4IS3A

Crystal structure of a 3alpha-hydroxysteroid dehydrogenase (baia2) associated with secondary bile acid synthesis from clostridium scindens vpi12708 in complex with a putative nad(+)-oh- adduct at 2.0 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
249
Chain Sequence
MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a 3alpha-hydroxysteroid dehydrogenase (BaiA2) associated with secondary bile acid synthesis from Clostridium scindens VPI12708 in complex with a putative NAD(+)-OH- adduct at 2.0 A resolution
rcsb
molecule keywords Bile acid 3-alpha hydroxysteroid dehydrogenase
source organism Clostridium scindens
molecule tags Oxidoreductase
total genus 82
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.395: 3-alpha-hydroxybile acid CoA 3-dehydrogenase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4is3A00
1NWCA 1XELA 3QE3A 1W73A 3LT0A 4FFMA 4FJ2A 2VWGA 5H83A 8LDHA 3EZYA 4LN1A 1TVEA 2ZK7A 4AJ4A 1GTMA 2E6UX 4XWYA 1TI7A 3D4NA 3F5QA 4GGOA 4W7HA 3X2FA 1XHLA 4BNZA 1MG5A 2C82A 5JDCA 4FOSA 4RZIA 3OJOA 3PTZA 1LXCA 4CQMA 4PFJA 4FN4A 3DEYX 2VN8A 1ENOA 1CRWG 1RPNA 2P68A 5TRTA 5C3MA 5EJ2A 3W6UA 4DWVA 1E1LA 1GV1A 1EE9A 3PVZA 1LU9A 4ZGWA 2C7VA 3NT5A 3M1LA 1Q7CA 1EMDA 5G4KB 3KETA 4YRBA 3UFXA 1P0FA 5DCUA 4UUPA 4MIOA 4F3YA 3M2PA 1VM6A 1KVTA 1UZNA 2CDCA 4A73A 1TT5A 2BFAA 5ENVA 2JCVA 4YR9A 1R4MB 2Y66A 3LK7A 2DBRA 4EJ0A 1GZ3A 2DTXA 2GZ3A 4DA9A 2GN6A 5A9TA 1Y6JA 4W9NA 5FFFA 4LRSB 4PZDA 2J6IA 1IB6A 4YJGA 2IYPA 3S55A 3RUAA 4FCCA 1ZUD1 5EQFA 2YJZA 2GD1O 1SOWA 2VHXA 4BNTA 1B0AA 4YT5A 1PJ4A 1DFIA 4J9UE 3TZ6A 2GSDA 2XAAA 3ZNNA 2WM3A 2DLDA 3F5SA 4I9NA 4MO2A 3NDRA 4ZICA 4Y9DA 1K5HA 2H1SA 4GX1A 4UVHA 3AI1A 4ZVVA 4Q3BA 1CIVA 1EFLA 1KEWA 3DXFA 1NHWA 4IDFA 4O63O 2E48A 1HSZA 4WNCA 4U0JA 1I30A 1JVBA 2DTDA 3GDGA 3KSDO 4NPCA 3PPIA 3GGOA 4XDYA 3W1VA 1N7GA 2PWZA 2FPPA 1BVRA 3GN1A 4I1IA 3HZZA 3W8DA 4U6QA 1IPFA 3LC1O 2HMTA 3FF4A 4NQZA 4XYGA 4DPMA 2NTVA 2WSBA 3MTGA 1M66A 4AJHA 2Q99A 3RC1A 1U9JA 1NR7A 3DBVO 1YL6A 3Q2KA 3MEQA 4XYMA 3H2ZA 4OM8A 3HFGA 1GU7A 2W98A 3GVIA 2PK3A 2Z95A 4C7KA 3KYCB 2VRBA 2X0JA 4XD2A 3WGIA 2OHXA 3HNPA 4IMPA 4GSLA 3ONFA 4WOJA 3LT4A 4DBZA 1YQDA 4DLAA 5IXSA 3OICA 2C54A 4CMJA 3FR7A 4PZCA 1HYGA 1PJQA 1WNTA 2GZ1A 3PIIA 1B7GO 4K1LA 5JC1A 1XG5A 2BH9A 3ORFA 3O8QA 1YS4A 3PZRA 4KMSA 1EK5A 2WMDA 2IZZA 3NJ4A 3PYLA 2VYNA 3KEQA 3L0DA 4I5FA 5BR7A 1ENPA 2EG9A 1KVQA 2PH3A 2EIHA 3SJ7A 3QP9A 3KYDB 2GR9A 2EGHA 4E5NA 2GN8A 3RUEA 1UJMA 2VYVA 1LNQA 1E1NA 1UR5A 5L7YA 1U8XX 4E2WA 5J23A 1U7TA 4DTIA 4G81A 4RF3A 4QECA 3GZNA 5MDHA 1K0UA 3B1KA 4IDAA 2X1HA 1CJCA 3G1UA 4J4BA 3JQ9A 3OF2A 1JU9A 2I76A 4R5HA 5C7LO 3FNFA 1SAYA 8ADHA 3JQBA 5H82A 2X5JO 1DC3A 3GG9A 5T8KC 4WEOA 4CMBA 4B4UA 5EMHA 4ZRMA 2C2YA 1JKIA 1IYZA 2Q49A 1DAPA 5C7IO 3KRTA 3GPIA 3VDQA 1UP4A 4EI2A 1Z6ZA 2PD3A 1DOHA 1HDOA 2DBZA 3U09A 3NV9A 4MOWA 1LSUA 3H5NA 2HCTA 3K2BA 4J90A 4MVJE 5BT9A 3PLRA 4AJPA 4E3ZA 5C5IA 5IDQA 2R6JA 3ASVA 3GRKA 4PLZA 1VI2A 2PV7A 5B1YA 1F17A 4OH1A 2VTEA 4RORA 2IRWA 3LC7O 1KBZA 4WPGA 1GR0A 1VJTA 4XQCA 3DL2A 1G1AA 2D5CA 2EP7A 1KY5A 2XF8A 3JQCA 4F6LA 3TSCA 1B3BA 3FHLA 4GAEA 4W6ZA 3TZKA 1OI7A 3RFTA 3S2FA 3QIVA 3U49A 1H94A 4CM3A 4TKLA 2VNSA 2AQHA 3I6IA 4OMUA 1PX0A 4MVJP 3HQ4O 1M67A 2Y0CA 3UN1A 3GOHA 4J9VA 1V0JA 1PS0A 1Q2XA 2H5LA 5COQA 2O4CA 4YJDA 4LSMA 2A4KA 2P5UA 3PI7A 4R3WA 1QR6A 2X58A 4CLRB 3HN7A 1P31A 1BXKA 5A5FA 1BVUA 4JJIA 1WZEA 5JAIA 4H7PA 5JYDA 4H15A 3WTBA 2UAGA 4KDFA 2OGUA 3O03A 1P45A 4D43A 2G17A 2FZWA 2BKAA 3HE3A 3DZJA 1U7HA 2DTEA 1OC4A 5F3RA 3X2EA 1A72A 5U1PA 4B7CA 2A94A 4XDZA 4E5MA 2JL1A 2FZEA 2CF5A 4FFNA 2OMEA 3OH8A 1WXDA 2AMFA 1BDMA 3FR8A 3FTNA 1N8KA 2YUTA 3ETEA 1HRDA 4DPLA 2YFHA 2E4AA 1Y5RA 4QEDA 4Z3DA 2NU9A 2NVUA 2AG8A 1GADO 1P1JA 1ZVMA 5JNLA 3DZGA 3JD2A 3GDFA 2W2KA 2EJVA 2VNAA 1IZ0A 3FCOA 4LISA 4R1TA 5CEFA 2NADA 4AVYA 4WOKA 3OA0A 2WYUA 5TS3A 3ZU3A 1AE1A 4IS3A 2E37A 1DJNA 1VPDA 3IP3A 2BGMA 2P9GA 1YWGO 3ULKA 1KETA 2PKRA 2C5AA 1H2HA 3ZWMA 1EE2A 5TJHA 2DVMA 4YAGA 5I7SA 3AM3A 2Y1DA 1N9GA 3GDOA 5DP1A 1NPDA 1PWZA 1EDZA 2GERA 5IG2A 3ADOA 4IY1A 1JN0A 1IL0A 3MJCA 3SC6A 2NQTA 3WYCA 2Q1TA 4N5NA 5IFLA 1WZIA 3WMXA 4RVUA 4JJGA 2OBNA 1MV8A 1ARZA 3DMTA 4DYDA 3GUCA 4J1NA 2X0NA 4MVJM 3JQ9C 3GVHA 1IULA 1YRLA 3NUGA 3KSUA 5COAA 4P22A 1M76A 3TN7A 3AW9A 1CF2O 1E6EA 1VKOA 2OL4A 2Y1CA 3F9IA 1GZ4A 3GEMA 4FBGA 5CEEA 1RKXA 3RQSA 5F1KA 3Q6IA 3CKYA 3OJ0A 3GR6A 3BMCB 4CQMD 3IOYA 4BMNA 1R12A 2OO5A 5A4DA 3EGOA 1FDWA 3QRWA 1OBFO 3ETGA 4NFHA 5KKAA 5ES3A 4E5KA 2DBVO 1ZK4A 4MVJG 1DO8A 3D64A 4RVSA 3UW3A 1VKNA 3PQEA 4OGWA 2ZB7A 1QXSA 3O9ZA 5L4LA 3BMOA 3NEPX 4CLXA 3BIOA 2JAPA 2Y0DA 2P9EA 1IUKA 3HJAA 4CUJA 3T7EA 3QY9A 2PKQP 4QXMA 3JSAA 5K9ZA 4IIUA 3MCVA 4Q3DA 1YJ8A 3WYEA 3ZWPA 2WD7A 2B83A 3B1FA 4R41A 1T4DA 5IZCA 5TNXA 1U3WA 4J6FA 1LSSA 4CLOB 1GFSA 4RQTA 2ZB4A 3MZ0A 1NM5A 1CQJA 3FNGA 2NVBA 3PHHA 3NTOA 3ZW8A 3CUKA 1Q0LA 1EQ2A 3OA2A 1K89A 1HL3A 3LU1A 4HFMA 1H9BA 4DL9A 3GMDA 3C7CB 4GVXA 4D41A 4DIOA 2NVWA 3AUSA 1VLLA 4ZHSA 4ZRNA 2P4QA 3PQDA 4RVFA 4A5OA 4E2YA 3WSWA 3GRPA 2IE0A 2ZYAA 3FI9A 1I32A 2QX7A 3F46A 1QLJA 3DTTA 4XB2A 1KVSA 1QORA 1Z73A 3ADPA 