4IS2A

Crystal structure of the apo form of a 3alpha-hydroxysteroid dehydrogenase (baia2) associated with secondary bile acid synthesis from clostridium scindens vpi12708 at 1.90 a resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
245
structure length
215
Chain Sequence
b'MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTMLEPEEIANVYLFLASDLASGITATTVSVDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bile acid 3-alpha hydroxysteroid dehydrogenase
publication title Crystal structure of the apo form of a 3alpha-hydroxysteroid dehydrogenase (BaiA2) associated with secondary bile acid synthesis from Clostridium scindens VPI12708 at 1.90 A resolution
rcsb
source organism Clostridium scindens
molecule tags Oxidoreductase
total genus 72
structure length 215
sequence length 245
ec nomenclature ec 1.1.1.395: 3-alpha-hydroxybile acid CoA 3-dehydrogenase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4is2A00
3I9KA 4FPXA 3PEFA 2BF7A 4JX8A 2CUKA 5HTOA 4JJFA 1N2SA 3JQBA 3HQ4O 3NTOA 4KDEA 1HYGA 5I9NA 5ENVA 3KXDA 1ZCJA 1BVRA 3GG2A 1Z6ZA 4MVJI 1ZK2A 3VVBA 3Q11A 1FDWA 2EW8A 5JFOA 1WNTA 2ZB4A 4AJ4A 4QO7A 4CMHA 1QYXA 5I7VA 1P33A 1A72A 4JCOA 1E1MA 4Q3NA 3R1IA 4PFJA 3TDKA 1FDVA 4AJPA 1O9BA 1TT7A 1UDBA 3WGIA 3BHIA 3TNLA 5FI5A 4PLYA 4PVDA 4FJ2A 1YQGA 2O50A 4UVEA 3HADA 1ZW1A 3TWOA 1E6EA 3DHNA 3HFSA 3JQ9C 1WWKA 2C0CA 3ITKA 2FRDA 3M6IA 4CLHA 2J3KA 4CLRA 3UFXA 1DO8A 4CQMB 5CP8A 3Q1LA 5A04A 4YYZA 1Y5MA 2PD4A 1J49A 1NFFA 2B0JA 5IDYA 5TRTA 1CDOA 4E31A 2ZK7A 3ZHYA 1JW9B 3DHEA 1DC6A 2XXJA 2VT3A 3ITDA 4JP2A 5TC4A 2Q4BA 2NQTA 3QWAA 5CHEA 3ANLA 1DPGA 4IBOA 4A73A 2BLLA 4CLDA 5IFLA 1XKQA 2HU2A 2ZKLA 1I01A 3KEOA 1F12A 1Q2XA 3JQGA 5F5NA 3VH3A 4U0JA 1N92A 2PTGA 1N1GA 3WGQA 4MVJD 3L4SO 3BMQB 1E77A 3DB2A 4R5MA 4PLFA 1P1RA 3OA2A 4DVJA 2O3TA 5CEJA 3FTNA 3K92A 2DFDA 3QP9A 1DRVA 1K5HA 4YRAA 3R3JA 3EK2A 3LF2A 1HE3A 1XHLA 4B4WA 4P8RA 3DAGA 1T24A 4CV2A 2VN8A 1EFKA 3B1KA 3E48A 2BELA 4YAKA 1LDMA 5L53A 1KS9A 1E7RA 5JC8A 2VRCD 4IJVA 4Q39A 1UXKA 4P4GA 5L4LA 2E82A 4MDHA 3IC5A 4MVJP 2BI8A 1UAGA 3K30A 2R6JA 1YBAA 4PZEA 3DMTA 4ZRNA 4ZVVA 4YA6A 4WLEA 3VHRA 5JAIA 3AFMA 3GOHA 3E18A 4HX5A 1UDAA 2UYYA 1YB5A 4EJ0A 1BTOA 8LDHA 1N7GA 1ISHA 4CQMD 5EPOA 2D5AA 2JFHA 4Y9DA 5JCJD 2EF1A 2Z95A 4HFRA 3WGYA 2DU8A 1Q7CA 3G1UA 4GVLA 2D1YA 3S55A 1A4UA 1EVZA 4ZA2A 4CMJA 3JD3A 1V0JA 1C0PA 3ONDA 3EGOA 4J9VA 4LK3A 3RIHA 4G81A 4FQ8A 5JCXA 5T67A 2GUGA 2A92A 1SNYA 4IS2A 2V65A 4BGUA 4UUNA 2WD7A 1BGVA 1OAAA 1Z74A 1TVEA 3C3XA 1A71A 3RUAA 3C24A 3HN7A 3NTQA 5L7WA 2VHZA 3F1LA 2P4QA 3NT2A 4D41A 1N7HA 2B5WA 4D44A 5HWSA 3DQPA 3HDJA 1D4FA 4MVJH 3WJ7A 2VYNA 3RUIA 4E3ZA 4AJJA 2X4GA 1E5LA 2GGSA 4YT4A 1GUFA 2IYPA 4W7IA 3RBZA 4BKUA 4MKZA 3GDGA 1HDZA 4NFHA 5DCWA 4DBVO 4BUCA 4LSMA 3ZWMA 2VHVA 3WTCA 2HRBA 4CMGA 4URFA 3GK3A 3WMWA 3WSWA 4BOYA 2Q1WA 3RI3A 4H15A 3W8DA 1V35A 1H6AA 1QSGA 1M76A 2DQ4A 3NGLA 1HE4A 1U7HA 1MFPA 2HLPA 5AXBA 3ZU3A 4RVFA 5CAEA 2CVZA 4HFMA 4AJ1A 2A35A 4TRJA 3TZKA 1PGJA 2O4UX 1LQTA 3M2TA 3TOXA 1F06A 4CMIA 4NFSA 4RVDA 4AJNA 2IDZA 3JCZA 4WK6A 5G2OA 2JL1A 3GHHA 4O59O 2JJYA 2Z1NA 3VTZA 1VJ1A 1P45A 2FR1A 2G17A 4GX0A 4QT0A 2JFFA 1FDUA 3C1TA 2OP1A 2P9EA 4D79A 5IF3A 1KYQA 2GF2A 4BO0A 1T25A 4LMPA 1GZ4A 2C7GA 1FXSA 3DMYA 4R16A 4BNJA 5CPBA 3RJ9A 5EL0A 4MKXA 2BD0A 1HETA 4BNXA 2DBQA 3TN7A 1C0LA 1W0CA 3C7CB 3QSGA 2GN9A 1PGPA 4C4OA 4L0QA 4UUMA 2EGHA 4KUEA 4E4YA 3SC4A 3ZW9A 3L0DA 4WE3A 4ND2A 2JAHA 1LDYA 3GN1A 4XYLA 1VKOA 2NQ8A 3GFBA 1AHIA 3HFGA 2OORA 3ZNNA 1GAEO 1AXEA 4HY3A 2NACA 1UJMA 1XA0A 3PLNA 4N18A 3ZWOA 1R6DA 1QKIA 2WD7B 1B3RA 3IUPA 3RC1A 4HV4A 3MWEB 2R00C 3AM3A 1X7GA 3L9WA 2Y1OA 5A9SA 2QYTA 1VLLA 1UH5A 2VWQA 3WLFA 1U3TA 3IJRA 4OSPA 4K1LA 2Q1UA 2B5VA 3P2OA 1JVSA 4PGFA 1E3SA 1SEPA 3O4RA 5DP2A 3H65A 2ZQZA 3OIDA 2YFHA 1R12A 3ROMA 1SB8A 3LT1A 2XOXA 2O7SA 2FHSA 4IS3A 1TI7A 1IL0A 2PD3A 4R69A 1T2DA 3OQBA 3GGGA 5KWEA 3RAJA 4B3IA 4NQZA 3PDJA 5CDYA 2YV3A 4O0LA 4XKJA 3L6DA 3WBFA 1K2WA 4RO0A 3HN2A 1HDOA 2O3QA 4I08A 3A9WA 1X15A 2ZB3A 3UF0A 2PH5A 1UP7A 1AE1A 3I1JA 4BO4A 9LDTA 4JROA 3VH2A 2PA3A 4CMIB 2HDHA 4IQGA 2NADA 3PWZA 3ZNQA 2OZPA 5U9CA 3IKTA 4E33A 2GPTA 2Q3EA 3OEYA 1E7MA 4DLAA 2AQKA 1DAPA 2WEKA 1MXHA 4YAGA 3AUTA 3PIDA 1GQQA 4PG8A 4NBTA 3GPIA 4L8VA 3FNEA 5AOVA 5T57A 2DTEA 2D59A 2R2GA 3NTRA 4ZD6A 3A1NA 4RCVA 1IPEA 4BGIA 3W4IA 3FR7A 1Z75A 5LDGA 1Y1PA 2X23A 1XSEA 3V8BA 5I7FA 1DJQA 4TKMA 1N9GA 1PL8A 1U5CA 1EE2A 3K2BA 3PQEA 3RBXA 3G17A 3Q9UA 4WLFA 2VZ9A 3HDHA 3ZH2A 4BNNA 3B70A 5IN5A 5EIOA 3H9UA 4YAJA 3JSAA 3PJDA 3ZWWA 3ZU2A 3VH1A 1PR3A 2X22A 1U4OA 4II3A 5DCYA 2G82A 1ENPA 2CDBA 3JD1A 5ER6A 3WGOA 5A9RA 2PZKA 4JNKA 3GVPA 3QVOA 1NASA 3PLRA 4BO9A 1KOLA 2ZQYA 4NU5A 5A9SB 4XR9A 4J0FA 1HL3A 2VUTA 1LX6A 3L4BC 5TT1A 3WSVA 3D64A 3I52A 1GEEA 2C5AA 3KBOA 4IM7A 4WECA 4RJTA 3D4OA 1PJQA 1PJ2A 3QE3A 1X7HA 1NVTA 3CH6A 5KJCA 5A3VA 2NVUA 4INAA 4M55A 1K3TA 2EJWA 3UKOA 4E6PA 4J7CA 1YE3A 4X54A 4YT5A 4P4NA 5I7EA 4OKIA 3I23A 4XQEA 2PGLA 1PJSA 4WASA 3K6JA 4NPCA 4JBHA 1O5IA 5HM8A 5H82A 2VTEA 4A10A 2C7VA 3I9LA 3WOHA 3LT2A 2J5RA 3INTA 2OHXA 5TJ9A 2QRKA 3AY3A 5DBGA 1B8UA 4RF2A 2WE8A 1SAYA 4LRTB 