4IS3A

Crystal structure of a 3alpha-hydroxysteroid dehydrogenase (baia2) associated with secondary bile acid synthesis from clostridium scindens vpi12708 in complex with a putative nad(+)-oh- adduct at 2.0 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
249
Chain Sequence
MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a 3alpha-hydroxysteroid dehydrogenase (BaiA2) associated with secondary bile acid synthesis from Clostridium scindens VPI12708 in complex with a putative NAD(+)-OH- adduct at 2.0 A resolution
rcsb
source organism Clostridium scindens
molecule tags Oxidoreductase
molecule keywords Bile acid 3-alpha hydroxysteroid dehydrogenase
total genus 82
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.395: 3-alpha-hydroxybile acid CoA 3-dehydrogenase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4is3A00
1B8UA 3OQ1A 2NVUB 4WEQA 2BH9A 2O50A 1DJQA 1DBVO 1MB4A 2YDYA 5GZ6A 2AEMA 2EG9A 3TOXA 3TZHA 5TIIA 5DNAA 5A9RA 1EQ2A 1PGQA 2YUTA 2VWQA 4MPDA 4DLAA 2D59A 2NVWA 1JKIA 2EP5A 1PU2A 4UVEA 4GMGA 3HE3A 3TWOA 3ZWCA 4TVBA 3DHYA 3K5PA 3VH1A 5L4NA 1V3UA 5THKA 3GVCA 3VKUA 4CV1A 3UOGA 4BNXA 1SBYA 5U1PA 4OSPA 1ISIA 3WDSA 5L9AA 4KZPA 5I8WA 5JC1A 1I36A 2YFHA 4R01A 4NU5A 5DT9A 2HK7A 1MV8A 4IM7A 1LSJA 2Q50A 2BGMA 3ZNNA 9LDBA 2W98A 2EXXA 3PHLA 4RVUA 4TQGA 1ENOA 3W6ZA 3PLRA 3ZNPA 1R0SA 3GT0A 4BGIA 2WD8A 4FW8A 4JBGA 4WKGA 3CE6A 4R16A 3TZKA 1SC6A 1C1XA 1HSOA 3DZJA 2OGUA 4L8VA 4LSMA 1VRWA 4MVJA 5FEUA 4IZHA 1NFFA 2RAFA 4BKOA 2NVBA 3HFGA 5CAEA 2Y1DA 3QWIA 4PN3A 5L53A 2A92A 3TNLA 5TJ9A 1U2GA 4GX2A 1E77A 4QT0A 3DAPA 2X9GA 1TVEA 4L9RA 4E2YA 2A4KA 2GPTA 1GZ3A 3WIDA 5IG2A 5HWSA 1KYQA 4LCJA 1HL3A 2P4QA 2QRKA 3IJRA 4J1SA 4XQEA 1WMAA 3HADA 4Y6RA 3O9ZA 1JA9A 1B8VA 3U5TA 1JVSA 1E7SA 3CTMA 3JQCA 3OJ0A 3DHNA 4M86A 2RIRA 4FC7A 4Q3NA 3WOHA 5EQFA 3DC2A 3D3WA 4AJJA 3K31A 4QO7A 1FF9A 1Z6ZA 3QLJA 2V6FA 4YT2A 4ZHSA 4EZBA 3CINA 3DDNA 2WE7A 1Q7BA 3OEYA 1BW9B 3SLGA 4OM8A 3Q3CA 4W99A 3PTZA 3UCEA 4D42A 3SX2A 3FNGA 1X7GA 3GNTA 3QRWA 4OH1A 4MJLA 2E48A 2I3GA 4NBVA 3U3XA 1X1TA 2EF1A 4DPLA 3NGXA 1HF3A 5TQVA 4E5KA 4WNIA 5KJFA 2H63A 2WM3A 3MEQA 1E3EA 1GTMA 4JP3A 3V1UA 4FFMA 4JBIA 3RFTA 1ISFA 2P4HX 3JQEA 3LT4A 2R2GA 4L75A 4NHEA 4PVDA 3OH8A 4GMFA 5AXDA 3S2EA 1R37A 3FR7A 3I52A 5KTKA 4LISA 1VKOA 2FR8A 2PGJA 4IQ8A 5T57A 1SB9A 2WDZA 3H9UA 3MJCA 2O4UX 2X1HA 1KETA 3JQDA 3L77A 3NGLA 4CLDA 1NVGA 3JQAB 2W90A 2IZ1A 1YJQA 3Q6IA 3WYCA 3U4HA 4XRGA 4P38A 2ET6A 1P1JA 5IAAA 4WASA 2IDZA 3S8MA 2HRZA 2BFPA 1PJCA 1DOHA 1S6YA 1L7DA 3LVFO 4ALLA 3ROMA 3QP9A 1GY8A 4GLLA 1YDEA 2PLAA 4IDCA 1XWFA 3VPHA 5A9TA 4BHTA 3VTFA 1WPQA 4PIVA 1B16A 3I6QA 4YWJA 5C37A 1A72A 4DBZA 2GSDA 1RJWA 3DTYA 3OETA 3P2OA 1GYRA 2B4RO 2PGLA 3FCOA 4ZQBA 4J2OA 1NPDA 4TRNA 3M6IA 2FRDA 3VC7A 1Y7TA 3GZNB 5DOZA 1HE4A 1C0LA 2PY6A 2YV2A 1AN9A 3LF2A 4YJHA 1QORA 5CEEA 4AJPA 4E32A 5L4LA 1UDBA 1B14A 3ZWVA 1B8PA 5ER6A 4FQ8A 4K9DA 3RUIA 3K8ZA 1PJTA 3PIIA 4J91A 5I8ZA 4E13A 4A26A 1H5QA 1PWXA 1NXQA 1ORRA 1YWGO 3RC9A 3R3SA 3V2HA 1U28A 3GLQA 5DP2A 1D4FA 4BQRA 5IDXA 4BNLA 3W8FA 4B4VA 3ZHYA 1ZK0A 1R4MA 2B83A 3VPFA 2X23A 3DQPA 4BO3A 3KXDA 4IJWA 1Q0HA 5I7EA 2J5QA 1IB6A 2X0JA 4BGUA 2G76A 5JPIA 4ALMA 4EJ6A 3I3OA 3FN4A 4B4UA 2GASA 4R3NA 5JS6A 3ZWPA 3PWZA 4CQLA 1WW8A 3E03A 2ZQYA 3MZ0A 2TMGA 4LRTB 4XYEA 2XOXA 1KOLA 4OGWA 1E3WB 4M55A 2E6UX 3ZV6A 3GN2A 3GY0A 3JYPA 1C0IA 4AJHA 1I2BA 3D64A 4EYEA 2NQTA 4ZQHA 2PZLA 4IY1A 3KHUA 1PZFA 4E0BA 4R5HA 3KLPX 3GEGA 4BNYA 1MXFA 4R4JA 4B8ZA 2CNBA 5HTOA 4BS9A 4PGFA 3GR6A 1HTBA 3EYWA 3FF4A 4HV4A 1NHWA 4JJIA 4DMLA 3JQFA 1YDWA 3L6DA 4XZ3A 1C1DA 3EK2A 3ZV3A 3CMCO 4R1NA 3WTCA 1J49A 1GDHA 4RZHA 3G0OA 4KOAA 1NBOA 2VYNA 4PRLA 2ZB4A 4ZJUA 4BOYA 2C07A 4OOFA 4PLHA 4CPDA 4DQXA 1PJSA 1LRKA 4NBUA 4O1MA 4WCDA 2FPIA 3OJEA 3FBGA 3GVHA 1EE9A 4GSKA 1QLJA 3GVXA 1BXKA 2D2IA 3JQ8B 4L4XA 4HFJA 1N9GB 4D43A 4BNJA 1ZO8A 1LTHR 1E6WA 1ML3A 3RWBA 3LQFA 3NT5A 3DBHA 3QWFA 3WICA 4A2CA 2YHUA 2EHDA 3NV9A 4N18A 1HDOA 3SVTA 1NASA 3E5MA 1HDGO 2FOIA 3EY4A 1NWHA 1DFIA 3T4EA 3WTBA 1DLJA 1DSSG 3DO5A 4B3IA 5CFZA 2Y0CA 3DXFA 4S1VA 4FS3A 2YV1A 5JY6A 4HKTA 1EMDA 1MXHA 3AOGA 5KOIA 1I0ZA 3AU8A 4XA8A 4BNZA 3INGA 2FPGA 3ULKA 2DAPA 1E5QA 1AHHA 1ONOA 3RI3A 3AWDA 1YB4A 4OJNA 4DPKA 1NFRA 5DULA 4EGFA 2AQHA 2WD7A 1YL6A 4GBJA 1D1TA 3WGOA 3OSUA 3VH3A 3KOUA 4Y6SA 3BMOB 5DBGA 3OMLA 3ZN2A 5TNXA 4WPGA 5ILOA 1BRMA 3RU7A 1KVTA 3BMNB 3MTGA 1DRUA 5B1YA 3C7DB 5U9CA 4PG8A 2AA3A 2FSVA 3NT2A 5I7FA 4MINA 3ZI0A 1ZJYA 3CMMA 3O26A 4CL8A 4E6PA 3TRIA 3ZHXA 2CUKA 3HWRA 1HXHA 4NG5A 4DIOA 2X0RA 1MX3A 4I08A 4OOEA 2NM0A 1IL0A 1LRJA 3VH2A 2Z1NA 2J3HA 3H6KA 4XR9A 3TZCA 5C7IO 4WOJA 1DB3A 4GI2A 2I9PA 2IXBA 3K92A 3O38A 4YAGA 3DOOA 5DP1A 1E1LA 2JHFA 3E9MA 2VTEA 3PZRA 4BV8A 1HDZA 1VL6A 1ZEJA 5K6AA 1QYXA 3JD1A 4PRKA 1T1RA 2OP0A 1Q7GA 1YQXA 4D3FA 1XYGA 5BSGA 3V1YA 1PGOA 1PGJA 3QIVA 2UVDA 3S55A 4MP6A 2G17A 4HUJA 3H9JA 4UUMA 3E5RA 1NFQA 5IDWA 4Z9XA 2HMUA 5TJHA 4XGIA 2RCYA 2O3QA 3ZV5A 1QYVA 4UULA 3GUCA 2P9CA 4YJGA 1CRWG 4E30A 1F0YA 1G0OA 2DTEA 2VWHA 3D3EA 2Y66A 3DBLA 4CQMB 3IUSA 4YT5A 2UDPA 2Y68A 3PYLA 3RUFA 3CH6A 4U6SA 2F1KA 4AL4A 4DRYA 