4IS2A

Crystal structure of the apo form of a 3alpha-hydroxysteroid dehydrogenase (baia2) associated with secondary bile acid synthesis from clostridium scindens vpi12708 at 1.90 a resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
245
structure length
215
Chain Sequence
MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTMLEPEEIANVYLFLASDLASGITATTVSVDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the apo form of a 3alpha-hydroxysteroid dehydrogenase (BaiA2) associated with secondary bile acid synthesis from Clostridium scindens VPI12708 at 1.90 A resolution
rcsb
source organism Clostridium scindens
molecule tags Oxidoreductase
molecule keywords Bile acid 3-alpha hydroxysteroid dehydrogenase
total genus 72
structure length 215
sequence length 245
ec nomenclature ec 1.1.1.395: 3-alpha-hydroxybile acid CoA 3-dehydrogenase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4is2A00
4XD2A 1NPTO 2VYND 1SEPA 3L4SO 1ZNQO 3ENNA 1EQ2A 1F0YA 1PS8A 2X86A 3DMTC 1O9BA 1KEUA 4F6LA 4AJIA 3TZCA 2P4QA 4UULA 1NQTA 1IY8A 5GMOA 5FI5A 1YVEI 1BMDA 3ABIA 3ONEA 4FJ0A 4NBWA 2DTEA 4KUGA 2D8AA 3SLGA 1PL8A 1XLTA 4ZN6A 3JQBC 3JD1A 3S2IA 4D44A 2CSUA 4E2ZA 4J1NA 3I23A 2O7QA 1UXGA 1XWFA 3WFJA 5TJHA 1U3VA 2Q1TA 4HFJA 2GN4A 5EINA 2BHLA 4E32A 1C0KA 1HWYA 3IS3A 5I7SA 4ZGWA 3D1LA 1K2WA 4ND5A 4HP8A 1EK6A 5T8KA 3I83A 3AUUA 4QSMA 4OMUA 1CERA 3L9WA 4J43A 4CLRB 4J1SA 1AXEA 1V6AA 2QYTA 5T6BA 5TF4A 3QVSA 1HXHA 3A14A 4BO1A 2X4GA 2PH3A 4MKRA 3FSRA 4R68A 3UVEA 2WJPA 2DFDA 3JTMA 1Q1NA 1DB3A 3ETDA 2W2LD 1Q7GA 1OMOA 2NUAA 5AXCA 3DZGA 4LISA 4UUNA 2JAHA 2O2SA 1T2DA 2VT2A 3ASUA 3K2BA 1ULSA 4IUYA 4CQLB 4JIGA 2GR9A 2Q1UA 4MVJI 3H9QA 3UF0A 2ZJ1A 3B20A 3GN1A 4A27A 2Y1EA 3D0OA 3PEFA 3L07A 3GZNB 4CQLA 2AHRA 4GVLA 4X54A 5ES3A 2QIOA 2RH4A 1NAIA 1XDWA 3GC6A 3H6KA 5CP8A 2BLLA 2X5OA 3PQFA 4RJTA 1BRMA 3W6ZA 1FXSA 1CQJA 5DCYA 2FMUA 5ILGA 3GY0A 1G1AA 2JCXA 1Y8QA 1JTVA 3BMNA 2QHXA 1Z45A 4TROA 3AJRA 3KYCA 5IFLA 4BMNA 1HLPA 2P9GA 4WLFA 2BKAA 4BNVA 5GZ1A 2PD4A 1E92A 4OKIA 3QE3A 3QW2A 4OH1A 4ND3A 2X9VA 3E9QA 3IJRA 1UAYA 1HT0A 3BMQA 1A5ZA 2FPGA 3NTOA 3V1YA 4RVSA 3SLKA 4A03A 2PKQP 3KO8A 1PTJA 4E5NA 1PGJA 5TIIA 2I65A 3U49A 5I9MA 4RF2A 4P22A 2P4HX 1B14A 1GU7A 1DFHA 1QG6A 4WECA 3U09A 2GUGA 1GD1O 1ADBA 1U3TA 4L9RA 5CG2A 1YL5A 4MVJG 2VRBA 2AG5A 5JC8A 1U28A 2YJZA 3EUWA 4QFCA 3WXBA 4DMMA 4CMGA 4OM8A 1Y5MA 3HDHA 2GN6A 3SX2A 3NTRA 1T1RA 2H63A 4C7JA 5LC1A 5T64A 2VHZA 1X13A 3OQ1A 4DL9A 4J7CA 5LCXA 4EITA 4JBGA 4WKGA 6LDHA 2ZB8A 3PYXA 3DHEA 1NWHA 1UH5A 4XKJA 1WMBA 5T5QA 1ENPA 2FY8A 2AMFA 2AA3A 3A4VA 3EVNA 2B36A 4IJVA 3KLMX 1H0KA 1AHIA 4HXYA 4PLWA 3PI7A 4MO2A 2J3JA 4N5NA 2G5CA 3FWNA 1U7HA 4YAGA 3AUAA 2NU7A 3RBXA 3MTGA 1T4BA 2D5CA 1GDHA 1VSUA 4LVCA 1ZFNA 4JQCA 3IIEA 2X22A 5JCJD 3VDRA 8ADHA 4W9NA 3DHNA 3M1AA 3COSA 4BO2A 1H94A 2IYOA 4UEJA 4R69A 4PVCA 3NGLA 5JLAA 1XHLA 4JK3A 3T7EA 2NVUA 4DUPA 3UAGA 4F3YA 3FBGA 4GX2A 5TX7A 1MXFA 3DOOA 3D7LA 1Q7BA 4M89A 5FWNA 4DVJA 1PIWA 2DBZA 1P0FA 4Z9YA 1VM6A 2J8ZA 1EVJA 4BNLA 3PWZA 2IDZA 3Q0EA 2GSDA 1LSUA 5JSFA 2OMEA 3QJ5A 2B5VA 4BNWA 4ILKA 3H3JA 1UJMA 1DC4A 4DLBA 5A9SB 3JYNA 2V6MA 1HYGA 1M76A 4FS3A 5DDIP 3I6IA 1VLLA 3U4CA 5JDCA 4CR7A 3AWDA 2B4RO 4PLPA 3NJ8A 5I7FA 3L4BC 4LRSB 3F3SA 4A0SA 4NZ9A 2X0IA 3CEAA 3TFOA 5EQDA 3I9KA 2IE0A 2Y0DA 5IXSA 4B8WA 4NFYA 4GVXA 1A27A 3FF4A 4EZBA 1MLDA 4KUEA 3ZGYA 2IXBA 4S3MA 4ZVVA 3PRJA 2PZLA 4CR6A 1PZHA 4OOEA 1ML3A 4BOYA 3P2OA 4ALJA 4Z0HO 5T57A 2CF6A 1EUCA 2Q2VA 1EVZA 3O38A 3I9NA 2WDZA 2AE1A 5AXAA 2BH9A 2X9GA 4UEOA 1NX6A 4CV2A 4OL9A 3O26A 3DAGA 4FW8A 4AJOA 4E5YA 3ROPA 1YGYA 2OZPA 2E48A 4QECA 4TKMA 4EUFA 4K26A 3OICA 1O0SA 2EJVA 1Q0HA 1DAOA 2ZATA 4Q3EA 1K89A 1ENYA 2QZZA 3WQQA 1EE9A 4LVUA 4PZCA 4I5GA 1X0XA 3O03A 1KETA 1HETA 3WBBA 4KWIA 2YDXA 2HDHA 3VVCA 4C7KA 3EK2A 4AJEA 3H9EO 3HJAA 1CEQA 1UXJA 3T4EA 2YQ5A 4AL4A 1JN0A 4B3HA 1A7KA 2X1HA 2PGDA 4OIMA 4Z0PA 4R41A 3C8MA 5G4KA 1M67A 3DZJA 3GUCA 3I52A 1H6BA 3UN1A 2OFPA 2Q46A 5G0UA 3GF4A 3ZHXA 2Y68A 3WSVA 3IOYA 5EMHA 4FOSA 4B3JA 3LLVA 4PZEA 4NQZA 5H83A 1YOVA 4J16A 4DQXA 2Y1FA 4R1NA 3U4HA 2H5LA 5U1PA 4DREA 3ETGA 4OGWA 1OOEA 1B16A 5F5NA 1PL6A 1QYDA 3GOHA 1R4MB 4B7CA 1L7DA 2AEMA 2TMDA 1YL7A 1UDBA 4XQEA 2DFVA 1KY4A 2C7VA 4ONEA 1LI4A 4BO9A 4DIOA 3ZHYA 4RVHA 1UP7A 5COQA 1P77A 1ISGA 4JGBA 1YQGA 4JJFA 3F5QA 1DFGA 1LRKA 2X0NA 4E12A 4YAKA 3RFTA 3I4FA 2FZWA 4XEHA 4FFMA 1T24A 2NQ8A 2AQHA 2NNLD 3CTMA 5G0TA 2C5AA 4AG3A 4Z3KA 5KKCA 1QV6A 2E4AA 1GY8A 5L4NA 1GZ4A 1PGNA 1TT7A 3BYZA 4J4HA 1HSOA 4FFOA 4ALLA 2RAFA 4YAIA 1SOVA 4S1VA 4BNXA 4FPXA 2ZJ0A 4BNZA 4IIUA 1EUZA 4OYRA 3EYWA 1E77A 3RBVA 2PD3A 3QWHA 1OAAA 4MKZA 4BNUA 2I76A 5KVVA 4AJHA 2JFFA 1RJWA 1DXYA 3N58A 4W6ZA 1KC1A 3SJUA 2WE7A 1E6UA 3LK7A 5L4SA 2DUUA 1QYCA 4BS9A 4CUZA 1LC0A 4A2CA 1NR1A 5L45A 1XIVA 4MOWA 4EEXA 3GN2A 2HCTA 4Z9XA 1LRLA 2XOXA 1E7RA 1N2SA 1E7WA 1XA0A 2QZ9A 4KDEA 4OJNA 2BGKA 4XJTA 1SZJG 1T1SA 1V3TA 2YDYA 3BA1A 3H65A 3ETEA 4IXWA 4CM1A 4WCFA 4E2XA 3MWDB 2Q50A 3K92A 4YRAA 1ZMTA 3KETA 2VHXA 4OXKA 1ZO8A 3KYCB 3UCFA 1BVRA 2POQX 1NM5A 3H9JA 2EKPA 3KEOA 3QLJA 1GPDG 3NYWA 4P4GA 2AG8A 2WYVA 3FNEA 4YT8A 2C7GA 