1K6IA 4IDCA 3PQFA 2R00A 4J49A 1PQWA 4I5GA 1GEGA 2Y99A 2V6MA 5T64A 1BWSA 4J3FA 4MIOA 5A1TA 3JQAA 1Z73A 2QW8A 4BVAA 1HZJA 3WMXA 1PQUA 2O48X 3AI3A 2YQ5A 5ER9A 3PJFA 2VHYA 4Y6PA 1KERA 2HUNA 1PS0A 1WVGA 3EC7A 4W6ZA 4DL9A 4EUFA 3BIOA 4YVFA 2GERA 3EZYA 3BMOA 4FOSA 3ZHZA 1E3IA 4F6CA 1HKUA 2JD0A 2W2KA 3ZCXA 3QY9A 4XYEA 3DHYA 1ORRA 4OAQA 1N9GB 3TOZA 1XYGA 1ZIDA 4R9SA 3CE6A 4RPHA 4YWJA 4UVIA 1NP3A 4BO1A 2C54A 2CDAA 3CIFA 2H1SA 4LMRA 4QTZA 3L77A 1E3JA 1HYEA 1ENYA 2AEMA 3GZNA 1C14A 4GLLA 4DTIA 3VDQA 2NU7A 2DT5A 1LLCA 1NVMB 5IZ4A 5G0SA 5J23A 4GWGA 5ITWA 1F14A 2HMWA 4FCCA 3ZWYA 3E1KA 5FWNA 4WNIA 1O94A 2WJPA 2PD6A 1KBZA 2QZ9A 3H8VA 1P44A 4F45A 1BW9A 3PPIA 2O3JA 5LC1A 4DYVA 3A4VA 1B8PA 3JD0A 3W8EA 3OETA 3OHSX 4LISA 3VOSA 2RCYA 3GUYA 2O3UA 4GX5A 1KIFA 4PZCA 1AN9A 2VQ3A 3FCOA 3GPDG 2QRLA 2YV2A 3D3EA 3KV3O 3RQSA 3KEQA 4FFRA 4ZQEA 3RSHA 3X2EA 4FFNA 4CJXA 2NWQA 2NVUB 4O6VA 1NFRA 1RM5A 4P4LA 5L45A 3PYLA 3ZWAA 1YQXA 5CDTA 3GEGA 4A26A 3S2EA 1SCUA 1GCUA 4B4UA 4CR6A 1O89A 4YJFA 4DYDA 2OL4A 1GDHA 2X9GA 3LF1A 4UVGA 5JXWA 3O26A 5IN4A 1NR7A 2VT2A 3FN4A 2X1HA 3FTPA 5TF4A 3OSUA 4GPD1 1ZFNA 1N5DA 1P1IA 2FPIA 1S6YA 4F46A 5A02A 4BNHA 4GBJA 1J5PA 3ORFA 4DQVA 4XIJA 5HS4A 1IB6A 2BGKA 4NIMA 3ANNA 1SBYA 3G79A 5KVVA 1YL6A 2UUOA 1Q7GA 2DAPA 3GDOA 4Y67A 4NJOA 1IE3A 3I9NA 3ROQA 4I5FA 3ETEA 4G5HA 3NUGA 3JQAB 4M86A 1O6ZA 1WMAA 1F8FA 4W4TA 3ZGYA 3F5QA 1ISMA 4M87A 1U3VA 1XELA 3C8MA 2VUSA 2UAGA 2OXIA 4GMFA 2TMGA 4NBWA 4A7PA 5JAMA 1P1KA 1V3VA 3S2GA 4RPJA 1E1KA 3KOUA 3MJEA 1R4MB 4ITUA 3BMOB 3P7MA 1NQOA 3PFFA 4E21A 1C3VA 5JBIA 3OIGA 3BMNA 3WNVA 3WIDA 3CSDA 3JQDA 4KWIA 7MDHA 4LCEA 1JQBA 3L07A 1PQPA 3TFQA 3LC2O 1DDOA 2WYWA 4UAGA 3AU9A 3GZNB 3LC1O 5FFFA 3ZNPA 1E6UA 4NU6A 1SMKA 1I2CA 2PH3A 4IJWA 3DC2A 5TGDA 3CMCO 4ZQBA 5EINA 1WZEA 6LDHA 1PJBA 1IZ9A 5U1PA 2BFAA 3H2SA 4AJOA 5BSHA 3OQ1A 1ZBQA 3PGXA 4XEHA 4DLLA 3PRJA 5KKAA 2VRBA 1ZVMA 1BW9B 2VNSA 2YUTA 3E8XA 2DC1A 3CTMA 3KSUA 4CR7A 2Y66A 4NG5A 4TVBA 1DLIA 4E5NA 2PV7A 4J0EA 4WLNA 2I76A 2PK3A 5DBFA 4EZBA 2GLXA 4N54A 5COBA 1GY8A 2FSSA 2FMUA 4EW6A 2W98A 4J91A 1PSDA 3JV7A 2DTXA 1EUDA 2O4CA 3RBVA 1YGYA 2VZ0A 3H7AA 4AG3A 3DAFA 4KUGA 4YJFB 3UCEA 3JQAD 2FPGA 5TJHA 4XX0A 4FGSA 3CXRA 3PGJA 2IXAA 1H2HA 2Q4EA 4F3YA 2DVMA 2V6GA 3CZMA 3PDUA 4R68A 3WGZA 1A4IA 2WD8A 3HDYA 3IDSA 1GV1A 4OIMA 4HKTA 1LDBA 3O03A 1Q7BA 4TVOA 3ULKA 3RUEA 3BMQA 4GH5A 4XGNA 4IMPA 2EJVA 5JY1A 3U3XA 3IP1A 3ANMA 3GEDA 4CMCA 1L7DA 4YQYA 2FPPA 3NGXA 3JQ8B 4W99A 3E82A 4HUJA 2BGLA 3ZV5A 3FD8A 4UEOA 1DOHA 4KQWA 3MJ4A 2C2XA 3GAFA 3DO5A 4S3MA 3RKUA 5LDHA 1NHWA 4J6FA 1JA9A 4CLEA 1IOLA 3KYBA 3VZSA 1IY8A 3B1JA 5JE8A 4FSHA 1Y8RA 1M67A 1DAOA 1C1DA 4RZHA 4XQ9A 3ZV6A 3BMNB 2Y1GA 4J9UE 1DBVO 4J1SA 4RGBA 4E2YA 1PJTA 2PZJA 3AM4A 4QXMA 3INRA 4QO8A 3H6KA 4L9RA 1LXCA 2C2YA 4TQGA 4CM6A 5JW6A 3FHLA 3SLKA 5H83A 1B16A 3K73O 1KVUA 4IY1A 4Z0TA 2D0IA 4OM8A 3F5SA 2HCTA 4YJHA 2AXQA 4IDFA 5KJ1A 4Z6KA 4XYGA 4ALLA 2F00A 3PHIA 4NH4A 1EVYA 2GASA 1FJHA 1OC4A 3SVTA 2D5CA 5KIAA 4FJ1A 1I2ZA 1C0KA 2I6TA 3I9JA 4ILKA 2Q49A 4IPTA 1KEWA 1I32A 4DPKA 3GRKA 2EG9A 2X0NA 1E92A 2IZ0A 3E9NA 4MIEA 1HDXA 4GKBA 3QVWA 4BKRA 4FBGA 4PIVA 4BMVA 3PYXA 3CINA 2EV9A 1M6WA 2NNLD 2VUUA 4MP8A 2F1KA 3DEYX 4EGFA 1P0CA 4FFLA 2QYSA 4OH1A 4WNCA 1A7KA 1LUAA 3RKRA 3VZPA 2HMTA 3NV9A 4BS9A 3L9XA 4KQXA 2NM0A 5DOZA 2OGUA 2O2SA 1NPYA 5GZ6A 1Q0HA 4DC1A 1ID1A 2YDYA 3CPSA 1JN0A 3ZI0A 4FOOA 4DWVA 2Y0EA 4Q3AA 4MVJF 4NJMA 2H5LA 1YB4A 5JAQA 4HBGA 1R4NA 1NYTA 4RV9A 2IZ1A 1X1EA 2ZTLA 4JK3A 5LCXA 5CDGA 4KTTE 1TT5A 5G0WA 1PS8A 1X1TA 1T26A 3SC6A 3UOGA 4TKLA 4CV0A 3FPCA 3NAQA 1LA2A 3K96A 3RC7A 2RAFA 8ADHA 2X7HA 2OP0A 3TQHA 4TRMA 1H9AA 4MIYA 3GF4A 4YT2A 4B4OA 1CQIA 3DL2A 1LDEA 3PP8A 4QFDA 1NR1A 1U9JA 5B1YA 4RF5A 4U6SA 4WCDA 1LLUA 4I5EA 1Y8RB 1C1DB 4IIVA 1Z7BA 2FP4A 4LVUA 1LRJA 1VRWA 3H4VA 4XB2A 1W73A 2PLAA 1XCBA 2Y1DA 4YR9A 1HLPA 2IEDA 1XR3A 1HDCA 1Y6JA 3IS3A 1DIRA 3WQRA 5JMWA 3NEPX 4ONEA 2WMDA 1XEAA 1E7YA 3GG9A 3RCBA 3O8QB 3A28A 5DULA 4J16A 4L73A 4Q3DA 1T4DA 3JD4A 4ZJUA 4DMLA 4YJHB 1PTJA 4FC6A 3U09A 4CM9A 4Z3KA 5L7TA 5HBRA 3UGKA 4ALMA 1BXGB 3E5RA 4PVCA 4NFYA 5ILGA 3WICA 3F4BA 4QEDA 2A4KA 2DTDA 3S1LA 3VKUA 3TSCA 4AJIA 4OL9A 4L4XA 3KETA 1MLDA 1YBMA 4E2ZA 1L7EA 3E6AA 5AQ1A 3QVTA 4EJMA 4PRKA 3LQFA 2AMFA 3T4XA 1LSOA 3VDRA 1EK6A 1HEUA 1ZSNA 3KHUA 1Y8QA 4IDGA 3VTFA 4HFNA 2G76A 5JAZA 1OI7A 2Q50A 3DXFA 2PZMA 4E30A 2P9CA 4HNHA 2QQ5A 4Q3EA 2JHGA 2Y93A 4LW8A 4QUKA 4R1NA 4CM1A 4YBZA 1JKJA 3KRTA 5A5EA 3MJSA 4JLWA 4NJMB 3FRJA 4Y8VA 5JYDA 1R4NB 3RUFA 3HDQA 3TZCA 1R66A 4W82A 2ZB8A 1Y5RA 4J2OA 1E7SA 4UVDA 4BIIA 1TT5B 4RVSA 1OBFO 1PWZA 4OGWA 2UDPA 3EYWA 5TQVA 3WG9A 2A9FA 3Q3CA 1RPNA 1GTMA 1K6JA 2FY8A 1J6UA 1NAIA 3OP4A 1NBOA 1A9YA 3CUKA 3ONFA 5CEEA 1PX0A 3CKYA 3QWHA 4FC7A 3MOGA 4DMMA 2WSBA 3P5SA 4L74A 2FN7A 3RUDA 2I9PA 4IGFA 3U4DA 3WS7A 5CDUA 5B37A 1Z7EA 2O2YA 5K0ZA 1NX6A 1OC2A 4AFNA 1PZEA 2HMVA 4DGSA 1PS9A 1NM5A 1PL7A 1GYPA 4BNLA 4Y98A 2POQX 3RWBA 3GDFA 3VZQA 3ICCA 4YCAA 4CL3A 1I36A 2QHXA 2GR9A 4NI5A 1PJLA 1NPTO 2AQ8A 2J8ZA 4JXKA 2YYYA 1YB1A 4I1IA 5T8KC 1HF3A 1PR9A 4GVXA 3UN1A 4D42A 4U8GA 4KWHA 2AA3A 2EP5A 3OJLA 1A27A 3B1FA 3S2FA 3U49A 4XGIA 