4INAA 4BKQA 3BIOA 2IYPA 3WXBA 1LSOA 2DFDA 3RJ5A 1ZK2A 2AQ8A 4PZEA 1X14A 1VSUA 4J6FA 2C5EA 2EEZA 1GCUA 3H3JA 4YJFB 2XF8A 1U7HA 4BO0A 1ADCA 1R0LA 2EGHA 3WIEA 4L74A 3TDKA 5L51A 4IGFA 2C2YA 5H83A 2J8ZA 4HP8A 5JCJD 3AI2A 1VLLA 5L45A 3ZWWA 3PLNA 4CV2A 1DXYA 1C14A 3A14A 5EL0A 1UXKA 1VE9A 5ER9A 2FZWA 5IN5A 3OP4A 2O23A 3QJ5A 3WX0A 4BL5A 5DOVA 1Q1NA 5DDIP 1O6ZA 2IRWA 3SBOA 4RO0A 1QYWA 3I9OA 3IC5A 1RKXA 1U3UA 4IDDA 3DZGA 4JN6B 4WOKA 3UN1A 2UUPA 4R1SA 1X0XA 3E9QA 1R15A 1P77A 4J7XA 4JROA 2OFPA 4M49A 1A27A 2X9NA 2ZB8A 5KJCA 4RQTA 2ZKLA 1Y1PA 3VZPA 3D4NA 1EVZA 3BHJA 1GPJA 1HSZA 3C1AA 4UUPA 2ZK7A 4CMBA 3NDIA 4Y98A 5F21A 3AU9A 4BKUA 4A27A 1P1KA 1GV0A 3TN7A 1T26A 2JD1A 2GR9A 3L07A 1B3BA 1YGYA 2VUUA 4TSKA 1Z74A 4XYGA 2RH4A 1IHYA 4YAIA 5JLAA 2V6BA 5BQFA 4E4YA 4YB8A 2I76A 3ZWXA 4K6CA 1MFPA 5I9LA 3T7CA 1IPEA 1XSEA 1E1MA 4BKPA 1M2WA 4DIFA 4Z0PA 2Q4BA 3VTZA 3PQEA 4HADA 1ENZA 3IP3A 4II2A 2GZ1A 1ADFA 3ENKA 4FFNA 1H6CA 4J4HA 1CEQA 5A06A 3ZU2A 3H2ZA 1DIAA 4KUEA 4YDRA 5DCUA 2GERA 3COSA 1U1IA 4FFOA 1GZ4A 4W4TA 4P8RA 3RFXA 4HFNA 1P33A 1PS0A 3GHHA 4GVLA 1J6UA 1K6XA 2WEKA 4TRJA 2CDBA 3MOIA 4ESOA 2JD0A 1GADO 1P1FA 4ZRMA 4CR8A 2A94A 2VTDA 1DAOA 3ZDFA 3D1LA 4RF2A 1UH5A 1EEHA 1Y9AA 4J1TA 4Q3DA 4QSMA 5IN4A 1E6EA 4YJFA 3DBHB 2V6MA 4BO7A 4PZCA 4A7PA 4JIGA 4RDHA 3ZU5A 1ISMA 1E7RA 4FCCA 4Z9FA 2EGGA 4E5PA 2GGSA 4TKMA 1DIRA 5AXCA 4EUFA 1YH3A 3KTDA 3WG9A 2CD9A 4EEZA 3UGKA 1IE3A 1ADGA 3I4CA 4LW8A 1BXZA 1E3LA 1GUYA 3WNVA 4GH5A 3PJGA 1H94A 1VJ1A 2ZTMA 2O7QA 3GMSA 2B5WA 1HDYA 3OICA 5G4KB 1J4AA 4BB5A 3AUSA 2D8AA 2J5RA 1BW9A 3DHEA 4FN4A 4BNFA 2J3JA 4A5OA 4L0QA 4AICA 3QHAA 4OXYA 4NK5A 3PGXA 2BF7A 2AE1A 4HFMA 3RBVA 3DZKA 3BTUA 3ZWYA 4IUYA 1ZEMA 4ND5A 3N74A 3DMTC 3HN7A 5DZSA 3JQBC 2Q1WA 1M6WA 4IDFA 2PZJA 3PHIA 3NDRA 4WGGA 2YY7A 3DAFA 1W4ZA 2W8ZA 4W6ZA 3HJAA 2ZYDA 5IXYA 4RVGA 4FFLA 4U0JA 2Y1EA 1LXCA 4R68A 3CUKA 1P0FA 3LT1A 5HM8A 5MGBA 4H3VA 1GUZA 4K26A 4CMEC 5A3JA 3VVCA 4BMNA 4J1QA 2OBNA 3BTSA 2B0JA 4JNKA 5IDYA 3JYNA 4OQYA 3QA9A 4JQCA 1LQTA 1YB5A 1U3VA 3F47A 1QKIA 4QO8A 1LC3A 3C24A 3KSDO 2JCYA 4E2XA 4CM9A 1AUPA 4FFPA 4BUCA 4YBZA 1DFHA 1BTOA 3CZRA 1X7HA 3DEYX 4E5NA 3ITKA 1N2SA 1SMKA 3CIFA 4PFJA 3VZQA 2PD4A 4D46A 3OECA 4G81A 3JQ9C 1R4NB 3F1KA 3OHSX 3FR8A 1T2AA 4IBOA 3BMCB 5EINA 3B20A 1PJ4A 1ZIDA 2OZPA 1CDOA 4DGSA 2FN7A 3HZZA 2HDHA 1I3KA 1JKFA 1ZSVA 3DB2A 4DWVA 2P9EA 2Y05A 5L3ZA 3H8VA 5LCXA 3ZCXA 2O3JA 1HLDA 1L1FA 1BVRA 1EDOA 3FNFA 2Z95A 1N9GA 5LC1A 5AQ1A 1MG0A 5G0UA 2PKRA 3AUTA 4QEDA 1PR9A 3JYOA 2IODA 3AY3A 2YFQA 4KWHA 4FJ0A 1JWBB 1IHXA 4J0FA 1LX6A 3NTOA 4EBFA 5L40A 3GVIA 1R66A 5CEFA 4RPJA 4CLOB 1EFKA 6LDHA 9LDTA 1OC4A 1EVJA 4R51A 4B7UA 3M1AA 1DJNA 5CDTA 1R12A 1YRLA 3G1TA 4RGBA 4P4GA 4YEDA 2ZCVA 5DF1A 5TGDA 3E48A 3RAJA 1XR3A 2QZZA 3H9EO 1A9ZA 3PQDA 2VZ0A 4YCAA 4ND1A 2PNFA 5L7YA 1JLLA 1Z7BA 2ZYAA 4KTTE 1ISJA 3NAQA 2JCXA 5KIAA 2B4QA 5HRUA 4MDHA 4KWIA 3ZU4A 4L4SA 5F1PA 3GNSA 1PJ2A 2OP1A 4BMVA 4FBGA 1V35A 4NI5A 1P1HA 3QV1A 3ON5A 5KVQA 1E7WA 1SAYA 5DCWA 2DTXA 3F9IA 4ZQFA 4OHUA 4UUOA 3WGTA 5TC4A 4CM5A 3GHYA 4L76A 2PD6A 1UAGA 4WLOA 1LI4A 4YACA 4YPOA 4TWRA 1RM4A 1QRRA 4FB5A 3R0IA 3RC2A 4BO2A 3TZ6A 1UJMA 2VCYA 4NH4A 3OIDA 2EERA 1B7GO 4IZIA 3NYWA 3MWDB 1PGPA 1SOWA 3GOHA 2WSBA 3JQ7B 3ZNQA 1GCOA 2BGKA 1ZKMA 4J16A 3RC7A 2CFCA 2DT5A 4PLVA 2CZCA 1LUAA 2WYUA 3ICCA 4I9UA 5IZCC 2BFOA 3QVSA 1VJTA 4BB6A 1QR6A 2GLXA 2Q99A 3OJLA 1A9YA 1V3VA 4BKRA 2IZZA 2O4CA 1DC6A 4OKIA 3ANMA 1PQPA 1KEVA 1BHSA 1T1SA 2W2KA 4QX6A 2O3RA 3PXXA 1U5CA 4ZA2A 3ASVA 2P5YA 1WXDA 4R9RA 4DQUA 4EUHA 1TI7A 2VNAA 2RHRA 5B4VA 1OBFO 4XDZA 2GN9A 2QRLA 3BAZA 1IY8A 4TKLA 4BNNA 1N5DA 2AMFA 2FR0A 1V8BA 2PV7A 5CPBA 4CM8B 2XXJA 1CERA 1KVUA 4U0KA 3NJ8A 2I67A 4CQLB 1A5ZA 3HDHA 2OOSA 3JD3A 4WLVA 7ADHA 4WE3A 1LQUA 4CMEA 4J1NA 1W73A 3U4DA 3FNEA 4IJUA 2QZ9A 3BHMA 1F8FA 4JK3A 5KJEA 3GPDG 2DVMA 4XGKA 5LDGA 3Q2IA 2PD3A 2ZJ0A 1HZZA 4MKRA 4W9NA 1E3IA 1DIHA 2OO5A 4DIBA 4X54A 3HQ4O 3MJVA 3ZHZA 4BNTA 5JY1A 3EVNA 1MLDA 1V9LA 2AQIA 3OFSA 1GFSA 1HDCA 3EVTA 3EDMA 3Q0EA 4C7KA 2QQ5A 2Y99A 3H7AA 1TA4A 2GRAA 3ONDA 2I99A 3GN1A 4PG5A 2HMSA 3AM3A 1VSVA 3JTMA 1LBEA 1YS4A 4E31A 2X4GA 3PHGA 4OXKA 5IFLA 5TX7A 5KJ6A 3RUHA 1YQGA 3RKUA 3FHLA 2EKQA 3OQ6A 5EESA 3BA1A 4TZKA 3VOSA 2VHWA 5A4DA 1H0KA 1ZH8A 2QG4A 3GGOA 2EWMA 4FR5A 4W7IA 3H2SA 3PDJA 1QSGA 2C7VA 4FC6A 2J5KA 5COAA 1PQWA 4IDGA 4YJDA 3WGQA 4CLXA 4GWKA 3F1LA 2J3KA 1VJ0A 2DBRA 4MKXA 2HUNA 1ZCJA 3LF1A 1MGOA 3JQ6A 3RQSA 2O2SA 3A1NA 3GAFA 1GPDG 4F6LA 2C5AA 4AG3A 1EK5A 3RASA 2AXQA 1XU7A 5A05A 4GGPA 5JAMA 2DPGA 3GA0A 4J49A 5FI5A 2B35A 1QYDA 1CF2O 1MUUA 4KDFA 5HA5A 4L73A 3DZFA 1WWKA 1O89A 4GGOA 3RJ9A 5LDHA 3Q9NA 1UXJA 2DTDA 3DBRB 5A03A 3WGIA 5JDIA 3GGGA 4E33A 1B0AA 1R16A 1OAAA 2H1SA 3DBLB 4CQMA 5ENDA 2UYYA 2VRBA 4ZQGA 5JYEA 3W1VA 4FIZA 3CZMA 3K9QO 2FPPA 1RPNA 2WD7B 4N7RA 3W6UA 1ZSNA 3R1IA 4NJMB 3PFFA 3M2PA 3U62A 4QECA 1QXSA 4TRRA 5A9SA 3AI3A 3C8MA 2O3UA 4RZIA 1UP6A 4IS2A 3KM0A 4CMHA 1EUCA 4YR9A 4AJ2A 1CYDA 3WFIA 2HLPA 3DL2A 4BNHA 3BXXA 1H93A 5KNLA 3OA2A 3ONFA 2Q49A 1E6UA 3EZLA 1UZLA 4F6CA 2P5UA 5G2OA 5T5QA 3GZ4A 4P4NA 3PRJA 1DHTA 1SB8A 4BV9A 2B5VA 1YBMA 1Y8RB 3OIFA 