3JQ6A 2AQIA 1VKNA 3M2TA 4GX5A 3IC5A 3K9QO 4HV4A 1DHRA 1VJTA 2I6TA 3W8EA 2D2IA 3V5NA 2EGHA 3VHRA 1ZUD1 2EKQA 3KRTA 5L7YA 2FSSA 2ZYDA 3NEPX 4FFLA 5J23A 1E7QA 4II3A 3FBTA 1LJ8A 3QP9A 1Y81A 3U9LA 5JYEA 2DM6A 2WSBA 5JAZA 4NBVA 3W4KA 3ZZNA 3OH8A 4ZU3A 4WE3A 2EWMA 1DRWA 1CF2O 4QT0A 3K30A 4W9NC 4Q3NA 3LT0A 3ZWYA 2CD9A 2WTBA 3MJCA 1C0PA 1GFSA 2ZTUA 4GBJA 3BHJA 1R15A 1DIGA 2W2LA 3GEMA 2VWQA 3AUTA 1RM0A 3G0OA 3MOGA 4MIOA 2CNBA 2EIHA 1PQUA 4CMJA 4CMEC 3VAZA 4CV0A 1PJ3A 3GMSA 3RUEA 1N1EA 1CETA 3F4LA 3IDSA 4WCFC 1V35A 1WVGA 3D64A 2HK7A 4L8VA 4G65A 3JQ7B 1NXQA 3TZHA 3PP8A 4W4TA 1I2ZA 3A06A 2QX7A 3HB5X 5DCWA 4E5PA 1J49A 1P33A 3OQ6A 1LLUA 3FNHA 1NFRA 1J5PA 3HDYA 1XGKA 5DP2A 4WOKA 3PFWO 4YYZA 4YJDA 5COBA 2WEKA 5DNAA 3AU9A 4CUJA 3E5MA 1F8FA 4MIEA 5ITWA 1X7DA 3ICPA 3C1TA 4IIVA 2E82A 4Z9FA 2F1KA 3ZV6A 1T2EA 1B2LA 2EGGA 2CFCA 4IDBA 1QLJA 1W0CA 4H16A 1VJ1A 2FPIA 4E5MA 5IJZA 1H9AA 4JJGA 4BNFA 1E5QA 2A92A 3GNSA 3RUFA 3S55A 3JQFA 3E03A 2XF8A 5A9TA 4IJKA 2GASA 3DAPA 1QLHA 3D4OA 4I5DA 4D3DA 2GF2A 3H7AA 3I4CA 5I7EA 4RL6A 1U3WA 2VWGA 3FRJA 4QO7A 5L7WA 1Y9AA 4P4LA 5CHEA 1GTMA 3BMOA 4DTIA 3LZ6A 2VZ9A 3HDJA 3PPIA 4L4XA 1F14A 1R0KA 2J5KA 4Y9DA 4JP2A 3WTBA 2FSVA 1WDLA 3BAZA 3R0IA 1ZK4A 1PR9A 4D45A 3G1TA 3MOIA 3IP1A 2C29D 1DLIA 3GQVA 3JQAD 3TPCA 3E5RA 1PQWA 2Z95A 4OAQA 1EBUA 1Y8RA 3ZWWA 3ZV4A 2ZYGA 5HRUA 1Q7CA 2CY0A 1B3RA 2PNFA 1HSZA 1LLCA 4IDGA 4BQRA 1YJ8A 4CUKA 3PZBA 4OHUA 2J5QA 1F12A 1GYPA 1E1LA 4RORA 4LSWA 1ZEMA 5IZCA 3OP4A 4F6CA 4FR5A 1T2AA 4DMLA 4NK4A 1PEDA 5LDGA 2QRKA 5JAIA 1YOVB 2PKRA 4ZQFA 2NTJA 5DOZA 3FCOA 2Q3EA 3H3FA 4DLAA 5IZ4A 3DMYA 3PTZA 4IQGA 4RDHA 3AM5A 1FF9A 5KVSA 4L75A 3C1OA 3BZUA 2JJYA 1WP4A 3CMCO 1U5CA 3K6JA 4PVDA 4WLEA 4PLTA 4BKOA 4BL5A 5KCZA 4BNKA 3CUKA 1VC2A 4F46A 3GHYA 3TFQA 2FZEA 1DPGA 4GSKA 4N7RA 4OOFA 4YTEA 1GAEO 1PR3A 1T4DA 2Y67A 3S8MA 1ADGA 1R0LA 1Z7BA 3Q9UA 4JJIA 1OC4A 1P31A 4J1QA 2AEFA 2Q1SA 2Y1GA 4GWKA 3ZU5A 3GRPA 4CL8A 3OA2A 4U8GA 3W4JA 3JD4A 3WYCA 3UGKA 4B79A 4JX8A 1OI7A 3MJSA 2CF5A 4EJ6A 5TGDA 3WSWA 5BSGA 1ZH8A 1JA9A 2PZMA 3NT2A 4RVFA 3WMXA 2YFHA 2ZQYA 2Q2QA 4LK3A 3PJEA 1LA2A 3V2HA 1BW9A 1AN9A 3OF2A 4ALIA 4BNYA 3L4BA 3W6UA 5TS3A 3KSUA 4PCVA 4YAJA 4GGOA 2GLXA 3RQSA 2B4TO 2GERA 4N5LA 5A5EA 3A28A 3KSDO 5HTOA 2JFGA 2R2GA 4TRRA 4DBVO 2CMDA 5KIAA 1J6UA 3RUCA 5KJ6A 9LDTA 3PGXA 3IUPA 1XQ6A 1F8GA 4E6PA 4CM9A 3INRA 3GA0A 2ZIZA 3VTFA 3DZHA 4XQ9A 3Q6IA 1Z73A 4PRKA 4DC0A 3VH1A 2RH8A 4HNHA 1DIAA 2RHCA 1IZ0A 3KVOA 4BUCA 3I3OA 3PLRA 3EY4A 2UUPA 1E6WA 3DEYX 3OEWA 3ANMA 4RQUA 1C1DB 3WB9A 4XIYA 3D4NA 5BNTA 2JCVA 2DC1A 2QW8A 2W90A 4NU5A 3PJFA 3L77A 4YDRA 4RVUA 3VZRA 2O3QA 2DU8A 3UW3A 3M6IA 2X0JA 3C24A 3DWFA 2BFPA 1XQ1A 2G1UA 1Z74A 3LT2A 2UYYA 1NQAO 3WMWA 2CVOA 3PWKA 3RFVA 3LYLA 1PGPA 4D3SA 2GYYA 1B8PA 3GNTA 3VPFA 4AJNA 3HB4X 3FTPA 4CODB 4KZPA 3E8XA 3L6DA 3PIDA 3ZU2A 4OSPA 4OXNA 4NK5A 2GZ1A 4CV3A 3OSUA 1QV7A 4IDFA 2BFAA 1IPEA 2FOIA 3CINA 1YL6A 3QWAA 1NPDA 1PZFA 1H2BA 3EVTA 4E30A 1RYEA 4NJMA 4ITUA 1OZAA 1YRLA 2EV9A 1KY5A 3ZN2A 1VPDA 3FN4A 3OJOA 4P4NA 3WX0A 2VWHA 5JY6A 1CJCA 4CM3A 1HE3A 3QVWA 2V6GA 3WGYA 1E3EA 2HLPA 4HFRA 3RKUA 4QQRA 1E0DA 4GMFA 4F45A 5A1TA 1LTHR 4J1TA 3SC6A 1EVYA 2NU8A 1O94A 1TEHA 3S2GA 3K31A 3AFNA 4G81A 3RVDA 3C3XA 2BMAA 4UVGA 3WGIA 2BGLA 1ZBQA 3JQGA 1WPQA 4GX1A 3D5TA 3RBZA 1UXKA 4J0EA 5IF3A 4A73A 4EEZA 2TMGA 4DA9A 1IE3A 4PGFA 4ALMA 1XSEA 3PJDA 2O3RA 2R00C 4I1IA 2Y93A 1C1DA 2HJRA 1WWKA 3HADA 3DTYA 3CZRA 4TMFA 3ZV3A 1SAYA 1RM5A 2CVZA 2A35A 2UDPA 4AJ4A 2Q49A 1M66A 3JSAA 3WQSB 4JLWA 1O95A 3M1LA 3NJ4A 3E6AA 3QY9A 3RC7A 1Q2XA 3CXRA 3JQ9A 4ZA2A 1PWZA 1DDOA 1GYQA 4BB6A 4E2WA 1R66A 1SB9A 3TN7A 1EE2A 2J5RA 5C5IA 2BFOA 4PG6A 3H8VA 2EG9A 5JO9A 1FMCA 2Y1OA 1OBFO 4Z6KA 1WXDA 1Y8QB 1R4NB 5BSEA 3ANNA 3GAZA 4IDAA 4BNTA 1R12A 1FJHA 4DIFA 3D3WB 5JY1A 3TQHA 3AUSA 2O4CA 3E82A 3INTA 5G0WA 3PQEA 4IXTA 1PX0A 1O8CA 4FC6A 5TJ9A 3ZNOA 4M55A 4LN1A 4I9UA 5KNLA 4MDHA 4O1MA 3R3SA 3OQBA 4IMPA 1DIRA 3M2PA 3VZPA 1TLTA 5L7TA 4J7UA 3AOEC 2X58A 2HRZA 5KJCA 3PVZA 2VWPA 2O3UA 1TB4A 2X7HA 5L95A 3EDMA 4CM5A 1U5AA 5JO0A 1HE5A 1XYGA 2HO5A 1U2GA 2CUKA 3DBHB 4XYMA 3WQRA 3OM9A 2X9NA 4XRRA 3QVXA 3S2FA 4KQXA 5EN4A 3RWBA 3D5QA 1TA4A 3BMCB 1ZXBA 3JYQA 1E1KA 3PYMA 4ALKA 3ROMA 3F4BA 1FDVA 4H15A 1U2DA 2D5AA 2R00A 2P5YA 4L4RA 4XJSA 5KOIA 1UXHA 1UZMA 4YJFB 4AJ1A 3VPXA 5A5FA 4XYBA 1WLYA 4EW6A 2YY7A 1Y5RA 5ENVA 3ITKA 3WICA 4IMRA 2X6TA 3EZLA 4D41A 4CLDA 5JW6A 3WLFA 1HDXA 3AY6A 4GKBA 2BI8A 4CMKA 1S6YA 1SB8A 2C0CA 2FR0A 2HMVA 3PHIA 1MG0A 5F21A 1UZNA 3WGGA 2OUIA 4NIMA 1DO8A 5I8ZA 1E7MA 1ZK0A 1PJLA 2NVWA 1TI7A 3WJAA 4CQMB 4K1LA 2YHIB 4Y67A 1S7CA 1KEVA 3RD5A 2G76A 2VUTA 2D0IA 2HJSA 1E3WA 3AI2A 3FR7A 4RF5A 1VI2A 4CQMA 2YV3A 1ARZA 4UUPA 4K9DA 1SCUA 4P8RA 5F1PA 1LQUA 1DSSG 2VOJA 3GDOA 4YRBA 2OOSA 3UCEA 4DLLA 5B4VA 3CZMA 4DPKA 2VHWA 1KVTA 4W99A 3EHEA 3GUYA 1UAGA 3PFFA 4PG7A 5CDUA 1R37A 3RIHA 1DJQA 1Z75A 2DLDA 1G6KA 1H6DA 4O0LA 4RPJA 1O89A 3FNFA 2Y0EA 3K8ZA 3RU7A 5TC4A 2LDXA 2BI7A 2A94A 3ZI0A 1D7OA 2UAGA 2B5WA 3ZH2A 2DT5A 3CH6A 1R0SA 4LMPA 3PWSA 1X7GA 1ADFA 1BHSA 3MEQA 1LXCA 4R1SA 2NTNA 3JD2A 1NAHA 3VDQA 3EMKA 3BTVA 3CMMA 4RVGA 1HDZA 2DTXA 