2EKQA 4OXYA 2X0IA 1NFQA 1KVTA 2ZYGA 2X5KO 4TMFA 2X5JO 3LU1A 5EQDA 4GGPA 3EUWA 3TRIA 3AOGA 5FI3A 1P74A 1A9ZA 4BNWA 2QRJA 3B6ZA 5ADHA 2PY6A 4M49A 3ZWXA 4RL6A 4TSKA 3ZWCA 4U0KA 4RORA 4EI2A 4W7HA 3JYPA 3G1TA 1P1JA 2X9VA 5CEFA 3OJ0A 1YJQA 3FBGA 4J2HA 1Y8QB 2H63A 3TPCA 1WAMA 1ML3A 4XZ3A 1I24A 1DIGA 5F3RA 5DNAA 5TLSA 1ULSA 4XRRA 2JD1A 1GQYA 5EESA 3F46A 3WXBA 2G1UA 3AM5A 2VTDA 4BO2A 1XU7A 1YXMA 3IIEA 4FFOA 3FI9A 4BO3A 3KLMX 1CIVA 1WZIA 3U5TA 1YVEI 1I3MA 3ADPA 4FS3A 2IEBA 3ADOA 4JQCA 4PLHA 4L4SA 4GAEA 1I3KA 3D4PA 2PGJA 4Q3CA 2NUAA 2YHIA 4UUPA 1U8XX 3UH1A 5CFZA 4WEQA 3EDMA 5GZ3A 5JDCA 4N5LA 4RDHA 4XA8A 2XPCA 3W8FA 2UVDA 1QLHA 3N58A 1V8BA 4HFJA 4PG6A 3LK7A 5JNLA 1G0NA 1Q0LA 2D3TA 1VI2A 3BTVA 1QYDA 3PXXA 2FR8A 5K6AA 5L9AA 4MPDA 1FMCA 2GZ2A 2I67A 4XQCA 3ENKA 1XG5A 4IDAA 1K0UA 3NDRA 2J5QA 4O1MA 4GQAA 1R15A 2EKPA 4WOJA 4YB8A 1QP8A 2NU8A 3QWBA 3RUCA 4E2WA 4YJDA 4CM9D 4K9DA 3AY7A 3W6UA 1ZZEA 4ZICA 4CUJA 3QQPA 2HO5A 3UHAA 3DTYA 3SJ7A 3VPGA 1U1IA 1P31A 3FNFA 3KVOA 1EBFA 1I3LA 1U3UA 2PR2A 3HSKA 1VJ0A 4NMHA 1GFSA 1LSUA 1PZHA 3QRWA 1D8AA 4FFPA 3GFGA 1DIAA 4DLBA 3GVXA 5L4NA 3PHLA 1DC3A 1DFHA 2G0TA 4WCFA 3WB9A 1T1RA 5JPIA 3FWZA 2GZ3A 1ULUA 4JP3A 4GX1A 4RQTA 5TT0A 3QWIA 1DHTA 3WNQA 5JSFA 1JDJA 5EQFA 4BNTA 3VKVA 3ZHBA 2PKRA 4Q9NA 4RF4A 5DP1A 4DIFA 3H9GA 4CUZA 4Z0HO 3DBLA 1KEUA 4TWRA 4H7PA 1VSVA 2E4AA 1B7GO 2B37A 4NBRA 3ZDFA 2IXBA 4WOKA 1M2WA 3MOIA 1EVJA 2IRWA 4D46A 4CM4A 3GY0A 4PG4A 1H6CA 3NDIA 4M1QA 1V6AA 2NTNA 1D7OA 1LDGA 4NDNE 3G0OA 2O3SA 1MGOA 1VE9A 3FSRA 3PTZA 4QECA 5I9LA 5T8KA 4OHUA 4JJGA 1EK5A 2QZZA 4YQZA 1QYVA 3FNHA 4XWYA 4CMKA 1QLJA 3WQQA 3PYMA 1CJCA 2YHIB 4YJGA 5CPFA 1EE9A 1NQAO 4ZGWA 2NLOA 3PZBA 2C59A 1LLDA 3E9MA 1DJNA 1QXSA 1XQ6A 4PLVA 5JO0A 3AW9A 3KSZO 1NVGA 3JQEA 4OKNA 1VSUA 1UXHA 5ITVA 3NJ8A 4OXKA 1PGNA 4BGEA 3MEQA 1QMGA 5TSDA 3HWRA 3TZ6A 3U9LA 1P3DA 2DM6A 3OM9A 1V3TA 4YACA 1GUZA 3RROA 3C1OA 5B4UA 1SEVA 4Z0PA 1N8KA 5IZCC 1U2GA 2DBZA 1ZK0A 4PLGA 1E3LA 1ZSVA 3I83A 4D3DA 4DC0A 2Y0CA 5G0TA 4F6LA 3D7LA 5KOIA 3M1AA 3F47A 5DBIA 3WIEA 1ISGA 1R4MA 5H81A 1Y9EA 4N7RA 4E5PA 3C85A 4RVUA 4WCFB 1XWFA 1TXGA 4CODB 5BSEA 2JCXA 5IDQA 1BMDA 1G1AA 1ISIA 4BNYA 1ZXLA 4IUYA 1WP4A 1U5AA 2ZTUA 4IXTA 4GGOA 1IZ0A 2AW5A 2Y1FA 1DB3A 1MB4A 3LLSA 4D3FA 1BVUA 3DBLB 2OBYA 2HMSA 2I3AA 3KYCA 3LVFO 3GGPA 4J43A 3UUWA 2WWRA 3WGTA 3GGOA 3M2PA 4WKGA 5TS3A 5C37A 3LT4A 2OUIA 3PK0A 3AUSA 4CM4B 1XQ1A 4HWKA 4I8XA 2NSDA 3JYOA 1ZNQO 3DFUA 1DC5A 3DAPA 3Q9NA 1ONNA 4P38A 1SC6A 3EVNA 1E3WA 1XGKA 4Y6SA 1LNQA 1E5QA 2GNAA 1SOVA 3E03A 1UAYA 3NYWA 1HLDA 5I9MA 4DQUA 4BNMA 5EMHA 3I4FA 2IODA 4NBVA 4XYBA 3WDSA 3GNSA 4XGKA 5GZ1A 1CF2O 2WYUA 2XAAA 4IDBA 1D1SA 2XF8A 1Z45A 2E6UX 1R37A 4PLZA 1DFIA 3G49A 2DBRA 4UREA 4YJGB 3H9EO 3TFOA 3ROPA 2JFGA 3HZZA 4ESOA 1OOEA 3LC7O 1JTVA 5ICSA 2NV6A 4OYRA 1JU9A 4CM8A 5G0VA 1F0YA 3V1YA 3FF4A 5A05A 5THQA 2ZTVA 4MKRA 3NT5A 2B36A 2OMEA 5I8WA 2YFQA 3ZU5A 1R16A 5KVQA 3TZQA 3UW3A 4BV8A 3O38A 2GD1O 1GQ2A 5DOVA 2LDBA 4JBIA 2Y68A 1YWGO 2AQIA 2AE1A 1FK8A 3JQ8A 4RPLA 5IG2A 3ETDA 3U4CA 3KYDA 5ICMA 2A94A 4EYEA 1NQ5A 4O63O 3DZJA 3DOCA 4NZ9A 4LN1A 4P22A 5K9ZA 3C7DB 1GYQA 4BNKA 3EHEA 1UZLA 1P0FA 2CD9A 3P2YA 4KMSA 3K5PA 2WM3A 2YQ4A 4BO8A 5BSFA 4YAIA 2B4RO 1UZNA 1WLYA 4LCJA 1LEHA 4W9NA 1WDLA 4D0SA 1O0SA 3JYQA 1ZMTA 1C1XA 1GZ6A 1WDMA 3CZRA 3ZU4A 1SO8A 3ETGA 3EW7A 3QW2A 2YZ7A 1QV6A 2P68A 4BHTA 2QIOA 4AL4A 2NU6A 3RFVA 4CM5A 1H0KA 3V1UA 3KYCB 4K28A 2LDXA 3TZHA 3GEMA 3VH4A 4B7XA 4IZIA 1E3EA 4WJZA 2Q1TA 4TRNA 1NHGA 4CMBA 1YS4A 1LQUA 1YJ8A 5IZCA 2E49A 1NWHA 3F3SA 1MX3A 3KTDA 3LSYA 3OJOA 3QHAA 4E5YA 4J7XA 4KTVE 1E3WB 3HHPA 1AXGA 2C07A 5HRUA 3RFTA 4OOEA 2HJSA 4EBFA 3NKLA 1NXQA 1ZJZA 3WYEA 4XR4A 1KEVA 1ZXBA 1HDRA 2CVOA 4R9RA 4ZQFA 2ZJ1A 3SXPA 3ONEA 3LZ6A 2H6EA 5G0UA 1VKNA 1MC4A 4ND5A 1ZEJA 1WW8A 3VZRA 1SB9A 1IPFA 3BXXA 1VL8A 3IOYA 2J3IA 3JYNA 2E48A 4XYMA 2FZWA 2P4HX 4JGBA 3QIVA 2NU9A 1T2AA 1ARZA 4AJLA 4FFMA 3S2IA 4M8SA 1UR5A 1EFLA 5EERA 1R0LA 1W4ZA 1LLQA 4B7UA 2P5YA 2CFCA 3HB4X 5KJEA 4CM8B 3DBVO 5HA5A 3GZ4A 4RPKA 4B3HA 1YL5A 3AY6A 3MZ0A 4ZHSA 5DN9A 4BO5A 2BHLA 4J7UA 4I9UA 4M89A 1YQDA 4EUEA 4BO7A 4R01A 4N5MA 3AJRA 2X6TA 1GUYA 1JKFA 5COQA 2W2LA 4B79A 1CYDA 2VOEA 4A2CA 1UP6A 1ZMOA 2GSDA 1I3NA 1BSVA 1UZMA 3AI2A 5A9TA 3PIIA 1QR6A 3KYDB 3WYBA 3ZZNA 3BMCA 1ADBA 4MP3A 4NHEA 4A27A 3QVXA 4YEDA 1JWBB 2NTJA 3GNQA 3PHGA 3IUSA 2XXBA 4BL5A 4A5OA 3OA0A 3FNGA 3KZVA 3JQ7A 2D4AA 3WWYA 4IDEA 1LRKA 2YDXA 3LLVA 4CQLA 2YHUA 4NBUA 4RVHA 3GQVA 3GH3A 1RKXA 1C1XB 2V6FA 2ZJ0A 1AUPA 1YONA 4PLCA 4E2XA 3BAZA 4B8ZA 1Z82A 4MVJG 2C20A 1MA0A 3E5MA 3QV1A 1PJ3A 1CEQA 4BMNA 2CDCA 1U8FO 3O8QA 4Z9XA 2HAEA 4CMAA 3H2ZA 3EAGA 3T7CA 3UAGA 3HNPA 1UXIA 2OOSA 4ZN6A 3OIFA 1H5QA 5BNTA 1HSOA 1IYZA 3UICA 4D7AA 1ZEMA 4PLWA 3H5RA 3PQDA 1MFZA 1NWCA 4CLOA 3R6DA 2DBVO 1BXGA 1XDWA 3SBOA 3T7EA 3DFZA 3GNTA 4PN3A 3RJ5A 4ALKA 4XCVA 5DZSA 1IULA 2BH9A 2ILTA 2NVBA 3DZBA 1CQJA 1LU9A 3K2EA 1N1EA 1KY4A 3B20A 4FW8A 2B4TO 5BNIA 3TF5A 3V5NA 3IKVA 3AWDA 1JLLA 5COAA 4E5MA 4ALIA 1KEPA 2UV8A 2HKIA 5T5QA 3RUHA 4WGGA 3DDNA 3ROKA 1KVRA 1MUUA 5TNXA 4K6FA 5KNLA 2WE7A 3AUUA 4XD2A 2CF6A 3HG7A 4IZHA 2RHCA 4CMEA 3BHMA 4S1VA 