4NG5A 4RZHA 3TOZA 1CEQA 5L53A 3OHSX 4AL4A 2YZ7A 9LDBA 4E31A 4NH4A 3H5RA 4RF4A 4D7AA 1OAAA 1PZFA 4HY3A 4RLSA 1JKJA 3ZHZA 5B12A 1ADCA 4WECA 2AXQA 5KIAA 5ITVA 1YDWA 2A9FA 1ZBQA 4WGGA 3RKRA 1Y9AA 5A04A 4RDIA 1P44A 5JPIA 1NWHA 3BXXA 4J7UA 4D3SA 2YW9A 4KP7A 4LCJA 5CPBA 3GH3A 3DAPA 4ZQEA 3U5TA 3WWYA 5CG2A 2O7SA 2IXBA 4P8RA 1XU9A 4A27A 4GX2A 1M6WA 2J3KA 2IEBA 1R15A 4GMGA 3R1IA 4YT4A 1C1DA 1YL5A 3WG9A 5F21A 3UCXA 1D3AA 4PLWA 4RVGA 4BO0A 1KC3A 2HSDA 2VYND 1LI4A 1U4OA 3FBTA 3IMFA 2OFPA 3M1AA 4A2CA 1DC5A 4II2A 4BMSA 2Q2QA 1LQUA 1N1EA 3KHUA 4CPDA 3A9WA 3DMTC 1CWUA 3JD4A 4XQEA 4DVJA 4FGSA 1LRKA 2DT5A 3TOXA 4DIFA 3GMSA 3H7AA 3DHEA 3MWDB 2NLOA 3H65A 3L6OO 4Q9NA 1MC5A 1U2DA 3S2EA 1EEHA 3Q9UA 1PL8A 3D1LA 4CQMB 4A7PA 4NMHA 1GCUA 3ABIA 2V7PA 3Q9NA 4D44A 3CTMA 3LLSA 3CINA 3V1TC 3C1AA 1H5QA 3LF2A 2ZTVA 3GFBA 4U6SA 1TXGA 3HB5X 4YPOA 3KUXA 4IDEA 1B8VA 3OFSA 2IEDA 1FDUA 1P77A 3OIFA 3F1KA 1NXQA 1GYRA 4MDHA 1TT5B 3VKVA 1SNYA 3B70A 3WLFA 5U9CA 2RHRA 3EZLA 4IBOA 1V8BA 3FSRA 4H3VA 4WLVA 1QYCA 4YJGB 4DBVO 1ISGA 1D1TA 4ND5A 4EW6A 1UDBA 2POQX 2ZB8A 3QWHA 4AG3A 4BO3A 1PGJA 4RDHA 2OOSA 5G0WA 1MUUA 1AUPA 4QTZA 4HUJA 2VHYA 4QSMA 2DPHA 4FR5A 1GD1O 4QUKA 1ZJZA 3ZCXA 2EKLA 4AJEA 2PH5A 4K9DA 5G0UA 2UUOA 1UAYA 1H6AA 1DEHA 1O5IA 4CMKA 5HS4A 2V65A 4NDNE 1X1EA 1NAIA 4DRYA 5IDYA 2PZKA 2WWRA 4WNIA 4M86A 3ZN2A 1PJCA 1X14A 4JBGA 5A3VA 3PLNA 2GUGA 5A05A 4GX5A 4D45A 1TB4A 4L74A 3PGXA 9LDTA 1T4BA 1PGPA 5KVVA 4WLOA 1ONNA 2J5KA 1DHTA 1UH5A 3OETA 3L77A 5A06A 4J16A 3GNSA 3ANLA 1I3KA 1QV7A 3PWKA 1IY8A 1X1TA 1ZSYA 1H6BA 1Y9EA 4B3HA 1E5QA 4KTTE 3JQ8B 4GI2A 5BSHA 4XQ9A 1VL8A 3DONA 2I5PO 4GVLA 4AJLA 4UVDA 4GBJA 1YB5A 3E1KA 1XWFA 2GPTA 3TNLA 1F06A 1IE3A 1AHIA 1RM3A 1SOVA 3LSYA 4YRAA 5DNAA 4CR7A 2B69A 3D3EA 3PXXA 4XJSA 4HFRA 4QQRA 2H6EA 4TWRA 3OP4A 5L7WA 3MOIA 1EVZA 2FPIA 3CH6A 3EVTA 4BNYA 3G0OA 4BNVA 3RWBA 2W90A 4AJNA 1EUCA 1TT7A 2CVOA 4R69A 3NKLA 1DPGA 1UDAA 1X0XA 3R3JA 3V1YA 1OFGA 4PRLA 3VOSA 1N5DA 4FB5A 4B7XA 4XYLA 1C0LA 1G6KA 4DPKA 2EW8A 4ROSA 1P1KA 1WW8A 3DB2A 4N5LA 3FPLA 2JKVA 2NU7A 4IGFA 2PFGA 4J1TA 2HK8A 2PD6A 1HEUA 3GZNB 3RFVA 2IZ1A 2QHXA 1QKIA 2J8ZA 4JJFA 2YHIA 3VAZA 1IOLA 4NIMA 5COBA 1UZLA 2IYOA 1G0NA 2FR0A 4OOFA 2YQ5A 4FFRA 3UHAA 3K9QO 2CNBA 5EESA 5EIOA 4Y8VA 1ADFA 2ZTMA 4Q3NA 3IDSA 3E8XA 1T2CA 1PU2A 1RJWA 3LYLA 4HV4A 2BGLA 1IHXA 3JQAA 4PG7A 3RUIA 3H8VA 2DM6A 2C0CA 3RUFA 1ULUA 3CE6A 1GYQA 4FC7A 3INTA 4P4LA 1ISJA 2B4QA 3W8FA 4S1VA 2FSSA 2V6GA 2YHUA 1YQGA 3D7LA 4YVFA 4CM9D 4Q39A 3FBGA 1GY8A 1H93A 4FIZA 5I7VA 1LDGA 3NDIA 1N2SA 3WMWA 3ZHYA 5A03A 1DSSG 1E1MA 4TVBA 3RVDA 1WPQA 3IJRA 2FOIA 1V9LA 4D0RA 5K0ZA 3NAQA 1SZJG 3H3FA 1NFFA 3DZIA 3RAJA 3KLMX 5FEUA 1P33A 2WE8A 4CR8A 4YT8A 5CG1A 4RGBA 3AOEC 1YJQA 5L51A 4R5MA 4BB6A 4BB5A 1ID1A 1KY4A 4R1UA 1EFKA 1SB8A 2RAFA 4O59O 4XGNA 1I2BA 3T4XA 1U8FO 1B16A 3JTMA 3UICA 1BHSA 3WGTA 1PJBA 1HZJA 5JDIA 4CMGA 4B3IA 4M54A 3PWSA 1M75A 4E32A 4E5YA 4ZU3A 4OO3A 2D3TA 1YDEA 4BGUA 5HS6A 2XPCA 2GN4A 2TMGA 4NFSA 1WVGA 4Z6KA 4DUPA 5EQDA 1CDOA 5BSGA 1UXGA 2OORA 3E03A 2E82A 1DB3A 2NVUB 4MP8A 2J3HA 2W2KB 4FOOA 4JX8A 3HSKA 1SEVA 3PK0A 1ISMA 4PLTA 4RPHA 1UZMA 3BMQA 1VC2A 1UUFA 5A1TA 1A4UA 1MA0A 3WR5A 3LT2A 4BV8A 3WGZA 5CEJA 3VPXA 1HDXA 3GVXA 4YJFA 3GFGA 4EUEA 1R16A 1PR9A 3DWFA 3L4BA 3Q1LA 4W82A 2JHGA 4J4TA 4XB1A 1W0CA 2ZQZA 3IIEA 3SVTA 3ZWXA 1N9GB 4CLHA 4KUGA 1FXSA 1MGOA 2I65A 2PA3A 5JY6A 3V2GA 4LVCA 3VZQA 5JYEA 1F8GA 3HDYA 4JCOA 3W4IA 1T26A 4MIEA 5GZ6A 5JS6A 2G82A 4PG4A 2AW5A 3OIGA 3EK2A 4Z9YA 2RH4A 3ZW9A 4ND3A 3PIDA 4INAA 2PGJA 1A9ZA 1DC6A 2CDBA 4Z0HO 3ZWNA 2ET6A 3DAFA 1XKQA 2DUUA 1E5LA 4XZ3A 3TQHA 3VH4A 1B26A 3PJFA 5TQVA 1LDNA 2OZPA 5TSDA 1PL6A 3BAZA 3JYNA 3DBLA 4IPTA 3HUDA 4MPDA 4X54A 5B37A 5KKCA 3ONEA 3V1UA 4UVGA 1BMDA 3ZWCA 3E9QA 2X23A 1O8CA 3QVOA 4XGIA 3KYBA 3SLGA 4OL9A 1ENYA 4PCVA 1W6UA 4E30A 4GH5A 1JW9B 3UXYA 2FRDA 2ZCVA 4XX0A 2JHFA 1ZCJA 3EY4A 4B4VA 4BKUA 2ZATA 5G0TA 3I83A 3KOUA 1VE9A 4UUOA 3VHRA 4XJTA 1Y1PA 4XRRA 4C7JA 4MKXA 1GYPA 2JJYA 2IODA 1B8UA 2EEZA 3ROQA 2B5VA 3QHAA 4PLHA 2QZ9A 4OOEA 3HDQA 2LDBA 4J1SA 2BFMA 4IXTA 5IAAA 1SEPA 1HYHA 1DDOA 3GNQA 1XR3A 3ZWWA 4CMEC 3AY3A 4BGEA 4EGFA 1EUZA 1PTJA 3D5TA 2X86A 5F1OA 3WX0A 4OXKA 1NQOA 3K30A 1V35A 1DIRA 4DQUA 2Q4BA 4RLHA 4Q3EA 2WD7B 4WCDA 1TEHA 4EJMA 2Q45A 1R4NA 3QLJA 1HWYA 1NBOA 3ENKA 4ALIA 2PGDA 4B4OA 4DIBA 3ZU5A 2YY7A 3DDNA 1U5CA 4XEHA 4ESOA 5JLAA 5JDCC 2D59A 3EVNA 2J5QA 3AK4A 3I9JA 5BNTA 3JQGA 3GAFA 3VPHA 4BNFA 3IUPA 1TLTA 4M49A 4YACA 3L4SO 2PY6A 2OXIA 4YT2A 1WAMA 2EF1A 2DFVA 4J0EA 1RYEA 3WYBA 1NPTO 1DC4A 1P1FA 4O0LA 2CUKA 4O6VA 4WLEA 2HMWA 1I2CA 4CM8B 3UF0A 4I5GA 3L9WA 1NP3A 5AXDA 4L0QA 4IMRA 1ISIA 1NHGA 4EUHA 1DIBA 4Y6PA 1ML3A 4TZTA 2GASA 2XXJA 4NBRA 1M6HA 4I08A 4TSKA 1NX6A 2DFDA 4E2ZA 3ZV3A 4J3FA 5JO9A 4W9NC 1YE3A 3PJDA 1MX3A 4G2NA 4TVOA 5DOVA 3G1TA 4BHTA 2EKQA 3NX4A 1ZW1A 3AU8A 4U0KA 4CUKA 4GSKA 4JN6B 1KOLA 2HQ1A 4FQ8A 3BYZA 4OXNA 1V3TA 3DFUA 5THKA 5IXYA 3F3SA 1XDWA 4Q3AA 1R66A 1FF9A 3UCFA 3KLPX 5ER9A 1C1DB 2GCGA 3JD3A 1QP8A 3AJRA 3KSZO 3PHJA 4IXWA 4Z0PA 1ZMTA 2P4HX 4OQYA 3D3WA 4YWJA 2AA3A 1X7DA 3A1NA 2BFPA 5GZ1A 3U9LA 5FWNA 1YBVA 2FMUA 