1LQTA 1YBVA 1RM3A 4DYDA 1EEHA 1KVQA 2VNAA 4E33A 1P1FA 3OIFA 2EJWA 3ONFA 5HS6A 1NASA 4W7HA 4BNMA 2PZJA 4R9SA 3WYBA 2QQ5A 5CFZA 3GVCA 2GO1A 5TNXA 4DGSA 1Y7TA 3GRKA 5B12A 1LDBA 3VH2A 8LDHA 1QP8A 5IN5A 1X14A 2P9CA 2X5JO 3JQ8A 2HSDA 3HN7A 4J0FA 2Q45A 5B37A 4Z3DA 4OQZA 1MP0A 4BNGA 1I3LA 2RIRA 1IHXA 1P0CA 1EUDA 1ZJZA 5CDSA 3RROA 2HAEA 3A9WA 4TZKA 1NHGA 1PZEA 1VE9A 5EESA 1H5QA 9LDBA 5JC1A 1DAPA 1UP6A 5JFOA 3MJEA 4ZQBA 1X1EA 2I3AA 1V3VA 4GWGA 5JAMA 2G82A 3WLEA 4R54A 4K28A 1PGQA 1EK5A 3DHYA 4XR4A 2Q1WA 2VNSA 4L4SA 3DC2A 4K6FA 2J6IA 4LW8A 1YKFA 4YVFA 4W7IA 2V6FA 3A1NA 3HN2A 3P19A 4NR0A 3H5RA 4BO8A 2WMDA 1K0UA 2EW2A 4IGEA 1HF3A 1E3WB 1E3JA 3PLNA 1QMGA 4U0JA 4RQTA 1A71A 1MFPA 5B4TA 4XB2A 4FDAA 4AJ2A 1ZJYA 4BKRA 1GV1A 3Q9NA 4PLZA 1KIFA 4MP3A 3JYLA 2C5EA 3DBVO 3B6ZA 2AW5A 4BKPA 1RYDA 3WNVA 4Q3CA 4IPTA 4XGIA 1YS4A 1CYDA 1MG5A 4DYVA 1NTOA 3GFGA 3HZZA 3BMOB 3W8DA 1K3TA 5JNLA 1RWBA 2EXXA 3LC7O 1YB5A 2P2SA 1ISFA 4R5HA 1ZCJA 1XU9A 2OP1A 3IAHA 1M6HA 5JCJA 1N7HA 3BIOA 4LRTB 2Z1MA 5A9SA 6ADHA 2LDBA 3AI3A 4E5KA 4I9NA 1JKIA 4B7UA 4IY1A 4J2HA 3IP3A 3GG2A 3NKLA 1Y8RB 3RUAA 2OXIA 2PLAA 4BO5A 2ET6A 2O23A 5FFFA 5TLSA 2PGLA 4RPGA 3IMFA 3GPIA 4IDDA 5HS4A 4BV9A 4CMIB 1IB6A 2W8ZA 1I24A 1KBZA 3WBFA 5B4UA 5L4LA 4IDEA 1P1IA 5HWSA 4E0BA 2I3GA 1SMKA 3R3JA 4NBTA 4GKVA 1PL7A 4AICA 2DPHA 5EPOA 4Q3AA 3WNQA 1PGOA 1E7SA 3DZKA 3ZWCA 3LU1A 3TZQA 4E31A 5A3JA 1ZK3A 1SO8A 4A10A 3RC2A 1MB4A 1P1HA 1JKJA 1A9YA 2B37A 3JQBA 2HRBA 5AYVA 3FPCA 4ZD6A 3BMCA 1U1IA 2PKQO 2IYPA 4QFDA 4HUJA 4JBIA 1Z7EA 4BV8A 3HWRA 2R6JA 2WE8A 1Q0LA 3AM4A 3JYOA 4A7PA 5F1OA 5JXWA 2BELA 3KHUA 3TL2A 4Y8VA 1WZIA 4MJLA 3DBLB 2FWMX 4IGFA 4J49A 3G79A 4FFRA 4NFSA 4J9VA 2DAPA 1SOWA 3BMQB 3ROQA 4G2NA 5KTKA 4WEQA 3IQDB 4JNKA 3JQCA 1ZEJA 4TVOA 3V8BA 2EHDA 4BB5A 1YBMA 3ZU3A 3CPSA 3UCXA 3CSDA 5GY7A 3AW9A 1HYEA 4PLGA 3SBOA 4M54A 5K6AC 2JL1A 5KVQA 4GSLA 1TVEA 4ND2A 4YJGB 3ZWNA 5CG1A 1R4NA 3R6DA 4FJ2A 1E5LA 3BTUA 3ZWOA 5IDXA 3WYEA 4FJ1A 4Y6SA 1H6AA 4PRLA 1WNTA 1BXGB 3HDQA 1NQ5A 1ZKMA 3KBOA 1VJ0A 2EKLA 2VYVD 2WYUA 2YUTA 3JV7A 1LEHA 1KVUA 1N92A 4XYGA 5G2OA 4RGBA 1BVUA 3C7DB 4EUHA 1UR5A 1CIVA 3CKYA 4CPDA 2VUUA 2W2KB 4ESOA 5U9CA 4I5FA 2G17A 4N5MA 4OSOA 3FD8A 1V0JA 2NU9A 1PJ2A 4DQVA 3WG9A 4OXYA 3GT0A 4AJJA 1QSGA 3KB6A 3BHMA 1P45A 1U4SA 2PGJA 3T4XA 5FEUA 2FR8A 5JMWA 3HFSA 2EF1A 5GZ3A 3GMDA 3LQFA 1NWCA 1JWBB 2C2XA 2A4KA 5L51A 3QIVA 3MTJA 1MUUA 1GQYA 3GNQA 1DFIA 4PLHA 4BNHA 2E37A 5COAA 1X1TA 2HQ1A 5DT9A 4B7XA 3UFXA 4CLRA 3VTZA 2UUOA 3NX4A 5L40A 1MXHA 3OFSA 1K6JA 4QEDA 3K5PA 1I8TA 2QYSA 4IJWA 3DZFA 2C59A 4GLOA 4N54A 4YRDA 3OA0A 4FOOA 1PJQA 1F06A 2VT3A 3B1KA 2AXQA 4HY3A 1I36A 3AFMA 3RASA 3MJVA 5HBRA 3RUDA 5EQFA 3HE3A 3VH3A 3C7AA 2DBRA 4J4BA 2ZB3A 4CMHA 3QWFA 4DQUA 3O8QB 1I32A 1B15A 2DBVO 4MP6A 5JAQA 3L0DA 2BRUA 5TRTA 4JROA 1U7TA 4LCEA 3DMTA 5IDWA 3KZVA 2CDBA 1UDAA 3R1IA 3VC7A 3HNPA 3G3EA 1ONOA 4CMBA 2BF7A 5JMPA 4FFNA 3TRIA 1B26A 4CJXA 3NV9A 3OJLA 3PYLA 4IINA 3F9IA 3OMLA 3CE6A 4PZDA 4B4OA 3FHLA 1JVSA 4GPD1 4D42A 1AE1A 1EMDA 3I6QA 1DLJA 1V8BA 4EJMA 1X7HA 5BR7A 4D0SA 5JBIA 2OBYA 2O48X 4N18A 3WS7A 5T67A 2FR1A 3KYBA 4GL4A 1VKOA 2PY6A 1DOHA 1I33A 2Y99A 1LUAA 4I9HA 1LLQA 1LBEA 3DFZA 4IQ0A 4FSHA 3VZQA 2P68A 3GGPA 1EZ4A 1H9BA 2HMUA 4K6CA 5F5LA 3OBBA 1JU9A 2H1SA 4YA6A 3ADPA 5A06A 2HMSA 2NWQA 5K0ZA 4ZQEA 2QRJA 5ER9A 2PTGA 1EQUA 2GGSA 3AM3A 5CPFA 1EFLA 1J4AA 3P7MA 4TRJA 2UV8A 1D3AA 1V9LA 3ZNQA 1C1XA 1R6DA 5CDTA 1XELA 2WWRA 3P2YA 3ST7A 3WTCA 1WW8A 1VL6A 3WGZA 3OETA 2E6UX 4MINA 3ROKA 3RC9A 4RPLA 2GZ3A 4QTZA 3V2GA 4RV9A 4CLEA 1E3SA 1EBFA 3F6YA 1YO6A 5L53A 2DUWA 2VTEA 1I30A 3QV1A 1WMAA 1LDYA 1HTBA 4NHEA 3SC4A 3QWIA 3WGTA 3ZNNA 4BGEA 3S1LA 4O6VA 3GG9A 1T2FA 3KYDA 4HFNA 1QKIA 2O4UX 3DBRB 1YWGO 4J6FA 1HKUA 2D4AA 1LX6A 4DWVA 1BGVA 4HNGA 3UXYA 1N7GA 1GZ6A 5F3RA 4J3FA 5KWEA 1ZXLA 1HE4A 2YV2A 3B1FA 5FI3A 2GPTA 2Q2WA 4HKTA 4XRGA 3WIDA 3ZWAA 1JWAB 3TNLA 2VYVA 2Z5LA 4ZQGA 4YEDA 1GUZA 4AFNA 4FD3A 2J3IA 4WNIA 4WNCA 2A9FA 3LF1A 1U9JA 2NSDA 1YQXA 3E48A 1LDGA 5I9LA 1OFGA 4H3VA 4YWJA 1R16A 3JYPA 1DIBA 4GGPA 2O3JA 1ZW1A 1IUKA 1GQ2A 2NM0A 1MGOA 4PLFA 4KQWA 1BDBA 3E18A 5IAAA 2Z1NA 4KP7A 1AHHA 4NMHA 3GLQA 5EJ2A 5ADHA 1A4UA 3MZ0A 4FBGA 4R3NA 1N8KA 5BT9A 2C2YA 2IEBA 4UVHA 4GMGA 1CDOA 1GPJA 2X8LA 3BTOA 2GRAA 1PJCA 4LSMA 1ZVMA 4PLVA 4CLXA 2B4QA 3TZKA 3PGJA 4CM4A 1DJNA 4R01A 4NU6A 2GCGA 3ZWMA 1EFKA 3NDIA 2VHYA 1YH3A 2OO5A 3NT4A 4KMSA 1T2CA 4R1TA 4KWHA 4ND1A 2VCYA 3Q3CA 3ICCA 1JVBA 2P5UA 1A72A 1CWUA 2YQ4A 2VN8A 3PHHA 2O3SA 1RM4A 1P9LA 3KV3O 5DBFA 1E1MA 2PFGA 3MJTA 1LRJA 3OJEA 3GAFA 2BD0A 1HDGO 3ZNPA 2BGMA 1I01A 3I1JA 5TT0A 1GR0A 4D7AA 5C7IO 5JS6A 1LC3A 3I9LA 3MWEB 1ID1A 3UKOA 1D1SA 4YAEA 3LT4A 3G49A 1MX3A 2ZB4A 3FTNA 1C14A 4RLHA 5TQVA 1YBAA 2QG4A 4MP8A 3VPSA 4ND4A 4BKQA 3IL2A 4XQGA 1JAYA 4IQ8A 1MC5A 3DONA 3GEGA 4RZIA 4PG8A 4CLOA 5ICSA 1DEHA 1ONPA 1EVIA 2Q4BA 2B83A 3WFIA 3GVHA 5DBGA 1C0IA 4I08A 1CQIA 2DKNA 3NUGA 2VYNA 4CV1A 4RO0A 5A02A 1MFZA 1SNYA 3VPHA 2PV7A 1M2WA 1Z6ZA 2J3KA 5DF1A 4R16A 4D43A 3NDRA 4MVJA 3WJ7A 2W98A 4BNIA 3OEYA 3RKRA 4U0KA 1GZ3A 1ISJA 1ZK1A 4MVJH 1G0NA 4II2A 1ZZEA 3HSKA 7MDHA 5AXBA 2DTDA 1I2BA 1D4FA 1N9GA 