1WXDA 3E9QA 3O9ZA 2Q1SA 3TJRA 1MXFA 4TZTA 3QJ5A 3KSDO 3C1AA 2X8LA 3G3EA 2NTVA 4H3VA 1O8CA 3ZN2A 4WLUA 2Q45A 1ZK3A 4XB1A 1JAXA 4NK4A 2V6BA 1PU2A 3ZWPA 3FWNA 1RJWA 4HXYA 3WBBA 4O5OA 1A5ZA 3R0IA 4FJ0A 4AICA 2DLDA 1DEHA 3BMCB 1B14A 5JDIC 2GO1A 3EY4A 4EITA 5B4VA 1EQ2A 1E7WA 1ENOA 4DQXA 1U4SA 2B69A 3JQ7B 4J1QA 4LRSB 1T2EA 3OEWA 4GI2A 4YXFA 1ZUD1 3OH8A 2Q2QA 4CQLB 3ICPA 1L1FA 1ZH8A 5C7LO 4R51A 3DR3A 3OF2A 4YAEA 4A0SA 3U0BA 3F4LA 1GPJA 1CRWG 3COSA 1ZO8A 3W6ZA 4U5QA 3DZIA 1HE5A 2WYVA 2JD2A 4OXNA 2Y67A 1RM0A 1HT0A 3LDHA 1B8VA 2AG8A 3DZKA 4CPDA 3BYZA 3HE3A 2CVQA 1T4BA 2CMDA 3I6QA 6ADHA 4ALNA 3ZHXA 2W8ZA 5A4DA 1QG6A 4CLOB 1YO6A 1LSSA 1QYWA 1Q1NA 2I99A 2PFGA 5JDCC 3LYLA 1LC3A 2DFVA 4RZIA 4UUOA 4B8WA 2BRUA 1X0XA 1DC4A 3AFNA 3DBHA 4E0BA 1CWUA 5DF1A 3SX2A 2BMAA 1WDKA 1YH3A 3GR6A 1EQUA 4N5NA 1RYEA 4ZQHA 1C0IA 1BXZA 5K6AC 1HE2A 5IAAA 5A3JA 2D2IA 3ZW8A 2DKNA 2DUUA 4FIZA 1B0AA 4FN4A 2IZZA 4R4JA 2CSUA 2W2LD 2V7PA 4BKOA 2AG5A 3CMMA 3DOJA 1U3WA 2G5CA 3N7UA 4BO6A 2B83A 2BFOA 4IIUA 1UDCA 2OBNA 4TROA 3FPLA 3UXYA 4JJIA 1NPDA 4IMRA 4I9HA 4L75A 4R3NA 4GWKA 1AHHA 4ND3A 2IE0A 2GDZA 5FF9A 3BA1A 5U4QA 1Y9AA 3RU9A 2ZCVA 1ADGA 3UCFA 3NRCA 3Q6IA 3DOOA 4CLRB 5GY7A 3GMDA 4WCFC 4BV9A 1FF9A 5A06A 3D1LA 4IQ0A 4BB5A 1KVSA 4E12A 1VL0A 3VAZA 1RWBA 1T2CA 4PLTA 1JWAB 3GA0A 4DXHA 3Q2IA 1NNUA 1PGOA 4AJEA 1O95A 1P9LA 4G65A 4NK5A 3PJGA 4DPMA 3GN2A 5HS6A 1NQTA 1YOVA 1RM3A 1XIVA 4Z9FA 4MVJE 1EUCA 2VCYA 3JQGB 3MCVA 2J5KA 1BDMA 4GKVA 3PJEA 3JQFC 1BRMA 4KZPA 3A06A 3CEAA 5EN4A 4MP6A 4TRRA 5IXYA 5L4SA 2YY7A 3ON5A 4RLHA 5DDIP 2WTBA 5CG2A 1MC5A 2Y0DA 5CG1A 4MOWA 1X14A 2X0JA 4R1SA 2ZCUA 1YDEA 4DPLA 2CY0A 4IGEA 3JQ9A 3KM0A 2GYYA 3BZUA 1LC0A 4QX6A 1HDGO 3GLQA 1K89A 5BSGA 3RU7A 4RF3A 1V3UA 1R0SA 4J4HA 3L6OO 2PGDA 3I9OA 2P9GA 4MVJM 1YRLA 3R3SA 4ZU3A 2E37A 5FYDA 2DUWA 1MV8A 1IHYA 4FGWA 1H6DA 4ND1A 2GN8A 1TA4A 4PRLA 3UCXA 3V2HA 4AJ2A 4DREA 1U7TA 2TMDA 3IJPA 1DIBA 1KY5A 5JC1A 3DBHB 5JDIA 2CF5A 1UUFA 4II2A 1GV0A 1T1SA 2O7QA 3MJVA 5A03A 1EVIA 2YV1A 3GHYA 4DA9A 3V2GA 3WGHA 2UUPA 3EZLA 1PWXA 4Y6RA 2HK8A 1ISJA 4IXWA 1GR0A 2GN6A 4RDIA 1M66A 3DZFA 4J4TA 1E1NA 3RD5A 1E6WA 2C5EA 1IUKA 5F1PA 3VVCA 5KJFA 3L6EA 3P19A 1HYHA 4MINA 4LVCA 4KDFA 2BFPA 2ZIZA 4PLPA 3WFJA 1LTHR 2PZLA 1JKIA 3VPXA 1NTOA 5C7OO 4G2NA 4WLOA 4YDRA 4M54A 3K9QO 1G0OA 3ASVA 5DCUA 3TL3A 1KC3A 1I10A 1I30A 2CZCA 5KVCA 2D8AA 3H9QA 3GMSA 1G6KA 2I3GA 3RC9A 5BR7A 4A03A 3C7AA 3AU8A 4XDZA 1HSZA 2FSVA 1ZK1A 4GSLA 3JD2A 3LT0A 4R1UA 3PHHA 2P2SA 3H9JA 3DONA 1ENZA 4HP8A 4R54A 3KO8A 1ONOA 4BNIA 3GC6A 1J0XO 4OSOA 2SCUA 1LJ8A 2GCGA 1YOVB 2JAPA 3V1TC 5AXDA 1WPQA 1RYDA 1VL6A 2RH8A 4D0RA 3HB5X 5L7YA 2Q46A 2EIHA 3ZV3A 2X0RA 4WEOA 5F1OA 1EEHA 4E5KA 2FR0A 2Y05A 2VNAA 3ZWNA 1LRLA 3M1LA 3BTOA 1I5RA 2EERA 4ND4A 4J4BA 4B7CA 4EEXA 3QWFA 4D45A 1P1HA 3GT0A 1PIWA 1DRUA 2BI7A 5JO9A 3PFWO 4HADA 3OQ6A 4IQ8A 5L40A 1KETA 1R0KA 1HTBA 4CR8A 4C7KA 5JY6A 4IJUA 4TZKA 3OMLA 4FDAA 1QORA 4GX2A 1QV7A 3GVCA 5TX7A 1UXGA 4OQYA 1SOWA 4ZQGA 2C82A 1H2BA 3FBTA 1E0DA 4BNUA 3DBRA 2I65A 3JQFA 1MP0A 2RH4A 4RVGA 1EMDA 4XRGA 5G4KA 2PKQP 1U2DA 4E13A 1XU9A 2YJZA 3PWKA 1ONPA 3HUDA 3D5TA 4BKPA 2J6IA 2VYND 2EXXA 2VWPA 1OFGA 2P91A 4U6QA 4XJTA 3PHJA 1XLTA 4GSKA 3VPSA 3DWFA 4XDYA 4BGVA 3F9IA 2O3RA 4FD3A 4B4VA 3RVDA 1GADO 4AJHA 1I33A 2ZYDA 4UEKA 1P1FA 2JCYA 3GUCA 4I5DA 3KB6A 3KUXA 1P77A 2CNBA 4W9NC 3ST7A 4BNZA 1PZFA 1PGQA 3ZWBA 1LI4A 2QG4A 1DHRA 1ZSYA 3I6IA 1EBUA 2B35A 1TB4A 5B12A 5KCZA 2Z1MA 2AQHA 3S8MA 5EJ2A 3PVZA 2HRZA 4QQRA 4BB6A 4AVYA 3WGGA 2RBEA 3T4EA 4DUPA 3D5QA 3ZNOA 3DTTA 2PKQO 5AVOA 3EVTA 1CERA 3ENNA 1VC2A 2GN4A 3OJFA 5THKA 4YT8A 1TEHA 1W8DA 2OO5A 3VPFA 2Y1CA 2ZB7A 4EEZA 2VWHA 3NT4A 4HNGA 4Q3BA 1GYRA 3GVHA 1Y81A 1X7DA 3Q2KA 3GRPA 5KJ6A 4Z3DA 3BHJA 5JLAA 1T2FA 1HDYA 2AE2A 2FZEA 1GL3A 4FR5A 4L76A 2HK9A 2OFPA 3SLGA 5JYEA 4GMGA 1YKFA 1E1LA 5KKCA 1JVBA 2VOJA 2HSDA 3A14A 5JMPA 5L3ZA 3TL2A 4BKQA 4U7WA 1EDOA 4ID9A 3RASA 2EWMA 4YRDA 4CUKA 1FDSA 3HJAA 4IINA 4R1TA 5AYVA 4H16A 2HK7A 5I7SA 1PL6A 3SEFA 3DZGA 5FEUA 4CM7A 3IP3A 3WTBA 5MDHA 2I66A 3AK4A 3GVIA 4GL4A 4D3SA 3OICA 5MGBA 4DIBA 2ET6A 3DBRB 1D1TA 2VYVA 4PCVA 1A7AA 5G4KB 3D4NA 1LBEA 4KOAA 3GAZA 3N74A 3ASUA 4D43A 3IMFA 5L95A 1PJCA 3QVSA 1D3AA 2JHFA 4EJ6A 1I0ZA 2X9NA 2Q2WA 3MJCA 3JQ6A 4BQPA 2QX7A 2Q2VA 1K6XA 2YW9A 3ZV4A 3NDJA 4CV1A 2EGGA 2I5PO 3AUAA 5AXAA 4DRYA 4MJLA 1ZKMA 5I8ZA 4FB5A 1QRRA 4E32A 2ZATA 2VHWA 4OO3A 4K6CA 5KTKA 2IYOA 3WX0A 3X2FA 5ENDA 1TLTA 3W4KA 1DIHA 5C7IO 1EDZA 1H9BA 3AOEC 4R3WA 4BNFA 1B3BA 1VM6A 4QFCA 3KLPX 3STHA 3OJEA 3OFSA 3WQSB 1GZ3A 5G4LA 4UULA 3IAHA 2EHDA 3H3JA 4AJKA 5C3MA 2GZ1A 2GRAA 4YTEA 1EUZA 1LSJA 3WR5A 4EDFA 3BTUA 1AGNA 1GPDG 2EKLA 2BGMA 4ZRMA 4BNGA 1F8GA 2W4QA 1V9LA 2W90A 3OBBA 2AHRA 1ADFA 3SJUA 3AI1A 5IDWA 1BG6A 4JIGA 3F1KA 3JQBC 3V2UA 1HRDA 3D3WA 1J4AA 5BNFA 4NNJA 4B3JA 1YL7A 2O23A 4UVHA 3NJ4A 3WLEA 3WJAA 4J1NA 4IDDA 1HZZA 1M6HA 1YBVA 5AXCA 1FDTA 1MG0A 3WYCA 4RPGA 4C7JA 3H5AA 1Q0QA 1LDNA 3VPHA 3JYLA 4LSWA 2ZTMA 1EZ4A 3WWZA 1DXYA 3L4BA 3MTGA 3F6YA 3ZWVA 3H3FA 2FWMX 2BKAA 1SZJG 4JBGA 1HXHA 3MWDB 3FR8A 4RLSA 2EW2A 4BNVA 2FOIA 2P5UA 4CMEC 4OMUA 1YDWA 3EMKA 4XQGA 1DSSG 1B15A 