5K0ZA 2FP4A 3JYQA 1C1XB 2JFFA 4CMIA 3I5MA 1ZW1A 1XELA 1E3SA 3SJ7A 3U4CA 3B1JA 3KV3O 4GKBA 3TFQA 1GEEA 2WTBA 1XU9A 2PFGA 5AVOA 4YT4A 4WECA 1NM5A 3RFVA 1IUKA 2B37A 4O0LA 1K3TA 1VKNA 1GQQA 2ZCUA 1X7DA 4B3JA 2YV3A 6ADHA 1O9BA 3CXRA 3B1KA 2O7SA 1ZVMA 5IJZA 1WAMA 5COQA 1P1RA 4PZDA 3S1LA 3TJRA 4MP3A 4DTIA 1ZK4A 4I5DA 5CG2A 4RVFA 5JO9A 1QYCA 1PX0A 3W8DA 5JBIA 4JLWA 4DBVO 3GDFA 4D0RA 3DMYA 3AFNA 4ZU3A 2IZ0A 3VZRA 2B36A 4BNUA 3WNQA 3AW9A 1JAYA 1XLTA 4R1TA 1E7MA 1NTOA 2DQ4A 4LMRA 3FD8A 4KUHA 1JN0A 3QVTA 4FPXA 5IF3A 2POQX 4O63O 1NAHA 4XB1A 5L7WA 3WR5A 4R1UA 1LDGA 3JYLA 4GX0A 2YJZA 5HS6A 4I1IA 4U6QA 1DRVA 3QE3A 1P3DA 1E7QA 2C7GA 1PS9A 5I7VA 4YJGB 5JAZA 4RPLA 1TT5B 5JCXA 3ADPA 3GH3A 2DM6A 5JMWA 2VZ9A 3ONEA 3D4PA 1YL5A 1TXGA 2ZJ1A 5F1KA 4DQVA 2BFAA 1PL7A 3AM4A 1Q0LA 3LLSA 3DFZA 2BMAA 1PL8A 4ITUA 5A5EA 1P44A 1WDLA 3E9NA 3ZW9A 1TLTA 3N7UA 1EUDA 4XQ9A 4J43A 3WMXA 1D7OA 3GF4A 5BNFA 4HBGA 4WLEA 1RM3A 2BRUA 4CR6A 1E3WA 5B12A 1U2DA 1ULUA 3RUEA 4LVUA 4E5YA 1HE2A 1GUFA 4YVFA 4WEOA 1PJBA 1BMDA 3IAHA 4U5QA 3T4XA 3PJFA 1O95A 1Y81A 4FJ2A 1FJHA 1U4OA 5B4UA 2FY8A 1HRDA 2EV9A 4R3WA 1YKFA 5F3RA 1Z45A 3OJFA 1MP0A 4LGVA 4B7CA 3ZZNA 4AJEA 3LK7A 3WGHA 3ROKA 1NQOA 4QTZA 1EVIA 3HFSA 4CODB 4YRBA 3PJDA 1MA0A 2OORA 3JD2A 3F6YA 3LZ6A 1Q2XA 3DZIA 3JD0A 1PWZA 1W8DA 3IQDB 2AE2A 3VDQA 2HAEA 2IEBA 1YB1A 5JMPA 1A7KA 3QW2A 5CHEA 2CMDA 2O48X 5JXWA 2VYND 2CY0A 3JQFC 1AE1A 2Q1UA 3E6AA 4CMJA 1H9BA 4I5GA 3A28A 4J4BA 4MIEA 5TRTA 2VHZA 2I6TA 2V6GA 3PI7A 5JDCC 3HDQA 3ITDA 2CVOA 1ZSYA 3X2FA 2RBEA 4N5NA 5AXBA 2GN8A 2I5PO 3F3SA 4NPCA 2ZQZA 3UF0A 3RROA 4PVCA 2VHXA 3GNQA 3NTQA 1GEGA 4AJIA 2UV8A 4PG4A 1JWAB 3FSRA 3PYMA 1SZJG 1CQJA 3AOEA 2XXBA 5FF9A 1IZ0A 4B3HA 4NBTA 3JV7A 4RDIA 3U4IA 1QV7A 3WQSB 5JNLA 1GYPA 2YQ4A 1EFLA 3PHHA 1TT7A 4NZ9A 1WZIA 7MDHA 3E8XA 2JJYA 3UKOA 2AW5A 3ETEA 1IZ9A 2GZ2A 2P91A 2V7PA 3Q9UA 4GSLA 3VPSA 2HU2A 3WGZA 4IXTA 4I5EA 1U7TA 3FWNA 4EJ0A 4IS3A 5CG1A 3NRCA 5TF4A 1U4SA 3UCXA 3RUDA 1ADBA 3KYCB 2YDXA 2XPCA 1N8KA 2C20A 2DKNA 4BNWA 4KDEA 1IULA 3WSVA 3AY7A 1P0CA 2NTVA 4GWGA 3C1OA 4DLBA 3GDGA 2JFHA 1LJ8A 2X0IA 1T4DA 4UUNA 1K6JA 4Z6KA 2CVQA 1KEPA 3PWKA 4O59O 5C7OO 3K6JA 3I6IA 3ZNOA 4YT8A 5T67A 1GV1A 1GYQA 3UXYA 4RF5A 1YONA 3ZWMA 4NK4A 3CKYA 4GPD1 3UAGA 1G0NA 4K28A 3HN2A 1EVYA 2NV6A 1DC3A 3U49A 1DIGA 3IS3A 1R6DA 2GNAA 1LSSA 3JQ7A 3LSYA 2BHLA 4ALIA 4C7JA 5GZ1A 2EP7A 1A7AA 4J4TA 3FPLA 3KUXA 4AJLA 2PGDA 2X5OA 1NWCA 4K6FA 4R9SA 4BO4A 4BNGA 3IJPA 3P7MA 4CM4A 1NX6A 4UVGA 3WB9A 1Q7CA 3VDRA 1PZGA 1RM0A 2CDAA 2QIOA 3NTRA 1I8TA 1QLHA 4UEOA 4BGVA 1ONPA 4YAEA 3SC6A 2Y0EA 5U4QA 3D3WB 1VPDA 2HO5A 4N5MA 5IZCA 1SEVA 3INRA 3A9WA 4UREA 3G17A 2CF5A 3SLKA 3WSWA 3B70A 3Q2KA 2BELA 4OIMA 3RUCA 5C3MA 1V3TA 2OBYA 4RF3A 3LYLA 2ZTVA 5TSDA 2NLOA 1K6IA 4PCVA 3VVBA 3JCZA 5DCYA 4HNGA 3CPSA 4Z3KA 4JP2A 5G0TA 2FMUA 2AEJA 3UVEA 1OFGA 3G3EA 4IQ0A 3FBTA 1K89A 1T24A 3A4VA 4XJSA 1JW9B 3SC4A 2B4TO 4UVDA 3IDSA 3V1TC 2VHVA 3WYBA 1KEUA 3PJEA 5KKAA 4RVSA 1B26A 2BFMA 4QXMA 5IXSA 5B4TA 3BMCA 4Q9NA 4UVHA 4AVYA 4EITA 4RLSA 1VM6A 2QX7A 1Z73A 4R54A 4J2HA 1DAPA 4XR4A 1KEWA 4KUGA 4G2NA 4E2WA 1ZXLA 1X1EA 4RL6A 2VWPA 2YHIB 2ZYGA 2E37A 3WWYA 3QY9A 1NPYA 2E82A 1NQAO 1FDUA 1DPGA 5K9ZA 1PS8A 3EC7A 2XAAA 3V2UA 1H9AA 1VL8A 3U0BA 5IZ4A 2AG5A 4CV0A 1KERA 2UAGA 3GG9A 3ICPA 5ENVA 3K2BA 4NMHA 1N7GA 1ZBQA 2Q2WA 2ZIZA 2ZTUA 1AHIA 3E18A 2C59A 4BNIA 1KVSA 1YOVA 3KB6A 1O94A 2DFVA 2HMWA 4JX8A 4I5FA 4BO8A 3AOEC 3C3XA 3UW3A 4D45A 2C54A 5JE8A 4BQPA 1QMGA 4IMRA 1BVUA 4GLOA 3AY6A 1D3AA 5IDQA 4RV9A 3KZVA 5EN4A 1EQUA 2PZKA 2PA3A 5F1OA 4XYLA 4WCFA 5FWNA 4DYDA 4MVJE 1G1AA 4WNCA 5A1TA 3EW7A 4Q3BA 2ZB3A 4A03A 1LRLA 1NVTA 4G5HA 3L4SO 1ZMOA 5G0SA 2A35A 1NYTA 2P2SA 2X58A 3OIGA 4TROA 3DZHA 5EIOA 1JKJA 1I5RA 2BD0A 3GVPA 1SOVA 2WE8A 4BO5A 4DPMA 1BXGA 3PQFA 3KEOA 3I4FA 1T25A 1U3TA 3AFMA 2BKAA 5K6AC 3GZNA 5KCZA 1E0DA 3WBBA 1NP3A 4Q3AA 1XIVA 4RPKA 2J6IA 4PLWA 1ISGA 4ALKA 3RSHA 4JCOA 4E21A 4ZN6A 4RVDA 5EQDA 1F8GA 3R3JA 2NADA 3S2IA 3OA0A 2DC1A 4F45A 4IIUA 1Y6JA 2I3AA 4Q3EA 1XQ1A 4Y8VA 5FFFA 3H9GA 4LN1A 2OMEA 2AEFA 2G1UA 3K30A 3VKVA 1N92A 5G4LA 3UICA 4S3MA 3GC6A 3NX4A 2EJWA 2Q3EA 4OSOA 2Q2QA 2OL4A 3G79A 5TLSA 4GX5A 2VOJA 1VC2A 5HBRA 1S7CA 1PSDA 4ZQEA 4YAKA 4LCEA 1OMOA 4QFCA 1B2LA 4CM3A 1HYGA 2YZ7A 5F5LA 4FOSA 3RBXA 5JDIC 4ZRNA 1FK8A 4HFRA 2NUAA 1PQUA 2X8LA 5ITWA 4UEKA 2QHXA 4CLRA 3GEMA 4JJGA 3OM9A 5KVVA 1JAXA 3NDJA 4KMSA 2HKIA 2H9IA 2IE0A 4MIOA 3WLFA 1H2BA 4OQZA 2Y93A 1GR0A 1PJQA 1DDOA 1XG5A 3GAZA 4MIYA 2D5CA 2I66A 4EJMA 1MC5A 3OQBA 4PLFA 1ULSA 2JL1A 5EJ2A 2VOEA 1R4MB 1HE3A 3HNPA 4PG7A 3LT0A 1O0SA 4Z0TA 1NQTA 4CMIB 2Z5LA 2DPHA 3C1TA 8ADHA 3L4BC 1PEDA 1I3MA 4OXNA 2BI7A 5A3VA 1W0CA 4BNMA 5T64A 1E7YA 4H15A 4PLGA 3OJOA 4BMSA 4CMCA 1YJ8A 1MC4A 3FTPA 3FPCA 3K73O 4AJ4A 3BHIA 2O3TA 3TSCA 1LLDA 1E5LA 1DC4A 2EW8A 2X7HA 5GY7A 1QV6A 2A9FA 3TL3A 3QWHA 1LDMA 4ALNA 4XIYA 1DO8A 3OF2A 2O3SA 4E12A 1WVGA 4ND2A 2V65A 4XWYA 3W4JA 4IGEA 4OYRA 4DC1A 2RH8A 1MFZA 4IMPA 3IKTA 3JQ8A 4XYBA 4NJOA 1C3VA 1ZXBA 2NQ8A 2FR1A 4IDEA 3H5NA 4G65A 2PR2A 3BTOA 2EW2A 5CP8A 3CSDA 3TQHA 3QWAA 1JVBA 3FWZA 1N1GA 1GU7A 4D0SA 3HG7A 3AUAA 3H5RA 2PH5A 