR7A 1NVGA 3WG9A 3RJ5A 1U8ZA 3CRRA 1U99A 2JH8A 1D4OA 4LBWA 4LDPA 1G66A 1BGVA 2H7VA 2PGOA 2VA8A 4QQNA 3GD5A 3FNRA 3WHPA 5BN3A 3MJRA 1OH7A 2YWFA 3HO8A 1JBKA 2OZPA 4PBSA 2CMFA 2H5JA 5LQRA 4A0SA 1GSAA 2PZ8A 4M1TA 1EDOA 4KSCA 2ZJAA 4D9NA 4EA8A 3SZOA 4NH0A 3KO8A 3LM8A 4Q5IA 2VCEA 1PX0A 1RRFA 721PA 4OOFA 3A3KA 2MDTA 4LHXA 4N6OA 4NU6A 4EG3A 4AQYB 5JARA 3HKEB 4KBGA 3B5JA 3QVSA 4RJ2A 5AOVA 3VO9A 3L4KA 1FSSA 4BQQA 2VJLA 1WCIA 1SUDA 2J31A 1VTKA 2RGXA 1AB6A 1R10A 3GC6A 1OIXA 3F9RA 2NSDA 3ZWQA 4XRRA 4GMFA 2R8ZA 4U7FA 4Z4CA 1O2DA 3G2IA 4FUQA 4JJEA 5LOVA 1P1IA 2CUTA 2J3EA 1H4SA 3E2IA 2BOVA 1QC5A 1RHRA 3AEUB 1Z75A 3LG2A 4RK7A 2LP4Y 1Y3CE 3FPJA 3KQLA 1ZM7A 2AYXA 2KBEA 3CUUA 5EXXA 1KFEB 2IYQA 3I01M 3E9ZA 4PLVA 1W35A 2VHCA 1EIWA 2MU1A 3HV0A 5DCLA 5K0TA 2QG4A 1BXRB 3KT6A 4EFKA 2EFJA 4Z4HA 1L4GA 2VDPB 1ONBA 2RAUA 1OVMA 3L5KA 4OB8A 3ZKWA 3HFJA 3SXJA 3G8DA 4G0ZA 2ZJ6A 3AF5A 3U44A 3AB7A 2VYNA 3BXEA 5LLSA 1ZUIA 3HVJA 3T06B 3OHSX 5GIOE 3AHHA 1P2FA 1C7FA 1JEAA 3OOYA 5F1OA 2JIMA 3ELYA 5MF6A 2J0SA 4UBNA 4KRGA 1U81A 2JBHA 3WO1A 1T6YA 2WU3A 4UUBA 5EHGA 1Q0ZA 1X1CA 3IP1A 3IPXA 4DJDC 4MTCA 1B00A 1KDRA 2WFMA 3AVOA 5DHFA 2X7XA 2QIPA 1MAWA 2NSHA 9LDTA 3OU7A 4E30A 3CEMA 3E9DA 2VI5A 3Q8XB 2XOKD 3O74A 4H7FA 3PEYA 3QYFA 4AYTA 3P20A 4MCJA 1PLLA 3DT6A 1FSFA 2AN3A 4MQEA 4RKYA 3AB8A 1OFTA 3WB2A 3BA1A 3HJTA 4WCDA 2RI0A 1JKMA 3W1WA 2HIGA 1ECCA 2YWJA 3DCIA 3NJ4A 5T5QA 3TZCA 4KIFA 1RIIA 1I3OA 1YUMA 3DOUA 1RI3A 4HGNA 2Y6UA 1GPWB 5J2TA 3Q12A 5M7EA 2YDYA 2HD4A 9LDBA 3T95A 3MN1A 2FGKA 4ZQBA 4OH7A 2EGUA 1FBTA 2PZLA 3NDJA 2RGEA 3NRJA 4ZIRB 4IHKA 3PYLA 1U65A 1TC2A 3H11A 3LUGA 2D0OB 2IPNA 4L73A 3ZH2A 2GD6A 2BFEB 2AXPA 1PT9A 2GETA 2WWWA 4RIHA 1JQKA 1RU3A 2DUJA 3NEPX 2I2AA 2I7CA 1JG7A 5K3DA 3TNDA 4N3NA 3EDMA 1QXSA 3P9SA 5ALQA 3P9YA 5D5QA 3Q0IA 4HRXA 1Z5PA 2IYNA 2BGWA 1USWA 1KETA 3GLQA 3TMYA 2I65A 2R7KA 1EFUA 5EFOA 3EH2A 1D2GA 2DPYA 3F5QA 3LQQA 3MAGA 3ZWMA 4JR0A 4XX0B 3NGXA 3ZVKA 2FR0A 3ZUPA 2W4QA 2YJ5A 4GAEA 4B81A 1ND5A 2I6SA 2ZWOA 3IAS1 3PNPA 4MWBA 4Y8VA 4CPDA 1XA0A 4Z9YA 3I83A 2A7QA 1J0AA 5LOVB 2BM1A 