2J3HA 1GU7A 1GD1O 5KVSA 1QYCA 1GCOA 2W2KB 4MVJA 4KP7A 2HQ1A 4KUHA 4R41A 2HJRA 1VJTA 2X86A 5IXSA 3K8ZA 1W6UA 4ALJA 5F21A 1F17A 2DPGA 9LDBA 2ZYAA 1BDBA 2Y1EA 4UEJA 3IL2A 1S7CA 1KC1A 2EEZA 2BFMA 3U4IA 5T6BA 4L4RA 4XIYA 1BHSA 3RFXA 4CV3A 3PZRA 3MJTA 3JTMA 1I2BA 1DLJA 3DZHA 4CLXA 4Z9YA 2X58A 4GLOA 2Q99A 2VRCA 4K26A 3D0OA 3I5MA 4MO2A 5ILOA 4BQRA 5DT9A 1PEDA 2DPHA 1ZK4A 3K31A 4PG5A 5BQFA 2H9IA 1B26A 1IHXA 1X0VA 3BTSA 4ROSA 4CL8A 1OMOA 5IJZA 3U4HA 4OQZA 3MTJA 2PWZA 2X5OA 2VWGA 5BT9A 1ADCA 1MG5A 2JCVA 1ISFA 1Y7TA 1OZAA 2EP7A 1U28A 3UVEA 4PZDA 3WFIA 4JN6B 3INGA 5IDXA 5TIIA 1I8TA 2AEFA 3PI7A 4CM3A 2PNFA 5JCJA 4CQMA 3I4CA 1JAYA 4PG7A 1H94A 4WPGA 4DIOA 7ADHA 5L51A 4LGVA 1PZGA 2VHXA 4RQUA 5GMOA 3W4JA 3I3OA 1E7QA 2C29D 4J1TA 2RIRA 3W1VA 1UXJA 1BXKA 3DMTC 4YPOA 3D3WB 1KVQA 5F5LA 2AEJA 4YRBA 1X13A 3PWSA 4EUHA 2Z5LA 1H93A 4XJSA 3QA9A 3U62A 1M75A 1HWYA 3QLJA 5F1KA 5C5IA 1H6BA 2B4QA 2VYVD 3IQDB 3OECA 1PJ4A 3RC2A 1UP4A 4WUVA 4NR0A 4OOFA 4OJNA 1RM4A 5CDSA 3AOEA 2RHRA 5A5FA 2NVWA 3NX4A 4I9NA 4IJKA 2HMUA 2JKVA 2VZ8A 4DBZA 2J3JA 1CETA 4R5HA 4WLVA 1DRWA 4BMSA 1DFGA 3I9MA 3Q0EA 5ES3A 1B2LA 1WMBA 5B4TA 2WDZA 1NAHA 4QSMA 1VPDA 4J90A 1ZJYA 3VC7A 3H5NA 1SPXA 3ABIA 5JS6A 3JQCA
chains in the Genus database with same CATH superfamily
4HYEA 3G85A 2FZGA 3GU3A 2CUKA 3PNSA 3JQBA 3NTOA 4AZ3B 4DWWA 1YZGA 1HYGA 1K8XB 3O8OB 4MYUA 3LVQE 5A5GA 2C4UA 3WAGA 4MVJI 1H66A 1P2TA 1U81A 4XCXA 3D6JA 5D7NA 5DBOA 2G07A 2WHQA 3VVBA 4PYQA 1APBA 2Z6UA 4OK6A 3COZA 1QRUA 2G9RA 2HSGA 2I8AA 1JP7A 3X1DA 1WNTA 1OLUB 4I9GA 1Y6RA 4CMHA 1QYXA 4KVAA 2KLHA 2QUBA 4NCXA 2I6XA 3HA3A 4CKEA 1ZI6A 5DSXA 4PF1A 4H17A 3ICWA 4FMPA 5SV2A 1R2QA 1V5IA 3BB3A 4MTCA 2P6PA 4IQ4A 1KYTA 2QN9A 1DQPA 1XA4A 1JDTA 4PWZA 1EUYA 1XZPA 3E3OA 3TNLA 1ODLA 3H8WA 3CF4A 4PVDA 8MHTA 2O50A 1M8PA 1QJ4A 4L16A 2LWIA 5ECGC 1DELA 4IXDA 2BEUB 2WICA 3JQ9C 3HFSA 3G2JA 1TEVA 4PXAA 2YS6A 5T4HA 3VR4H 2FRDA 3M6IA 4F1KA 3ME5A 4UCFA 3RHTA 1NI3A 2DWOA 4JR1A 4DCMA 4IDNA 1L3BA 3Q1LA 5D84A 2ZU0C 2YVUA 4FOLA 4XGQA 1NFFA 2BF4A 4PR0A 4MUAA 1JEDA 4KNWA 4MWZA 3L6UA 3PNOA 3WL7A 2YXPX 4WESB 3VSEA 3DMGA 2ZG6A 1VE6A 2XXJA 3BZBA 3EOZA 3OIUA 4JP2A 3DDHA 3RRZA 1KFBB 5CHEA 3K0EA 1WOYA 5BQ3A 3BEOA 2VQFB 2I03A 1OJLA 3PC4A 1Y3DE 5HMMA 1XQWA 2ZKLA 3MPOA 3HS3A 3WRYA 3N2KB 1Q2XA 1M0EA 4U0JA 3QUSA 1N92A 5JSUA 2CW5A 1FU4A 4D1YA 1K97A 2QLMA 2BKEA 5ALEA 1E77A 1SU7A 4A15A 1HYBA 1OYVA 2C9ZA 3DB2A 3WE7A 3KKEA 2RK4A 4MGKR 2Q5LA 3DVLA 3OA2A 4DVJA 3TIGA 2O3TA 3G88A 4ENWA 3O75A 1HDIA 1YKSA 3DPSA 3H0EA 1OWOA 2GEVA 1K9SA 3GLUA 4E51A 3HB7A 4IHJA 2W43A 1K5HA 3QKRB 4GI7A 1NLUA 5BNZA 3W9SA 3DJFA 1NRXA 2WQ7A 1GNTA 2OPHA 1HE3A 2XE6A 2ZSJA 1OBHA 2MJLA 4WKNA 2BTQB 4R2KA 4CV2A 3AI7A 3T6KA 2BFBA 4HH4A 5HF8A 5EC8A 3A6ZA 3E48A 2P41A 2IS6A 4YAKA 1LDMA 4OBXA 3LQYA 1KS9A 2WZCA 2HBQA 3FFBA 1P91A 4Q39A 1UXKA 3TMKA 4P4GA 4DJFC 2E82A 1DV1A 3IC5A 5D00A 5IK2D 2R6JA 1OT3A 2QNIA 5DEOA 4CIYA 2QTVB 3U80A 2B4KA 3DMNA 5FOUA 1H65A 1Z5NA 5K4GA 3L2OB 1Z25A 4EB8A 1KGSA 1MZPA 5MGNA 3IT0A 4MS3B 3A1DA 1UDAA 3GLGE 3TG8A 4QYSA 1NW9B 2UYYA 3SEQA 2G28A 1W5TA 4RTNA 1Y63A 1YB5A 3A6EA 1R8QA 1D8TA 1NUPA 2NOAA 4F86A 4BV3A 3S2UA 1ISHA 1ZYUA 2ECPA 1ACMA 3OZDA 5FWYB 2AEEA 2Z95A 3FI0A 3GCWA 5DYIA 1TCCA 1ZN2A 3MWYW 4F12A 3SZRA 4V1CA 3MTQA 2CV0A 3IMEA 1XWWA 4GVLA 2D1YA 1Z4KA 2V9CA 3VYWA 3JWPA 2J31A 4ZA2A 3JD3A 4R2XA 4LFCB 1RZRA 1Q7RA 1C0PA 1CUZA 2Z5FA 2ZUSA 2VF5X 3ONDA 3TNDA 2ZAIA 4LK3A 4CG0A 2WWVD 3CEJA 1CF9A 1W8IA 2A9KA 3EDYA 4GR5A 4ND8A 4DLVA 2O2IA 4M0MA 5T67A 1CUUA 2IV2X 3EWNA 3CE9A 2Q0QA 1QFJA 4IS2A 3TQCA 2V65A 1UFKA 3MMNA 4UUNA 3BSSA 1OAAA 3C3XA 3IVRA 3EEQA 5FIUA 2TMKA 3B53X 1GUDA 3NTQA 1Y82A 3NT2A 1DKOA 3ZZ0A 2V1UA 4D4LA 1R6BX 1SXHA 1KDZA 3DQPA 3HDJA 5BWMA 4OP2A 5FTLA 1KYIA 3WJ7A 1BYUA 4R2LA 4D92A 5LUAA 3K4HA 3IMCA 1EJ0A 1VIVA 2MSDB 2WUVA 4F2GA 3VU9A 4B83A 1JG4A 2OVBA 3ZJ5A 2IYPA 5AK4A 2RHLA 5HJ7A 1KQPA 2J6HA 1VKZA 3AQIA 5DCWA 1G3QA 3CJRA 1CCWA 1DO0A 4RADA 4BUCA 1MO2A 4O4HB 3SEAA 3DDCA 4CMGA 5CXQA 4TVKA 1JG1A 4BOYA 2Q1WA 3ZLUA 2HBZA 4DN6A 5HUJA 1EX9A 2R1TA 1HE4A 2AFHB 1U7HA 1MFPA 3ZJVA 1OHHA 3ZU3A 4M1KA 4QWMA 1KO7A 3I6ZA 1A1SA 2CVZA 3LG2A 4HFMA 4OYYA 4TRJA 1MF7A 2VHJA 1PGJA 3HXLA 4TTAA 3TZKA 3AHIA 3D54D 1DBRA 2BONA 1UINA 3OCYA 1Z4NA 4F8EA 5IPFA 1K7CA 4FI3F 4BRWA 4WJLA 3AETA 4HDCA 1KSFX 1N25A 4WK6A 2BHSA 4Y2XA 3F67A 1W75A 2VBFA 3G8BA 1BMFA 1XHEA 1ORHA 1NZJA 3NUQA 4FR2A 1KO1A 2Z1NA 4GOLD 3FFWA 2F1IA 3L82B 4PO1A 1VJ1A 1P45A 1PW7A 1YR2A 1EEXB 3N8DA 4GX0A 4JB8A 1FDUA 5AI4A 2AC4A 2OP1A 1UC8A 3FAKA 4JFAA 4UNSA 2GSWA 3GYBA 1RQPA 3NGMA 2QM8A 4NMMA 4D79A 5H9WA 3SG0A 2L19A 4LMPA 2ISQA 2XOKD 3M1IA 2C7GA 4DMKA 1FXSA 5B53A 3DBIA 4ERNA 2OXCA 4M3NA 2OXFA 1QGUA 1XLWA 4TL6A 4BNJA 4RZUA 5EL0A 4LOAA 1VL1A 2FOLA 3PA6A 1HETA 4Z54A 4BNXA 2PVSA 2VP4A 2F55A 2ATCA 3OWHA 1N8NA 3OZXA 2FXVA 1YBFA 2ZRNA 3C7CB 5J2TA 3GCDA 1RJ9B 3QSGA 1T6XA 2M6LA 1DWPA 5I9BA 4C4OA 3AM1A 3VR5H 3AJAA 3EDRA 3LCJA 1CZLA 3ZVRA 3PKIA 1GNRA 3HMQA 3FYUC 4CIXA 3I62A 1J99A 1LDYA 2EZ9A 2XHZA 3QKSB 2ZT6A 3QX8A 2Z8YA 4Z3OA 1FYFA 2AOVA 3FPAA 2QTNA 3VDMA 4ZZIA 1VSQA 2FEPA 3EGWA 5C53B 5A0VA 4CBVA 3LPDA 4PSCA 1UJMA 3CX8A 1NLFA 4IXMA 