1ZSVA 4A5OA 1B7GO 2ZTMA 4WLNA 4XDZA 4CR8A 1UXIA 1GUFA 4G5HA 4WEOA 4CM7A 1NQOA 3PQDA 4H7PA 4WUVA 1QYWA 4J9UE 4RLSA 3F5SA 5FYDA 4C4OA 4JXKA 3ENKA 2OORA 3BTSA 1UDCA 4ZQHA 3KM0A 4U6SA 2I67A 3G1UA 3DBRA 1KC3A 4UUMA 4KTVE 3PHLA 4NH4A 2GN9A 4TSKA 4D0RA 2AE2A 3INGA 3V1TC 4YQZA 1KEWA 3ZV5A 2AQ8A 1N9GB 3RSHA 2Y1DA 3MCVA 3HFGA 2FHSA 3EZYA 2O7SA 5G0SA 1NFFA 2IZ0A 3H2ZA 5DULA 4XA8A 1W4ZA 3W8FA 3PIIA 4XZ3A 4CMAA 3TL3A 5FF9A 1QORA 4HWKA 1VL0A 4BGUA 1AUPA 2UVDA 3SVTA 2B0JA 3GPDG 5ILOA 2F00A 2IZ1A 4CMCA 2VQ3A 4B4VA 3JD3A 2ZCUA 3RI3A 3HHPA 2YFQA 3B70A 3VOSA 4PFJA 1WDMA 4D46A 4EGFA 3JQ9C 3JQ7A 2DPGA 4FQ8A 2V6BA 5C7LO 3ZU4A 5KKAA 1LSJA 3U4DA 4E2YA 4U7WA 3D3WA 5JCXA 1IOLA 3KEQA 4PG5A 5L3ZA 5K6AA 5TSDA 4YJGA 3TF5A 1QRRA 4DC1A 2I99A 2H6EA 4NG5A 4RCVA 3DQPA 2NVBA 3ZDFA 4KOAA 4O5OA 1GADO 1B8VA 1ADCA 3SJ7A 4Y6PA 3KLPX 3DTTA 5G4LA 1TXGA 2FPPA 4J90A 4BQPA 3O4RA 1I0ZA 3ASVA 1ISMA 1C0LA 1U4OA 1PS9A 1LNQA 1YDEA 2B69A 5ITVA 2BFMA 2OHXA 1ZSYA 1YQDA 2HMWA 3V2UA 4DIBA 1A4IA 4HFMA 3WDSA 1HDYA 3H5AA 2AEJA 3IUSA 5THQA 1AGNA 3EGOA 3WIEA 4WCDA 1I3NA 1HZJA 3NDJA 1VL8A 1HRDA 4TWRA 1DIHA 2Y1CA 2PA3A 2CDAA 2JD0A 4IZHA 4D79A 4XB1A 2ZYAA 3F1KA 2EP5A 1P1RA 5BNIA 1B0AA 1YONA 1DBVO 4CM8A 1K6IA 5DZSA 2VZ0A 1GV0A 1K6XA 3JQFC 3OIGA 4KTTE 2D59A 2RCYA 5T8KC 2O2YA 2J3HA 5ENDA 4TVBA 3WGQA 3GFBA 5JE8A 4R51A 4YACA 5CPBA 3F1LA 3LT1A 1I2CA 2NLOA 2OBNA 5EIOA 5CEEA 5F1KA 3K73O 3E9MA 3DFUA 1WZEA 3QWBA 3LDHA 4LMRA 5ICMA 4M86A 3RUHA 1GCUA 3Q2KA 5B1YA 1PZGA 3U3XA 2DQ4A 4ZICA 4MVJF 5BNFA 1YE3A 3NT5A 4NJMB 1I10A 4R1UA 1IZ9A 2NV6A 3GZ4A 2P9EA 3KTDA 5C3MA 4E3ZA 3VVBA 4MVJE 4XR9A 5JDCC 2DVMA 4JBHA 3WWYA 5CEFA 5DP1A 1ISIA 4J91A 4BNNA 4UEKA 4P38A 1IULA 3U62A 5A03A 3E1KA 2JAPA 4BMVA 2XPCA 1XU7A 1XCBA 4XGKA 3QQPA 2VRCD 1H6CA 5C37A 4Y6RA 2PWZA 1SPXA 1BSVA 4TRNA 2X0RA 4R3WA 4UUOA 4MVJM 2JHFA 3HQ4O 1LSSA 1OC2A 5KVCA 5DN9A 5JPIA 1HLDA 1BXGA 2C07A 4UVEA 4BVAA 2RHRA 3UICA 5MDHA 1ISHA 4UREA 3LVFO 3NRCA 2IXAA 3I5MA 4YJHB 2DBQA 1EDOA 1PU2A 3DBHA 2JD1A 4E4YA 3H9UA 3VPGA 1JLLA 3EAGA 1JQBA 1N1GA 3UUWA 2O50A 4RPHA 1KS9A 1MV8A 2HK9A 4NBUA 2CVQA 4IDCA 5G0VA 1J0XO 2I9PA 2NQTA 1I5RA 4CM6A 2XAAA 1E3IA 3CIFA 4GI2A 4YT5A 4FB5A 4ZHSA 4GAEA 4YR9A 3N7UA 3H5NA 3LF2A 1LDNA 4NJOA 4TZTA 2OP0A 2PD6A 2Q99A 3PZRA 1U8XX 3K2EA 2ZB7A 4XCVA 4RPKA 1IPFA 3BMNB 1NVTA 1D1TA 1P3DA 1DRUA 4HX5A 1I3KA 1UP4A 2ILTA 4Q3BA 1M6WA 1U3UA 3BXXA 5CDYA 5IDQA 1NYTA 2HU2A 1BTOA 3DZBA 4EBFA 1SEVA 4BGVA 1JDJA 4J7XA 5JDIC 2FRDA 3JD0A 4XYLA 2NVUB 5TT1A 1JW9B 4IZIA 4B4WA 1HDCA 3IKVA 5AVOA 5ER6A 3WR5A 2GNAA 5AQ1A 3FI9A 2X23A 4NI5A 2JHGA 2VUSA 1PS0A 1ENOA 3ZW9A 3PDUA 4JCOA 3VH4A 3WGOA 2GD1O 3LLSA 4TRMA 2V7PA 4RDIA 4YJHA 3H9GA 1E6EA 4CMIA 4YPOA 2O3TA 1B8UA 1KYQA 3AOGA 1FDSA 1X0VA 1ZIDA 4XX0A 3RUIA 4DXHA 1N5DA 3O9ZA 2YHIA 1WAMA 2V65A 3DB2A 5THKA 3ZW8A 1NFQA 1IL0A 3VKVA 3U5TA 1T25A 1P1JA 1X15A 1FK8A 1HE2A 4J4TA 3RCBA 5IXYA 5A9RA 3DDNA 5I9NA 4B4UA 4BO6A 1ZMOA 4JN6B 1E7YA 1LDMA 2VZ8A 4INAA 4Z0TA 2PH5A 4M49A 4MVJP 3RU9A 4DPLA 1UZLA 7ADHA 1EDZA 5CDGA 4BKUA 1BXKA 2Y05A 4CQMD 1VRWA 1PJSA 2RBEA 1QYVA 2E49A 1H2HA 1QYXA 3PHGA 2X5KO 3BHIA 1PJTA 3TSCA 2YHUA 3TOXA 3TDKA 2GDZA 3GK3A 3SEFA 3LSYA 1SBYA 3IJPA 4FC7A 2WM3A 2VTDA 1L1FA 1R4MA 1GUYA 3ZWXA 3QSGA 4LGVA 3MJ4A 5JDIA 1LDEA 3C85A 4QUKA 5L9AA 4WLVA 3Q1LA 4Y98A 1VSVA 1HDOA 4MPDA 2JKVA 1GEGA 5GZ6A 4CM9D 4PLYA 1RKXA 2WD8A 4ZRNA 4LCJA 4YJFA 3QHAA 3L9XA 4IS3A 4JP3A 2VOEA 4GLLA 2HUNA 2NTVA 1E3LA 4BO3A 1TT5A 2IODA 1Y9EA 5I7VA 5MGBA 1ORRA 4HBGA 2ZTLA 2IZZA 4EYEA 3ZHZA 3GZNA 5LDHA 5HM8A 4FIZA 3GVXA 4MKXA 5IDYA 3RAJA 4CM4B 5KJFA 5H82A 1KEPA 4WOJA 5KJEA 3DOCA 4YQYA 1YJQA 3L6OO 4R4JA 4YBZA 3ADOA 4Q3DA 5BSHA 2C82A 1GQQA 3AU8A 3GVPA 3UHAA 3H4VA 4GQAA 4WK6A 4WPGA 4HADA 1I3MA 4XYEA 1DC3A 2YW9A 3Q11A 2B35A 4GH5A 3LC1O 5DCUA 3X2EA 3O8QA 3ITDA 1KERA 2ZQZA 3P5SA 3ZWBA 3ZWPA 2PK3A 1DHTA 4AJKA 5K9ZA 1BW9B 4BMSA 4YB8A 2I5PO 1AXGA 3DL2A 1T26A 3ON5A 4XQCA 3VZSA 1PWXA 3DOJA 2JD2A 5BSFA 4KDFA 3JCZA 4M1QA 1XR3A 3S2EA 1B3BA 4DRYA 3DAFA 2ZKLA 1Z82A 1Y1PA 1YXMA 4CMEA 4D3FA 1YB4A 5A4DA 3GDGA 2PR2A 1P44A 1UUFA 3STHA 3ANLA 3T7CA 4ZJUA 4PN3A 2NADA 3GDFA 2IEDA 3PDJA 3UOGA 3AOEA 4YT2A 4XWYA 2D3TA 3WOHA 1A7AA 4Q39A 2HMTA 4PIVA 4WLOA 2NU6A 4XGNA 5AOVA 1M75A 2C54A 1D8AA 4BO0A 1P1KA 4E21A 4URFA 3RC1A 4RF4A 3F47A 3D4PA 2WD7A 1Q0QA 1LLDA 3FWZA 4QXMA 3KUXA 3QVOA 1NP3A 4I5EA 4IJUA 3PXXA 2EP7A 3ORFA 1NHWA 1XG5A 5A04A 4MVJD 5H81A 3OHSX 3I9MA 1ZSNA 3K96A 3OECA 4RZHA 1A9ZA 2EEZA 4ALNA 4OKNA 3N74A 2ZCVA 4W82A 1LSOA 2VRCA 3GR6A 3FPLA 1ENZA 3ONDA 1O5IA 3DO5A 2NACA 4Q9NA 1BXZA 1NR7A 5IG2A 3KYDB 2CZCA 3IKTA 2HK8A 4NNJA 2Q4EA 3DBLA 4YXFA 1W73A 1PJBA 2GZ2A 2PZKA 3OJ0A 3KOUA 3SXPA 4CM8B 3FNGA 4EUEA 4M8SA 5JYDA 3JQAA 3VKUA 2ZK7A 4NDNE 4DPMA 4IS2A 2D1YA 1BWSA 4E13A 4UVIA 1H93A 3D3EA 3W4IA 3TWOA 5C7OO 3AY7A 1IHYA 1C1XB 1NNUA 4YCAA 5HA5A 3TJRA 5I8WA 4GX0A 2IRWA 1QXSA 3Q2IA 2OGUA 5DBIA 4BGIA 4ZRMA 1IYZA 5AXDA 4BO7A 3U4IA 5IZCC 1RPNA 2WD7B 1E1NA 2YZ7A 1W6UA 1GCOA 1MA0A 4XIJA 3I9OA 2W4QA 5G4KB 2G0TA 3JQEA 4NFHA 2I66A 1KVRA 5CAEA 4KUHA 3OIDA 3UH1A 4OO3A 2ZTVA 3B1JA 3AY3A 4UAGA 1NBOA 3AI1A 3WGHA 4WASA 1G0OA 1FDUA 2OL4A 1GL3A 5EL0A 3RJ5A 