3I9NA 3MOGA 1E3JA 3RBZA 4YRAA 3L6EA 1UXHA 3QSGA 1OC2A 1P31A 1UDAA 1XEAA 5TT1A 1PR3A 2O2YA 3KEQA 3DBRA 2NU9A 3STHA 1V6AA 3RC1A 3WJAA 3G49A 3ZU3A 2R6JA 1KC3A 4WCFC 4M8SA 4RORA 1GZ6A 3VHRA 1I3LA 1M75A 1U5AA 3WGYA 5JC8A 2X86A 1UXGA 4XB2A 1NR7A 5H82A 2FZEA 1C0PA 2GN4A 4I9HA 5G0VA 3TL2A 4NFYA 3ANLA 4QQRA 5I9MA 1KVRA 3WFJA 3VH4A 1HDRA 1U3WA 4XYMA 2W2LD 1KS9A 2WYWA 3GRPA 4ROSA 1UDCA 1PIWA 1BWSA 1LEHA 2QW8A 4YQYA 1KY4A 5GZ3A 1LC0A 4GVXA 2GD1O 1XDWA 1RWBA 5MDHA 1YBVA 4J90A 2JD2A 2CVZA 3ST7A 5KVCA 2IXAA 4O6VA 4GQAA 3ZHBA 5JYDA 2YQ5A 2Y67A 4DL9A 4MOWA 1TEHA 1LLQA 2X6TA 1FDSA 2D0IA 3EGOA 4NR0A 3NKLA 3RU9A 4R5MA 4XEHA 4CMGA 4JXKA 2FHSA 1D8AA 2DBZA 4CM1A 4ALJA 1ARZA 2D4AA 4CR7A 4GKVA 1YO6A 1BDMA 3P5SA 4Q39A 4AJKA 1Q0QA 3QVWA 4NBWA 4XJTA 1UP7A 1XGKA 3L4BA 3LU1A 3QQPA 4Z9YA 1LDEA 2CSUA 2VN8A 1A4IA 4YYZA 3F4BA 4J3FA 1LA2A 3H4VA 4CUJA 1I32A 3JQAA 5F5NA 4CM4B 2JFGA 2QYSA 4D3DA 3IUPA 3FTNA 1N7HA 3SEFA 3RVDA 2VQ3A 3OBBA 4WUVA 3PZBA 2ILTA 8LDHA 1ZMTA 2C2XA 1BSVA 3V8BA 3WS7A 4PLYA 3IOYA 1ENPA 4QFDA 4ONEA 4IXWA 5JFOA 1H6DA 2GF2A 1UAYA 4LVCA 4CL3A 1HWYA 3GRKA 3INTA 4AJNA 3M2TA 2P9GA 3ASUA 4RQUA 1H2HA 3PPIA 1IYZA 2VRCA 4TVOA 1X0VA 2VT2A 4NFHA 4HXYA 4WLNA 3ZH2A 3WLEA 1U9JA 2DBVO 4R69A 2YW9A 4B7XA 3LC2O 5CDGA 2Q45A 1SEPA 4HWKA 3A06A 2AG8A 1JTVA 1PJLA 5FYDA 1GL3A 3IMFA 4YJHB 3ANNA 1DIBA 2HJRA 4LSWA 3PDUA 1Y5RA 2AHRA 4MVJH 3RIHA 2Z1MA 5A02A 4IIVA 1K2WA 3KLMX 3C7CB 4OMUA 1W6UA 1E92A 3LC1O 4MP8A 2Y1OA 3ZWOA 1GAEO 1LLCA 3I1JA 4D3SA 4DA9A 3GEDA 1O5IA 2ZB7A 1PZHA 4OAQA 3PFWO 4IJVA 3T7EA 4CMAA 1EBUA 1I33A 4GL4A 2BI8A 2GYYA 3D7LA 3QWBA 3DONA 4RVHA 1K0UA 3RD5A 2R00A 1X13A 1Y9EA 3DTTA 3WMWA 3IL2A 1ZK3A 1YL7A 3H65A 5HS4A 5KKCA 1CJCA 1LLUA 4I9NA 1VL0A 4FDAA 3PVZA 3O03A 2PTGA 3JQBA 2YHIA 4Q3CA 1Z82A 2FWMX 3UHAA 2DBQA 2OXIA 1LDNA 3F5SA 1LNQA 4FGWA 1DLIA 1I3NA 4FOOA 2VYVD 3S2GA 2G82A 1T2CA 5J23A 4B4WA 3ENNA 1RM5A 3AUUA 2GCGA 3BYZA 4RLHA 2W2KB 1Y8QA 2HCTA 1XCBA 3PYXA 4BIIA 4CLOA 4B4OA 3KBOA 2ZATA 4N54A 3GQVA 5GMOA 3L9XA 2G5CA 4CLEA 1CIVA 1YOVB 3ETDA 1EBFA 1CWUA 3ROPA 1HZJA 4KP7A 1G6KA 1U8FO 2Q4EA 3DWFA 3I83A 2VRCD 4BO6A 4OO3A 4DYVA 3Q11A 1KY5A 2HMTA 3K2EA 2NNLD 4YQZA 2C82A 4NU6A 3NJ4A 4L4RA 4FGSA 5T8KC 3IIEA 2VUTA 1CQIA 2DUUA 4M87A 4TRMA 2ZTLA 3RCBA 1J5PA 1PJ3A 3PHJA 4TZTA 1IPFA 4YXFA 4D7AA 3I9KA 3I9MA 4RJTA 2PKQO 1WLYA 1UUFA 2NTJA 4MO2A 4XGNA 1FDWA 4K1LA 1TT5A 2G0TA 1AXEA 1XKQA 4NFSA 4W7HA 3HDYA 1I2ZA 3JQGB 4XIJA 5JSFA 5JW6A 3WYEA 4FSHA 4DREA 2E4AA 5AXAA 4F46A 4M89A 2JHGA 3BZUA 1QP8A 2TMDA 1ZNQO 1FMCA 4DLLA 3AK4A 3EZYA 1UZNA 4Y9DA 1NVMB 1NHGA 2WYVA 2NU8A 1JDJA 1WZEA 1M76A 5JAQA 3KYDA 1PZEA 4UAGA 1T2EA 4NNJA 3MWEB 4WLUA 4GX1A 5I9NA 5I7SA 3E1KA 4H7PA 4P22A 4DUPA 1T2FA 4IINA 2HJSA 1AGNA 1SO8A 1EK6A 5BNIA 1SNYA 2D1YA 4EW6A 1Y8QB 2HK8A 1HE5A 4CV3A 1M6HA 2QRJA 5EMHA 4B79A 5DN9A 3FRJA 1UR5A 3MCVA 5G0WA 3ZWBA 2PKQP 4FFRA 3WJ7A 2B69A 1RYDA 4M54A 1BG6A 4JBHA 2HSDA 1KC1A 4CUZA 1YBAA 4MVJF 4MKZA 1FXSA 4ND3A 1WNTA 4MVJG 3PK0A 1GQ2A 5BSFA 1RYEA 3U9LA 3LDHA 4HNHA 4NDNE 4J9VA 5TT0A 1NQ5A 2Y1CA 1C1DB 1WDKA 1PL6A 4NIMA 3BMNA 3D0OA 4AJ1A 5BNTA 1H6BA 5L4SA 3LLVA 2CF6A 1KIFA 1ZZEA 5C5IA 4XD2A 5CDUA 1NNUA 4KQXA 3WQRA 2JAPA 4J0EA 3L6OO 3R6DA 5THQA 2OUIA 5FI3A 3RUAA 4CM9D 3W8EA 4QUKA 1P1IA 1YQDA 1O8CA 3TF5A 2HQ1A 3UH1A 5JO0A 4II3A 3Q1LA 1B3RA 4C4OA 5BT9A 3GFGA 4ZICA 1X15A 4WJZA 4U7WA 3HUDA 2Q1SA 2VNSA 1I01A 3PIDA 5ICMA 2HMVA 2Y0DA 4NJMA 3NEPX 2J3IA 4XDYA 4ID9A 1B15A 3C85A 3WWZA 1R0KA 5EERA 1NPTO 3K96A 1DFGA 4E2ZA 5ICSA 2H5LA 4WCFB 5EPOA 3VAZA 4F3YA 1JQBA 1BGVA 2IYOA 3B6ZA 2VYVA 5AOVA 5KVSA 4CM6A 3RKRA 1IOLA 4J7CA 4HY3A 2Q2VA 4D44A 1R4NA 5T8KA 3TZQA 5CDYA 2JCVA 1DEHA 2R00C 4FJ1A 4N5LA 4ZVVA 1Y8RA 4XRRA 1LU9A 1P9LA 2DLDA 2RHCA 4Z3DA 1D1SA 4JGBA 2QYTA 4YTEA 1UZMA 2H6EA 4O5OA 2YYYA 1ENYA 4HX5A 2BLLA 4TMFA 4U8GA 3H3FA 5CPFA 3DOJA 4NQZA 4CJXA 2BGLA 5DBIA 2UUOA 2GO1A 3FI9A 2NTNA 3D5QA 3WQQA 2HRBA 3O8QB 2W2LA 2NVUA 4PLTA 1J0XO 1M67A 1U8XX 3P19A 4W82A 4PLPA 2NSDA 3D5TA 3GUYA 3HB5X 3AM5A 1HYEA 3EAGA 3G1UA 3LT2A 3KVOA 1F06A 1F14A 5ITVA 3DR3A 3GGPA 4IPTA 3DOCA 4WLFA 1EZ4A 3MTJA 1F17A 4JJFA 3GPIA 1EUZA 4EUEA 3P2YA 4IQGA 2W4QA 3AI1A 4IDBA 2PH3A 3JD4A 2EKPA 1CETA 1YE3A 2EKLA 3VPGA 2Y1FA 4Y6PA 5H81A 4OKNA 4ND4A 2HK9A 4DVJA 2F00A 3WGGA 3W4KA 2X22A 4XKJA 3TPCA 3TOZA 5T6BA 3GFBA 3O4RA 1SPXA 5TS3A 5CEJA 5JCJA 1A71A 3N58A 5ES3A 2X5JO 3SJUA 1I30A 3F5QA 1VI2A 4Z0HO 3JQAD 3MJEA 3LC7O 2WMDA 4RF4A 3DFUA 1XHLA 2NU6A 2OHXA 4GAEA 3KO8A 2E49A 1I2CA 3SXPA 1UP4A 2X9VA 4B8WA 3S2FA 2AQKA 3HDJA 5KWEA 1V0JA 2DU8A 4MVJM 2NU7A 3KYBA 2VT3A 3D4OA 4CMKA 1BDBA 4XQGA 3WBFA 1HT0A 4J9UE 5A04A 4I8XA 3KSZO 3ZGYA 1N1EA 2GZ3A 4CM8A 4CUKA 4UVIA 4XQCA 3U09A 1NR1A 2P68A 1P45A 3C7AA 3V2GA 2D5AA 3L9WA 3DAGA 4H16A 4MVJP 5JDCA 3I23A 1HKUA 3L0DA 5ADHA 1H6AA 2D3TA 3X2EA 4KTVE 1T4BA 4J7UA 3ORFA 4YRDA 1UXIA 3ZWNA 1AXGA 1I24A 3F4LA 1ZJZA 1XQ6A 1LDYA 3FNHA 2C0CA 1ID1A 3H5AA 3JQ9A 5B37A 3ZWAA 1I10A 3UCFA 2PZMA 1GQYA 4XX0A 1PGNA 1GD1O 4PLZA 1DC5A 1EE2A 4EI2A 4UEJA 2PWZA 1LDBA 3PEFA 2JAHA 1SCUA 2GDZA 4CQMD 4URFA 4DC0A 2I65A 2FSSA 3KYCA 4ZGWA 3BTVA 4BVAA 3KRTA 2Y1GA 5C7LO 2WJPA 3KYDB 1WDMA 2JKVA 