4RTQA 5GIPE 2LGJA 4B35A 4QM7A 2MWMA 1CG6A 5DHSA 4KHZA 4O2RA 2QLFA 5E8RA 2QNBA 3B1XA 1GXSA 3T5AA 1M7HA 4UFNA 5IJ9A 4QYWA 5IU6A 1JF8A 2QYTA 4NPHA 2XYQA 4DIEA 5AW6A 4ISCA 3W5UA 5EGNA 2VZEA 4MRVA 4K1LA 3H84A 2R4TA 4JBWA 1YZUA 3P2OA 1IY0A 2B5VA 4LHEA 4KYTA 4UASA 4XXHA 4ZCTA 1RQXA 2ZVPX 2ODBA 1OYOA 4JI2B 4I55B 3TOCA 1WU8A 3OIDA 4FCTA 1IH8A 4TXLA 1R12A 4EY4A 1TMOA 1RWVA 4KI7A 4M9RA 3VU3A 3L4EA 4IS3A 3Q5EA 1IL0A 1U4NA 5IUKC 3TO5A 2PD3A 1YUNA 1CVIA 2VJAA 4R69A 4EF4A 2DQYA 1I5OA 1G8GA 1UJ6A 4LF5B 1VMAA 4NQZA 2BSQA 5F9FA 1QOZA 5GIOE 4LE2A 2YV3A 1JQAA 1ORTA 4D9EA 1QP4A 1KYYA 3LP6A 4BJHB 4RO0A 3FSEA 3HN2A 3ERCA 1X86B 2CDRA 5E1OA 3EWSA 4I08A 1IBSA 5DTMA 1X15A 3R7WB 1EGHA 2ZB3A 4DZRA 3UF0A 4F71A 4RPIA 1SC1A 3AILA 3HU1A 1XXLA 3I1JA 3KYIB 2QAGA 4JROA 3Q8LA 4M9QA 3IGFA 4X8HA 1E89A 1GRNA 4C03A 3IUQA 2PDAA 1OVMA 2JFYA 2IUYA 5U9CA 3DDSA 1V2GA 3ZDCA 2GPTA 2IXDA 2AVDA 3HM2A 2IFTA 3OEYA 4INOA 4X1YA 3O4HA 2ZYWX 4QG7A 1OXBB 1DAPA 2AQKA 2FEMA 3ACBA 3BEDA 4HZUA 3W78A 3IR6A 1UBLS 1ZNWA 3U7HB 3EF1A 2AJDA 3AUTA 2ZSDA 1R0XA 3QW4B 4ASUA 5AW8A 1TZ2A 2IITA 2OFXA 4P93A 721PA 2ZRLA 3GPIA 3ORQA 1QAQA 5FULA 3FNEA 3S1AB 2FXIA 2E9SA 4ZIRB 2D59A 5EGSA 4WRRA 2J09A 1LBTA 4ZD6A 4RCVA 3ONVA 1XQYA 4BGIA 5CFRA 1Z75A 3DT8A 5LDGA 3LTNC 5CFQA 2WUDA 5E1MA 2R6GA 2JAQA 3SHQA 3NZEA 2G71A 3OJWA 3TKAA 4JGGA 2TRSB 1Z63A 3U7JA 5KC9A 4ZTUB 3DPUA 1FLNA 2BFEB 2BI4A 3PHCA 2QBYB 3IOBA 1V4NA 4KMRA 4X93A 3PQEA 3RBXA 1OFIA 1AZLA 2I3BA 1R00A 1QMPA 4BLQA 1DIOB 2VZ9A 1A8UA 3SYMA 5IN5A 1LBSA 3A6FA 1CY4A 2GCEA 3FSGA 3H9UA 3ZWWA 1IATA 2GEFA 3C3KA 3VH1A 2IX3A 1RADA 1D6JA 4QATA 1U4OA 1KMCA 2ZSEA 4JUBA 4C21A 4GHWA 5ER6A 2Q3BA 1V39A 2Z2JA 1A8SA 2AOTA 3GH1A 4IUDS 3KJXA 4WVLA 2WW8A 5AI5A 1S3GA 3L6RA 4P2BA 5F73A 4WD3A 1M2JA 2ZQYA 4UNNA 4EYGA 2YWGA 2ZVQX 4JUCA 4XR9A 3R7AA 5KI6A 3KOOA 4MQFA 3J80A 1Z0JA 4KFCA 4JJEA 2Y92A 2ERXA 2QSUA 3PC2A 4HJXA 5CVTA 1TO1E 2JVJA 2JF0A 2B8TA 1PJQA 1DG3A 1PJ2A 1X7HA 4KQKA 1M5TA 2ZJZA 4JIMA 2BE9A 5EFZA 1JHOA 5KYKA 1KEEA 3PXCX 4S04A 1CRPA 4INAA 4M55A 1VB3A 2EJWA 3UKOA 4A8JA 2V4ZA 4E6PA 5K45A 1BDIA 4YDHB 4OKIA 4XQEA 4E5SA 2OCDA 3K53A 4H7EA 3K6JA 3OZVA 3TLZA 1OX4A 4MR9B 3S28A 3LL4A 4E7OA 2GEJA 3IT1A 3PD7A 2BVNA 1QQTA 3OCWA 1VJRA 2NXWA 3JASA 3I9LA 2OLEA 3MJFA 4G07A 3FZNA 4M1MA 1YTUA 3INTA 1MGPA 2YINC 5I9SA 1B0ZA 4KVZA 1XP5A 3V8QA 1ZR2A 2R8ZA 1YB6A 4B3DA 3LZCA 1NTRA 4CDMA 2L0XA 2DH6A 4L3WA 1EB8A 3SJZA 1RS0A 5IJAA 3NWPA 2Y99A 4YAWA 5T64A 3Q0IA 5CIWA 1BWSA 3QI2A 1CUCA 3ORHA 4MIOA 4B84A 1AGRA 5IWCA 1GVHA 1Z73A 3WYDA 2QW8A 3P0EA 2VI5A 1HZJA 1KFJB 3ILVA 3TB6A 1XTBA 4JLNA 3AI3A 1A9RA 1FBNA 2BAGA 4G0WA 3AIKA 4YLEA 1U9YA 4KQIA 4RXMA 2VHYA 3CLKA 1TNDA 4Y6PA 2EFGA 2HUNA 1WVGA 4DL9A 4Q4LA 4QBTA 3AGQA 4YVFA 3H4TA 4NEHB 3RRJA 3W7VA 3ZI7A 1M8KA 4TS9A 4D0GA 2BR4A 1XMOB 1CDDA 2JPDA 1EFUA 3QY9A 2IYVA 4LHSA 2ZJ8A 3TPFA 2JDIA 2X4LA 3TXAA 5HKBA 4OAQA 4Q9KA 1I7SB 2ORED 4N3CA 1ZOIA 2I55A 4OHOA 3RIGA 1H2EA 1ZIDA 2JKZA 1AKEA 4R9SA 4M53A 4RW0A 4RPHA 4X6UA 3ITNA 4YWJA 1IMOA 3DTVB 2QGNA 3KDAA 4LMRA 4BPBA 1WE2A 3F7NA 5BQXA 4QNMA 3EPKA 3K9LA 1QQAA 1ENYA 1VBMA 3BCUA 3TD9A 1BS9A 4QC2A 2ZJ6A 1V7QA 1Y8CA 1LLCA 1NVMB 3EEFA 4EUNA 5GGYA 4TMKA 2ECKA 3V9PA 4HLCA 1WUJS 3GUUA 1Z13A 3H19A 3F3MA 3O93A 3MJRA 3KT8A 4LNAA 3EWAA 1O94A 5HTKA 2KJQA 4KWTA 3JWJA 5FWNA 2FPKA 4F06A 3E2MA 4COOA 2XF2A 1MU0A 1P44A 1WV0A 3GX1A 1N8TA 3HCCA 4RNDB 5F2KA 5FPYA 3PPIA 1UPAA 1II9A 1ND5A 5A7HA 2WYIA 3OHSX 3VOSA 2JCBA 2LCQA 4XW2A 1JQJC 2X3FA 2DWQA 4GP6A 4PZCA 1MV5A 1B23P 2HT6A 1FDRA 3GPDG 1TUIA 1EINA 1DADA 1A4RA 2QRLA 3D3EA 3JZAA 3AKZA 2CJPA 2XRMA 2LKCA 1XZAA 2XIJA 4FFRA 3PV0A 1U3CA 4IRMA 3NIDB 4HDOB 1GGVA 3PLAE 2QNRA 3VO2A 5DVZA 2IHZA 1IN6A 1G19A 1RM5A 2FW1A 1Z7WA 2JGJA 4GXQA 2QXYA 1YQXA 3ZWAA 2FMXA 4CVNA 2WUWE 2GK3A 3GEGA 3N8KA 3S2EA 4OU4A 5ARDA 4B4UA 4BDTA 1BCRA 3E3LA 4C4ZA 4AT1A 3HNOA 2DPXA 5GJVC 2X9GA 1XXHE 4TWIA 3DAYA 3FN4A 2X1HA 3FTPA 1G8KA 4OQMA 3NBXX 1HKHA 4G0QA 4GPD1 4UEWA 5BQ5A 3RSGA 3SC3A 3WL4A 2ZRGA 3HCBA 4F46A 4BNHA 2HU5A 5BR1A 5DYTA 1U80A 4XIJA 1ULAA 4H9GA 2BGKA 2IWHA 4NIMA 5BYBA 1ZDMA 3ANNA 3G79A 4MVWA 1GKKA 3F74A 3T7TA 5KVVA 1XTVA 1YL6A 2MR6A 1YI8A 2E18A 3ZPXA 3UMBA 1Q7GA 3SU8A 1JU3A 4PFSA 2HA3A 1G8HA 5KYUA 3I9NA 3URMA 4GE0A 4ERXA 2O2XA 2BH2A 3ETEA 4G5HA 4AZSA 3IEUA 3HU5A 3MCUA 5LP6C 1V45E 1O6ZA 4R2JA 1DC7A 1U0HC 2IDKA 3IAFA 2R86A 1ISMA 3QPVA 1U3VA 1XELA 4NENB 4Q4HB 3FTFA 2UYGA 1NSFA 2VUSA 2W6IA 2UAGA 2ZYRA 4EOGA 1XEXB 4NBWA 4WOCA 1P1KA 3LTEA 3CLHA 1KDPA 1E1KA 3MJEA 3OQIB 4PPNA 4Q1DA 3S2GA 2CKMA 1R4MB 4KPUA 4GEKA 3P7MA 3TCNA 5C52B 5EIXA 2X0FA 5E9JA 3R3XA 3G23A 3I01M 4CG2A 1WDWB 3EG9A 1VB5A 1OUMA 3SOZA 2CXUA 3PGLA 1T5HX 4DLUA 2OHJA 3A9UA 3HA2A 2W2OA 3JQDA 4KWIA 1OB5A 2PVPA 3A10A 3AJ9A 2IU6A 1QE3A 2VHQA 4CTNA 1DDOA 1JHPA 1FW6A 1U9ZA 1YE5A 2YOGA 3GZNB 3W5HA 4D8WA 4ZTZB 2QQEA 4HDAA 1E6UA 1BKDR 1EA7A 4NU6A 1SMKA 4CKBA 1I2CA 2FK7A 2PH3A 5HP4A 2D2VA 1MDFA 4DR4B 1RMYA 4M4SA 3CMCO 3E1GA 5EINA 1WSDA 1OLUA 1AS3A 4RTKA 1YIAA 1QIKA 2B1QA 2HLHA 2M6SA 2PEYA 4H3KB 3TXYA 4I7EA 4AJOA 5BSHA 2NZVG 4FX5A 2WYOA 1ZVMA 2FPRA 5FAXA 3AG6A 1RLJA 1FU7A 2F1RA 1W5EA 3P32A 2YBEA 4YP0A 4CR7A 3C41J 5B7GA 4HN4B 