3GVIA 1LU9A 1DC5A 1FDTA 4XDYA 4ROSA 1YDWA 4L73A 3U0BA 3GHHA 3X2FA 1YB1A 3KXDA 4PLCA 2WYWA 1ZK2A 4O63O 2W2KA 4QX6A 4EI2A 2HKIA 1HL3A 4BNJA 4M87A 1GYRA 5IN4A 1HZZA 4BIIA 3G17A 1PQPA 1KVSA 1L7EA 3DR3A 1O6ZA 1JAXA 4A26A 1BG6A 1ULUA 4WJZA 4FGSA 2XXJA 1F17A 1P74A 3KSZO 5KJ1A 4B8ZA 1CRWG 3EW7A 1KOLA 4QO8A 3I9JA 4L0QA 2EW8A 4CL3A 3EC7A 1MC4A 4WGGA 1NPYA 2XXBA 4U6QA 5CEJA 1NVMB 1V3UA 4B3IA 1NVGA 5A3VA 3QVTA 1ONNA 4L76A 3TOZA 3F46A 3C7CB 4WCFB 3FR8A 3RFXA 4U5QA 3H2SA 4J2OA 4OQYA 4RVDA 1W8DA 3PHJA 4TQGA 5A05A 4WLUA 4TKLA 4I8XA 3E9NA 2AQKA 3DZIA 4RF3A 3NTQA 1WDKA 3L6EA 3NGXA 3QRWA 4ID9A 3V1UA 4FN4A 4L74A 1JKFA 3C1AA 4NBRA 1PJ4A 2FP4A 3PJGA 3JQGB 4EDFA 5EERA 3NAQA 3WWZA 4BHTA 3HUDA 4YT4A 4FCCA 1XEAA 3HG7A 3GGGA 3DXFA 2YYYA 4EJ0A 1HEUA 2Y66A 5DOVA 3GGOA 3RJ9A 4PG4A 2VHVA 1Y6JA 2CDCA 3AK4A 4NPCA 3W1VA 2JFHA 4IBOA 1FDWA 3ULKA 1DRVA 3ZCXA 3ZWVA 4BO4A 5BQFA 2Y0CA 1SC6A 4AVYA 4CLHA 3JQDA 3QA9A 4CLOB 2JCYA 3JQAB 4FGWA 1PSDA 1C3VA 1GEEA 3OJFA 2C20A 4MIYA 3GEDA 4FFPA 4R9RA 4DBZA 2QRLA 1HDRA 4O59O 3TZ6A 4R5MA 2EERA 4IM7A 2H9IA 1QR6A 3PK0A 4AJLA 4AJPA 5U4QA 1TT5B 1XKQA 3JQ8B 4UVDA 1DC6A 3ZHBA 1BDMA 3LC2O 1HYHA 1K5HA 1U8FO 3GH3A 2P91A 2GN8A 2YV1A 2FN7A 2SCUA
chains in the Genus database with same CATH superfamily
2AR7A 4NCJA 2BEWA 2KJQA 3G88A 3HB7A 1NPTO 4RESA 1ZNQO 4ZO7A 1BU5A 3ENNA 1P2VA 2AOUB 2XWBF 2YJGA 4QJ4A 4K0RA 5EJ6A 1XN1A 1Y3CE 1BQ3A 2Z2KA 3HMQA 2IP1A 3LUKA 2C94A 5E6RA 4AJIA 4DV7B 4TWAA 3PCTA 3RTCA 3TZCA 2SCUB 3NHBA 4FKMA 4UM7A 5HJ2A 5KYKA 4D9FA 1JFFA 1ZNZA 5JSQA 1SUEA 4FJ0A 3EIEA 3H1GA 2XE4A 3G68A 4M1WA 4NBWA 1C7FA 3BK1A 1PFWA 3O7WA 4H35A 4QL3A 4RTNA 4QJBA 4ZVPA 3UUFA 5BMVF 5UKDA 1XLTA 2PHZA 4CFSA 4ZN6A 1CHNA 1PK7A 3PNSA 4RETA 2YHSA 3JD1A 3S2IA 3ZD9A 4D44A 1TK9A 4X0EA 4AIRA 1CP2A 4WK2B 1PBNA 1GRNA 2XT9A 5K0BA 1UXGA 1XWFA 1PFKA 3IAS1 2WHYA 4I1YA 4EP1A 3EXHC 2Q1TA 4HFJA 3GJ7A 4G1FA 5LOVB 2QNRA 3REFA 4M0FA 5ALQA 4UE3S 2B30A 1EX6A 3OTHA 2O8EA 5I7SA 1FU8A 4ZGWA 1QK5A 2DSTA 2WJ3A 3NWBA 1WPXA 2CXTA 4DQ0A 2PV0A 1K2WA 1ZUNA 4HP8A 5AVKA 4M7PA 2OXFA 3QE4A 3AUUA 1E9DA 4JUBA 5DM2A 3MQFA 1AS0A 3U31A 3L9WA 4J1SA 3GJ3A 2DY0A 2FV8A 2CL0X 2QYTA 3JAKB 2FQ1A 1DC8A 4KIJA 3ZY5A 3WKDA 3AR6A 5DN6A 2PH3A 2IS2A 4Y1FA 1QCCA 1TZBA 1AQIA 1ZN9A 2JGIA 2R8RA 4ZCMA 1TAUA 1XTIA 4HGNA 5LP1A 1Y34E 4F21A 2NUAA 3DG9A 4ZK6A 5C1DA 4LTDA 1K8RA 4FDUA 3LY8A 3KVNA 3SF0A 4LISA 1E2UA 2JAHA 2ZXFA 3KTFA 4AY6A 4MDFA 5BV7A 2H06A 1FJ2A 3H87A 2AK2A 2YV5A 2HV8A 5FLEX 4IUYA 4PZPA 3F98A 4JIGA 1C7IA 4XTRA 2PSDA 2WOJA 3CLRD 1R9GA 2H08A 2VSYA 1IZ8A 3H9QA 4HEHA 1T15A 4MVJI 2ZJ1A 4Q3LA 5LQUA 3B20A 4BVJA 4K2HA 3RSFA 2V5UA 3NHSA 1J1IA 5E7IA 2FR8C 1OD6A 3QX8A 2NYVA 4ZYYA 3R3XA 2ZVDA 4GVLA 5TQ2A 4F4IA 4EQ6A 1HG1A 1X2BA 3OPYI 2OCLA 4FOTA 5CP8A 4QYSA 1NULA 4AF6A 3TPZA 1P60A 2CFTA 1KZ1A 1ONSA 4Q03A 3W6ZA 1CXZA 1FXSA 1CQJA 1H3EA 1NOKA 3BXEA 5ILGA 1PV1A 4AY4A 4Q5IA 2RJ3A 1G1AA 2A9KA 2BJHA 4B3CA 1C8VB 5FUVA 3CLTD 1K97A 3FMOB 3KYCA 1KI6A 3IT0A 4G5GA 4LBVA 4FD2A 4WVLA 2AX3A 2EARA 5DLEA 4BMNA 2P9GA 1Z2CA 4BNVA 3VTAA 5AK6A 4D4GA 4ECAA 1W4LA 1FFAA 4Q3OA 4QXPA 2GWHA 5LQSA 2PD4A 4DRZA 2QUBA 3BFKA 5JQWA 3I37X 3QW2A 1C8LA 4FGKA 4GOOD 3UYLA 3PRHA 5E0KB 1T1EA 3IJRA 5CH3A 2JI9A 4AG5A 5C9ZA 3FMGA 2NPOA 3D7SA 2O7VA 4IUDS 1ETUA 3OG9A 5ESDA 1PDWA 1PTJA 3R3UA 1VFNA 1AKRA 4GYWA 3VRHA 1GN8A 2X7XA 1NUUA 4KXVA 4U2FA 4ANFA 5I9MA 4RF2A 1W94A 3OF3A 4P22A 3PPXA 1AA9A 1ZCFA 3CV3A 4OA5A 4ACBA 1QG6A 3QEBZ 1U81A 3U09A 2HJWA 2QLFA 2AG6A 5B7GA 3EGCA 1GD1O 4AAYA 3LUHA 2JLXA 2NIPA 4RTLA 3I12A 1RLTA 4IDHA 1XAJA 4XJXA 5JC8A 3QE9Y 4HTAA 2IA5A 1U28A 1E9SA 3LXXA 3CBGA 2H2DA 3EUWA 4DMMA 2VIIA 1T8SA 2OZEA 1D4OA 1XDBA 2ZT8A 3C43A 3QXCA 1W36D 5CB4B 1ECCA 5T64A 3HKDB 4XWGA 3TQIA 3OQ1A 3BRQA 4J7CA 2Z6AA 4EITA 4JBGA 4MJ3A 1NWHA 1Z2NX 1XMOB 3OWXA 3BXFA 3PTLA 4G9EA 4XKJA 5LZ2A 3PF9A 3B6KA 3B6MA 3A4VA 1CNMA 1EI9A 2QR5A 3KLMX 4L8WB 1AHIA 4DNPA 1WF6A 3LY9A 3KC2A 4R0NA 4ZU1X 1WUHS 3PI7A 1QUFA 2ATVA 3AF3A 4IYJA 1C3XA 3UT6A 4B6EA 4DJDC 4DTCA 3AUAA 2LKDA 4WBNA 3MTGA 1T4BA 4NHOA 5SZJA 3U4AA 3ZHVA 2CV1A 2VCHA 2QN7A 2PUDA 4EGAA 3QG1A 3CG0A 2C2OA 4LVCA 1ZFNA 2J0EA 3DH0A 3IIEA 4MYUA 3VDRA 4GVPA 2E0IA 2WM8A 4PC1A 3GJ0A 4YCDA 3UGTA 2NZXA 4BO2A 2IYOA 2XWQA 2PMEA 2J7PA 4PVCA 3S7TA 3K8QA 1XHLA 1KAQA 3T7JA 4DXDA 3NM4A 1LX7A 3B38A 4BVEA 3R5XA 1IZZA 1FX0A 1MXFA 5DRTA 3VDXA 3HWX1 1Q7BA 4M89A 2P4UA 5IEBA 3WLNA 5I51A 5LMUB 3VNVA 2V5VA 1X80A 1TZJA 2PYDA 3EC1A 1PIWA 3C6YA 3CZ5A 4RENA 2X3UA 4YJ3A 4DVJA 2C8LA 5JALA 1EVJA 2Q4OA 3OIUA 2CK3D 2P3SA 3T9EA 1LSUA 1LV7A 4XVCA 3ZDYB 2OMEA 4G01B 3RS9A 2ZIWB 3LQRA 4JR0A 2QMZA 4ILKA 5JVDB 5I8PA 4EZEA 4X7MA 1UJMA 4Y9SA 1DC4A 5TPZA 3JATB 5A9SB 2V6MA 4N6GA 2Z2ZA 2XJ4A 3KQYA 3I6IA 1VLLA 3U4CA 3SJBA 1RFLA 4CR7A 4KR7A 3ZE6A 4P0QB 2Q5QA 4FEYA 1UC9A 4PO3X 5DI9A 4RU1A 1XP8A 4Q7QA 1NXSA 3ND9A 1MRSA 4QYXA 1S8OA 2HIAA 3BGOS 2J6HA 3H19A 3I6YA 5EQDA 2Y0DA 2UZIR 4PM4A 1GGJA 3S8EA 2YW2A 1YACA 3GLHA 1S8FA 3GUVA 2IXBA 4ZC8A 1V45E 4S3MA 2MOKA 4G1UC 1K06A 1XAGA 5BYJA 2FMKA 3BIJA 3CSSA 4NMWA 4HN4B 2RKWA 4A8PA 5ED0A 2FN3A 4CR6A 1ZNXA 3HR4A 2XNSA 1JHOA 4OCZA 5J5VA 4BOYA 4BFWA 4ALJA 4C2AA 1BKSB 1T1IA 1QZZA 2PDAA 