5ICMA 2P9CA 1OMOA 4HFNA 4OYRA 4DC1A 3RC2A 1LDBA 3RJ5A 3IAHA 2Y1FA 2CFCA 5FF9A 3TRIA 1WDMA 3QQPA 3RI3A 1EBUA 4LCEA 3DOJA 4F46A 3S2IA 1I24A 4BO2A 2O50A 1L7EA 4I5EA 5G2OA 4UEJA 4YQZA 4CMAA 2QYSA 1OZAA 3AY7A 3IJPA 2G1UA 2O7QA 4RV9A 1I5RA 3WTCA 4HP8A 3I9NA 3NRCA 1DHRA 1I36A 3COSA 2JAHA 1XSEA 2D1YA 1MFZA 1I3LA 4YEDA 5LDGA 4HWKA 2Y05A 3H4VA 5GZ3A 3WS7A 3H3JA 3JQAD 3AUAA 2SCUA 4RVDA 1H6CA 3TWOA 1J6UA 3NJ8A 2FR1A 2Q4EA 4MP6A 5LDHA 3OJFA 1LRLA 5TGDA 1C1XA 3HHPA 2AQIA 2VZ0A 3BTOA 2YFQA 3QVWA 1ZFNA 2V6FA 4TQGA 4J2HA 3C1OA 1P74A 4CLEA 4AJKA 1KYQA 4JLWA 4BNXA 3CZRA 1E77A 3B1JA 4D3FA 1KVRA 4PLPA 2Q46A 4W4TA 4RF2A 1UXKA 4D46A 3GHHA 3WJ7A 1F0YA 2AG5A 3JQBC 3ON5A 4NBUA 1J4AA 3QWIA 5CDYA 5I8ZA 5C37A 4ALMA 3AUUA 4PLFA 2W2LA 2TMDA 1ZXBA 1SO8A 4PLGA 4QT0A 3GNTA 1T2EA 2OBYA 4NJOA 1QV6A 1SPXA 4MINA 4CM9A 2GZ2A 4DMMA 5IZ4A 3SJUA 3K92A 3GZ4A 4R9RA 4CV0A 1L1FA 2O3UA 4OSPA 4JP2A 4CM1A 4N54A 2HRBA 1DLJA 2P2SA 3KVOA 2OP0A 1HSOA 5A9SA 1GPDG 4L4XA 1EVJA 5JAQA 3FRJA 4BGVA 3S1LA 1HETA 1GZ6A 5DZSA 4NJMA 3F47A 4UULA 4CODB 4DYVA 2G5CA 3E9MA 1MXHA 3I3OA 4F6CA 5L7TA 4GWGA 4MVJF 2GDZA 5A3JA 3LF1A 3O38A 1N1GA 1EVIA 3CEAA 1UP6A 4P4NA 4YTEA 3RU7A 3WGOA 2YDYA 5CDTA 1A71A 3JQFA 3OEYA 4E2XA 5BSFA 4LVUA 4PLCA 4WCFA 3PP8A 3WQQA 2I6TA 3O4RA 2BFOA 4BO5A 3OQ1A 4Z9XA 4M1QA 3VPGA 1B2LA 4L75A 4UVIA 3GUYA 2O48X 1LDEA 3MJ4A 2VWHA 2NUAA 3GC6A 1LLCA 3PHGA 5L9AA 2VT3A 5MGBA 2C29D 2I9PA 1XQ1A 3FNEA 3DOOA 4YRDA 3H9QA 2PNFA 4ALKA 1P1RA 2AQKA 3DZHA 1E3EA 3CIFA 4G65A 4XKJA 3GT0A 2P91A 1HYEA 3DTYA 3AM5A 2Z5LA 2IZ0A 5T64A 3K73O 2VZ8A 1PJLA 2R00A 5JAMA 1YXMA 2HDHA 5TC4A 4K6CA 4ALLA 3W4JA 1WDLA 1N7HA 5EL0A 1RWBA 5FYDA 4YXFA 4CM5A 5BNIA 2YV2A 3V8BA 4FW8A 3OQBA 2VOJA 2C20A 2F00A 3JQEA 1NQ5A 1WMAA 2J3IA 4JP3A 1AHHA 2EJWA 4CLDA 3Q11A 1PJ2A 1H9AA 1HE3A 2RCYA 2Y0EA 4JBIA 3RSHA 1R0SA 3LLVA 4B8WA 1I10A 1C3VA 1XA0A 7ADHA 3EUWA 1ENZA 1G0OA 1ZKMA 4XYBA 1JTVA 3JQAB 4EJ6A 4WE3A 1LSOA 3P19A 4RPGA 1UAGA 4PZEA 1WP4A 1U3TA 1NVTA 3GA0A 3DBRA 1L7DA 1ONOA 1ZJYA 4P38A 3NTQA 2AE2A 3QV1A 1JA9A 4BNNA 1RM0A 2X22A 4NU5A 2NU6A 1GQ2A 3ZDFA 3L6EA 3TPCA 5ITWA 2D0IA 4OHUA 5L45A 2CMDA 2XOXA 5B4TA 3ZHBA 1HDCA 3K31A 1CETA 1DRVA 1HT0A 4JIGA 2IDZA 4IJKA 4NNJA 3SXPA 3UH1A 5A9RA 2GN9A 4YAKA 1NASA 3WBFA 4OXYA 1E92A 1EZ4A 4XCVA 5A02A 1C14A 4IJUA 1GEGA 2ZTUA 4GLLA 4Q3CA 1LSJA 1ZZEA 3F4BA 1X7GA 4OIMA 1VL0A 4BKOA 1JAXA 1JWAB 2NTNA 4BVAA 3SLKA 1K6XA 3N7UA 4HADA 3RC9A 4R01A 1E1KA 1PR3A 4N5MA 4GMFA 4O5OA 3INRA 3CPSA 4AJJA 2Q1WA 4CL3A 5B4UA 1E3IA 2O3TA 4K26A 3P2OA 1ZK2A 4L4SA 4AJOA 1H0KA 4UAGA 3WFIA 3W8EA 1SC6A 5CFZA 1CQIA 4IUYA 1MLDA 2Q1UA 1P1IA 2BMAA 2QRJA 3AI2A 4GLOA 1I01A 2JD1A 2PZJA 1J0XO 4UVEA 5HWSA 5IJZA 2UDPA 1GPJA 4J4HA 3UGKA 2JCYA 3JQDA 3VH2A 4PG8A 3GEDA 4RO0A 3WQSB 4DLLA 1F14A 3H5AA 4BNMA 3OJEA 4R4JA 4DMLA 4I8XA 2WEKA 3WWZA 3U62A 3L6DA 3E9NA 4M8SA 5KCZA 3E6AA 2NNLD 1YGYA 4YA6A 5C7OO 4KZPA 3ONDA 2F1KA 3ZWAA 3WIEA 2NM0A 1H6DA 4BNJA 1T1RA 4Y98A 4D3DA 4TRRA 1BSVA 3FPCA 4WK6A 4CUZA 3ETDA 1B8PA 1T1SA 5IZCC 2NTJA 2Y1EA 2ILTA 4PRKA 1ONPA 3KEOA 1R6DA 1XEAA 2X5KO 3V5NA 3A28A 3HWRA 4PVCA 3ZH2A 3RIHA 1PL7A 3EMKA 3FWNA 4MKRA 3EDMA 3MJVA 4DC0A 3TFOA 1HTBA 4FD3A 2BGKA 2HJSA 2QG4A 4N7RA 3GVCA 4I5DA 2C5EA 3OIDA 5AXBA 3H6KA 1H2BA 4D79A 3I9MA 1HDGO 3NT2A 1A9YA 2X9GA 1I2ZA 3EC7A 4KDEA 3BMCA 4RJTA 1V3UA 3RBVA 3Q2IA 2ZQYA 2EERA 3IS3A 3QVXA 5JMWA 3WICA 3A4VA 1BXZA 2Q1SA 3TL3A 3IP1A 3PZBA 4YDRA 3QVSA 1VJ1A 4ZD6A 2WJPA 5HM8A 2HK9A 4KQXA 4EDFA 1E7YA 3PJGA 2FP4A 5TJ9A 5DBFA 1VSUA 3VH1A 3WDSA 5A5EA 4Y67A 5KVSA 3PGJA 2C59A 2VTDA 2UUPA 2UYYA 3O8QB 3ROKA 3RUCA 2HMVA 4CM4A 4FS3A 2WYVA 4II3A 2XXBA 2PZLA 4K6FA 1LDYA 5AXCA 4ZJUA 4ITUA 1AGNA 1PWXA 4E13A 2VT2A 3CZMA 1PZEA 2HU2A 2B4RO 2X0RA 1Z75A 3ANMA 4B3JA 1ISHA 3PYXA 3GY0A 3WXBA 2DUWA 4WLNA 1HDYA 1HLPA 2ZYDA 2O3QA 4BNUA 3F1LA 2Y99A 1LC0A 4IDDA 1CYDA 3NGXA 4IQ0A 4DXHA 3DZKA 5KJCA 5F5NA 4BNLA 1GDHA 1GQQA 3HDJA 1R4NB 3K5PA 5L95A 3ZV5A 1BRMA 1T25A 4GX0A 1PZHA 1Y8RA 3GAZA 4DREA 3JQGB 2Q2VA 5AVOA 1R0LA 2QRLA 4ALJA 2EWMA 5CP8A 3ZZNA 3IUSA 5KVQA 3R0IA 4I9UA 1R0KA 1S7CA 3GQVA 3ZU4A 1LUAA 3GPDG 4UUNA 1ZEJA 2YV1A 2VHVA 2W2LD 4EYEA 3W6ZA 4E0BA 4ID9A 4RQUA 3VDRA 5KJ6A 1DFGA 4IZIA 3ZU2A 5DULA 2HKIA 3IKVA 3TZHA 4BO6A 5JY1A 4J49A 2Z1MA 1HXHA 1N92A 3DC2A 4WUVA 3RCBA 2HRZA 1U3VA 2X7HA 3O26A 3FN4A 4JGBA 1DLIA 1Y8QA 3AFMA 3ZWBA 2GO1A 4NR0A 2BI7A 4E4YA 3AI3A 3WJAA 2VUUA 5HBRA 3UOGA 4U8GA 3EYWA 1NAHA 3SEFA 4ZQGA 1YB1A 1QYDA 3HFSA 1E7SA 3Q0EA 1FDTA 3OJLA 1E3LA 2AEFA 2JFHA 1AXEA 3ZNQA 4CMCA 2O3SA 5ILGA 1LRJA 3ENNA 4CQLA 4XGKA 1QG6A 3BMNA 3IC5A 4HNGA 5T57A 3VPSA 4YAIA 4ZQBA 4YJHA 1Q0QA 1E3WA 4M89A 1NVGA 4RL6A 4BNKA 1K6JA 2O3RA 4CM6A 5CDUA 3JQ7A 3JYOA 5T8KA 5KWEA 2D5AA 3GGGA 4B7UA 1RYDA 2CVZA 2O4UX 4L73A 1YONA 1GUYA 1V6AA 2RBEA 3D3WB 3DZFA 3ITDA 2I66A 3PYMA 4KWIA 1YVEI 2OP1A 1UDCA 3C1TA 4EEZA 4R68A 4H16A 4XA8A 5T67A 5DN9A 5B4VA 5JC8A 4BQPA 1O89A 5DT9A 5FI5A 3TFQA 3SBOA 1GEEA 3SC4A 2A35A 3BA1A 1BXGA 3I9OA 4GL4A 2CDAA 3ZNPA 4BO7A 3JCZA 4PLVA 3C85A 1DFHA 4CMIA 1QYWA 3MJEA 5ILOA 3AWDA 3GEGA 3PDJA 4BKRA 5JSFA 2LDXA 1ZH8A 3RUHA 1BDBA 5HTOA 1BW9A 2WYWA 3JV7A 1NQTA 4BQRA 1KVUA 4FSHA 