3HYTA 2L42A 2SNIE 1QGZA 5DHAA 2ZIEA 4HLDA 3P0JA 2PV7A 4FHZA 4U2FA 4F4DA 1F0NA 4WLNA 3FUVA 3SM9A 4LJRA 3DTNA 1CEXA 3F7MA 4GKAA 2WU8A 3KZMA 2ZWOA 2GLXA 6CHYA 1XRPA 4N54A 5H70A 4ZV4A 3GLGB 1GY8A 3ZDAA 3DEAA 3GB9A 5D3MB 4E1AA 1TVMA 2B25A 1PSDA 2W98A 2XMQA 3HEAA 4AU1A 2PGAA 3RBVA 2REOA 1YGYA 4EL5A 1T0HB 3X1YA 3HJBA 3RARA 4QPZA 4ABTA 4YJFB 4DMCA 1JEJA 3JQAD 2D6FA 5TJHA 4NNPA 4WIAA 1CIPA 2W6NA 4FBLA 4FGSA 4ZO4A 2ZXUA 4XIGS 3O95A 1KI6A 2C8KA 4DA4A 2E4UA 3PDUA 3Q8MA 2XUZA 3JW8A 2M98A 3IDSA 5BW4A 1GV1A 4HKTA 3N2KA 1Q7BA 3BFPA 1ZOOA 2HCRA 1S3IA 2J3DA 1G3MA 5DGXA 4K87A 4MV8A 3UPTA 3PC8C 4I1UA 1O5TA 2ZVJA 1TU4A 4IMPA 5I48A 4N3NA 1H4VB 2ICAA 3GLFE 1N34B 3FJ1A 1ZHOA 3TSWA 3HJCA 3IP1A 3GJRA 4MQ4A 1OILA 3IUEA 4HMQA 4Q9AA 3NGXA 1XNHA 3E82A 4HAWA 3ZLTA 3UMCA 3ZQKA 1WMSA 2CZQA 1VL2A 1P9RA 1VZ3A 2Y27A 3FD8A 3SY8A 2DE0X 1FX0B 4AIRA 2XUIA 4LC1A 3EEYA 3RRYA 5DRYA 1MAWA 3DO5A 3B9PA 1PCXA 4QECA 3A6LA 4L78A 1S0UA 2VUIB 4I5IA 4S3MA 5LDHA 4M88A 2IGBA 3IVMA 3SXUA 3CG0A 4S0ZA 4G1UC 4X8MA 4M0EA 3B1JA 3KTAB 5JE8A 2XITA 1DNPA 1H1LB 3QZUA 1DAOA 4LGYA 1C1DA 1YAJA 3RE1A 3TQIA 2P6RA 4XQ9A 1Y48E 1C4WA 4OV6B 4WFKA 3BMNB 5B1EA 2EYQA 4ZREA 2UZAA 2QKYA 4BLSA 3DLBA 2KS6A 2EFDB 5EMJA 2RGXA 1GKIA 1RPAA 3QKTA 4QO8A 4L9RA 3SHVA 4LOLA 3WDMA 3EGDA 2VJMB 3FHLA 2OZVA 4B3RB 1B16A 3I04M 3K73O 2QRNA 4M76B 2WP8J 5E3HA 3A9CA 4CF6A 1KVUA 1VCNA 1Q20A 3RPEA 4EJSB 2P78A 4YX9A 3S1SA 4HRYA 1O58A 2QDKA 2VPYA 4XYGA 3BUSA 3C4JA 4Y3UA 3T4UA 1X9GA 4ALLA 4NH4A 4R0MA 2RE8A 1L0BA 1EVYA 2CLIB 3JWHA 3OCUA 3QU2A 3H5LA 2NVOA 3WZ2A 5CB4A 3QLEA 4FJ1A 2BR3A 1RRCA 1Z8DA 2D3WA 4GRDA 2Q49A 1MJGM 1JB9A 2OAEA 2YIJA 3GRKA 4ILKA 1QUFA 4PZLA 4GD3Q 3P4UA 1JDSA 4MYCA 4N3GA 5DYYA 4QTYA 2ACWA 2WQ6A 1HDXA 2BFDB 3VSCA 3OY7A 5KNDA 3HK2A 3WA6A 1S2DA 5HJ2A 3ZY3A 3QEBZ 5AI8A 4CRWB 4QVGA 2QUKA 3N0TA 1XWIA 3KEFA 4KFTA 2QUJA 2ZE6A 3RKRA 1CP2A 3RTEA 2HMTA 3VYUB 1EUDB 3NV9A 1ML4A 3RANA 2NU9B 1WR8A 1TJ3A 1JHYA 4Q1EA 4BWFB 3T41A 3D8BA 1JHVA 1JDVA 1WVIA 1LGYA 1N78A 4RD6A 4XX0B 3X1XA 5FB3A 2QVBA 1M74A 1NM5C 1XD8A 3CUWA 2GVZC 4UE6A 3LPAA 3EXFB 4MYDA 4RWEA 5CD1A 2MSCB 3FMFA 4O1IA 4MVJF 1SVWA 4JVOA 4KKXB 4J94A 1RCUA 1Q1AA 4HZGA 1J9ZA 3K0CA 5AVXA 2QLTA 2LNDA 5DGDA 1NYTA 1P2BA 2PYZA 4RV9A 4B6OA 4L57A 5CDGA 1T1GA 4KTTE 1ZN9A 4ZEXA 4OXIA 3RTBA 1TT5A 1LV8A 4BMPB 1X1TA 2D5LA 3AJEA 1FTWA 3DYIA 3F98A 3TKLA 4GS5A 4CV0A 1QCZA 3M3HA 4HDKA 1FTYA 2RAFA 2CLOB 3RQIA 4G4SO 4PC3A 3S81A 4LNUB 5M5BA 3D81A 2OYSA 3I1IA 1KR5A 4UXIA 2P2DA 5JNSA 3GF4A 1T5SA 1MB9A 4AYXA 5FUBA 4TGLA 3K9FC 1TKBA 5BUZA 5AKIA 1UFQA 3H97A 2VS1A 1SUPA 3PP8A 3REQB 2DHDA 3D2LA 4RCYA 2BKUA 5LPNA 4RF5A 2A88A 2LUOA 3D02A 4U6SA 4WCDA 3N8IA 2JLZA 1EFPB 4IIVA 2FP4A 4LVUA 4S1NA 5G1OA 4C6TA 5B6PA 1DKNA 2ZSHA 4OL0A 1LRJA 1W73A 1XCBA 4JOBA 4OLJA 4LI0A 2IEDA 1XR3A 2JAOA 3EXIA 1S89A 3GLRA 3IS3A 3K6RA 4GZ3A 4V0QA 3WQRA 4BMDA 2VG8A 4ER6A 1YK0A 5J59A 3EZFA 3GARA 5F52A 4KXNA 3ELBA 1GFWA 3A28A 3O8QB 2E55A 2UZ1B 4GMHA 4Y1RA 5C46F 5HILA 4C0QC 1TGYA 1HPLA 1NA5A 2C4MA 1WMFA 1I0IA 2IUTA 4JP5A 1U2QA 1QTRA 3OLZA 1KMHB 3KL4A 2UUBB 1GL6A 3PGKA 1AQIA 4Z3KA 5L7TA 4ZWNA 1GZUA 4ZZ0A 4AECA 2XVXA 1VHWA 1X7ZA 4L8WB 2MSEB 3VC2A 1YZHA 4AP5A 2VRWA 2EHJA 1AMNA 1RXCA 4AJIA 1CY0A 3KETA 3EIFA 5B7PA 1ZVVA 3K4QA 1MBZA 1PWHA 1DXHA 2ZBDA 3CY6A 5BYAA 1F7VA 2Q5HA 3C4QA 1PZMA 2FR8C 1E8MA 2I2CA 1D2EA 3GNLA 3QVTA 5CB0A 4H7IA 1R0CA 2PSJA 1M0TA 5CHYA 3B51X 3UWSA 4BZXA 1E79D 1GTJ1 3T4XA 3T5GA 3UJDA 1L5QA 1YUBA 1A82A 1EK6A 3L5OA 3U7QB 3IEVA 3VTFA 1T3GA 3EMVA 3IB3A 5LZ8A 4HFNA 2G76A 5JAZA 1C4KA 2R6FA 5FWXB 1YI1A 2PRJA 2PZMA 5DW0A 2P9CA 1FUYB 2VDOB 3AYZB 3B7PA 4HNHA 3U17A 4L72A 4QUKA 3OJCA 4R1NA 4TV8F 1UZAA 5HCIA 4M0PA 4YBZA 1MAHA 2IV3A 5EE5B 1K86A 1M8FA 2PANA 3RG8A 3N59A 5A71A 5GJBA 4JLWA 1JE1A 1CVLA 2LVBA 3K0SA 4UOZA 4LF7B 4N8EA 2Q1YA 1V1RB 3HDQA 3ZX4A 1IQUA 1TYEB 1STOA 1KJ9A 3LV8A 1Y5RA 5A2QA 5CU7A 1HRKA 1NDQA 4KXUA 5A0TA 2RC6A 3A8TA 2ZE7A 4TLDA 3L4JA 2FWNA 3ESAA 2QMOA 4QNNA 4AKEA 5ELMA 2V6IA 5LD2C 5LU9A 1OV4A 2P0YA 2BHRA 3Q3CA 4UNPA 4G1EB 2RG7A 4FHGA 2OFFA 1NBOA 1LLFA 1N3BA 3CUKA 3ONFA 3GLFA 5CEEA 5ARBA 4G1VA 4W8GA 1Z5PA 1ZHHA 2NPIA 1OZHA 2ERYA 4UTPA 1SC4A 2AX3A 5LP6F 3J81A 1ZM4A 1NMXA 2FN7A 5CDUA 4CNQA 5ESRA 5JSHA 1RRFA 1UT6A 1Z7EA 3NG1A 3OMXA 1JHDA 1RZ3A 1LW6E 2NV0A 2BSXA 2QTGA 2R8OA 1I1HA 5A4JA 3B89A 5DXJA 1WO8A 2DUNA 4OEHA 4KN5A 1PL7A 5FHQA 4C4XA 1GYPA 1GN9A 2G8NA 4BNLA 5JASA 2XWSA 1DMRA 3FDIA 2YIVX 1KZHA 5I7HA 1ZUWA 1BZYA 3GDFA 4YMIA 3ICCA 3VZQA 1N7JA 2GR9A 4LZWA 1LTQA 2J08A 2QVGA 4FOTA 4GW3A 5ESDA 3ZVNA 1YB1A 1QP7A 1H5NA 1HF3A 1GAWA 1PR9A 3KD3A 2IH2A 2AF4C 4Z1MA 3UN1A 3R5HA 4I1PA 4KWHA 3OJLA 2Y4OA 4GSYA 4DJTA 4H1VA 4TLCA 1N9ZA 4JLAA 1GQRA 3ZOKA 4W5OA 2W70A 1MB3A 2OEPA 4OXYA 2X0IA 2BCEA 3Q6NA 5CIQA 2Z8XA 4EEKA 1DWUA 4FWIB 4TMFA 5DISB 3SMVA 4BAUA 4KHPB 1VQ1A 1V8OA 1GL9B 3K7EA 1DUIA 1N2IA 3GGJA 3WWEA 3ZCVA 3AOGA 4EDHA 2W9XA 2ZDQA 1TF2A 2AOWA 3IXMA 3L1JA 5CDFE 3FYDA 4M0UA 3T99A 3D6MA 3ZWXA 4TSKA 4B82A 4CIBA 5DIFA 3ZTTA 1UBNA 1FL9A 1RMQA 4OGLA 2WMNB 2X9VA 1OLSB 4NY1A 1YJQA 2Z57A 4J2HA 4RV4A 3ROEA 3TLAA 3S29A 3GPLA 4M8NE 4PIPA 4Q12A 1RLMA 1JG6A 2JGAA 2G06A 2X1VA 1MR3F 5GM1A 3N0RA 4XRRA 