4MUBA 3FTDA 2CF6A 4WGFA 5FJIA 1JEQB 1D7AA 1Z08A 3RSOA 3RV3A 5KWJA 4EHIA 3NIWA 2AE1A 1XEWX 1K2VN 3I5AA 2A7XA 1XK6A 2OOKA 2X9LA 3D6UA 3OD1A 1NNEA 3ODPA 2YN0A 4XEUA 3NCHA 3O26A 1GTVA 3DAGA 4LTNA 5K2MA 3U48A 5HRCA 3WBJA 1BMQA 2DH6A 1KMHA 5EZYB 1TCBA 1THZA 2OZPA 4QECA 4XJVA 2ODEA 4O4HA 4HSEA 4DR1B 1EWRA 3DT8A 3IRUA 3UV7A 2JLQA 1PLKA 3KLOA 4JUFA 3VSBA 2BDTA 3EWIA 5E2AA 4JD5A 2QD1A 5KYUA 3UAWA 4EX7A 1K89A 4J94A 3IUYA 1ENYA 1Z18A 3RVBA 1KOFA 3NBYC 3OT1A 2OHGA 1LV8A 3MB8A 2VK2A 2ZIFA 2HH9A 5DU2A 2ZWPA 1JXMA 1X0XA 1NQXA 1YQQA 2HEIA 3OZDA 3SYRA 1BFUA 4KWIA 3RV4A 4CI0B 2NSLA 1JQKA 3EK2A 3KQLA 2H00A 3KXLA 3H9EO 4AJEA 4CKWB 3P9XA 3UOAB 2YQ5A 4AL4A 1QQTA 2JA1A 1U6JA 2X1HA 5CVCA 3ILHA 4Z0PA 3QNWA 1M7HA 3TW8B 4F6RA 5G4KA 1CDEA 3RT7A 5A4AA 2P0EA 3QPBA 2GD0A 4JOQA 2PWPA 4AZ0B 1DXHA 3WK8A 4FMCF 4BWGA 1DG9A 2Z6VA 5JH7A 1SBIA 221PA 4QNNA 3ZS9A 1KI9A 3A0UA 3U7QA 5KSYA 4CG0A 5EMHA 1CC1S 1PKXA 4FOSA 3I09A 1YC5A 4KQIA 4CKCB 2XUZA 5D84A 2JBAB 2W0MA 2R85A 4J16A 4DQXA 2H5LA 5IH3A 2VJYA 3DPUA 4WKOA 3ETGA 4QU8A 1UBLS 1P39A 1C7ZA 3RTEA 3NS7A 4MS4B 5F5NA 4EKEA 2OWEA 3HCPA 4KQKA 3FI0A 1L7DA 4KFCA 3V55A 4PNHA 3KZNA 3IE2A 1YL7A 3ME5A 2NYRA 2DFVA 1YAJA 5KYYB 4ONEA 4EVQA 3C39A 3HEAA 5KQLA 3EZXA 2IQ5A 4UEQA 2OBMA 4OI4A 1UP7A 1FU7A 4RVHA 4KOEC 3TZEA 3ZHYA 1ISGA 2RJNA 1CB0A 2FLVA 2JIDA 2QNIA 1UM8A 3F7TA 1YK0A 3QVGB 4O8CA 2Z2XA 1JHPA 3OZAA 1U0SY 2AYYA 2KX7A 4N0EA 3KT8A 5M3BA 1GG9A 2VCEA 1T24A 2NQ8A 3BCRA 3N6XA 4H1UA 4LXIA 5KKCA 3M9WA 4PYNA 1JSXA 4Q1FA 1LZLA 3C5HA 3E5HA 2NZJA 4HLUC 4UJ3A 1HNWB 2ZJ5A 3PXGA 1U11A 1M1NA 2RAFA 2V7EA 4MLPA 4QUJA 1SOVA 4S1VA 3TKYA 4ALLA 4BNXA 3AKZA 1KZYC 4Q1BA 1OPXA 4X93A 2ZCJA 2XGSA 5C1BA 2UZAA 3EYWA 5CB0A 1N2XA 4MKZA 3OU2A 5EIHA 2I76A 5LVAA 4W8HA 3VGPA 4CEJB 4PRYA 4QDZA 4F85A 2R7NA 4CIAA 4NXNB 2Y76A 2FLKA 3PXAA 5F2KA 4OGFA 1ABBA 1WBDA 5HQ3A 4BZZA 2GBGA 2L82A 2DUUA 2FW1A 1QYCA 4DV4B 4YO8A 1NR1A 1ODFA 3FHOA 3PNLA 1MEEA 1ZD3A 1TVCA 2HO4A 2XOXA 1E7WA 1HEYA 1NU8A 1Q15A 4QTYA 3UPUA 1RPAA 4OJNA 2AJCA 2HNKA 2H2FA 2ZIXA 3ETEA 4E09A 3A2NA 1H1LA 2BFFB 3WLIA 4RK1A 4LF8B 1GQRA 3OOYA 3P2JA 4WCFA 5EIBC 1HA3A 1ZQ1A 5CDHA 1ZMTA 2CLMB 3EVZA 1X9GA 3IAEA 1E3DA 2I4IA 4KGZA 1XLWA 2CZQA 5JI3E 1WXXA 1NM5A 1XQWA 3CF4G 1DMSA 1QP0A 2JGFA 2XTMA 2JK0A 3B1YA 3GCXA 5T3YA 5HR5A 3FNEA 2VAVA 3SZUA 4E1VA 2FK8A 4UFPA 2IYSA 2C7GA 4EABA 3NV7A 3JQ6A 4EY7A 4HZUA 1CY7A 2RHOA 2AQIA 2RB4A 2FJ0A 2HY7A 4EHLA 1QJCA 3H3XA 3A3PA 3O75A 5FYQA 4ZZIA 3K9QO 1GGKA 2I6TA 1IIBA 3OQPA 3S2UA 2D2IA 2P2CA 1W6RA 2EGHA 1OILA 3L93A 1VRCA 4H18A 4M7OA 5L7YA 2BGNA 5E3JA 3RVMA 4PZ9A 3VA7A 2O8BA 1NW9B 1C9KA 2C7BA 2FMIA 2IYEA 1H2EA 3NEPX 4HNSA 4C04A 1FS4A 1Z8HA 2AKYA 1BVHA 3G9UA 3RC8A 1LJ8A 4NICA 3WMGA 4MRMB 3L2OB 3LXUX 4RD6A 2BTEA 2CV0A 2WSBA 4OMDA 5JAZA 5AVXA 3ZZNA 2K5UA 4DBLE 1SCKA 4AO6A 3QXXA 1E9VA 2HL6A 3NUZA 2EWMA 1DRWA 2C98A 2FH5B 2P62A 3C3DA 3K30A 4W9NC 3OZWA 4EYKA 5MN5A 4JR2A 3RIGA 2WTBA 1C0PA 1R15A 2VBFA 1IOVA 2ZJ3A 2W2LA 4B71A 1OX6A 3Q0TA 5I7FA 1OU4A 2QLJA 4MIOA 1PQUA 5SZIA 3VAZA 1PJ3A 1U3GA 3ZGOA 3UJ3X 4OP1A 1F6BA 1IMJA 4ZAYA 3OWOA 4Q00A 1KH2A 2I1QA 5FT9A 2R9VA 3GJ4A 2ZP1A 3JQ7B 2HDOA 1H8EA 1I6KA 1NXQA 1W46A 1G6OA 3WQBA 3SJAA 1FSPA 1J8DA 1ZOLA 1Z0JA 5H68A 3WIOA 4EPVA 2CE7A 3A06A 1BX1A 1X9HA 2QX7A 3FUCA 3HB5X 2QUZA 1J49A 2X0EA 4Q34A 1P33A 3OQ6A 3FNHA 3QF4A 1NFRA 1J5PA 1GZ5A 3G0GA 2GBCA 4YJDA 5COBA 1J0EA 1WE2A 2Q3FA 3BGWA 1AXRA 3NZEA 1P5JA 3FSEA 2PCLA 3H2BA 3T61A 2QT0A 3P2IA 4UPEA 2OGZA 3I6MA 3JX9A 3GRAA 3FPEA 2ZWIA 2ECOA 1UKVY 3FLAA 3LW8A 4L22A 4IDBA 4Z9FA 5KNCD 3GFQA 1W0JD 5AVJA 1RMTA 1VJ1A 3O8DA 4MUXA 3HBFA 1A2QA 1H9AA 5EFOA 3P4YA 1IHUA 3DE2X 1VRVA 2R7KA 1E5QA 3FCEA 3RUFA 3S55A 3X0DA 4BEBA 1CLUA 3L0PA 2XF8A 2K7ZA 4EYQA 4HLNA 1RLIA 2ZUVA 1RCTE 2GASA 4YALA 3WB0A 1O6BA 2FUG1 2HF7A 4D3DA 4BIMA 5J43A 2ATCA 3ILVA 2WSYB 3LV8A 5B1DA 3MMNA 4BBAA 4QVKA 4JXJA 1IBKB 3IP8A 1KMCA 1BCRA 4UNRA 5CHEA 1CFZA 3HYRA 4H77A 2IYYA 4TS3A 3HDJA 5LB2A 1ZQ9A 2UU9B 2WF7A 4JI6B 1N2BA 1WMDA 2XYQA 3BD7A 1R0KA 5ALRA 2J5KA 3RHFA 4DR3B 3UXMA 3PXUA 4NCAA 1CEEA 1ZK4A 3W6OA 2HYDA 3A6JA 3IP1A 2WR8A 2XUKA 1V25A 4IFBA 3GQVA 2QRMA 2PX2A 3TPCA 4NNOA 4OAQA 3EPJA 3FPFA 1TC2A 2FDXA 5LP6C 4F3NA 1RP7A 1EK0A 5JQGF 2WUGA 4XH9B 1B3RA 2PNFA 2GXAA 1R1DA 4BQRA 1YJ8A 4CUKA 3JARB 3JZFA 4URXR 5BOSB 3QBDA 3LUPA 1F12A 4C7MA 4RORA 2HWKA 4MQMA 2H18A 3ZCPA 4MHSA 1W581 1TMGE 2IYVA 3CUUA 2V54A 3MS2A 4H4DA 4D0NA 4Q4CA 5KYUB 1T10A 2W5UA 3IBGA 4PYIA 2FOLA 2QRKA 3K7EA 1E3QA 3ZCTA 5JAIA 2PKRA 3O3NB 5DOZA 2NTJA 4GP7A 3H3FA 1LPPA 4URHA 3TQSA 2PO5A 2QU8A 3L84A 3BD8A 3AM5A 3CR7A 1G5RA 4B2YA 1NI5A 5A5GA 4WLEA 4PAGA 1J21A 4PLTA 5DHRA 4BL5A 4Z8YA 5FUWA 3CUKA 1XI2A 1VC2A 5LQMA 5G3YA 1BKYA 2FZEA 2QL6A 4GI5A 3EJWA 1I7NA 4OOFA 4YTEA 2M9MA 3T9AA 4Y2JA 2GZAA 1S96A 5EI5A 2CLIB 1GPYA 3K6SA 2YFYA 1COWD 1PR3A 3KD2A 1QG2A 3HXLA 4UZFA 5CLGA 3NBMA 2DEUA 2XBUA 1VYVA 3T9BA 1OC4A 3WFZA 1NQUA 4LVOA 1Y7PA 4H6WA 1KK1A 4GWKA 2OE2A 4KYVA 4HQNA 2DY1A 3JD4A 1Y42X 5IUKC 4BLQA 4BNDA 1GZDA 2E4XA 4H08A 4KGDA 3MJSA 4BPBA 2ZIUB 2PRJA 3IPXA 2CE2X 1Q0PA 1EK2A 2R79A 3IQZA 4CCSA 2JLWA 3QMWA 1E5XA 5FPYA 4PONA 5AJVB 3SFVA 2FRXA 1SVSA 1IOZA 3KOZA 3WJ1A 