2CD9A 2PTGA 1T2DA 3VTZA 4S3MA 4MVJI 5T5QA 3WSVA 3EHEA 4WLUA 4N18A 2VRCA 4WEQA 3ROMA 4GQAA 2EV9A 3I52A 3I9KA 2CVQA 3GHYA 4LGVA 1C1XB 1VSVA 1DXYA 1KC1A 4M87A 1WDKA 5BQFA 4OKIA 2NV6A 3DBHA 4MJLA 4HFJA 2C07A 1V3VA 5BSEA 5KJ1A 4URFA 2R2GA 3H9UA 2QRKA 3C7DB 3FNHA 5DDIP 2V6BA 3KO8A 1GL3A 5ER6A 3AFNA 4JQCA 1LJ8A 4IZHA 5CPFA 1HE5A 1P0CA 3RASA 4AICA 4EUFA 1YO6A 3RU9A 2J5RA 1AN9A 1NTOA 3UUWA 4D0SA 1KEUA 1UXJA 2GGSA 1NPYA 4L8VA 3V2UA 1JWBB 3P7MA 3A14A 4J0FA 3I5MA 4E21A 3BHJA 1MFPA 3INGA 3PDUA 4KTVE 3WOHA 3JQ8A 1E0DA 5AYVA 1LLUA 4YQYA 2FR8A 4FJ1A 1E6WA 2NWQA 4IINA 3I6QA 4CV2A 5TT1A 3MWEB 3IKTA 3WB9A 4CV3A 5A9SB 2ZB3A 5I9LA 2PGLA 1Z7BA 2QQ5A 4JNKA 3KBOA 3I1JA 4NJMB 3BMOB 1Q0HA 1S6YA 2JFFA 4XYEA 3VTFA 3VVBA 3ICCA 1NYTA 1GV0A 1O94A 1X0VA 4TROA 4DQXA 2JFGA 3PFWO 5ICSA 5EERA 4AJ2A 2B5WA 1WWKA 3BTUA 1FK8A 1XCBA 2AEJA 2ZCUA 4WCFB 5H81A 1GQYA 3WQRA 1YKFA 4DGSA 4XIYA 1PQUA 2ZJ0A 4U5QA 2GRAA 4LMRA 4ONEA 5LCXA 4PG5A 1MXFA 3M6IA 5IDXA 1Z74A 1A7KA 1XIVA 3FTPA 5I9MA 2A92A 5JDIC 2ZIZA 2Q3EA 2PD4A 5JXWA 2WD8A 3QVTA 1HLDA 1TA4A 4GGPA 4YAEA 1NNUA 5EINA 4IJVA 3WNQA 3K8ZA 4FFPA 5KOIA 1Q7BA 4ZQFA 2B37A 1E7QA 1QRRA 1QMGA 1MC4A 3RUDA 3UVEA 2VUSA 2Y1OA 3D4OA 5DOZA 2P5YA 4LMPA 4Y6SA 2EP5A 3MTJA 3WNVA 5JW6A 3JQ6A 3TDKA 4AJ1A 2B0JA 4E12A 4Z0TA 3OM9A 3ZV6A 1AXGA 1D7OA 3UAGA 3HB4X 3Q3CA 3NYWA 5KJEA 1LLQA 1E7RA 4ILKA 4WLFA 5ENDA 1UXHA 2Y67A 1YOVA 3PFFA 1LC3A 4DQVA 3OECA 5KTKA 4IQ8A 1W4ZA 1A5ZA 1R37A 1WLYA 2X6TA 3GF4A 3IQDB 2BRUA 4IDBA 1OOEA 4XR4A 3DBRB 5G0SA 4TKMA 4GKBA 3L4BC 4BKPA 3NT4A 4BS9A 5KJFA 5CHEA 4R1NA 1DBVO 3GLQA 4CV1A 2G0TA 5JMPA 3CMMA 3JYPA 5LC1A 5TF4A 1PJ3A 3SX2A 3BTVA 1LQTA 4BIIA 1LBEA 3ANNA 2BELA 5CDGA 3C3XA 3PWZA 4E33A 1PEDA 3EAGA 5AOVA 4PN3A 1HE4A 1FDVA 3RFXA 2FHSA 3H9GA 3BHMA 4EITA 1U28A 3WGYA 4M55A 3JD1A 4HNHA 4IDCA 5G4KA 3HN2A 4KUHA 1NFRA 1NQAO 3OSUA 3DR3A 2W8ZA 3H9JA 3S2GA 1X13A 5IN5A 1BWSA 1R4MA 4ZN6A 2AQ8A 4LRTB 3CXRA 5CDSA 1P1HA 4QO8A 5JFOA 3G79A 4XQGA 4MVJA 4ALNA 3STHA 1DRWA 3IL2A 4NBTA 3DOCA 1YBAA 3B6ZA 2HK7A 3OEWA 2GNAA 4U7WA 3U3XA 1W8DA 3P5SA 3D5QA 4KOAA 4BOYA 5L4SA 3AU9A 4GKVA 4TMFA 3VKUA 5JBIA 1E3SA 2YV3A 3I23A 1B14A 2X8LA 1SCUA 1O9BA 3TL2A 4I9HA 3PEFA 4LW8A 3BZUA 2EHDA 1A27A 5JO0A 3E18A 4G5HA 3LQFA 2CSUA 4E6PA 2IXAA 4PGFA 5F1PA 4JROA 1PJSA 1PZGA 1JQBA 4WJZA 4NFYA 3LT1A 5AQ1A 2BLLA 3LDHA 2GF2A 3E5RA 3D4PA 5JCJA 3QSGA 1C0PA 4LK3A 4C4OA 6LDHA 3ZWYA 3DHNA 2HAEA 3ICPA 4IJWA 3MJSA 3RC7A 5T6BA 4TRNA 1KEVA 2VUTA 2NQ8A 3K96A 5IF3A 3DFZA 3I4FA 3HG7A 1ZSNA 4PG6A 2VZ9A 3ZWOA 2HMSA 2C7GA 4A0SA 3DZBA 4BO8A 2Z1NA 5G0VA 4XIJA 2HUNA 4E5PA 3T4EA 1IPEA 1LTHR 1GUFA 3ZHXA 2YQ4A 4NK4A 1ZK0A 4Y6RA 4HKTA 4FGWA 1HE2A 1PS8A 1EBFA 1PIWA 7MDHA 2DQ4A 2H9IA 3I9LA 2AHRA 4RPLA 2DKNA 1XU7A 3KYCA 3LZ6A 5I9NA 4IS2A 2AE1A 2BF7A 1PSDA 2C2XA 4AFNA 4YYZA 1XGKA 4FDAA 3ZWVA 4PVDA 5FI3A 1C0IA 1E6UA 3QW2A 5L40A 1YQXA 3U4IA 3QJ5A 5U4QA 5ADHA 1XQ6A 3U0BA 4UEKA 3H2SA 2GLXA 1Q7GA 2H63A 3G17A 2NSDA 4L76A 1X7HA 4PLYA 5DCYA 4FC6A 3ST7A 4J1QA 5IN4A 2EW2A 4HXYA 4XR9A 1U5AA 2X9NA 3JYQA 1KEPA 1ZXLA 1PQPA 3ROPA 4Z9FA 3CMCO 4A26A 3KYDA 1D1SA 1PJTA 4NU6A 3C8MA 2JD0A 1ZK3A 1ZK1A 2J3JA 1QSGA 1U2GA 4IQGA 2RIRA 4RF5A 1FDSA 4CM4B 3VPFA 2VWQA 3MJTA 3E48A 1QLHA 3RKUA 2X9VA 1B15A 2QW8A 4OKNA 1MP0A 2FPGA 5DF1A 4ZQHA 1LLDA 2O2SA 1KS9A 3GK3A 5JCXA 1LDMA 3R3SA 1T2AA 3TJRA 2VRCD 4J7CA 2Y93A 1DRUA 1RM4A 4FPXA 1RM5A 2YHIB 1EDOA 1BGVA 3WGGA 5GMOA 1I0ZA 3C7AA 3MOGA 1E3JA 1I3MA 5DP2A 3WGHA 4F45A 3HDHA 5KNLA 3RROA 1HZZA 2WE7A 2YDXA 2ZJ1A 1P9LA 1T2FA 2WTBA 3ZGYA 4CM7A 2I3AA 4J2OA 4CM8A 4NBVA 4BNWA 1SBYA 1Y8RB 4BUCA 2GYYA 1BG6A 1XLTA 2HMUA 4BNIA 1GUZA 5G4LA 3VZPA 1Z7EA 5DBGA 3UKOA 2O3JA 1ZMOA 3AY6A 1HDRA 2UVDA 3PRJA 3QWFA 3H9EO 2JCXA 3A06A 3DHYA 4NBWA 4IDGA 2FY8A 3VH3A 4GPD1 1JKFA 3K2EA 3JD0A 3ZNOA 2VOEA 1O95A 4BV9A 5K6AA 3KXDA 3ITKA 4YB8A 2PZMA 4CLRA 1MG0A 3ZI0A 3I4CA 1O6ZA 1Y8QB 4Z3KA 1QYVA 2G76A 1DIAA 4A10A 3RD5A 1D4FA 2DBQA 4P4GA 3AOGA 1SB9A 1FMCA 2D8AA 3BHIA 3D0OA 4KUEA 5BNFA 4CL8A 4YCAA 5TLSA 2O23A 4R51A 4CQLB 4YAJA 4W7IA 3BMNB 2DAPA 2CZCA 3PHLA 4R3NA 3RBXA 3ZV4A 4FJ0A 4YJHB 3KV3O 1Q1NA 5THQA 1Z82A 3TZQA 1E3WB 1OC2A 3TF5A 1U1IA 4WASA 4R54A 1VJ0A 3FD8A 3RBZA 1HDZA 2VYVD 1DIGA 6ADHA 2W4QA 3JQ7B 1VL6A 2AEMA 5EN4A 1CERA 4B4WA 5TX7A 1YB4A 4PIVA 1YL7A 2E49A 3CSDA 5JE8A 4EBFA 1U3UA 4FFLA 4UUMA 1K3TA 4QFCA 5TIIA 4R9SA 2Q2WA 2RH8A 4ZA2A 2B35A 5HRUA 4BNHA 1VRWA 5AXAA 1F8FA 1Y7TA 2OUIA 1ISFA 4OQZA 4FFOA 1BXGB 2VWPA 3QA9A 4IGEA 3WGQA 4D42A 4R1SA 3G3EA 4OAQA 4CMIB 1PS9A 1I3NA 3BMQB 3JQFC 1YH3A 3DQPA 1LA2A 3ASUA 5L4NA 4O1MA 4WCFC 2QZZA 1JLLA 4XRGA 1BW9B 1HF3A 4YJFB 2QIOA 3DAGA 3T7CA 1ADGA 1WMBA 4HX5A 1PGOA 3L07A 3N58A 3QWAA 4QFDA 3KM0A 2O2YA 4KQWA 2D2IA 4NZ9A 1PGQA 4RCVA 2X0IA 4MP3A 1P3DA 1D8AA 2PLAA 5EPOA 2BD0A 3AOEA 4QO7A 4OJNA 1E7MA 5I8WA 3W4KA 1ZSVA 2VHWA 3G49A 4J7XA 4BO4A 3F6YA 3GGPA 3DBHB 1T24A 5GY7A 4BL5A 3VZSA 2D4AA 4RVHA 4BMVA 3BTSA 4L9RA 2R00C 2UV8A 4CR6A 4LSWA 4JXKA 2DC1A 2HO5A 3WBBA 5I7FA 3OBBA 3LVFO 3PQFA 1DIHA 5DCWA 3UCEA 4NHEA 3DBLB 3NTRA 1E7WA 2JD2A 1GCOA 2X4GA 5F5LA 2QYTA 1ULSA 3U4CA 5HA5A 4MIYA 2ZYGA 4NK5A 3WFJA 4EEXA 3EW7A 4UEOA 4ND4A 