3ADOA 2C29D 4W9NC 1LSUA 3ABIA 3DZBA 3M1LA 1YVEI 4D41A 1ZUD1 4OL9A 1DHRA 3QVXA 3H9QA 3GDOA 2VUSA 1HLPA 3KSUA 4YAJA 5BSHA 1FDTA 4A10A 4BO1A 4E3ZA 3PGJA 4LK3A 2EJVA 3TFOA 1HYHA 3AJRA 3F46A 4R41A 4MVJD 3KETA 3IP1A 1M66A 3ETGA 1Y5MA 5G4KA 4CLHA 5CDSA 3DMTA 5ILGA 4BGEA 4PLCA 1Z7EA 1A4UA 4NBRA 4IJKA 2VHYA 1NAIA 2GUGA 2VWGA 4LRSB 3NUGA 3EHEA 1KVQA 3W4IA 3HSKA 3VPXA 1ZK1A 1L7EA 3O8QA 5A5FA 4MVJI 3BMQA 2NWQA 2X0NA 4P4LA 5COBA 3OEWA 4RPHA 4IDAA 3EUWA 4WK6A 4BNVA 4EEXA 1C0KA 4XCVA 1HEUA 5JAIA 3UFXA 4BNKA 3E82A 2Q46A 1OI7A 4AJOA 1F12A 1OZAA 2NACA 1P74A 3ROQA 1YXMA 2WWRA 2LDXA 3PWSA 3GG2A 3CEAA 2Q1TA 3JSAA 1ISHA 4M1QA 1PTJA 3HB4X 4ILKA 5A9SB 1XA0A 5BSEA 4KQWA 1BXGB 1HETA 4ZD6A 4A0SA 5BR7A 4BO9A 3GMDA 3I9JA 5DBFA 2EIHA 4AFNA 1K5HA 2GN6A 1MG5A 4A73A 4PG6A 4Y67A 1KBZA 1TB4A 3EMKA 4RPGA 3ZW8A 4LMPA 4E5MA 2DUWA 3IKVA 2IEDA 3VZSA 1ZFNA 2CDCA 3DBVO 1ONNA 3I9LA 1WMBA 2VZ8A 4RCVA 5AYVA 3HHPA 3MJSA 2PK3A 3ZV4A 3MJ4A 3QVOA 1T2DA 1E1NA 3JQGA 3B1FA 2SCUA 3UUWA 1DRWA 4EDFA 1JU9A 2LDBA 1WP4A 1Z75A 3BMOA 4D79A 1HDXA 4CM7A 1E1KA 4FD3A 3V5NA 1QG6A 1OOEA 3PP8A 4CLRB 3BMQB 5L7TA 5L95A 3MJTA 1EDZA 3GK3A 3NT4A 4DXHA 5KJ1A 4YA6A 2X5KO 4DMMA 1FDVA
chains in the Genus database with same CATH superfamily
5LQCA 3TLEA 1T2VA 3OQ1A 2GN1A 1TTPB 2JIDA 2CJYA 2I33A 3O9VA 4ZIRA 3RAEC 1NM5C 2BTQB 1ZNWA 3KXLA 1HT3A 3FUUA 6Q21A 3UJDA 3AERA 3Q88A 5A9RA 1EQ2A 1U8YA 2E4XA 1G8MA 2GKOA 1AUXA 2IZ7A 4MPDA 2PA0A 2NVWA 3T3GA 1JKIA 1WD7A 3UMBA 3C5HA 1OAOC 2IEZA 4V02A 4EPYA 3NB0A 2NUPB 3K5PA 3VH1A 3AV0B 2PTHA 4FGKA 2ZIXA 1CJUC 1V3UA 1KSFX 2G0NA 3W2GA 3K09C 1JSXA 2ZI5A 4HGNA 4IIEA 4YAOA 4I0WB 4CV1A 2HYIC 1U7ZA 2O8CB 4C7OB 1GZUA 3HEBA 5JALA 1POXA 2XDYA 2MSKA 5F76A 2A9RA 2JBAB 3KTOA 2WDPA 4HB4A 3Q3JB 5AVZA 2Z9BA 1NBAA 2I2FA 1JBKA 1K8QA 2PLRA 3EEIA 3KPYA 4NU5A 1MV8A 4DLUA 4OBBA 3VC3A 1RRKA 1NY5A 2Q50A 1Z6YA 3YASA 1IWBB 1H9CA 2F3TA 2VPIA 2BT4A 5A5VA 2W98A 3BXOA 3AJAA 1I94B 2JI9A 3C5EA 4YV7A 2OV2A 1HT1E 1JKJB 3WYFA 4MV8A 2IS1A 1OI2A 1X7XB 2CHUA 3GT0A 4U9HS 2QM3A 3UQZA 1GKYA 2RC5A 3ASYA 4RHYA 2DCUA 1WQ3A 4TYPA 1I6WA 2CFOA 3F6SA 4KPUA 2RAFA 4BKOA 4CF7A 2NVBA 3TQTA 1OXTA 1Y3BE 4JLUA 4X3CA 1L7QA 1MIOB 3DUFB 4KMMA 4LSZA 4PN3A 2A9KA 2QPLA 3IO5A 5L53A 1EXMA 5MHTA 1INLA 3TPFA 2VXCA 2CBZA 4I4TF 2GH1A 5ALLA 4JC0A 4L9RA 2BFDA 4E2YA 4WW0A 5JROA 5IG2A 4OBWA 3WI7A 1OHHD 1ISPA 3T7DA 1KYQA 1TAQA 2QRKA 3FSGD 4J1SA 4Q4JA 1IY2A 1WMAA 3HADA 3WB1A 4CN9A 2C8VA 3I6ZA 1RHMA 4OTZA 5I7OA 2JGDB 4D4KA 3HWSA 3JWIA 3A9UA 5TQJA 1FXWA 3JQCA 1LGYA 2BEKA 3B89A 3M9WA 1J25A 1V4NA 2BSXA 2I6FA 4Q3NA 1SG0A 5EQFA 1FIUA 3D3WA 4AJJA 4PW0A 3K31A 4QO7A 1ND6A 5L3VA 1O1YA 2UXCB 2FZGA 3GJ4A 1VBKA 4XM0A 4YT2A 2Z5VA 3GWGA 3OEEA 4C0KA 2IYRA 5F2OA 2EC5A 3OEYA 2YH2A 1TEZA 3CC8A 3CVWA 1KA9H 2Y1KA 4RVOA 2VH5R 3CLVA 3PTZA 5DYIA 1EESA 1XZJA 4BQSA 2YHBA 1X7GA 3GNTA 4F5DA 4NXNB 2X1MA 2XMPA 3C8ZA 2I3GA 4B2PA 3ACBA 3K9WA 3GUZA 3I1IA 2XMBA 1IBSA 4AO7A 2H2FA 3OG9A 3SFVA 1V45E 2ONCA 2EW1A 2V4UA 1QIFA 4ZCSA 1QGZA 1WDTA 4M53A 2F8LA 5HDBB 2J08A 3LLCA 1UBGA 4FFMA 2FXVA 3L82B 3RFTA 1QPZA 3PPVA 4CKBA 3L1HA 1G63A 4IH1A 4F8YA 1USWA 1C3XA 3EDQA 3OH8A 4MWZA 1QWOA 3ZU6A 1KGDA 4H4DA 5E4TA 2XGJA 1VA5A 3I52A 4DS3A 4EKYA 2QP4A 4LISA 1VKOA 2XYPA 1J2EA 2ZVPX 3IHWA 1DX9A 3OEHA 4CKCB 1YQWA 4M1YA 1RPAA 1SB9A 2WDZA 2VJCA 5LBUA 1KETA 3W3AD 4GNRA 5CK5A 1JKMA 3WC4A 1P3Y1 1Q95A 2C00A 1N0VC 2FMIA 3HYNA 4OATA 1NVGA 2DUMA 4NNPA 4BTLA 2OM6A 1ZC3A 4WFJA 4XRGA 3RRNA 4D57A 2WU4A 4KMOA 1G2PA 1P1JA 4GPAA 4PZAA 4GLJA 1JS1X 4EG3A 1TZMA 1S6YA 3PGLA 4K0KB 1IXYA 3MW8A 3OE5A 3RQIA 3R76A 4JT4A 3MRTA 3A3YA 5KDLA 3WMGA 2NO4A 3ZVRA 4EA9A 4IDCA 5L6LB 3CQ9A 4PHHA 2E5FA 1Y48E 3SSOA 5C1OA 4BHTA 3EWNA 1NBMD 1A2OA 4PIVA 4F9TA 4HB3A 1B16A 4AUEA 3FJ1A 1CUUA 1YQUA 1A72A 2Q9AA 3V7NA 2I2AA 2Z8ZA 3DTYA 3VI4B 2ZI9A 3P2OA 3RT1A 2B4RO 4M9SA 2EU8A 2V9PA 2YTZA 3D1VA 3R6GA 1NPDA 2YIVX 4M76B 4TRNA 5T4HA 4GL2A 4EQZA 1TEVA 2IGBA 2ZPUA 1HE4A 1C0LA 3TBHA 2O19A 5MF6A 2R8YA 2XA2A 2YV2A 3LF2A 4MB6A 4A23A 1ODTC 1QORA 3HCNA 2QZSA 3DYIA 3A58B 3GBPA 3ZXSA 3N2YA 1JLHA 3SHQA 4AJPA 3BXGA 5L4LA 4KXQA 1B14A 2ZUTA 3ZWVA 3IELA 1J0EA 5J40A 4FQ8A 2ATCA 2E4YA 2ZULA 4K9DA 5FBQB 4CIAA 5LQAA 2FUG1 1JEYA 1JLSA 3QLTA 1QVAA 2VYCA 4E13A 1RXSA 2VK8A 1YWGO 2RHOA 5HF9A 4AB1A 2ZDGA 4WOCA 3GLQA 5E6RA 5CFLA 2AI2A 4OUKX 4RZUA 3TR6A 2J9YB 4BNLA 2O5EA 1ZK0A 3O4JA 3STVA 1FUUA 2PWBA 2Q6OA 3D7SA 4IGIA 3UMSA 3IQXA 3KXDA 3KZXA 4IJWA 1Q0HA 2ZSFA 3VHXB 5G3YA 4DR6B 1DOZA 2D3WA 1QGUB 3FFWA 1L8XA 1LW7A 2HA5A 2PT5A 2X0JA 4LRYA 1VCHA 1CJVC 4ALMA 5LP6F 4ENTA 2O7NA 5AVYA 3OE7D 4RMIA 2GASA 1QTRA 1YS1X 3QSYA 2ACKA 1WHTA 4AKGA 1WW8A 4TYWA 3P0EA 5K0BA 3W79A 2ZQYA 3KU4A 4LRTB 2TMGA 5BW6B 3ZZUA 2CEKA 4OGWA 4DMUB 5KQGA 1F5SA 4M55A 4CKZA 1JQ5A 1UT5A 4FTWA 3GN2A 4JI0B 1L5OA 1ZI9A 3VNUA 1U2GC 4FMBB 3T7SA 1JMKC 1KK2A 2ZAIA 2OXTA 1CJBA 1I2BA 3PE6A 2NQTA 4PTZA 2PZLA 1CY7A 1U9ZA 3GDHA 4IY1A 3KHUA 2QRGA 3AKZA 1QC5A 2IYSA 3QNWA 1FUEA 3L8EA 4EELA 4BN5A 2QQ0A 3TCKA 1GL9B 4NYIQ 4R4JA 2KE5A 2CNBA 4KE7A 4B8ZA 4C2AA 5HTOA 2ZJZA 2QV0A 4KIUA 3EYWA 1G41A 4O4JB 3FF4A 2IYYA 1XD9A 4XM1A 4Z1OA 1NHWA 4RK4A 4ZYUA 2ZZNA 2KI5A 3JQFA 4XZ3A 