1S4QA 2YFHA 5JARA 4N76A 1DQNA 5DNEA 3KKMA 3R8XA 3PJEA 3X1DA 1C9YA 5IKEA 4Y2RA 5FL7A 4Z4HA 3KSUA 1IN7A 4AQYB 3RQSA 2I4TA 2Z3VA 2AKAB 4FDLA 1XMPA 4P2GA 4XB6B 1SKYE 3QM1A 1NKTA 3A28A 3NWOA 3KSDO 5F1YA 3U56A 3JR3A 1E79A 4DBVO 2ORIA 2CMDA 3E53A 3TSYA 3RUCA 2JLYA 3HB1A 4N0MA 4O2BF 2VRNA 3PGXA 3IUPA 4UQPA 4Z3KA 2IYWA 1L4GA 4HWRA 1T6YA 2BUAA 2ZTSA 4IGAA 4CM9A 2H2HA 5BWBA 2OCKA 1F7VA 1JSZA 2N46A 3VPAA 3VTFA 3UJCA 5CU7A 2J9RA 3Q6IA 1SCAA 3BIWA 3DKVA 2MINB 4JB2A 4QGHA 4AY5A 1T2NA 4NDAA 1KAGA 2RH8A 1Z26A 3HA2A 3TO5A 1IZ0A 3G2QA 3I3OA 4UD2A 2P7IA 3OUTA 4M7RA 4PYKA 3GGJA 5GJVC 3H13A 1QH1A 3D4NA 1TJYA 3KTAA 5DTMA 5BNTA 5CFMA 2AGVA 1RWNA 1SN7A 2VBGA 4J76A 3COYA 3KIPA 3PJFA 3L77A 3VU1A 3VI4B 4CEHA 5GPBA 5EKXA 1MORA 3SQDA 2PPVA 4R40A 1Q16A 1ZUIA 2LE0A 3D8NA 4L78A 3L8FA 1DTEA 1H2AS 3H1PA 4CKEA 2PVPA 2X0JA 3C24A 3HKBA 4RHEA 2EGUA 1XQ1A 2G1UA 3FYUA 3LT2A 4HDAA 5T3UA 1XZLA 1CUGA 3DXZA 3VR5D 2OBLA 4FNAA 2D1SA 4D9MA 3ESXA 4EH1A 1TIPA 1QWOA 4MV7A 3MWDA 2HR1A 4I1UA 4OV6B 3TOSA 3HZHA 3M6UA 3SMVA 1N77A 3RF6A 3HZRA 3RIXA 3CT4A 3UW1A 2C4WA 1B8PA 3QVLA 2YWXA 3UV6A 1D5WA 4AJNA 2PJUA 2WG1A 2WVAA 3HFJA 2QI9C 1S2GA 3FLEA 4LG1A 3G6WA 3IHTA 2O6LA 4E5SA 4KZPA 3KR0A 3PIDA 4RVCA 1PT7A 1DJLA 4CFZA 1YZNA 3MT7A 2C3OA 3WY9A 1IPEA 1EP9A 1JLMA 3B2QA 4DB4A 5K1ZA 5ICEA 3CINA 4C29A 3BORA 3OPMA 4C3ZA 3C4JA 2WA1A 4JU9A 4CXMA 4NJMA 5FR1A 2BH2A 2BZGA 3GBPA 5HJ7A 2EV9A 1KY5A 3G2KA 3ZN2A 1V3QE 3GU3A 4TTTS 4B2IA 4P4NA 2VNJA 3L7YA 4Y9TA 2P4SA 5AVQA 1SVKA 1I5OA 4URUR 5B3JC 1UPBA 2IF2A 1SRQA 1V4VA 2V6GA 5HIMA 3WWPA 1QGAA 4UASA 1ETHA 4HDRA 3F0TA 4KXWA 4QQRA 3UA3A 1KO8A 1XZBA 1WL8A 3I8OA 5A1TA 1G18A 2QAJA 3ESZA 1L4EA 3CG4A 4PCAA 4X7PA 3S2GA 1FSFA 1NUPA 4G81A 4R84A 3C3XA 3TLJA 3GJZA 2ZYVX 2A0UA 4JBNA 4JP1A 1K6MA 1ZBQA 1WPQA 2BE7A 3CRNA 3DL7A 4MITA 3RBZA 4BATA 4XWOA 4A73A 5ADVA 5IF3A 3I73A 1YDHA 4G0WA 4E14A 3GAMA 1DEKA 2JEOA 2H8GA 3TRJA 4HCJA 4CZ2A 3NEAA 2Y93A 1JMKC 1HT1E 1WWKA 2ZUWA 4KBGA 3PUHA 5CIQA 1FTSA 4JELA 1SAYA 4TMFA 5F73A 3H6GA 1GAWA 3C3KA 1S2IA 2A35A 2UDPA 4R2MA 4AJ4A 2VG8A 1KJYA 2IYAA 3BH0A 3JSAA 1YHNA 1YT5A 2DPMA 3B82A 3M1LA 3AHHA 1EFDN 4Q9IA 2A1UB 3LFTA 5CBPB 3J80A 1XF1A 3HWSA 3JTEA 4OBWA 3VSDA 3CXRA 3MYYA 4ZA2A 3ORQA 2EKDA 2IXTA 2JGMA 1GYQA 4N39A 5B6IA 821PA 2ZZNA 4F2HA 4FZRA 1U99A 4X6YA 1E79D 2MYNA 3W04A 1OI3A 2P9YA 2A0XA 1C7RA 5K3DA 1TO6A 3P0FA 4BBPA 3GBVA 2RE8A 5JO9A 2RAUA 2W6QA 1M74A 4NABA 5C1OA 1WXDA 1YIDA 1Z34A 4H4CA 1UEJA 4KB5A 3CLVA 2W70A 3T3MB 3ZKWA 1DI0A 1KQOA 4LBZA 1JAIA 4C22A 5JZMA 1W1IA 1R12A 4JXZA 1IN4A 1FJHA 3M8KA 4D8VA 3UMVA 3E82A 1LVUA 5EPEA 2ZEJA 4L0MA 2IT1A 2ZREA 3ZNOA 4BLOA 4YNBA 4Y2TA 2YXNA 3RJMA 4EEKA 2XXAB 4MDHA 1JHAA 2BMJA 1TLTA 2VYCA 3AOEC 3N39C 4LYEA 1GG8A 2ZGVA 4WA7A 4LY0A 3H5WA 3PVZA 5KJCA 3T5TA 1YS6A 3ENVA 5E9QA 4NQRA 4ABYA 3KR1A 4CM5A 3HPRA 4QOEA 3EFEA 3Q7IA 1U5AA 3V00A 3PFGA 4EAAA 2HO5A 1U2GA 1QTIA 1DV1A 3K9LA 3OM9A 4WNAB 2FCRA 4KQXA 3IT3A 2FWNA 4E07A 5AIBA 3SM3A 1SUWA 2HWXA 3RWBA 3UMCA 3GFFA 4P53A 1ZXBA 3JYQA 3MHTA 2VXOA 1R0RE 3PI6A 4YIHA 4OHCA 4H15A 4NY1A 1E2EA 2D5AA 2PSSA 2R00A 1NE2A 2HCJB 4GWLA 5DHAA 1UZMA 1JUDA 4U7JA 5FWXB 4AJ1A 3NNNA 4UFOA 1TEXA 5ENVA 3MGBA 1G8MA 2ZE5A 3CNEA 3DWEX 5H7XA 4D41A 4Q12A 3UTDA 4K46A 3ZHQA 5JW6A 1GLNA 2A0KA 1B23P 4GKBA 1NXXA 2BI8A 3NBXX 4GUAA 3M34A 1ZGGA 1ZM3A 4CMKA 3ZDEA 2PIDA 3CKLA 2HIMA 5K3FB 4ZYVA 3EXAA 2JFXA 5CA0B 3WGGA 3DPSA 2ON6A 4GM4A 3VQTA 1A97A 3QX9A 2WT4A 3FKSA 1E7MA 1W35A 4TT3D 3V34A 1ZK0A 1PJLA 3CIOA 2FSPA 3WJAA 4YGXB 2HRDA 3AF6A 3AONB 4DLKA 2Q5CA 2YFKA 2ZBDA 1S7CA 3FUTA 5JSHA 1OIXA 3KG2A 2BCJQ 4M6WB 2R5WA 2HF2A 3NUQA 4L72A 3RD5A 3K6RA 3KB8A 4CNBA 2LWIA 2W00A 5HK9A 5JZOA 2GVZC 4RZUA 2BWJA 4CQMA 1WCWA 5E9WA 4YMTA 4X7BA 5F1PA 1P4RA 2WZDA 4E46A 1DSSG 2JJ2D 2AFHA 4RSMA 1QGUB 2ABWA 2ADMA 2OOSA 3TOVA 4DLLA 4ZEMA 1NKVA 5B4VA 4RFVA 4L08A 4Y18A 4DA6A 5DGTA 5CD1A 2HTEA 3N2GA 1UWCA 3LZDA 2FGKA 5DLYA 5K0EA 1G20E 2VHWA 4AKIA 2A57A 4EM6A 4W99A 1W88A 1PG5A 2HI0A 1ZX1A 5H3CA 1UAGA 5CEJA 3SC2A 2OSVA 1QYRA 4ZAWA 2J3EA 4JVOA 3L6RA 4UAVA 4ZDJA 2DLDA 4O0LA 3AG6A 4RPJA 1O89A 1U0LA 4KXFB 2P2DA 3GX1A 3K8ZA 1H8ED 3NVAA 2HBZA 3OKCA 1EFPB 3RU7A 2LDXA 5KDDA 2R6HA 4NAVA 4PQRA 1OB2A 3CLHA 4FMCB 2FPXA 3LYHA 1D7OA 1WABA 2IUYA 2F48A 1PYOA 3ZH2A 3CH6A 1YFKA 2NO6A 5CVTA 1X7GA 1ADFA 2OHOA 2QPAA 3EIXA 3NOQA 4K9KA 5IVIA 3QA3E 3PX3A 1IBLB 2QAGB 4IV0A 1BH6A 2NTNA 3EFBA 3JD2A 4NXMB 1JV2B 3W90A 1SU7A 3D31A 4EPTA 4JJAA 4ME6A 3CMMA 5AKYA 3O95A 1HNZB 1EHIA 1YBVA 4LYGA 1RM3A 4DYDA 3RS8A 1KVQA 2VNAA 3OIFA 1K63A 1EGQA 1U7XA 1OGYA 4OB8A 2C1XA 5FO1A 1IXRC 3FF1A 3L1UA 4Q3KA 4W7HA 3IDAA 3SVZA 3ZCQA 4BNMA 5J4LA 2NZ8A 2DR0A 1LS6A 2QQ5A 2Z9DA 3NHJA 1U65A 1RKVA 5TNXA 4DLYA 4Q9JA 2RFLA 5EE3A 1JXAA 1P4HA 2WSSD 2P6NA 2PQMA 3GRKA 1LDBA 4O2BB 2QRQA 3REGA 5IH7A 3HO8A 2JLUA 3VO2A 1GCAA 5IN5A 1X14A 3TEJA 5J58A 2P9CA 2OCBA 1A8SA 3JQ8A 3HN7A 4J0FA 4DR7B 1H5NA 1V7PC 2BZSA 2QRHA 3CRQA 3A1CA 4OQZA 4Z3DA 4BMXA 4TV9B 1DAFA 2EJCA 2RIRA 4DLWA 3Q3VA 3DMDA 1EUDA 1F4VA 2O2GA 1XZIA 5E4JA 3RROA 4GPEA 2HAEA 1NXOA 2CUZA 2NPFA 4YUAA 1PZEA 5JRZA 1VE9A 2WWHA 3G5AA 1C1HA 3KJXA 2B82A 2G08A 2CYCA 2GF0A 3AF5A 4R0MA 5JFOA 2DHRA 2OAGA 