2ZTLA 5L3ZA 4GWKA 1I8TA 3GG2A 2CF6A 2CY0A 2DPGA 2BI8A 1EVYA 1XYGA 3TZCA 1KIFA 1LEHA 3DMYA 5TT0A 1A4IA 2EGGA 3OMLA 1ZO8A 3AM4A 2HJRA 1KERA 5IDWA 4BNGA 2B36A 3F4LA 2YYYA 2FSVA 3KZVA 4J91A 4TZKA 1UXIA 4JK3A 4HBGA 4MVJD 4K28A 1FJHA 4YBZA 1K2WA 3QWBA 4A03A 3P2YA 1F12A 1X15A 1ORRA 3L9XA 3VC7A 4IIVA 4OSOA 1EQUA 1I33A 2DU8A 4NI5A 4CMHA 2VCYA 3OQ6A 4CLOA 4BGIA 4UREA 3WIDA 3E5MA 5K6AC 5I7EA 1J5PA 2ZKLA 1IHYA 1ZEMA 1ZNQO 2EXXA 4QX6A 2WDZA 5DBIA 5CAEA 1K6IA 1PQWA 4IM7A 3DO5A 1DJQA 4BO9A 1C0KA 1BTOA 1U4SA 4RPJA 3N74A 5KVCA 3S8MA 2Q50A 2NACA 1Y81A 3E82A 1PGNA 3VZRA 1ADBA 4MKZA 1NVMB 2B4TO 1LX6A 5JCJD 4L4RA 4MVJH 2HLPA 3KTDA 4B79A 4EZBA 3RJ9A 1DAOA 1A7AA 3PJEA 1EK6A 2FN7A 1J49A 2I3GA 1HKUA 1YBMA 2Y68A 1Z45A 2V6MA 1SMKA 1NFQA 4DLBA 1EUDA 2I99A 3NDJA 4CJXA 1UP7A 3HADA 3KB6A 3LC2O 1O0SA 4TRJA 3B20A 1Y5MA 3VVCA 4B8ZA 4ND2A 3K6JA 2PKQO 2PR2A 2NU8A 1JAYA 3GN2A 4J43A 2RHCA 4BO1A 3NGLA 1M2WA 2I67A 1JDJA 1ZIDA 2FWMX 1IZ9A 1MB4A 4WKGA 1NR1A 4KWHA 3U4HA 4BKQA 3FWZA 3V2HA 2X5OA 3WLEA 3JYLA 1QYXA 2BHLA 4R16A 2VQ3A 5JAZA 1YOVB 1GAEO 3AUTA 3GVPA 4ND1A 2EKPA 3PHIA 4CMEA 3R6DA 3M2TA 4W99A 3C24A 1B3RA 4TRMA 1JVSA 2VHZA 3U4DA 4AJIA 4JBHA 4RPKA 2Y1GA
chains in the Genus database with same CATH superfamily
2GPJA 1Q95A 3QE3A 2PX6A 4QXAA 5ERYA 3QLTA 2ZSJA 2VWGA 3QU9A 4LZOA 8LDHA 4N9WA 3SFZA 3WRXA 4BAGA 2BM0A 2ZK7A 3RJZA 2PT7A 3UZUA 1AU9A 1NZFA 2HU5A 2QDKA 1XHLA 3CNOA 3ZX4A 4JASB 5KO2A 4RTNA 1N8SA 2PEYA 3ZLVA 1LQ2A 5CT6A 3W2FA 5AH0A 4CQMA 5F9MA 4MUFA 3DEYX 3COJA 2VN8A 2ZJAA 4F3RA 1PT7A 5EY5B 1RPNA 1U9YA 2P68A 4U9UA 4Y0VA 3AX6A 5DX8A 3W6UA 5J2UF 5CH8A 2RK3A 1E1LA 3W1EA 2WB2A 1EE9A 3T3PB 3UTCA 4BFWA 4EYKA 4JB3A 1X1CA 1A2QA 3PEEA 5DTIA 3KVNA 5IUKC 3UFXA 2E5LB 1GPNA 2O06A 4LJSA 3DB1A 5KOHA 2WTXA 3FTCA 4DR7B 1ZISA 2GI4A 4EGCB 1OLSA 1POXA 2HA3A 1CUZA 2V3WA 4UARA 4C4ZA 3PQ4A 4WCVA 3LK7A 5CGQB 3IR5A 4AX8A 5GVRA 3O82A 4IIFA 3HJRA 1N77A 4CEHA 5A9TA 1Y3IA 1RWQA 1Y6JA 3L1VA 4PSVA 1VJGA 4PZDA 1WZCA 3IBCA 2XGOA 3QBDA 5AR1A 4G84A 1J0CA 4DCOA 3U7HB 1LI5A 3QV2A 3HXTA 3TW0A 5JMOA 4TS3A 1NBMA 4RWEA 1SOWA 1Q17A 1B0AA 5ABPA 4YT5A 1PJ4A 3MBIA 1DFIA 3P9XA 5FQNA 3PX3A 3TZ6A 3CZ9A 3KB8A 1A9PA 2GSDA 3P52A 3ZNNA 1IWPB 1U3DA 3D7MA 3O8OA 4PINA 1P0PA 3SHWA 2JI9A 3VU9B 2J48A 4A4DA 1BHO1 3ZXIA 3NWOA 2PH1A 4GX1A 5JJKA 1XQXA 3AI1A 3EEIA 3NHBA 1NP7A 3R7NA 3SG0A 4Q3BA 1KTIA 1X94A 3FCXA 2FW8A 4KGVA 4M21A 1XCJA 2H54A 3G88A 4IW3B 4UHFA 3C4VA 5FTWA 3SGLA 2VFAA 4FYWA 1HSZA 1WD5A 5FV7A 4Y1RA 3HBAA 5IAJA 2OYRA 2WT4A 3SHVA 4NPCA 3FMVA 2ZUTA 4AN1A 5GQSA 2J9GA 3GGOA 4PBSA 2IXTA 4ENSA 2EAUA 2YWHA 1JLHA 1KDVA 2IHVA 3T0IA 1FRQA 4MKGA 2PWZA 3V9AA 3ROFA 2HHAA 1JEDA 4YS6A 3A1UA 3QYPA 5E9JA 3KKMA 3STYA 2HMTA 4DPMA 2XWQA 1FU7A 5K09A 3KWJA 1M66A 4AJHA 3NBYC 4FTWA 1U9JA 3GT4A 1WQ3A 5CA1A 3HXOA 1J00A 5CIYA 1A1SA 1DQPA 4N1AA 4IDQA 1YA4A 3CO0S 1JHDA 1NN5A 1UBGA 4HNUA 5LQDA 3L7YA 3PGMA 5FJJA 3QFFA 3K0FA 3P2JA 1HFJA 2A30A 5F7JA 1QM5A 1ZMBA 3KQMA 4ZVRA 1NU6A 1NOIA 2X0JA 3KYCB 3CKKA 1IVYA 2IIQA 3JWPA 4MR9B 4AIIA 3R41A 4KWCA 4MYSA 2KJQA 4DLAA 4BLPA 5K0GA 3SCZA 1Y9JA 2C54A 2JJ2A 1ZKDA 4CMJA 4R2XA 5B55A 1XD2B 3IYLW 1ZONA 4ISCA 2GZ1A 3PIIA 2A84A 4ZTBA 1P4GA 5JC1A 3U48A 1X80B 3MXOA 3O8QA 4QG3A 1C81A 4KMSA 1E9VA 1EK5A 2AJDA 3W2EA 3MWLA 5E6RA 3CEPB 4Q7EA 3UEOA 5ETJA 4MQMA 4QPDA 2LE0A 1YVUA 4I5FA 3LQQA 1QLWA 2RONA 2QN1A 3AR7A 1KVQA 2PH3A 3DKVA 4LQLA 4QQ8A 3GW8A 4YAUA 4ZYLA 3QP9A 2H08A 2RGXA 3KYDB 3U56A 3ZD7A 1IEWA 2GN8A 1V8FA 2OQRA 3DDSA 4P33A 2YRXA 3V4PB 4AN4A 1LNQA 3SIPA 1UR5A 5L7YA 2COUA 1JMVA 4OBEA 4ZK2A 1O3YA 5K7SA 3ZY6A 2D00A 5ULLA 4IZOA 1K0UA 2QZ4A 1O58A 2AX4A 3B1KA 4O4JF 1P4HA 1TTHA 1JU9A 4QBKA 3FNFA 1SAYA 2I71A 3RK4A 3U7EB 8ADHA 3K70C 1ODCA 2CLSA 2E18A 4KPYA 3ZDXB 5IBCA 3CLKA 3W5HA 2DXIA 4X66B 4FGUA 1VPWA 4WEOA 2F64A 3IDFA 3PRYA 3HV0A 3F73A 1L8AA 3VYSB 2IDJA 1D4ZA 1YQEA 3NRBA 1IYZA 2C95A 4Q7MB 1DAPA 4YGYA 2JA2A 4N0DA 3KRTA 2YMQA 3GPIA 4G4IA 4NJEA 4EI2A 5C7IO 1HDOA 3U09A 2WAAA 1ZI9A 3WL4A 4DCJA 3NV9A 1YHNA 2YTZA 4IIYA 1COWD 5C5IA 2R6JA 4PLZA 3FCSB 4QVGA 1V9SA 2Y6VA 5B1YA 1F17A 4OH1A 2VDWA 1EAMA 5FNVB 3OPYB 4ZWNA 1GR0A 5HF6A 3WGKA 4DQLA 1TD1A 3PENA 4RY0A 3JQCA 5EJEA 3BWMA 2V96A 3N0TA 5C51B 4B80A 3T0GA 1OI7A 1GN9A 3RFTA 4IUDS 2ASEA 3AFHA 4I1RA 1LW7A 1ZWLA 1TVKB 3U49A 3TYXA 1H94A 2EX4A 1BDIA 4CM3A 2O8VA 4QPJC 2ZBRA 4B9EA 5BYAA 3L7JA 2DUNA 4DF3A 1XEWY 4OMUA 3P0EA 4P83A 1RIIA 5CDHA 3ZDBA 1M67A 4X1IA 2YJTD 4J9VA 1V0JA 2Z1DA 3QXHA 2H5LA 2VJCA 4Q4JB 1P72A 2O4CA 5LP1A 1RJEA 2YOHA 4O4HF 1T0HB 1QR6A 5CA0F 4Z9BA 2C92A 4G09A 4LTMA 3W5DA 5IRCD 5LSAA 2KBEA 1BXKA 1Z37A 4GZMA 1GIAA 1BJTA 1OJLA 3HYLA 3E22B 4PZYA 1X3LA 4H15A 3BEOA 3T34A 1QC5B 1TJ5A 2ERYA 3WTBA 4IRUB 4B31A 4ZOLB 2HXGA 3O03A 4QUJA 4D43A 3QLEA 2FZWA 3AEUB 4LJ4A 4EY3A 5BRAA 2X8JA 3QEOA 5U1PA 3BFJA 4G25A 1ETUA 1QGYA 1PNTA 5DSTA 5EWJB 1AC5A 3ROXA 3VMFA 4I1PA 4XDZA 4AKIA 1M73E 3WAKA 2AFIB 1ZH2A 3EOBI 4O4IF 5D00A 4CU2A 4HNSA 3F71A 2YUTA 5L3QB 3GARA 1VCNA 1Z5ZA 3CX6A 5AESA 5KS2A 3LFHA 1A8QA 3CLRC 1WV1A 1Y5RA 3QJGA 2NU9A 3VU1A 1UPCA 1GADO 1JXMA 5BUSA 3LBHA 1ZVMA 4NYJQ 1S2OA 4NV0A 5AKLA 5BSVA 2I22A 1JXAA 1E2IA 3QX9A 2W2KA 2EJVA 