5ADHA 1GQYA 3WXBA 2XWQA 2G1UA 3AM5A 1KZYC 2QW1A 3AINA 2VCEA 5AJTA 3Q7TA 2RSLA 2FFQA 2CNOA 1C7JA 3KLMX 4ND7A 1I3MA 2G36A 4L4SA 1G20A 4GAEA 2HQOA 2DQKA 4YCSA 4F9FA 2PGJA 4LXUA 1EFRD 4C20A 2WHEA 4YV2A 1CRLA 2PMKA 1GKYA 5DGCA 5JYCA 2CHFA 3K1ZA 3OJXA 1U8XX 2ZAYA 3I12A 5TPZA 2C7OA 1P5RA 1XKXA 2Q6VA 1YS1X 4JNCA 4N5LA 2XPCA 4Q6BA 1SZPA 1RQRA 2IPAB 3HY3A 2DZDA 3JWGA 1VI2A 2ASVA 4G2TA 5B55A 3BDIA 1XRJA 3PXXA 3W2EA 3RGWS 4N39A 5L9AA 2J9XB 2GZ2A 4OFBA 2H08A 2DULA 3ENKA 2HTEA 3U60B 1T5OA 4EY7A 1UADA 4O4IB 1DO2A 2ZP1A 1OWPA 1GILA 1MA3A 1XTPA 2J5QA 3HPRA 1H2AS 4GQAA 3WY9A 2EKPA 5AFSA 1XQXA 5J5VA 3WLIA 4HF7A 2CLHB 4NZMA 3FZEA 4RAQA 4G24A 3EZ9A 2H2IA 5HIMA 3W6UA 1LPOA 1Z4MA 1Z68A 4LXQA 4POOA 3H1AA 4D9KA 1PTKA 5H8WA 3LLCA 4V0SA 2EX4A 3JPWA 1CHDA 1HE1C 4YH1A 1TC2A 1U2SA 1XXHB 2QTHA 3NKVA 3SDBA 1LSUA 1PZHA 2D7CA 3QRWA 2GHQA 3O4GA 4YPFA 3GVXA 3ZHCA 5L4NA 3IP7A 4HNQA 4UHCA 1LVUA 5EJAA 1JLRA 3MWGA 1J1ZA 3H1TA 4KQGA 1ZCFA 4NP6A 5AHXA 4AULA 4PBTA 5TV2A 4JLDA 1I9GA 3WB9A 1T1RA 2XVMA 2AYXA 2OAGA 1NBHA 1ULUA 2GZ3A 3ER9A 4BWYA 1C81A 3QWIA 5DT2A 4EHJA 3JQPA 1RYHA 1X80B 3BCRA 4F4JA 5JSFA 2ABWA 3V4OA 4ECAA 5E6UA 5KOHB 1V4BA 4RF4A 5K3BA 4QRDA 3RYCB 2XTJA 4IZOA 2RGNA 4PHGA 4TWRA 1JH9A 2K6GA 2GYUA 1B7GO 3T5BA 2B37A 2CEKA 3EXHA 4NBRA 3DE3X 3ILSA 3AONB 1M2WA 3QE0A 1NVVQ 2IRWA 4NZNA 1FZQA 1ZP6A 3LZDA 3MT7A 2X15A 3GY0A 3BQ9A 3IRUA 3OF3A 2IZ5A 3KPUA 1BC5A 1L5RA 1TJYA 4PX2A 1FS5A 3RRXA 4Y1EA 4I50A 1V6AA 5IBQA 4YN3A 3EYAA 3UMGA 3QBDA 1JFSA 4D82A 4UC0A 2BFCA 3SKYA 3BJIC 5KNCA 2W6OA 5HCUA 4NMWA 4MQ5A 3RNOA 2O3SA 3PTZA 3WLMA 5AVVA 4EG0A 221PA 1CW2B 3NTXA 1KORA 3QQ5A 3R6WA 1YCDA 1SU8A 3EDCA 4J3JA 4M1ZA 4Q7LA 1PFQA 5I5EA 2QX9A 5IC5A 3C5HA 4N76A 1E2IA 3QEOA 4JA2A 1NUAA 3VU0A 4XWYA 2VBIA 3GLHE 4XQ0A 1JEQA 2ZDHA 5EUCA 3PYMA 4KSCA 1JSXA 1FNDA 2YHIB 3VVLA 3CPJB 4YP7A 4K8RB 3UAVA 4NE7A 3I5YA 4Q03A 4B6FA 3T3PB 5JS7A 1DPFA 2FZVA 4M8IA 4WKOA 1HV8A 4ZGWA 2O8EA 3QOFA 1VOTA 3BHNA 3DB1A 3PZBA 3E9MA 5BWNA 3BDVA 4CEHA 1C9JA 4M1EA 1XQ6A 4XLTA 3RHZA 4BCBA 3TVYA 1WHSA 2A7QA 3KSZO 5JO0A 1KTIA 2J5BA 3FGPA 4LI3X 2V8OA 4OXKA 4L2IB 4PZAA 2PZBA 4A4DA 3ZKWB 1HEYA 3MEQA 3TZ6A 2QA5A 2OCKA 3B3GA 1P3DA 5B7QA 1Z4IA 1LF0A 2DM6A 3DCYA 2FG6C 3FB4A 3II6X 3UYKA 4NV3A 1A9OA 3TIVA 3HSSA 1E1YA 4Z0PA 2HV8A 3M6MD 2NYVA 4NCNA 3L1UA 1UMCB 2KPOA 1N8KA 3FOEC 1UPCA 1TRHA 4I81A 3R44A 3D31A 1E2HA 2BSAA 2H1VA 2QQFA 5FJJA 1FYEA 5KO2A 3S68A 3UJ8A 2XVAA 1WB6A 2XDYA 1YB2A 2ZRIA 3DWIA 4PHTA 4X61A 5GVRA 1WBBA 3ECAA 1II8B 2JFBA 1FC0A 3MWJA 3S0JA 4Q1FA 4A2QA 4UPEA 1Y7LA 1N9KA 2YFYA 4BFYA 4LFAB 1TKCA 2XCIA 3D0QA 4XAQA 5KTPA 3TRKA 3HFJA 1GM5A 1ISGA 1JIQA 1R4MA 1Y9EA 2NX2A 3H2YA 4N7RA 4R81A 1MNQA 5CGZA 4WCFB 2BTEA 1P7VA 4NG4A 3V8RA 3KVVA 5IEBA 1VGVA 3OTQA 1PNRA 3MS2A 1TXGA 2REQB 3M3DA 4IEEA 4OLHA 5KQPA 2A30A 4OUDB 5SICE 2NZJA 3N0WA 3A1FA 1PHPA 4Z9BA 4ZI3A 1S02A 2Y1FA 1DB3A 3QKWA 1MB4A 5EUMA 4D3FA 1PT6A 1BVUA 1V7PC 2OBYA 5SYAA 2I3AA 3KYCA 2ZWPA 4J43A 3H2IA 2WWRA 1ODJA 4K0RA 1JS1X 5TS3A 5C37A 2OUIA 2DHCA 2GAFA 5D1HA 1DC8A 3QUTA 3W3AH 1NBEA 4CM4B 5KQGA 1MAAA 2Z2ZA 2E89A 1KK2A 3P8ZA 1GPUA 2FQYA 3KQKA 4EB3A 1DC5A 5BWBA 1Y6ZA 3DAPA 1ONNA 1KO4A 3NHPA 4G3XA 4MTLA 1FB5A 3MELA 2RD2A 1LNQA 1E5QA 2GNAA 1SOVA 2XYVA 3D7SA 3O1HB 1EAMA 3VO8A 4RFSB 4FLMA 4C7OA 3HBMA 5LSAA 3IURA 2YRWA 2IUEA 3I4FA 3ZHQA 5HGXA 2IODA 5I9LA 4XGKA 1GLGA 1TFUA 1GFIA 4LK2A 5GZ1A 1AF4A 4W1RA 1IM2A 3IKMB 3DDWA 1D1SA 2C4KA 2XF8A 1F8YA 3IDAA 4D02A 4LF4B 5UKDA 2W6MA 1IZ7A 1R37A 4U2DA 3Q72A 3QNWA 4MMZB 1RPJA 4UREA 4UTOA 5K1ZA 5JJKA 1V5WA 1Q1EA 1TYZA 4YS6A 4K2AA 3GZTB 3BORA 3TFOA 2I6FA 3ROPA 2JFGA 3CW9A 4IFBA 1OOEA 3RIMA 4EG6A 1M1YA 2CVFA 2JIMA 3P2MA 1SRQA 3FUUA 2P9TA 2JIOA 1H9CA 5IKOA 5JZBA 1R8SA 2NV6A 1JU9A 4JXXA 5F35A 3I2HA 2XX3A 1SD5A 5A05A 1Z5GA 4QT4A 3NT5A 1ZGCA 1PN3A 2W4IA 3ESQA 4G1BA 1G21E 5ALZA 2WY2D 3SNHA 4OHXA 3NU1A 1AQUA 1JHXA 1QQ6A 1CB7A 3GDHA 3IQFA 3MMXA 5K0CA 1XZ8A 1E2FA 1R16A 5DCLA 5CR9A 4DR3B 3PC7A 1ILEA 3M4NA 1R4ZA 5ECYA 5HM6A 2GD1O 4JBIA 4DNXA 1YWGO 2AQIA 2AG6A 2AE1A 4W1PA 3PUWA 3VR3A 1I1OA 3H1BA 3ETDA 2ZS8A 3FDJA 3LQQA 1NQ5A 4QUIA 1COZA 2OHHA 1P6XA 4O63O 2CJFA 2ZS9A 4NZ9A 2PM8A 3FMGA 3LO8A 3SQDA 4G0YA 3OQMA 3FVTA 3K5PA 2WM3A 1GN8A 3C97A 2ZROA 3QMPA 4IWNA 4TMWA 2YHBA 1P2SA 3UA4A 2QG9A 4LYYA 1FS4A 1LEHA 4W9NA 1POXA 3PQCA 4Z1OA 1CJBA 1PLJA 2J85A 3ESBA 1ZMTA 1C1XA 3E2PA 3QIAA 5AKEA 3ZU4A 3ETGA 1JUDA 4UEQA 4ZAVA 3QW2A 2YZ7A 4G8CA 1EXDA 4LIPD 2WAOA 4BHTA 3TMAA 3V1UA 4A0QA 1LPSA 3RHSA 4RGQA 2CNDA 4JOSA 2RARA 1PG2A 3GEMA 4JMPA 3TZHA 5ADUS 3L7OA 1WG8A 1QDUA 2Q1TA 3DMPA 6PFKA 1V1MA 2V5UA 4M7RA 1XTTA 4PC6A 1TUGA 4G86A 1MW9X 4MVCA 4QUGA 3F4KA 4TTSA 2E49A 3UWKA 5IZCA 3FVQA 3F3SA 1KBQA 1ZVJA 4YMGA 4H6VA 4KXFB 1A04A 1KDYA 3Q8XB 4KTVE 2QRMA 1JR4A 6Q21A 5TPWA 1AXGA 2GARA 4D4JA 4YBRA 5JVDF 4QYTA 1SWVA 2HF9A 4OOEA 4V3BA 4TKZA 4IOLA 1NXQA 3M7IA 4R6WA 3RIEA 4K2HA 3RW9A 2DPLA 3WYEA 4E08A 2ZE8A 3UGJA 2BFDA 1GNPA 2WG2A 2PKXA 1KEVA 4R9RA 5D7BA 1T4CA 2ZJ1A 1CK4A 1Y4SA 3KQMA 3ONEA 4HVTA 4OMFG 5G0UA 3S3TA 2MMCA 4L5YA 1ZEJA 1EH5A 3DCNA 1V11A 1MW8X 5E2AA 1BMTA 1CUAA 1SB9A 1IPFA 1VTKA 3BXXA 3QUAA 4G67A 1VCOA 2CNLA 4K5QA 3V4SA 3AGPA 1SC3A