5BQOA 4BRZA 4C4PA 4ZQBA 3TTUA 1T3HA 3NOXA 2I3DA 3QVVA 1XKXA 4K28A 1NVUQ 3D8RA 1SUIA 2XUQA 3HA5A 1RYBA 3ZE9A 4C2UA 1GCIA 2IKSA 4RXMA 1BS9A 2VNSA 4P82A 5LMZA 3OM0A 4K6FA 3BFVA 1YKFA 2PH1A 4A2QA 4YVFA 4FGJA 2VDMB 5FBRB 1C3JA 4YR7A 1Y6ZA 3A1NA 1UKYA 2D6FA 3EFHA 3W5DA 3H5RA 4HLDA 1HF3A 1E3WB 1XTBA 3P96A 1CZNA 4TKUB 5IHXA 1Z6GA 3DOHA 4RQTA 4S0ZA 1QIFA 1OREA 3GJQA 4J29A 2GEVA 4XB2A 4HRXA 1ZJYA 1DAKA 3Q9NA 2J3DA 1KIFA 2WIBA 3FIJA 4G1CA 5CW2A 2G9RA 3JYLA 2C5EA 4PU0A 3K70B 1E0AA 2XA2A 3A9VA 3Q7PA 4BV3A 4Q3CA 3ZTTA 3EGWA 1QFSA 4KODA 1ID8A 2WWVD 3W8DA 3HZZA 1RHQA 4X6UA 2F3RA 1LPOA 1K68A 4TUYA 3AHDA 2ONCA 3LC7O 5E8JA 1WX1A 3CZAA 2BEJA 1ZCJA 1XZJA 3WAGA 3L7KA 4U9HS 5JCJA 2WU1A 3DW1X 3MBIA 5SY4A 4O2LA 5D1NA 5K8IA 1VIYA 2Z1MA 3JATA 1UFKA 2LDBA 2JK1A 2VDOB 5E8RA 5FEMA 5GONF 4D74A 5A9SA 4CRWB 1JKIA 4B7UA 4IY1A 4NAUA 2OV8A 3AHJA 5TLSA 5HS4A 4IDDA 2Z04A 4WZBB 3HJGA 1SUCA 5GV7A 4YJ3B 1I24A 3N8NA 1NLUA 1VLJA 1KMQA 1NGSA 1RDFA 4BQIA 1RE0A 5B4UA 4ZJPA 2O6HA 5DWQA 3ZI4A 3CLUC 4U63A 4FXPA 4X1YB 1GSHA 2Q8QA 3R3JA 4NBTA 5ALLA 1MR3F 4ENQA 5BQ3A 3HR7A 4AICA 2X14A 3F6EX 3NP7A 2YR0A 4YYEA 4P36A 4R9VA 3QF4B 1TU3A 3IPCA 2DPHA 5EPOA 1NUQA 1UBCA 2N1BA 2Z43A 4A23A 2JCSA 1E7SA 3M82A 3PQ7A 4CG1A 3LU1A 1SHLA 1KKUA 1RBYA 2ESRA 4V39A 5A3JA 1N7IA 3QKRA 1ZK3A 3S28A 3RC2A 3L1HA 1IUOA 2C2BA 1A9YA 1DBQA 2B7LA 5CVJA 2Q2NA 4X1IA 3WSWA 4BZWA 1N4DA 3DL0A 5AYVA 4ZD6A 2MT9A 1SELA 1ODIA 1K08A 3K94A 3MPOA 8ABPA 2C5GA 4H1VA 1Z7EA 2ZYHA 5H9WA 5I5EA 1VCMA 3CH4B 4GM1A 2WE8A 1RYZA 4UBMA 1JQJC 5LPNA 2LZ0A 4L9WA 1Q0LA 3DW3X 1Y7LA 5KREA 5F98A 4KMRA 1ZRNA 1MEOA 4U2BA 5KTTA 4Y8VA 3RYCA 5G02A 1XDGA 3DBLB 3PF8A 5FTJA 1KFBB 3G79A 4FFRA 1TKBA 4NFSA 1GDDA 3NYQA 4EW1A 1U8ZA 1FNSA 3IQDB 4JNKA 2FPOA 4IEIA 4QUDA 1M83A 3STVA 3VHLB 1YBMA 3AESB 2AOXA 3I2IA 1DJOA 3O3MB 3VR6A 4ZOQI 3ANYB 3R7FA 5HZHA 3SBOA 1HYEA 3AL0C 1TMOA 4MULA 7ABPA 4M54A 4H31A 3VYVA 4HGRA 2J0VA 4ND2A 1UJCA 6CHYA 1G8SA 3HXKA 1QP7A 4MR7B 3DF9A 4GLJA 4RKRA 3R6DA 5CG1A 4FJ2A 3DKRA 2JIBA 4ZV7A 3BTUA 3K4PA 1AV7A 3AVUA 1PWYE 1V96A 1E98A 3DZCA 3PGMA 1IWOA 3IP7A 4Q7JB 1W30A 1C3OA 4J1TC 1OYOA 1WNTA 3ND5A 3EB9A 1QCZA 4MUHA 4NG4A 4F4DA 5FRDA 1RWPA 1ZKMA 1GAJA 3JV7A 2M6RA 4XYGA 1P7ZA 5ALYA 5HILA 1LEHA 1KVUA 2AX4A 5K51A 4BX8A 5BV2P 1BVUA 2RHJA 3K16A 1VOTA 3PFIA 3GLSA 2VUUA 2W2KB 5C31A 4K03A 4RL4A 3QKWA 2G17A 4MR9A 5IUJC 2FMTA 4OSOA 2HBRA 4KRGA 4DQVA 3GFOA 4HLQB 1JLLB 4JODA 5EXDA 3TW0A 1XTTA 2HCBA 2ZR8A 3NAZA 4FUTA 5K3EA 3AERA 1G3RA 3KB6A 4F56A 4DUYB 2PGJA 3TXYA 5BQXA 5FEUA 1A96A 1VDMA 3RSSA 2EF1A 1G7RA 2FJUA 1UC8A 1JWBB 4O5AA 5FBLB 1LH0A 4OGGA 4RDXA 3UM9A 1M2HA 3LYAA 4DZZA 6REQA 4BNHA 2E37A 2O5CA 3LZCA 5ABPA 5I4BA 5EWJB 1B42A 4HAVA 1C9JA 4K7JA 5COAA 3Q7QA 2XYGA 3EGXA 2HPVA 2H0AA 2NGRA 3VTZA 2D7DA 5L40A 1X80B 3KKZA 2HGSA 1PJ8A 1MPTA 3VOBA 2CKDA 2QYSA 1E66A 4OU4A 1R8QA 2YV4A 4FE3A 4GLOA 2FW8A 4N54A 4YRDA 4G6ZA 3NHAA 3R77A 3W9YA 1DGQA 4X44A 4QARA 3VVLA 5HTKA 1GCGA 1GSAA 1HMPA 1V1MB 1UIMA 2F64A 1MN6A 1VJ5A 1GTJ1 1XPJA 4TMVA 3RGWS 3ZD7A 1XKLA 4RMJA 2X3FA 2WIAA 1I0LA 1JIUA 1GPWB 3MJVA 3CVXA 5IWCA 4PAMA 2ZBRA 3HE3A 3TTWA 2IHVA 1YBHA 2VNIA 5KTPA 1TA0A 3HN6A 2GVNA 4MUIA 4KH1A 4L9SA 5EZYF 2ZB3A 3M1YA 1VIMA 1N0VC 1T4MA 2I4LA 2VSFA 1I32A 1XNGA 4RZ3A 2WJGA 3WKAA 3UJHA 2YWFA 4MUGA 1U90A 4Y9RA 5KINB 2ERXA 2WNHA 3DMTA 3PGLA 5IDWA 2CDBA 3O90A 1G21B 1ZUNB 3HNPA 3G3EA 4EUNA 4PQYA 1ONOA 2JHPA 4CMBA 2Y71A 2ZWMA 4FFNA 2EZ9A 3TD2A 2QXUA 1ZMRA 3KDAA 3R0QA 3K5IA 5D3MB 4S1PA 3TOCA 2AZDA 2QUIA 3OMLA 4PZDA 3VC1A 1OLOA 4QJ3A 1YI0A 3V7YA 4D42A 1SCDA 2Q5FA 2R68A 3CPEA 3V6LA 5AVRA 1NXPA 1XCMA 3RS4A 4D0SA 1FUEA 2DWOA 3R7AA 2YNMC 3ZIAA 3SJCA 1EWQA 2IIQA 3IE0A 4DDMA 2REXB 1VKOA 1SVLA 1B73A 1ST2A 1DOHA 2PY6A 4JVNA 4C4SA 1GGMA 3OC6A 1JL3A 1AQYA 4FWTA 2H0QA 4TTSA 1LLQA 1Y4AE 4L4ZA 2C8KA 4MVXA 4B43A 4N9QA 4FZVA 4LV6A 5IAJA 3L8MA 5AP9A 3Q15C 4D8UA 3ADPA 2WFMA 3S2ZA 2NWQA 4BFTA 1M6EX 4LF4B 4ZQEA 4Y2XA 4YJ2A 1B6GA 3NYIA 1NV8A 1NU6A 2X13A 5B2EA 4BTEA 2PTGA 2QZJA 5JWOA 1SVIA 3P7MA 1V9LA 1YDFA 2I1VB 1TLFA 3ZNQA 3CO0S 4MS1A 5CDTA 1AUQA 2KW5A 1XNHA 4Z4FA 3R7NA 1AZLA 5DYWA 3P2YA 3FPHA 3PUIA 4R8MA 4RMHA 4Q9DA 3W3AH 4RFSB 3FTEA 3A3NA 2B3TA 1N6NA 1NSYA 4LQCA 3NANA 4MINA 4TTIA 4XLZA 2FQWA 5JG7A 4OI1A 3WGZA 4Q4AB 4ESHA 2E6KA 2WY2D 4UU7A 4DADA 4ZI7B 1VIAA 4I2NA 3WLOA 4AKSA 4BFUA 2LGJA 1E2GA 3FOWA 5ICGA 1J70A 4FOPA 1JR4A 5J63A 4D9HA 3OJWA 2BMVA 4DAEA 5L53A 3AZOA 2XODA 2M6SA 3T1YB 1QU3A 5MN6A 1YE5A 1WMAA 2F43A 2X4LA 3KUDA 3PT5A 4NHEA 4X92A 3WGTA 4BGEA 4F72A 4WN9A 5KMGA 3BL6A 4HB4A 4O6VA 1W93A 2W58A 2VRWA 2YWGA 4JUIA 1QKIA 3DBRB 2ZBVA 4N5HX 3OPQA 2MSKA 1XD8A 2IK8A 3V4SA 2CXXA 3KL2A 1HKUA 1NF9A 4GDFA 1SQFA 1ESMA 5BOVA 4HNGA 4WL0A 1N7GA 1QH8B 4TMXA 5K0NA 4J3FA 5P21A 1I3OA 3E0QA 4WXPA 5F7XA 4WAUA 3VR5H 2GPTA 2IBMA 3CYFA 2YCLA 3RQIA 5AMXA 5CUQA 1EIWA 4C0SA 2N42A 2VPIA 3U7IA 4TS1A 4ZQGA 4CTKA 1GUZA 2YYSA 1ULTA 1RKBA 1WVIA 1ZUWA 1NBMA 3GGCA 4FD3A 4G85A 5AJHA 1M34B 4WNCA 3ZY2A 3AEXA 4LECA 2NSDA 1NM5C 3E48A 1ZM4A 2JFPA 4YWJA 2HF8A 2GXQA 5D1HA 1QHHB 1IK6A 2C58A 2EFHB 4QXAA 1MGOA 1VECA 3E18A 5IAAA 2IELA 3G8AA 3ORHA 4AMYA 5GONB 5EQTA 4C7OA 2YQZA 4LYDA 3DMHA 4LWQA