4DMLA 2PGIA 2NPIA 3BK7A 3G02A 3CMCO 4H3SA 4QHTA 5C3UA 4ASUD 3WTCA 2P5TB 2JIZD 4ZI3A 3I2KA 3CSUA 1CCWA 3G0OA 4IO0A 4KWTA 4MV3A 4N40A 2Z6AA 2G71A 5EIBD 1M73E 3TS1A 4ZJUA 3HWX1 1N36B 3BWVA 3ZGLA 4OOFA 3V8RA 4ODIA 4MRMB 1VPLA 4CPDA 5F12A 1PJSA 2Z5GA 4F1KA 2MWMA 1LWOA 1YZ3A 4LYJA 4JBNA 4TYQA 5IUJC 4FD2A 4CKXA 3D6JA 4OEHA 1W5TA 1IONA 2AYZA 5HK8A 2VDQB 3PPWA 4F7DA 2QUIA 3BULA 3FI0A 1S2MA 3IDFA 4ZK6A 1N9GB 1B1CA 3VR2A 2PKXA 2V3CC 1E6WA 2C9CA 1E4EB 3GD7A 3H9BA 4LWOA 5BMVF 2PLWA 4Z4IA 2JFWA 3LPMA 1FE8A 2R5NA 3WICA 1NXVA 1YC2A 1UBUS 2BFBB 2EATA 3PNSA 4RKRA 4ZOAA 2PU5A 3VA7A 2WAAA 2X1LA 4DV5B 3D2AA 1CJKC 2FOIA 4DXAA 4MS1A 5F7OA 1I7QB 4BMCA 4H1VA 3WTBA 4HLCA 1XTIA 4EQ6A 4FDLA 4QHYA 3WK6A 4FHCA 2BH2A 5CFZA 3DDWA 1WJGA 3DMNA 3CNNA 1K7CA 3MG9A 2YV1A 2KB0A 2ZT8A 4HKTA 5CIWA 1X9IA 3AEUB 3TIVA 3AOGA 3FCAA 4KR0A 1E4VA 1IHDA 4C1NA 1VPTA 1JQAA 1I0ZA 3AU8A 3BGWA 4KX3A 3EG9A 3RTGA 1DOAA 2BEWB 1YZYA 4Q19A 4RTJA 4BVHA 4JI3B 1AHHA 3RI3A 3LTNC 1IJEA 2YWHA 1KI9A 1GPMA 1WO8A 2ZIVB 1JDBB 4EGFA 2EX0A 2QU7A 2AQHA 3T3HA 3BB1A 1E6MA 1ODSA 3DV0B 3CJQA 1PLLA 5K0FA 4F97A 3NW9A 5KWSA 3OSUA 4Y6SA 3P45A 5FB3A 3BMOB 4BU1A 4MQLA 4C0XA 3NEJA 1LS1A 1C9MA 3P2JA 1XZKA 1C4XA 3K4QA 2FQXA 1FXUA 2V7BA 4MINA 2OQVA 4YYEA 3ZI0A 1B74A 2ZZMA 3IOCA 3O26A 4JJ4A 2FSUA 4ZAWA 4E6PA 4F2HA 3I61A 1P5FA 2CUKA 3HWRA 5LM3A 5JSQA 3USCS 1NU8A 3IAM1 1N57A 5LIPA 3C48A 3P9XA 4OOEA 3PEVA 4DZTA 1IL0A 3K9HA 3HKEB 1BHO1 1OLSA 3V1LA 3WAJA 3TZCA 4FYXA 1QRAA 4TLAA 2Q3BA 2JFNA 4WOJA 5IBQA 1ULHA 2PL3A 2IXBA 2NW6A 4YAGA 4XASA 4UTVA 5F2EA 5FXMA 1CUAA 1ILWA 1NTRA 4RL4A 2BYTA 4LDRA 4EFNA 3E7DA 1J8DA 3JD1A 4O2AB 2WG2A 3PQ7A 4D3FA 3IAS1 1L5ZA 3VKWA 5KNCA 5ICFA 3V1YA 2UVDA 3S55A 4HUJA 4JA2A 3A6JA 2QE6A 4NKRA 2ZP1A 3OCZA 2C04A 1NFQA 1QQ7A 2PO5A 3E5RA 4GM1A 2OD2A 3I39X 1YZTA 3EEFA 1RBMA 3ITNA 3EQ9A 4XCQA 4YJ3F 4FWTA 4CGZA 1QYVA 5CVVA 4Z0NA 3ER9A 4D92A 1XJCA 2B8WA 3GUCA 2P9CA 1CRWG 4MWCA 4Q18A 4QOEA 4UM8B 3OO1A 3VO8A 2CNWD 2ZRKA 4E30A 2DTEA 3NAGA 2VWHA 1OYOA 2M6SA 5GVRA 4YK7A 4YT5A 4JA0A 1OR8A 2N3ZA 1IBMB 2FX3A 2W7TA 3IV9A 4NAUA 3GUUA 4AL4A 3ED5A 1V1RA 3OTIA 4INAA 5KBYA 3W2FA 5HNKA 3A0RB 3BCSA 2IYPA 4GUDA 4LNUA 4O2BF 2AS0A 2EG5A 1ZK2A 1NNLA 3PIRA 3CWQA 1VSUA 4WK0B 2C5EA 3H3JA 1GCUA 3RSGA 4O8CA 2ZRCA 4BFUA 2W6QA 4BO0A 2A5GA 2VK2A 1R0LA 3HNRA 4D74A 3THWA 4MHSA 1WUJS 1DKLA 1YS9A 4IGFA 3WL7A 5IEJA 1M1YE 3M6MD 2J8ZA 1YZVA 2QQFA 1W87A 2BC9A 1AA9A 4QNMA 3JVUA 3CJTA 3SPXA 2HHAA 3PC2A 1DQNA 2B1JA 4PX9A 5AH0A 3CKKA 3O75A 4L2IB 1T9ZA 1TM3E 4EHNA 1UOQA 3QPBA 4HNAB 4MV4A 3LUDA 1EFDN 1JZSA 3NKVA 3O3NB 2J3EA 3PLNA 4M0UA 4CV2A 1Z0DA 2CMKA 1YA8A 1T8RA 2GEFA 1UXKA 1VE9A 2IYNA 3ET5A 3E81A 4C4AA 1QQAA 2FZWA 5IN5A 3FHOA 1AKNA 3WKEA 1PQ4A 3L6RA 3WX0A 4DGQA 5L6MB 4PO1A 5IS2A 3OKAA 4BE9A 2IRWA 5T4FA 1C81A 1KAQA 1GXSB 3K09A 2FMHA 2GXQA 2WU0A 1UFVA 3DZGA 5DLQC 1UKAA 1EUDB 1DG1G 3K6KA 4MQEA 3RTEA 3UN1A 1R0BA 2XKAA 4LXQA 3NXSA 5ALVA 1X0XA 1AQNA 2HW8A 1R15A 1T9GS 2G9UA 4JROA 4M49A 5HVNA 2X9NA 5KJCA 1YQEA 4Q6WA 3GLIB 3CNLA 4BU0A 1R0YA 3D4NA 4X6LA 4CKBB 1GPJA 3ETJA 5BOVA 4CMBA 1CY4A 3TD2A 5BSWA 3GRVA 1QH8B 3NDIA 4Y98A 4ND8B 1NYLA 4BKUA 4KWEA 1SJ9A 1O0CA 1TLFA 5CYFA 4X92A 1L5WA 4YLEA 1GV0A 1MJ5A 2PZBA 2V0NA 4ZO7A 2JD1A 1H2ZA 1P72A 3L07A 5F9HA 1MCZA 1FP6A 1WKBA 2X0FA 3U26A 1XZMA 5EHXA 1BEZA 1ZGCA 3OZDA 5J4VA 3QU5A 5TMDA 2OC4A 4HOYA 4I1OA 1XHEA 2P2GA 2ZSAA 3AIKA 3AHHA 3E05A 3DEAA 3E1GA 3H5TA 4E4YA 5KYXA 1VYHA 2I76A 3HVKA 1V26A 3QOWA 4MWGA 3PC4A 3SICE 1WUHS 4BWFB 1IPEA 1XTVA 1E1MA 5I9LA 1QQBA 2BLNA 3VTZA 1A96A 3PQEA 4P0TA 1A0OA 3LXRA 3OX4A 3O8BA 2QORA 2YR0A 1ENZA 1P4GA 3BWDD 3FCXA 4ZWNA 3VO2A 4L5IA 4II2A 4QAQA 3L84A 3RF7A 2P2CA 4FFNA 1BJKA 4KO3S 4J4HA 4B3TB 2VSXA 1J9EA 3QKRB 3EXEA 3T3PB 3L5KA 3H2ZA 3ZU2A 1OI4A 4KUEA 1T3TA 4CL2A 3AVWA 3COSA 4WFQA 4FFOA 4DRZA 4B76A 3HRIA 5J43A 3RFXA 1COWA 2PN1A 1JR6A 1P33A 2W6JD 4GVLA 2QN1A 2ZTSA 2WEKA 4MQ4A 4OJMX 4AECA 2UXBB 1XLVA 1U4NA 1A8IA 1BOOA 1MNAA 1LK7A 1H1DA 1P1FA 4ZRMA 1XNRB 3TI9A 5J5AA 3KJHA 2C9BA 2FRDC 4RD4A 4RSMA 4DLYA 2ANBA 3O92A 3UMYA 2G1AA 5EXEA 3KVNA 3T94A 3MMZA 3NWOA 1SPBS 5IN4A 3GJYA 3H0EA 3S4YA 1H4SA 3B1XA 4BO7A 4WX2B 1OV6A 4H7HA 4A7PA 1SIWA 3CW9A 1WTAA 1QANA 3KQPA 3IUYA 2DMRA 1Z8DA 2EGGA 1YRBA 4WBNA 3IR5A 4ARIA 3PEYA 1MABA 1SKQA 5IAEA 4UHKA 3UT5A 4XVCA 3QVGB 3RC3A 3EAFA 1DJOA 5JNUA 1YH3A 3BSWA 1ZJ5A 3N0TA 2H1IA 3H04A 2G5GX 3WG9A 2WILA 4FDMA 2RKBA 1XV5A 4BFXA 5EKXA 3UGKA 3D2BA 4ZO4A 1CZOA 5EXTA 5JV5A 1Z6TA 3HEAA 1BXZA 4D82A 1GUYA 4HGPA 4JOQA 2Z3WA 1JH8A 3BIXA 3QTTA 3PJGA 3B1WA 4GXQA 2CXTA 3P0HA 4RACA 2RJ3A 2G5PA 1XD2A 3GMSA 2B5WA 1HDYA 2RHBA 2Z58A 1PFUA 4QJ3A 4TUYB 3OICA 5TXGA 4MGIR 2JRLA 3N53A 4F38A 3AUSA 1XCOA 1G4AE 3HYSA 4BNFA 2J3JA 4PTYA 3EN0A 4QWWA 1CY0A 1GQSA 4IWYA 3ABOB 3UT6A 3WSTA 5KI6A 5CBPA 1Z26A 3QUSA 3M6UA 1XTZA 2PSSA 4HLUA 4OXYA 4S2EA 1JQEA 3PGXA 1F9EA 4KR6A 1OBHA 5HMLA 3Q8LA 1AX9A 3DZKA 5FNVB 3TCNA 2H31A 5K0NA 4IUYA 1ZEMA 1YQQA 4ND5A 4OJKA 2QSZA 2CB0A 1FLAA 3Q8WA 2RKOA 5F7ZA 3TTTA 2Q1WA 1MQ8B 1NOJA 4AY6A 4IDFA 2HF8A 4WL0A 4KGXA 1TYZA 1S7GA 3PCXA 5JADA 3DLHA 2ZYDA 4XVHA 4MWDA 1EA7A 3NEYA 5IXYA 1Y4AE 2XYRA 3BGDA 3FDZB 1E1CA 