3CX8A 3D54D 1IZ0A 4LISA 2FR8C 4LXHA 4BP1A 7YASA 4R1TA 2DPMA 2DHRA 4LDRA 2BKVA 1U2ZA 5LQKA 4P92A 4WOKA 4D97A 3WI7A 2WYUA 1B73A 1OU0A 3JY6A 5TS3A 5FL7A 4EFNA 3KQTA 4R8KA 1KP9A 4IS3A 3J80A 2ZXUA 4TYYA 1FUEA 5T4EA 2ONYA 3IP3A 4BMXA 3DYVA 4WZZA 3ZVRA 2GAJA 3REQA 5JAUA 2OXRA 1CFZA 1QANA 3HCBA 1P9WA 4QUHA 5H02A 1EE2A 1XEXA 2ZFUA 1NF3A 1QQTA 2DVMA 3W06A 4RTLA 3RC8A 3DLCA 3SIRA 5MF6A 2Y1DA 3GDOA 1ECPA 5BQPA 3TMAA 3ML1A 3AI7A 4WFIA 2Y1KA 1Y6FA 3EWIA 1EDZA 4BLSA 4CHTA 1UFQA 2FN3A 3AIMA 4NE2A 4F12A 1IL0A 1QO7A 2FWNA 3WYCA 2IWHA 4RTQA 2QTMA 2HJ9A 3WMXA 3V48A 4XXHA 3TQTA 4JJGA 5DYWA 3RYHA 1ZUHA 1QKJA 1PVDA 2PRYA 2FDCA 1WRBA 4R31A 2Z2IA 2F48A 2O1XA 2GAIA 3WJ1A 4IV0A 1US8B 3NC0C 2YJ3A 4CTMA 2VXYA 4KREA 5KYYB 1TUEA 3QPVA 1AT1A 3JQ9C 1P60A 1OGIA 2RJOA 3K0HA 4AYWA 1IULA 3EUFA 5DBOA 2V1XA 1Z17A 1ZM9A 5EKTA 2BCJQ 5A7GA 1GRCA 3HJBA 3WY9A 1YNSA 1M76A 1VLZA 4HYTA 3TN7A 8OHMA 2AC2A 1H8HD 2E87A 2OL4A 3AUFA 2Y1CA 4GUAA 4MB0A 1GZ4A 1P7PA 1GG8A 2NPOA 4HMOA 4HZGA 1UODA 5B6PA 5F1KA 5HP4A 3CFYA 3AEKB 3IEPA 4JVMA 3CKYA 1RADA 1DL5A 1JGTA 3BT7A 4EUKA 3VHXA 1JIUA 1FPQA 1L7VC 1ZI6A 3AHCA 4RU1A 5DK4A 2X7XA 2GYVA 5B1SA 1G2OA 3VX4A 4EATA 3KPWA 5CVDA 3QRWA 4X97A 2EBFX 4NFHA 2TECE 2OD2A 2DBVO 1ZK4A 2RGCA 1DO8A 3AUKA 2ZITA 3EWNA 3UW3A 3I34X 5KSOA 1E0AA 1VKNA 1KO7A 3PQEA 4MQUA 1E6MA 4L16A 3TUJC 3TTWA 1T6NA 1SXJC 2YH2A 3E8MA 4A0FA 5KREA 4KWTA 1UL1X 3EXG2 4CLXA 4ERXA 1BH6A 3W0LB 1USWA 3MRXA 4E51A 2JLZA 3FOAA 3O0DA 5BRJA 4LHXA 3T95A 5C5DA 4G8DA 1IUKA 3TIGA 3UJ8A 5MN4A 2REQA 3PC8C 3QLVA 2PKQP 3C4JA 4M0MA 4KYUA 4QXMA 5BMVF 1WB4A 1A95A 4DHWA 2W9XA 4EG1A 1NV8A 2BEWB 5HK9A 5JD6A 5HCNA 4DRXB 3WYEA 4WZBE 2OBMA 3L93A 3G9TA 1U80A 3FDIA 3QVUA 4R2KA 4ZFNA 2DKFA 5IASA 1IY0A 3I5YA 1SGWA 3ACCA 4RCZA 4AJ9A 1QIFA 2F9FA 2AFIE 2G0AA 4M1YA 2IOFA 2ZB4A 2CZGA 3TLKA 3IUNA 1MBZA 2ONJA 4XH9B 3WL5A 3ZW8A 5C81A 3Q8LA 4ITVA 1HL3A 4QNMA 3FYUA 4HFMA 2FMTA 3OBIA 5IKEA 1QQAA 1H9BA 2G28A 1IMJA 4KN6A 5F76A 1CUHA 2FMIA 4PZUA 1YACA 2G7ZA 3K1AB 3M6XA 5KYVA 4R2WA 3LWBA 4LIPD 1G9XA 1KMIY 4KCGA 2DR2A 3ESDA 2C3YA 3G0DA 5K8VA 2JK0A 1E96A 2PSDA 4RACA 4WXHA 3TTXA 3OZAA 1O03A 2PS9A 5GONB 1DI0A 3UOAB 3UK7A 4R0VA 3WGIA 3QKRB 4JEHA 3GV0A 3DTTA 3HMKA 3HCWA 4MB6A 4XB2A 2HHHB 4ZCQA 1HLGA 1SUCA 3NVAA 1F5NA 2ZPTX 1UPXA 1RYZA 4E31A 4NH4A 2WINI 3H5RA 3FNQA 4RF4A 1C9DB 4QUAA 2GWRA 1VB3A 1OAAA 1PZFA 4YJ3F 5FOWA 2PZAA 1WSAA 4KRFA 4O25A 4A23A 2AMJA 4JI5B 3X1KA 2ONCA 1EUDB 1ESZA 1RJGA 1YDWA 1PF7E 4BQQA 3O84A 3RKRA 3F6PA 3H6GA 4N4AA 3QVKA 1DELA 1ULHA 3BXXA 4J7UA 4Q12A 4WOBA 5JPIA 4BJHB 4D3SA 2YW9A 4KP7A 1TYCA 1BOFA 2OZKA 4GI5A 4IV8A 2O0JA 3EASA 4JQZA 5CPBA 5CG2A 5ADVA 3VKFA 2KSQA 5AVWA 5GIOE 3CNQS 2FN4A 3F3MA 4JBLA 4PS0A 5TF0A 5AJVB 5FTLA 1NYLA 2VDKB 1P9OA 3LD9A 4AMBA 3IDQA 1V3QE 4H0NA 1M6WA 2F6RA 1I51A 2I4IA 2J3KA 2O14A 2BFDB 1C41A 2DHEA 4FZ5A 4GMGA 4N8EA 1C1DA 5F21A 2JLAA 3UCXA 1TLLA 2OM2A 4BO0A 5JPDA 2PVSA 4HCJA 2NUPA 5CVJA 3WLTA 1OIVA 4JEIA 3QEKA 1U4OA 2FSHA 3M1AA 4IQ4A 2OFPA 3V00A 1NMEA 5LQMA 3SDZA 4PQGA 4RZXA 3SPXA 2W8BA 4II2A 5K3FB 5KOJA 2C5FA 4ZVLA 4RGQA 1LQUA 1X2EA 5ALNA 2BUCA 3TLJA 1SPBS 3KHUA 3A9WA 4RHTA 1FTQA 1U2PA 4DVJA 4QDJA 5AO9A 5SY6A 2P0AA 2QG6A 2VIIA 5K3SA 3ZXXA 1JLSA 1UBOS 3ISJA 4CTNA 4HG2A 1AMOA 2ZT6A 1U7DA 3H65A 3BE5A 5CB4F 4MZXA 2EFYA 3A3OA 4JUBA 1U2DA 3DMGA 2ZRAA 3KT0A 3UMBA 2V7QD 1EUQA 2R11A 4CQMB 2GHRA 4A7PA 4POOA 1BE0A 2L0XA 1XKTA 2C8VA 3ABIA 2ZBDA 1A2OA 3Q9LA 1Z0KA 4GE0A 5FBHA 2CBXA 3CTMA 3ECCA 5AJYA 4AY4A 4F1KA 3DMHA 5P21A 5K2OA 1WBDA 4OK5A 4TV8F 3D0RA 4HWRA 3GFBA 4A91A 1AQIA 3HB5X 2QVBA 3FDJA 1KI7A 3LHFA 4N7BA 4XCQA 5CLIA 3ZKWA 4FMBB 2CJYA 4Q9HA 2BGWA 2IEGA 4JXZA 1AUQA 4PW0A 4AULA 1E99A 5KOHB 4DWOA 2JGIA 2HPAA 1S89A 2ADMA 4NAUA 1OLSB 4O3FA 1UXOA 3B70A 3VR4A 4D25A 1VZ3A 4G6ZA 1QQ6A 3K32A 4BBJA 3IE2A 3O3OB 4DWWA 3NASA 4YREA 3AJ8A 2ZZNA 2YMMA 1V8BA 4CEHB 4PNEA 1A9OA 1QYCA 2ZREA 3KPYA 2A59A 2ZS9A 1ISGA 5F2OA 4DBVO 2A1IA 1UDBA 1U2GC 5HGJA 2ZB8A 1DC7A 4K88A 4AG3A 1PGJA 1ZIYA 1KH1A 3LUPA 3GLIA 3EY9A 1SC3A 2BDUA 1AUPA 4EG3A 2ZJYA 5KYKA 1G98A 2DPHA 4FGKA 4IFTA 1RTTA 2OV6A 1OE0A 2HDWA 2XF2A 4QUKA 2CMFA 3O8OB 2EKLA 1I0IA 1U9IA 2OLKA 3U0VA 2BKUA 1UAYA 2HH9A 1H6AA 2OR3A 4Y2RA 4AI6A 4NDNE 4P82A 3RS3A 4HEA6 4GKKB 1Z15A 2X8AA 3PGLA 5HKAA 2K7FA 1L4MA 2G6BA 4NF2A 1MCZA 2PZKA 4M86A 2IXFA 1T5TA 3LS2A 5H16A 2XUZA 3FXAA 3PLNA 4Y1RB 5DI3A 4MQFB 4GX5A 1TB4A 2IYAA 3CHYA 4P08A 2CLKB 2J41A 1NG1A 3H42B 2A0XA 5KVVA 4G37A 1IBRA 1ONNA 4WLOA 3H7IA 3RV3A 4ZJPA 4AJIA 2W58A 2J5KA 1DHTA 1A0OA 1NXWA 1UH5A 2OHIA 2JLSA 3OETA 3KQHA 4Q82A 5A06A 3DS8A 1Z18A 3GNSA 3AL2A 3BWCA 3HA2A 4H3SA 4RYLA 3H2IA 2PX5A 4URVR 3T1YB 3SYRA 3CZQA 5KC8A 3LXXA 4NABA 1RLOA 4QQNA 4BDTA 1J90A 1EU1A 3JQ8B 5DHRA 5CA1B 2WJYA 1SUWA 1TUBA 3OE7D 4L9SA 1VHJA 5E4TA 1FOEB 4Y0AA 4B8YA 4DV7B 2QOEA 4KPGA 1EX6A 1QU3A 4DQKA 3NOOA 1M3SA 4AJLA 3B2EA 4UVDA 3K0FB 4I1UA 4ERNA 1QS0A 4BMYA 2BZSA 1IE3A 4TYQA 3SU8A 3P4YA 1QU2A 1JSRA 1RYNA 2B69A 1GG5A 1W7AA 2GCOA 4FWTA 2GBGA 2I6XA 4QOJA 2JFZA 4HFRA 2YX1A 4QQRA 3I0ZA 1O95C 4FGLA 2FPIA 4M1OA 4PCLA 3V55A 1U2TA 2QA5A 3KPVA 4OL0A 2IT1A 4QU0A 3STWA 3RWBA 4DY4A 2W90A 4M53A 3CR8A 1NV9A 