1HV8A 1O03A 1E3TA 1VG9B 3IO3A 3ND6A 2GXQA 4F56A 1JXOA 1P77A 2FN4A 3FVTA 1MG0A 4G24A 4N7RA 4OUDA 2CL7X 2AMJA 3EIEA 2J3DA 3WNBA 2PYDA 3VO2A 1T9GR 1SKYB 4Z9FA 3IKTA 1RABA 3O1JC 4KXYA 4M1QA 5JRJA 1VGVA 3KVNA 3FXAA 4QBGB 2QU7A 1IHXA 5BWCA 1RCUA 1OHHD 3AR7A 4ZU3A 2IHZA 4BVLA 1MO5A 2GQ0A 2GB4A 4BX8A 2FEXA 4EMTA 5CA1B 2WIJA 3IKJA 3KXKA 2DH6A 2QW0X 4NZPA 4MGHA 1YS7A 4CF6A 1ZVKA 3BWBA 1J2UA 4JHLA 4K81B 4UJ5A 3QX8A 4XDZA 1N2JA 1PK9A 1V16A 1VHLA 3Q3GE 2ZI5A 4KE9A 3IYLW 4PVDA 3WC4A 4C7KA 5JJBA 4L85A 1V8ZA 3RYFA 1C5KA 4BNUA 5KTRA 4WI1A 4HXGA 4BMVA 2VEOA 3CTMA 4IOMA 5FPHA 5C7LO 2G9QA 4RLQA 1U2GA 2OBXA 4DKXA 3IDZA 4EY4A 1FXSA 1PJBA 1TD1A 3RODA 1Y8QB 1T8PA 4YT2A 1YJ8A 1CUDA 1E5QA 2EP7A 3REGA 2BYTA 1P17A 3M6AA 3ENWA 3JRWA 4JJFA 2IIBA 5B7NA 3LUCA 1FLNA 3UUFA 5JLAA 1X1QA 1RBYA 2OE2A 2YMMA 3U0VA 4F91B 1X2EA 3QU5A 5REQA 2HQBA 1R6BX 3VAYA 5A5DA 2OR3A 5B2FA 2O4CA 3E5NA 3PDJA 5JOQA 3LTEA 1U8FO 1MOPA 3QJGA 2IQ5A 1E0JA 4XPIB 1RLOA 2PMDA 4R51A 4ETWA 5C7OO 4FUTA 1AO3A 3HEMA 2PNJA 3G89A 1W36C 1ELOA 1HG1A 5HKKD 4YRRA 1RP1A 2QUBA 4KOEC 4JWKA 3ULKA 1U5AA 1RZRA 3X0DA 3QPAA 4IDAA 1X6VA 2BZSA 3WIBA 2I2BA 3EVBA 4Q9AA 4OLBA 3TLJA 1X1EA 1VDMA 4DR1B 2FKNA 3W79A 1E9CA 4BNIA 5HF9A 1ADJA 1LRKA 2C2WA 2ZITA 1D9XA 1EJ0A 3DOEA 3F9CA 3JQRA 3QUSA 4TT3D 3RTBA 1CZHA 5BNWA 2GJ8A 1E0AA 4LJAA 2HA4A 4GWKA 1DJLA 1WMDA 5BQOA 3Q7IA 3SF8A 3EA4A 1G38A 3F71A 1E6KA 2C95A 3ZE1B 2P2CA 2LPMA 4L4SA 1J7JA 4NMXB 2FWIA 4CV0A 5IYZA 1Z2NX 1F1BA 1VSQA 4RKRA 4Y9SA 4DYDA 4JASB 7REQA 3Q8LA 1RPJA 2Q46A 1RXEA 5FHQA 3UB4A 1E6EA 1T8SA 2X1VA 4L0DA 4MMXB 3GWGA 4KPUA 5J2TF 5JDIA 3ZVMA 4DSNA 1QIIA 1SXPA 1DMRA 2RGNA 3UMBA 3LQFA 3B8HA 2FR1A 2I7XA 5ENDA 1O8BA 4O4HB 3ZCSA 1VKNA 3RJTA 4QQRA 4B4WA 1IB6A 4W1RA 2IXBA 5J1TB 1O6FA 4X62B 2M2IA 4JI4B 1CG6A 1S8OA 4I66A 3MLEA 2C9OA 3AINA 5ITWA 5EMMA 1UJ2A 4WMLA 2F62A 1WABA 1HYHA 1WEHA 1YR9A 3LO5A 1H2BA 3L0SA 1O94D 3QPWA 4TMFA 4ER0A 1KRWA 3OZDA 4QYIB 1BQ3A 3HLTA 1TCCA 1T10A 4DUPA 4CTKA 3MGAA 1SVNA 1JT2A 1KVUA 3FYCA 3LY8A 2HW8A 1P5ZB 4PAQA 3TCNA 2J5QA 2O2XA 1XKXA 4DM4A 4I36A 4IIBA 1HDYA 