3R0QA 4NZPA 4R68A 2XGOA 4OQ4A 3ET4A 2GYWA 3W9YA 2Q5OA 3CUKA 3NR2A 1GUZA 3IXLA 3UXMA 4BAGA 3VVCA 1L5KA 4D5GA 2LR0A 4MQ6A 2B0JA 4JNKA 1ZM3A 5EG5A 1MH9A 1QFMA 2FPXA 1YJAA 2H1RA 1Y1KE 3UJCA 4O2AA 2YFKA 3KVYA 3VYRB 5AJWA 4O2AF 2N9UA 2JCYA 4A16A 3KP1A 4KQMA 1FJXA 8GPBA 1C2TA 4FFPA 2J85A 4UHCA 4WKNA 4YAUA 2WNSA 3IXMA 2VDKB 1PWEA 3EW9A 3HUUA 3KKLA 5IC4A 3VR3A 1X7HA 3U16A 3CCFA 3HKCA 2WBLC 2P3QA 1N2SA 1SMKA 3C3PA 3CIFA 2QN2A 3OECA 4DB4A 3K9NA 3TFWA 1ZA2A 3N2GA 1EP9A 3F1KA 4KBYA 3QLVC 1ECJA 3QYJA 1WV1A 3FR8A 4S1NA 4ON9A 1JHZA 3WLTA 2XWQA 1Z5VA 3EVDA 4HDOB 4LECA 3ESRA 4BMOB 2OZPA 2IY7A 2OHOA 1CDOA 1NOKA 2NPFA 4X84A 1VL5A 4DGSA 2LGJA 2HDHA 3T7JA 3KT8A 4Y2VA 1Z18A 1U1FA 2GVNA 1JU3A 2C5BA 2QVYX 2PEYA 2P9EA 2JZNA 3JWEA 4PNZA 2CNKA 4QE3A 2QAGA 3N2EA 4QEKA 4QOGA 1EDOA 1MGPA 3Q15C 1N9GA 1W52X 5AQ1A 2LE0A 2W2QA 5DM1A 4B3BA 2JJMA 1RYYA 1P2FA 5FPTA 4QEDA 4RFLA 2IODA 3AY3A 3BDAA 2E5LB 1GVNB 2QW1A 4FJ0A 1B0PA 2NTEA 4FZ3A 1TDJA 1XRRA 2RBKA 4GR9A 4YREA 2VLIA 3PNVA 2ZRAA 3HYTA 4PYNA 2UYQA 2HJHA 1R66A 3IBGA 4JOBA 3SD7A 1L5RA 4A6PA 4C43A 2UUBB 4FONA 2QR3A 5E7MA 4ERNA 2DF8A 5KTYA 1XDSA 2IPAB 4B7UA 1X8KA 2WP0A 3OBIA 4R8SA 1FTYA 3I62A 1ICEA 1TA0A 2FGJA 3LY5A 4YEDA 1JQKA 4FBMA 5DF1A 2GWRA 3ORHA 2BCGY 1EGQA 2ZU0C 3GYGA 4AROA 5EIEA 3FMGA 2JASA 3KE8A 3H9EO 1A9ZA 3PQDA 2UVQA 3DP9A 2VZ0A 1ZIPA 1GAQA 3HM2A 4JLDA 2A0YA 3QIAA 5C1DA 5F78A 4MQUA 2PNFA 4DKJA 2H2AA 3WLIA 2ZYAA 1ZIXA 3QUBA 1ISJA 4Q9DA 1GLVA 1HQCA 4NH0A 2JCXA 5BWOA 3REGA 4JL6A 2XCSB 1LPPA 3BAFA 3MAGA 3IT2A 2M6RA 1BXRB 5DK6A 1OTYA 2WJZB 2V96A 1FQKA 2VHJA 3EBLA 3GNSA 5F1PA 4BMVA 1B23P 4FBGA 2B7CA 1UWKA 1FVXA 4QUGA 1XZPA 1P1HA 2FW9A 2REXB 5LJLA 2CLFB 4HTAA 4WN9A 1UT6A 4BVJA 2NZXA 4HNQA 2BBOA 5AHWA 1QGED 3NIGB 3K0CA 3VRHA 3WGTA 4OBXA 3D6TB 1ZNYA 4GYKA 5J9FA 4YACA 1K5PA 3HCFA 4YPOA 3BRWD 5IBRA 3BL8A 2C31A 4UBLA 3AJEA 3R0IA 3O47A 4PQGA 4JC8A 5EXPA 5AWFC 4RTQA 2CXXA 2YC4C 3OIDA 4NH4A 3ZZ0A 1L9XA 1R4AA 5JPDA 5BW8A 2EERA 4F3CA 3M6XA 1B7GO 2GEBA 2NYVA 2Z8XA 1F9AA 2OYCA 4PNEA 3MWDB 4FGJA 5LKRA 4RLFA 3GOHA 3ZNQA 1XWWA 4CTMA 4HJRA 3DOFA 2ZQ5A 3PC8A 4GEGA 1Y5LA 1NUAA 4J16A 4M0LA 1CR6A 2CFCA 3CS3A 4XW2A 5HIMA 3RC7A 4DLLA 3KJXA 3HVUA 5KSYA 3I5YA 1D2EA 3V2IA 3VTAA 2WYUA 4O1HA 1TUBA 3NHFA 4C89A 1RXIA 1QR6A 2GLXA 1XXLA 4JY7A 4LYYA 5K0JA 3OJLA 4LRWA 1ZN8A 1A9YA 1V3VA 2OHIA 2Z04A 3RRYA 4BKRA 1DC6A 3UAWA 4BLSA 3DCJA 4P7KA 3BBLA 4RNCA 4ZCTA 1KEVA 1T1SA 4AW9A 4JYCA 4QX6A 2IHBA 2V3WA 3DHWC 5K3CA 4GI7A 5E6RB 3ZGOA 4JOCA 2DJIA 2GI4A 3BJIC 2GHQA 1JRLA 1E8NA 3O8DA 4MB2A 4WA7A 4DQUA 2RHRA 2AFIE 2CD7A 1W96A 4P0PB 1F20A 2DQSA 4YRLA 4E7PA 1N5DA 2AMFA 2FR0A 4GEKA 3SKYA 4X1YA 1XLTC 3DMDA 1H05A 2ZWAA 3C6BA 5EUQB 3PTAA 3R9KA 2GEUA 2F3RA 4RQBA 2H65A 4WY5A 4IJMA 3B9RA 1QG2A 5J4LA 1V8PA 2HIGA 2QG6A 3A6KA 1FFXA 8MHTA 1P73A 3LCMA 5G53C 3WMEA 1A5ZA 2ZR7A 2NPOA 4BRUA 4WLVA 3T4UA 2G7MC 3BUSA 4XGRA 4KL8S 4UNRA 4J1NA 2GVZC 1K8YB 4ERXA 1W73A 2HB6A 4KXVA 3Q2OA 2EWVA 5FUWA 2ADFA 1QFJA 3ZWQA 5JRZA 4IJUA 3BHMA 1VIAA 1F8FA 5KJEA 4N3BA 4NONA 1U0EA 1Z36A 4D9MA 1TRKA 2DVMA 3MHPA 5LDGA 3HDGA 2IW3A 1FYFA 1TZJA 1HZZA 4CVNA 3KVRA 4TV9A 4YRCA 3F96A 1E3IA 1FNCA 1U6IA 2PH1A 5H59A 3O91A 3T54A 4DIBA 3ELWA 4BNTA 2GEKA 3WWPA 1UPUA 5TPWA 3K4PA 3FUXA 2QYOA 3KIPA 1GFSA 1D5WA 1KYVA 3E7WA 3NCHA 3NIWA 2P41A 3OIVA 4WZBA 3I45A 3KKMA 2VPPA 2Y9MB 5FBLB 3H7AA 2JLAA 2GRAA 1PUJA 1OBOA 5AI4A 2YJTD 3DT9A 3TSAA 1RXUA 2HMSA 3VO9A 2D7JA 3IQEA 1YRAA 2V55B 4DCUA 5KOJA 2R6FA 3G8DA 3PHGA 4JD5A 5U4XA 4E31A 2H08A 3PFHA 5KJ6A 2XYGA 5IKMA 1IMJA 4WFKA 2ZVDA 3FHLA 1FFYA 3OQ6A 3T9AA 5EESA 4AC9A 3BA1A 2CFRA 3HB0A 5DNVA 3VOSA 2ZAMA 2XH8A 3K0EA 4YR7A 2RSLA 2ZUVA 4H6PA 2VHWA 5A4DA 4TXMA 4LC0A 4IV0A 1F5NA 4Q82A 4EARA 4PYKA 3PNKA 2P7HA 5G41A 2ZJBA 1YQ9A 5JZ9A 2PJRA 2J7PD 1PQWA 3L02A 4IDGA 4YUXA 3CW8X 3SYKA 4GWKA 1Z4LA 3UT0A 1T2NA 2J3KA 1RBZA 3TE6A 4KFRA 1G5HA 4Y30A 5AUNB 1ZCJA 4M0MA 1TQ6A 4DWJA 4O4IB 1ZGZA 3GAFA 2FKAA 4FT4A 1RI3A 2C5AA 4AG3A 1JMYA 1JV2B 4M21A 3RASA 2ZT5A 3OCVA 5JAMA 4GGPA 3LBHA 1E5XA 2DPGA 3GA0A 4J49A 4Q1DA 5FOXA 5FI5A 9ATCA 1QYDA 2PYDA 3H0KA 1NDQA 2JFXA 3BPSA 3WLQA 4PF1A 4L73A 4Z1MD 1OA1A 3L6CA 3WLRA 3DZFA 1NY6A 1WCIA 1O89A 3IIJA 2Q4RA 1GT91 5LDHA 1RYHA 2I1LA 3BRCA 3NTVA 3NUZA 3T7RA 4E33A 4DV1B 1NULA 4G26A 5A4KA 4WN3A 2GTIA 4B2LA 3FOWA 3C39A 2VRBA 4PAOA 4FLEA 2JGIA 2RK6A 1XAHA 3FVRA 4ZV9A 1TFRA 2E5WA 4ZU6X 1E2HA 4G1UC 2A5YB 4GZ5A 4N7RA 3SIXA 3R1IA 3S68A 3PFFA 4G37A 4WXPA 5IMBA 1SVOA 2BZGA 4C29A 5JMTA 4TRRA 4CZ2A 5A9SA 2UUCB 1WEHA 2P7IA 1OLXB 2QMHA 3WGVA 1XFDA 1WKVA 4B5LA 2AB0A 3HNOA 4IS2A 2D06A 2CN1A 1Z16A 1Z56C 5H5JA 4BFWA 5I7UA 4YR9A 2W70A 3VSCA 3WFIA 2HLPA 3DL2A 3VX3A 1TM5E 4BNHA 2NU6B 4AO6A 2R751 5AKKA 2E85A 4W8OA 4ZAYA 1AOXA 1N2GA 3FZYA 2Q49A 3C3MA 4XWKA 1E6UA 2CHVA 1TD1A 1C41A 3BICA 3I9V1 4KXWA 2WHXA 3RODA 4A8JB 4FX2A 2YV4A 5T5QA 1CR1A 4OQFA 2B2NA 2PAFA 1KP9A 1E8MA 3CPHA 2WPDA 4QTTB 1M1XB 2B5VA 2RAPA 3LPAA 4OQNA 3OIFA 1EXNA 4DDUA 2C3MA 2CSXA 5K0CA 1T1JA 2FP4A 2I2BA 4GRIA 4BX9A 5LZ4A 1YR1A 2JFFA 4ARCA 1RMQA 3KJQA 1Z22A 5CVEA 4Y2QA 3RTBA 1ZW1A 1XELA 2JCSA 1D1QA 1A82A 3BN3A 1N2CB 1JE1A 2QM7A 3B1JA 2ZUCA 3AFGA 3M4NA 4FWBA 