1EUCA 4R69A 3ESXA 5E6RB 2IS2A 3RVOA 1ZH4A 3FUUA 1UDAA 2JGFA 3AJDA 4P54A 3V1YA 1XFAA 3WHPA 1EXMA 3OTHA 4ON9A 1H2YA 3B9BA 1GLGA 1E2UA 2I54A 4FB5A 1YTUA 4FQ7A 1G6KA 4JLVA 5DM2A 3WRYC 1BFKA 4EL5A 1AK1A 2ZWPA 3DF9A 4W5OA 4BC1A 2C78A 1KNQA 1L6IA 1XCGB 1FXWF 2NU7A 2J09A 4J1TA 1VHWA 4P5PA 5TARA 3G9QA 2WZCA 4BYMA 2PD6A 3QYFA 1BA2A 1HEUA 2J87A 3KL2A 1QKIA 4FT4A 3VAZA 3IUJA 1KRHA 4HYYA 4LDJA 1UZLA 5J2UA 1UF9A 1XWIA 2ATEA 4B71A 2PUBA 2NTYC 2KWIA 1QP7A 1NI4A 5JNWA 2ZVQX 2A67A 2CNWA 2HNAA 2YQ5A 3MM4A 4G1MB 1KYZA 1PZMA 1XMPA 2HTEA 5EIOA 1I4DD 4YHHB 4S35A 4Q3NA 4TV9F 1TGYA 1VKJA 1FEZA 5AJHA 3U4MA 3LYLA 4LYFA 3DE4X 4NJEB 4DCUA 5E4JA 3P45A 2PO5A 3HJHA 3JQAA 1A2BA 1LVGA 1T9HA 3CUTA 1QOQB 1SUPA 3H8VA 4D9MA 3RUFA 3TEJA 3FYTA 4IH1A 3LX4A 5B36A 3ZS9A 4HH1A 4UBOA 2BCGY 3UJNA 1XNHA 2VDWB 3ER8A 3HHEA 5IMBA 3DULA 5ERXA 4FHCA 4BNDB 4X65B 3H5TA 4NYMQ 1YQGA 5AI8A 3FBGA 5CFLA 1NDQA 3WWEA 3SOZA 1OHHD 1H93A 4MR8B 4H7DA 1TF7A 3IP5A 1RVV1 3IPXA 3TQFA 3WMWA 3EZXA 2FX5A 4ER6A 2QUHA 1YR8A 5DXAA 4MIKA 5A03A 1UAAA 3RVDA 4LJ5A 5CXXA 3BULA 4D0RA 1RDFA 2VHCA 3QYJA 1SZJG 1RXVA 1THTA 1NFFA 3DZIA 1YI1A 2DZDA 4JHXA 4U7JA 5FYQA 1P33A 5LB2A 4RHCA 4CRWB 2SBTA 4CR8A 5JCPA 1GZSA 3A8TA 3E15A 4N49A 5EE3A 4YT8A 4UNRA 3OKFA 1F8UA 2DWCA 4HUTA 2HRRA 2H3EA 1KZ7B 4NZPA 2ZT7A 3EA5A 2YV5A 3I76A 3OKAA 4LF5B 1KY4A 3U26A 4RS4A 2FEOA 1I2BA 5K6TA 1T9ZA 1IY9A 1U8FO 3GO4A 2AXNA 3G5UA 4O4LF 2ABWA 1PJBA 1HZJA 3LPMA 3QPAA 4G4GA 5BSUA 3KKPA 5IABA 1I1HA 1V7ZA 4IFEA 4B3IA 4M54A 3PWSA 2O8BA 3VKGA 1P80A 1WE2A 4UMFA 4E5YA 3F9RA 4OO3A 2P3QA 3T5GA 3F8SA 3F8TA 4RY2A 2WMOB 1YDEA 2X8JB 2AHOA 4TTVA 5HS6A 1AKNA 5T4FA 5KZMB 2VAVA 1AS3A 1WVGA 3KR2A 3CVWA 1NTRA 1XMSA 1V48A 1OFIA 1DQNA 4NNPA 2Q2NA 4U7HA 1GARA 1RI5A 1CDOA 1BN6A 4ZMSA 2CMHA 3C3KA 1FFEA 4FP9A 5LN1A 1JR6A 2PA0A 2BR3A 4I0WB 2NU9B 2Y1WA 1FSPA 4R9NA 5AI5A 4LC1A 3T5CA 3PPYA 5REQB 2W2KB 1MAVA 3KJQA 3HSKA 4R8LA 4BMDA 5J47A 3BMQA 2AXPA 1UUFA 2EBWA 5T6MA 2L19A 5C3UA 4BV8A 3AHEA 3GVXA 1TFUA 4QBIA 4EUEA 1GRQA 2GPAA 3WL8A 2W6ID 2D7DA 4EG0A 3WDMA 2GXSA 3JSXA 2JHGA 4HR7A 3REQB 4BUJA 1G4UR 4J4TA 1QX3A 4EA9A 4QQKA 3SVTA 1XEXB 5JEDA 4O4JA 4N5DA 3UBTA 1GGKA 4A1OA 3OLCX 1TOAA 2PR7A 3WL6A 3SOPA 4BVLA 3V2GA 4LVCA 3OX2A 1MX5A 4IIBA 5JYEA 1KS2A 2CLIB 3WLAA 4QGGA 1IHOA 2PV0A 2V5UA 3AL0C 4LYJA 2QJFA 5JS6A 3MT9A 4PG4A 2AW5A 3HBFA 3EK2A 4RHEA 3RHSA 3WP0A 5JXGA 4C0KA 4WKPA 2QN3A 3ZW9A 5JISA 2LUOA 3RYHB 2C58A 5JI3E 3BCRA 2B3TA 1NN0A 2G8LA 1KEKA 2EATA 1GU0A 3JR7A 2CKDA 2IL1A 5DTMA 4Z0HO 4B5KA 1W19A 4DV6B 2P1ZA 2QR5A 1CSEE 2DUUA 2NP7A 5B2EA 1ZGJA 4FT2A 3VH4A 1ONBA 3B9PA 2OZPA 4M9SA 3AERA 1QGDA 1QFSA 3BAZA 3ZHOA 2R6CA 4HGOA 4DXDA 4ETIA 2OM6A 1BAPA 1TC2A 3GGDA 4IPTA 4X54A 4FSXA 1J39A 3B7WA 3Q3JB 4R3NA 1L7AA 5YASA 5CCEA 5KKCA 1J06A 3GEBA 5LNK1 1N2CE 5MFPA 3NAGA 3FHTA 1BMDA 5TQ0A 1RTKA 3E9QA 4G85A 5AVTA 1RI3A 4AAYA 1G3UA 3RWMB 2X23A 2XD9A 3L02A 3PV0A 3PUYA 4NEHB 3UAOA 4BDSA 3D0QA 2V59A 1FBTA 2O6LA 1DZ3A 4E30A 4YRGA 1WU7A 1P6XA 4X93A 1G8JA 3VHXB 2JHFA 1ZCJA 2QVZX 1BEEA 3QVGB 3B53X 4HZIA 4MLDA 5HMMA 5ALZA 4HWOA 3U4AA 1JSZA 2DJIA 4JR1A 1CJBA 1XVAA 3OCCA 2PNJA 2J9FB 3GWZA 1Y7LA 4C7JA 4DS3A 4AZWA 3DWIA 2EEZA 1FXUA 1K4MA 2JGDA 2Q9CA 3AR3A 4R7GA 5B3JC 1X70A 3IAEA 2PRZA 2QZ9A 3D6VA 4I66A 1MJGA 4K05A 4E5UA 4J1SA 1UANA 3I58A 3M4XA 4RXUA 1EFVA 4DG5A 4YMUA 1SEPA 1PHPA 4O4HA 5CA0A 4UPVA 1DDOA 2XQFA 4PSCA 3RANA 1UC9A 2PH7A 2XDWA 2QN9A 3DT9A 4QNNA 1CP3A 4F11A 4C0BA 1XZJA 3ZCTA 2GBLC 4MS1A 4ZRDA 2QU7A 2REQB 1ODKA 4M0UA 1NQOA 3IP7A 3AQ4A 4IO1A 3RE1A 3WRXC 3GX1A 4RLHA 2AWOA 4Z51A 3JW8A 3LCMA 1YZGA 3AIKA 1JHQA 3A9TA 1DIOB 3B1XA 1NBOA 1NQXA 4ALIA 2PGDA 4DIBA 2WVHA 3G2MA 4XEHA 4ESOA 1RLTA 1QZUA 2C9MA 2D59A 4O4IA 3DHVA 3NRJA 3JQGA 3VPHA 1J8QA 1UBSB 1VYHA 2Q4TA 5AW4A 2WF7A 4CF3A 5IULC 1HRKA 3FZGA 4MR7A 4HH3C 5AIAA 2OXIA 3FYUB 1FTYA 2WHQA 5K99A 2EF1A 2BTEA 3E9EA 1RYEA 2QRZA 2H4XA 3L0SA 4EHIA 5KAPA 4F96A 2CT8A 4YV2A 4IVQA 2MHCA 4AQYB 2C5BA 1I2CA 1U0FA 2HMWA 3P9QA 3UF0A 3EZFA 2FF7A 4I5GA 4QHYA 4JSRA 4I3GA 5FFMA 1YKGA 3TUIC 4W1RA 2JLCA 2R8PA 3CUVA 4L0QA 1OTXA 1ISIA 2VQSA 4X63A 2WKSA 4JU9A 4Y6PA 4TZTA 2G1AA 3DFKA 2XXJA 4NBRA 3NI2A 1V7QA 4B3TB 4QFBA 4BY9E 1OLXA 1JXOA 2DFDA 4E2ZA 3BDVA 4LJLA 5EVCA 5HKLA 4AS1A 2Q27A 3NDBB 4RE6A 3E9RA 3MERA 2IYSA 3UYLA 4OGLA 3BHNA 1OW3B 1P2DA 1ZXXA 3IAS1 3PJDA 2OORC 4MVXA 4Y9RA 4DLXA 5DOVA 4ZAFA 4MJXA 3AH8A 3G1TA 1TMKA 2VPWA 1ZESA 1WCXA 1ODFA 3K2IA 3WKBA 4TKVA 3RHZA 4CUKA 2WSSA 3A32A 1L5VA 3COPA 3QPCA 4JN6B 1KOLA 2PKXA 3K20A 4GLJA 3M82A 5TPWA 2AK2A 3UTDA 4F2HA 1FW6A 3FSGD 3DFUA 1F60A 1U6JA 1SVNA 5CUQA 4KQ1A 1PNRA 1V2HE 3UPDA 2D0OB 4MH0R 1FF9A 3UCFA 5B58T 4MULA 2CK3A 2QRQA 3ZZTA 2VJPA 1FP7A 1I9GA 3ZVLA 4BRSA 4OBXA 5LR6A 3HYNA 2J67A 1C1DB 2GCGA 3B2QA 1B43A 1QP8A 1NUAA 3MINA 4G9GA 4J3JA 1J0DA 1WNFA 4Z0PA 1XTPA 3B5JA 4G4SP 4U63A 2Q3BA 4KXFB 4DV0B 2XCRB 3HY3A 4EX7A 2NUPB 4JBNA 4UE6A 4E1AA 5K3OA 3IVXA 1RZ3A 4P58A 3U9LA 4KSBA 1YBVA 1JEQB 3V6LA 1F38A 1Q83A 3IO5A 5DKFA 4D99A 5ICMA 1GNLA 3PD1A 2FEPA 4G5YA 3I6YA 4GG1A 3EFBA 5T3YA 3ZLUA 3TRDA 3DWGA 1CR0A 1Z0FA 3OZTA 4H77A 2WSYB 3DGEC 1NC3A 4HFNA 5J5AA 4DC1A 5FR1A 4C2TA 4L4ZA 4BAUA 