1SVSA 3FKSD 3Q9LA 2NN3C 2VQSA 1MB4A 3VR3D 2H8KA 2RJNA 1PLJA 3DP9A 3AL2A 3NNDA 3WLTA 5K3OA 4Q1EA 1B14A 3V7WA 3L1HA 5ALVA 2O8DA 2ZJZA 1ZI6A 3D8BA 2C2GA 3UK6A 2O2HA 3C48A 3O8QA 2E18A 4FCWA 4IIYA 4ZICA 5C5CA 4L78A 2W9XA 1Q14A 3WICA 5K05A 4HDOB 1A71A 4WW0A 4WH0A 1TEZA 3G5AA 3SBXA 1RHQA 2P5YA 1THTA 2NVUA 4PG8A 3EVAA 2D1FA 1RRMA 4M6WB 8ABPA 1ZD3A 5DBFA 1W4RA 2QX6A 3GLGA 2VP0A 1X7YA 2NU9A 4GW3A 4NBNA 3AUSA 1HY3A 4BC1A 1RYMA 3LI2A 1Y9ZA 1PZMA 2NSLA 2IZ6A 1F8FA 2HMTA 4KNVA 4A73A 5LP6F 4RSMA 1NIPA 1D0VA 1PV2A 4HHEA 2YXBA 2A1TR 3C1UA 4FONA 4NE9A 4PYIA 4RW0A 3WGJA 4LRYA 5KYYA 2QJWA 1FUUA 2QY6A 2EARA 1R8JA 5I4IA 4EKNB 4FT2A 5AMXA 3ZU3A 4EGAA 2K2QB 3E3MA 1R3DA 1SBQA 2PK3A 3BIJA 1BZYA 1GRRA 3EC2A 1EGVB 3MQ4A 4PQEA 3ZHYA 3SKVA 2N9UA 2VF5X 2WWIA 1W0KD 4WKCA 1IDN1 1X7WB 3V8EA 1E4VA 3C5VA 4NZMA 2BDUA 4FR5A 4RFSA 5E9AA 4FD3A 3SQMA 4N48A 3GLRA 1QOZA 3QH4A 1BO6A 1GKIA 2EYQA 3SQOA 5H68A 2AMLA 1MZVA 1VE7A 1N2GA 1TE2A 4XSHA 3ZK7A 4HNTA 1IAQA 1B26A 3NXSA 4V0SA 4XUEA 1RKXA 1MW9X 2ADMA 2P7IA 4RKFA 5L3QB 4KRYA 1T3HA 5BO5A 3BJRA 4YVFA 4EGSA 1U0TA 3IQGX 1NTOA 3KX2A 4D26A 3V4ZA 5DNYB 10MHA 2JLWA 2W37A 4K9DA 1Y5IA 2ENUA 4DCPA 2I9KA 2PYIA 4C4AA 5H70A 3DZDA 4YJ2B 2H65A 4JQOA 2NZ8A 3G5LA 2B25A 3KLPX 2CKMA 2LVBA 3OU2A 3AVVA 4MIYA 3FZEA 3IIJA 1ZUWA 4M55A 1RRVA 4CEJB 1UBGA 3EGEA 2W6PA 1C3EA 1YL6A 4YCSA 2HV8A 2O3QA 4XW2A 1FC0A 2ZSIA 1GTRA 4TMZA 5JSZB 1FX1A 3LYAA 4EDHA 2F1IA 3VR6H 1PYDA 8MHTA 3UJ7A 4JEMA 4ONEA 3WSTA 2I4LA 2ZIEA 3T7RA 4LUCA 1LDYA 1Y9AA 2SNIE 4PXSA 2JFYA 1X39A 2Q5OA 1F6BA 3WJAA 2QT0A 4XM1A 5C8YB 5E1BA 3ZDXB 2WIBA 1YOVA 4ZYYA 2BGNA 4ENSA 1QU2A 1SD1A 4MUGA 3Q3VA 4XR9A 3KVRA 1UQRA 4I6EA 4IVQA 4D42A 3ER6A 2R4TA 1GZVA 3O7MA 4LY9A 2ZS8A 2FDXA 4M6WA 2P3SA 4EYQA 3RS7A 1A3CA 2PUJA 3I5AA 5EJ8A 1JIIA 3EVCA 3MRSA 3OPYB 1PP4A 5CT6A 1EFRD 3TAXA 3OIDA 5EZSA 4DCCA 1POXA 3P26A 1U6KA 5AHOA 1IOWA 3WGYA 1NL3A 1LBEA 2HO5A 5FPQA 3TRDA 1THZA 5CEEA 2F67A 3X1YA 4NXNB 4AMZA 3VZPA 1VPWA 1F0KA 2J1LA 1PV1A 4PM4A 1XDBA 4YAFA 2PUBA 4UHHA 3NXKA 2QUJA 1FDUA 3VNBA 3B2NA 1MX9A 1YS9A 1D2NA 1V11A 2YRWA 3D9QX