5KHAA 4EJ6A 4C14A 4RM2A 4DUZB 4B74A 1KQOA 2R8BA 2Y4OA 3FY4A 4D4IA 1XU9A 4YT4A 4XPIA 1B76A 1FEZA 2O2XA 2X8BA 2B37A 5ITZB 2HHJA 1GQQA 1LY1A 5HCIA 2CNDA 2XT0A 1X7DA 2JK1A 2P9FA 6ADHA 5CVUA 3WLKX 1O9BA 1Z7WA 3CXRA 1RSZA 1SHLA 3B1KA 4M7OA 4EHAA 2Y77A 1N9KA 4P5PA 3IBYA 3RS5A 5ECWA 1WAMA 5J2TB 1B6GA 3A6LA 5AVQA 1XMPA 3LGXA 1Q14A 2BJWA 4MLDA 5JO9A 1XQWA 1YIDA 2P77A 1X38A 4LXTA 2AFHE 1OQAA 2H2WA 5AVJA 1M5RA 2JVKA 3I9FA 2Q1XA 1W49A 1RCTE 4R2KA 3ZWDA 3WNQA 3AW9A 3T5CA 2G40A 4RFSB 1JAYA 3SVLA 3ML1A 2DQ4A 3OLZA 3VZBA 3ENVA 3HB9A 3SFTA 1GGEA 1XWIA 3BREA 1K98A 1WQ1R 3PQ3A 4KUHA 4Q0MA 1D4AA 2RAUA 3QVTA 1OZ0A 4MULA 3LCJA 5B58C 2FMTA 5DI3B 4F1WA 1NVBA 4BXOA 1NAHA 2D1RA 2IEGA 4MAFA 4X7BA 3F7OA 5FL7D 3TTWA 5CGQB 1MEOA 4EJFA 4QAJA 2HPAA 2GAAA 2POCA 3I42A 1P4SA 2RHDA 2GMWA 4F3TA 2F1HA 2QA5A 1VE3A 5SY9A 6REQB 3RBAA 1E7QA 5LNK6 2QJTA 4EG5A 3E84A 4I8DA 4KW7A 3NDPA 3OZVA 4P4SB 4KIFA 1OH6A 2J7KA 1TT5B 3SSNA 5KB3A 4UMVA 3F4KA 3SR3A 1J90A 4C0QC 1Y33E 1RS0A 3MGAA 4Q12A 3N3AC 1B4DA 1J2RA 1V2GA 3REOA 4OUDA 5I47A 3FDXA 2V7VA 1F2TA 3R0JA 4LDJA 3W3AH 1VGQA 3NCTA 3ZPXA 2P6OA 4KXLA 2NG1A 1VG0B 1ZCBA 3ZW9A 1EUDA 4MQEB 1SKYE 2XE7A 4QPZA 3ZQJA 1D7OA 5ADWA 1XZFA 5REQA 2XUOA 4HBGA 4WLEA 2P35A 3H6HA 3I5AA 4TTAA 5AK6A 1ZG3A 2C1ZA 3UK2A 4CTNA 1RQ7A 3EHDA 3PPYA 3NHRA 1L5NA 5SZJA 1P0QA 4LVUA 4MGHA 1GRCA 1NBMA 4E5YA 3G0HA 2FE1A 4AG5A 3WK7A 4D3YA 1DJPA 2XE6A 4GR4A 2PRZA 4MA0A 5YASA 5IJ0B 4ZCMA 5T7BA 1XTKA 3IAHA 5DO9A 1P7ZA 1PHRA 2AUNA 3PJFA 3TOSA 1KWKA 3PA8A 2J5XA 2WZDA 4UAJA 2R8XA 4C4TA 4FJ2A 3ZOZA 3KUKA 4C03A 1M2OB 2GT1A 1HRDA 1CRPA 2PRSA 5CXSA 3HRKA 3K1TA 3WKAA 4TV8F 1GUDA 2QNRA 1SBHA 1MP0A 2VAMA 2WIGA 4GOJA 2TSYB 2WW8A 3CUSA 3I0NA 4Q21A 1YVRA 1QO7A 4P3YA 2O2IA 4PNHA 4P31A 3ROKA 3TLGB 5JH7B 1Z63A 1MX1A 3CZAA 3N86A 5HJ7A 4O2RA 3WHLA 4L1KA 1Q15A 3LFHA 1WUKS 1W8DA 2F59A 2AE2A 2EAUA 3NBXX 1CJTC 1XCLA 2FSIA 1UBOS 3QEMB 4IHJF 3RD5A 1UBEA 5JMPA 4QGHA 1DPFA 1K63A 3MCUA 1QS0B 2YN0A 1UJBA 4KIJA 4G0UA 2IDMA 1A7KA 3MUNA 3QW2A 4B85A 4US0R 1FU8A 3E7PA 5CHEA 1BJTA 4EKIA 2VYND 3LYAA 4O2BA 3JQFC 1KMQA 4HD8A 4XVQA 1SKMA 1SR8A 1EFRD 2Y6VA 1AHPA 2I6TA 1UKVY 3C3WA 3CEPB 4OHYA 2Q5FA 5EOVA 1M2FA 2V9ZA 2CVOA 3PUWA 4Q48A 5JSYA 3DMGA 5CFNA 1PNRA 2J9GA 3MBKA 4C7VA 5AXBA 2GN8A 5HQ3A 4J0JA 5TB5A 3UF0A 3RROA 2P6UA 3BERA 5AI6A 5FAKA 3O8OB 1E0KA 2FVXA 2V03A 4I4CA 3ORRA 4B6JA 3THSA 3PEEA 5D51S 1JWAB 1RRFA 3DL4A 3HL4A 4PS1A 1RP7A 2P0AA 2WFMA 2PS9A 3PYMA 4QFBA 3WDMA 4NOKA 4JR0A 1VA4A 3ZY6A 3RTCA 2YNMD 5TF0A 1WNFA 5K03A 4KK4A 4W1QA 1CQPA 4DJAA 3IMCA 3R4VA 3U4IA 4X6UA 2YZKA 3NM5A 3WQSB 2YQ4A 2GBLC 1WZIA 3CCBA 4KN6A 3E8XA 7MDHA 1EHCA 3L0ZA 3ETEA 2F3UA 3IGFA 4QUBA 2XCRB 1KNXA 1D0SA 1SBCA 3HBFA 3JZFA 3Q3GE 3E58A 5ESWA 1OH8A 4UD6A 3IDAA 4D4JA 3RHSA 3K1JA 3H17A 4IXTA 2YJNA 1GP2A 3MTAA 3PQCA 1U7TA 3MWYW 4QYWA 3O1LA 5EZYB 4NC9A 3NRCA 5CG1A 3GJ0A 1OIXA 5JNSA 1QOPB 1U4SA 2VUIB 1Z8FA 1IXZA 3PLAE 4GRDA 1ORHA 1PJAA 2C20A 3OTWA 4QQFA 2YBEA 4CF5A 3CHYA 5FNVA 4KDEA 1IULA 1CP2A 3AY7A 3FW1A 3NWPA 3GPCA 4GWGA 4OYYA 4DLBA 3GDGA 2SKDA 2CV2A 1X80B 2C5FA 1AQLA 3ILHA 2X0IA 4UUNA 3DVQX 1E2KA 5HZGA 1VIVA 1BO6A 3INYA 3PWKA 4FX5A 3BIWA 4B47A 2WWTA 4FZVA 3W04A 3I64A 3K6JA 4H6XA 4U7PB 5EWJA 5JANA 1EZ1A 2DSTA 4X44A 2RGBA 2AVNA 5CUQA 5T67A 4YRQA 1GV1A 3UXYA 4UXIA 1Z34A 2ADMA 1V4VA 5GOZA 1UPAA 1JFFA 4F12A 3M3HA 1A8PA 3C6XA 3OQMA 1L3IA 3KU1A 4GPD1 4NJEA 4WNYA 2NV6A 1W0KD 2BGGA 2QMEA 2VUHB 4MYSA 3IS3A 2R9VA 2ZYRA 5DE3A 2QROA 1E2NA 4ZDWA 2BHLA 4N5HX 5LP6B 4C7JA 1YNSA 4EW2A 2EP7A 3ESXA 3ABSB 4V0SA 3KQLA 5KKNB 3UA3A 2X5OA 3GWZA 5EA2A 5JQWA 4LF9B 4LI3X 4JFAA 1T0UA 4J07A 5CVDA 2OXEA 2ZRGA 3LPCA 2FF7A 2WB2A 1NX6A 1CX9B 3VDRA 2DGDA 3BOSA 1CF4A 1PZGA 3ECCA 2XSZA 1P19A 4EY5A 2QIOA 2Z3ZA 1S8AA 5CDFA 1I8TA 2NSLA 2YY6A 3VYVA 2IS4A 3MMNA 1F3OA 4TTQA 4D3ZA 2QTHA 5BVGB 4N48A 3HP7A 3SC6A 2B30A 1BWQA 3KAKA 1RXWA 4WRRA 4BLQA 3EPPA 5IZCA 2HADA 3LBIA 3UFXB 4BLRA 4CE6A 3LHIA 2EP8A 5CM9C 1C30B 3ZIAD 1XPOA 1CS0B 2QF7A 1EQAA 2ZGVA 3W7VA 4PNPA 1CJMA 1U8TA 1RKUA 1W4LA 2RGGA 3PDCA 5ENZA 4X62B 1KF0A 4RF3A 3LYLA 1MHTA 4QTUB 2ZTVA 2CHEA 3QZUA 4L3WA 4LJKA 5TSDA 3U7QA 3TTYA 4OX9Y 4HNGA 2ZFUA 2J3MA 1JEYB 1AC5A 1QZTA 1M0WA 4JP2A 4Z3KA 2FMUA 3NHKA 4MS1B 2QBYB 4FFBB 4EHBA 1OFGA 3G3EA 4IQ0A 3ZDDA 1I4LD 1T24A 2HCJB 1HA3A 1HKHA 2A9PA 3IRUA 4DJJA 4JVNA 3HEMA 1LX7A 1KY3A 3VV3A 5KX5F 4M3NA 1PF7E 1YZQA 5CFPA 2BFMA 4I1PA 1E0SA 3EQ6A 2CLDX 4CFYA 2Q3MA 3BMCA 2A7XA 3NORA 3GA7A 1AH2A 3VHLB 1A9QA 1NDHA 3D54D 3PFIA 4PQFA 1SRRA 4JI1B 1Q2UA 4KAAA 2X41A 3W2HA 1DAPA 5JEDA 1VLZA 4P83A 1ZXLA 2YHIB 4B81A 2W6ID 2E37A 1UJ4A 2IUUA 2J9ZB 3RS0A 1DWOA 3AFHA 2WWGA 2CFTA 3OZRA 1DPGA 2YYZA 5K4HA 5K9ZA 1VKJA 1PS8A 3SE0A 1RC8A 1FFDA 2JA2A 4L4YA 5JEEA 4NV3A 1NONA 3D8NA 1Z06A 1CF9A 4J6EA 2AIRA 3IEIA 4TL6A 4WKPA 3U0BA 1T6NA 3WL4A 1KR2A 4GOXA 5D3QA 3EXHB 3O6VA 1C1YA 3ZBPA 5IVHA 1MC8A 3E0QA 1O5OA 1CG6A 3E18A 1C2YA 4UM5A 4DARA 2B4AA 3DXZA 2VDWA 3NQ41 2QTAA 2JIOA 1RJGA 3HU1A 2RHMA 4OHCA 1EVEA 2Q8QA 3AIIA 2FW7A 4R0NA 4REOA 2FX5A 2HMWA 1M74A 2QPOA 1VPWA 4KRYA 4BO8A 1Z33A 3C3XA 4HWRA 1U9IA 2FG7C 1USGA 1KAHA 2C54A 4IMRA 1X1AA 1BVUA 2ZJ5A 3ZR4B 3AY6A 2PKEA