3RJ5A 3QELA 2OG1A 4KR7A 1Z36A 5I7UA 2Y1FA 5KQRA 5FF9A 1YJ5A 3TRIA 3M5CA 4FEYA 3QQPA 2Z04A 1FS6A 1EBUA 1V11A 3DOJA 3AC0A 4F46A 1X9HA 4NHOA 3S2IA 4HJXA 1RC1A 4IL5A 2CV2A 2XB9A 4UEJA 5A71A 2BGJA 3AY7A 2C3PA 4A5SA 3UJ6A 2O7QA 4AP9A 4U7FA 1I5RA 4S2UA 1I6MA 1XRLA 1ZITA 4HP8A 3NRCA 3V42A 1M8JA 2YRWA 4MK4A 4ZVNA 4DNOA 3DXXA 3KDSE 4ZYUA 4TKUB 2XAUA 4ZPJA 3ZKWB 1MFZA 1CF9A 3V7FA 4ZVOA 4S1WA 4KR9A 3IBSA 5BMVA 5D3MA 3TLXA 1BA3A 2R8RA 1W76A 3HA5A 1D09A 3KS9A 1G4AE 4MP6A 2Q4EA 4YDQA 2KMLA 3IEUA 4L7VA 4EHJA 5TGDA 1PEAA 3DTVD 3KWFA 2H4YA 2I80A 3HU3A 3QVWA 4P9NA 1ZFNA 4IP0A 4RHUA 4YXWA 1ZC4A 2XMDA 5CHYA 2QR3A 2QVXX 2WV7A 4IOKA 4AJKA 3VSCA 1FUIA 4JLWA 1HH4A 1WCIA 4I3FA 3ZZ1A 2A5LA 2V5VA 3WLJA 2QZSA 1XCMA 1KYIA 4CDRA 1E77A 4NWIA 3EIFA 1WUKS 5GGYA 2XUJA 3UW1A 3GLIB 3VZCA 1TO6A 4KO2S 1AGXA 2LV8A 3F7NA 4D9FA 1OXVA 3L8MA 3QLUC 1YDMA 5HVNA 3WK6A 3QWIA 5C37A 2OAEA 4PSAA 4ALMA 3MMPA 3RVNA 3I0MA 4DUGA 1ZXBA 2CXRA 1Z4OA 1SU8A 1SO8A 4GPIB 3GNTA 3NHYA 2OBYA 1W4LA 1NDHA 2C5SA 4NJOA 5HBGA 1QV6A 1SPXA 1ZH6A 2ZS8A 3LW7A 4LFAB 1RRCA 3SJUA 2EOAA 3GFRA 5DI3B 2IU6A 4AXBA 2QJTA 4CV0A 1TZJA 3B5EA 4UNQA 3PXCX 3OFJA 3OZVA 4X3PA 3MWEA 1VCOA 4Y2SA 2P2SA 3KVOA 1OX4A 2GDJA 3OLQA 4R0NA 1GPDG 4L4XA 4YJ3A 4KFTA 1EVJA 2QD1A 4BGVA 5DZSA 4ZAVA 2R48A 3NM4A 4DLTA 4ER7A 3F47A 5HJ7A 1K8ZB 3N3AC 4Y30A 3DLAA 1MXHA 2FEKA 2LCFA 3I3OA 3QKSB 4F6CA 2G36A 4NU8X 5FDFA 3N0VA 3UMGA 5FLEX 3O38A 4IF6A 1TUBB 2EIXA 4P4NA 1CLEA 2XITA 3TX2A 1W59A 5LUAA 2CBZA 3P9KA 4OHFA 2I4MA 1TE2A 3BXOA 3R0XA 4JP1A 3FPKA 2DFPA 1CY2A 4LVUA 5AJWA 5LQAA 2E9SA 3WDKA 5J43A 4JC4A 4OF4A 1KQPA 3DE6X 3L92A 4BO5A 2GCOB 1D6JA 3ZE8A 5H70A 2JI6A 2MTBA 3COZA 1WL8A 2GPYA 3DCJA 3M4YA 2VSOA 1LDEA 4PNPA 2FPIB 3KG2A 2QM8A 2VWHA 4QPCA 4BN0A 5JROA 5L9AA 2VT3A 1KZHA 2C29D 1V16A 3FNEA 3VU0A 2VZEA 4OFWA 4GXQA 4RIFA 1CTQA 1EUCB 2PNFA 4I50F 4ALKA 1KJJA 2AQKA 4KACA 1E3EA 1S96A 4XKJA 4FYMA 3GT0A 1HYEA 2CC2A 3EPJA 2LD4A 4IRMA 4UTRA 2CGEA 3JWHA 2Z5LA 2IZ0A 5T64A 4AZSA 4H3KB 1XXLA 3K73O 4LWQA 5LU9A 5CB4A 2VZ8A 1ZL0A 2ZRCA 2NU7B 4QKQA 4LJ6A 5JAMA 5SV2A 4K6CA 1CD5A 1K7XB 2V3VA 2IS6A 1EX7A 1NP6A 1N7HA 3ZHTA 3N07A 3L1UA 5FYDA 4YXFA 1SVKA 2W6ZA 3HZHA 1W85A 1IEQA 3LKVA 1QHIA 3QX7A 5J2UB 2YV2A 3C39A 5BNIA 3TOCA 5J4YA 3U19A 4EUNA 1FLNA 3EH2A 2DY1A 1BXRA 1GKKA 1NQ5A 4TV8A 1NI4B 1WMAA 4NECA 5EIWA 4CLDA 2CXSA 1HLFA 2ZWOA 4LAFA 1PJ2A 2YMLA 2YVKA 2RCYA 3RPEA 1IJKA 2L2QA 2VK1A 3ZOZA 1XZPA 3LLVA 4B8WA 1GAJA 4EHHA 2XB2A 1XTUA 4GEGA 4XE5A 5J1TB 3UAZA 1FY2A 3NW9A 4OIFA 2HX1A 5CH3A 5T41A 2CFTA 3EUWA 3MRSA 1GQOA 1UBUS 4YRFA 1ZKMA 4EJ6A 3JQAB 4DSAA 1NMXA 1QIHA 4U00A 2HA7A 1CZRA 3F7MA 2XUAA 4MWEA 2BGGA 1IXYA 1L7DA 3H3XA 1ZJYA 4KMRA 4P38A 1R50A 3FW1A 4PO3X 3NTQA 1Z47A 2J59A 4NCXA 3ILYA 3R7FA 1ZD8A 2ZSEA 3OLVA 5A3SA 3SIXA 1RYBA 1YJXA 3MUFA 4IVPA 5BURA 5LDDC 2I29A 3NHKA 2X22A 5CLGA 4B34A 1AO0A 3ZDFA 3CF0A 1KAOA 4ECEA 5L45A 3CZCA 3MSCA 4Y0NA 1Z2DA 4DDWA 2G1PA 2XOXA 4MRNA 5EXDA 3FF1A 1QAQA 1ZVJA 5AUOB 4ZOQI 2O7RA 3K31A 2AR7A 1CETA 3BCHA 2QAJA 1KYVA 4IJKA 3UH1A 2FV8A 5A9RA 1XNQB 1GL6A 3IGFA 1MOPA 3KUKA 1CS0A 2G9QA 3UUEA 5CBPA 4BFSA 4XCVA 2PIAA 2BZ0A 3DL7A 4JLSA 1B8OA 2GM5A 2XUIA 4CL2A 1FFAA 5JEEA 3IRVA 4N03A 4TLCA 1CDDA 1ZZEA 4QICA 3P4UA 3VX3A 4BVAA 3HBJA 2PSEA 1Z63A 2NTNA 5IBPA 3LJKA 3N7UA 4LE0A 2FWIA 3NKFA 3OT1A 3HM2A 1Y9ZA 5AHWA 4FR0A 3RC9A 3H84A 3RRBA 10MHA 2C5LA 4ZREA 3RT9A 1P0QA 1PR3A 1K0FA 2OCGA 4ARCA 2Q1WA 3T9AA 3HB7A 1E3IA 3TM4A 3D4IA 1E20A 3P2OA 4LE1A 4D9JA 2O8BB 1S0UA 4QRDA 3FFXA 3CUYA 3W8EA 1SC6A 2LIPA 2E4YA 4TWBA 3UGTA 2Q1UA 1P1IA 2BMAA 3BA6A 5HNKA 1JLRA 1I01A 3FUTA 2PZJA 3C3WA 3KXIA 1AQNA 1UBFA 4M6WA 2ZRNA 5BWLA 2EZUA 2JCYA 13PKA 3ZBUA 4GMDA 3SVLA 2PWBA 1L5QA 2HTFA 2MYPA 3WQSB 2R1ZA 4JZYA 1VLMA 3VRHA 1YK0A 4DMLA 3PCXA 3U2QA 2Z57A 2WEKA 5CX1A 3WLPA 3THSA 2ZAGA 4YO8A 3L6DA 3E9NA 4KKVA 3M6VA 4MYHA 5LOVF 1NULA 2XE4A 5HX7A 2NNLD 5C7OO 4Z7QB 3K8OE 3ONDA 5IVDA 1JEEA 1OFTA 3ZWAA 1XEFA 4AUEA 4CGYA 3QLVC 5KNBD 3FHCB 4WK6A 1EX9A 3DSRA 2FE4A 1TYZA 3ETDA 1PEYA 2HFKA 5B2ZA 3GCZA 4C9BA 1L4BA 1JLMA 1FXWA 1J56A 4GQIA 2UXBB 3AVUA 5B1EA 4U39A 2GMWA 3ZKAA 3FOBA 4OP2A 3RSOA 1ONPA 3R4CA 4TTQA 4OBBA 4I1YA 2ORED 1R5BA 1SVUA 4UQOA 2GSWA 1Q5PA 2NZXA 3EXAA 2IPOA 2P2YA 4HTAA 4PVCA 3GJ5A 1TVMA 5IKXA 4MKRA 3WK4A 1SCQA 2P4UA 4D3YA 3TFOA 1RCFA 4FD3A 4B33A 2QG4A 4I5DA 3ZDEA 1S4MA 4TV9A 4UXJA 2C5EA 4XQ0A 1IXZA 3M4JA 5AXBA 2F9MA 1ESNA 1Q1ZA 2A9OA 2HLHA 2Y77A 4IEIA 3AF1A 4UPEA 3E05A 3H1TA 4ZAZA 2ZSDA 1X3SA 2VJAA 3H6HA 4L8GA 3NT2A 3AVYA 1I2ZA 3RLFA 3EC7A 3I8SA 4CTKA 4KDEA 4RJTA 1ZINA 1V3UA 3OKCA 3OZIA 4URYR 3RBVA 3AERB 2ZQYA 2EERA 3EB9A 2JFOA 3DL4A 3PNVA 3QVXA 4D80A 1AZSC 1IHDA 2C4MA 2H7CA 3BWBA 4V0QA 5AKJA 2Q1SA 4DHEA 1X1SA 2EZ4A 2XQIA 3CX7A 4MNTA 3P9RA 4MW5A 4MHSA 1PQ4A 1VE5A 3KU1A 4BCBA 4PYJA 5TQ0B 1UPFA 2HK9A 2WHPA 1LS1A 3N70A 1LS6A 4NYIR 1J07A 3PJGA 4QOSA 1DCKA 4OFBA 5DBFA 1ZLXA 4Y67A 4DJDC 2C59A 5TY0A 1J09A 1JI0A 1LVHA 2QX9A 1L7MA 2TSYB 2UUPA 2UYYA 2VPZA 4FGZA 4ZVQA 4FS3A 1OX6A 3D6NB 3ZDZB 4II3A 2GZHA 3MELA 1BJKA 4K6FA 3T9FA 5FBRB 5AXCA 1NW4A 2FZCA 1N5KA 2C9YA 3E81A 3CZMA 3GWGA 2JGDB 3DWEX 3RKSA 1EWTA 3UO8B 3QF4B 2O8FA 2RGEA