4IS3A

Crystal structure of a 3alpha-hydroxysteroid dehydrogenase (baia2) associated with secondary bile acid synthesis from clostridium scindens vpi12708 in complex with a putative nad(+)-oh- adduct at 2.0 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
249
Chain Sequence
MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a 3alpha-hydroxysteroid dehydrogenase (BaiA2) associated with secondary bile acid synthesis from Clostridium scindens VPI12708 in complex with a putative NAD(+)-OH- adduct at 2.0 A resolution
rcsb
source organism Clostridium scindens
molecule tags Oxidoreductase
molecule keywords Bile acid 3-alpha hydroxysteroid dehydrogenase
total genus 82
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.395: 3-alpha-hydroxybile acid CoA 3-dehydrogenase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4is3A00
2FY8A 3SX2A 1WDKA 3S55A 4XZ3A 3GG2A 4ZQFA 4IQ8A 3H5RA 1D4FA 4WLNA 1AUPA 3ZI0A 3TZHA 1WNTA 4DXHA 3EHEA 3EW7A 2I3AA 5JO0A 1KEPA 4UUNA 1N8KA 1C1XB 3WLEA 5AXCA 4L0QA 4OMUA 3ONEA 2R2GA 1W6UA 2I99A 4L8VA 1G1AA 2JHGA 5F3RA 3DAFA 1PS9A 3BYZA 2X6TA 1MGOA 1GPJA 4B3IA 1Q7BA 4XYLA 2CDAA 2CD9A 1R4NA 3GUCA 3VVBA 3U4HA 3OECA 1YO6A 3DMTA 2CF6A 4IJVA 4DC0A 1VRWA 2PKRA 2HCTA 4PLWA 3BA1A 2FN7A 3VTFA 2VT3A 2P9CA 4AVYA 2PTGA 4U5QA 3HDQA 2EIHA 2EF1A 3JSAA 4YRAA 3UCFA 5CEJA 2VHXA 2JFGA 4FPXA 2E49A 5ER9A 3MOGA 4HNHA 2VZ0A 3ADOA 4L73A 3DTTA 1ZK2A 2EW2A 3I23A 3P2OA 2AXQA 1LI4A 2DLDA 3WJAA 7MDHA 2D0IA 4IQGA 1YB5A 4YAKA 4NG5A 1J5PA 2EGGA 4K6CA 3WICA 1UZNA 3D4NA 3K73O 1HDRA 3Q1LA 1PX0A 4U0JA 2OXIA 1E3WB 3TWOA 4YRDA 2C59A 3NEPX 4YJFA 4CLRA 1R0KA 4N7RA 1Y8QB 3QIVA 1K3TA 3ZU4A 1DC4A 3PJEA 3PZBA 4UVIA 4Q3CA 5BNFA 3TJRA 4Y6PA 2O2SA 4EUEA 1HSOA 5JAIA 1F8FA 1ENZA 4WLUA 2B83A 4DQVA 4LSWA 3NDIA 1PJ3A 5JCJA 1E7QA 4NK4A 2CSUA 1YBVA 5KTKA 2BGMA 2HAEA 4CLEA 4CQMA 4YT8A 1YOVA 1QG6A 5G4KA 4D43A 5MGBA 3WMWA 3RIHA 1HZJA 4IDBA 2X5JO 2WE7A 3JD0A 4RPLA 2GCGA 2JCVA 3E8XA 4YACA 1GFSA 3OMLA 4A73A 1UUFA 1BMDA 2ZB4A 4WKGA 1TI7A 1PU2A 1O6ZA 1QYWA 2W8ZA 4DPMA 2WM3A 2WMDA 1YBAA 5CAEA 1I24A 3R6DA 2W2KA 3PPIA 2V6BA 3JQBC 1E0DA 4OGWA 5EERA 3VC7A 4YT2A 5HS4A 4LCJA 1GEGA 5L4LA 2HQ1A 3GNSA 4JP2A 2Q2WA 5ILOA 5TF4A 4BKOA 3MJEA 4CLOB 5ICSA 1PWZA 1QSGA 1PGNA 4UVDA 4OJNA 5K6AC 1QYCA 4XJSA 3RBXA 1NFFA 1YS4A 4MVJM 3C85A 3GPIA 5LC1A 2Z1MA 5H81A 2H5LA 3JD4A 3OSUA 4YAIA 5KVSA 5EESA 5EQDA 2FSVA 4BO9A 1YH3A 1Z82A 3EUWA 3L4BC 2FSSA 4RVGA 2HO5A 3UGKA 4BO0A 3I5MA 4XGIA 1ZUD1 2WDZA 4XCVA 5IXSA 2J5RA 3DONA 3PZRA 5A06A 3DTYA 3GY0A 1DIRA 2V7PA 4KMSA 2BH9A 1P77A 1RM5A 4C7KA 3TZKA 4CM9D 2J5KA 4BGUA 1NXQA 1PWXA 2GN4A 2QRJA 3KRTA 3KUXA 1JVSA 1CIVA 3DQPA 3WGZA 3JTMA 1NX6A 2QW8A 5TS3A 2Y93A 4AJ4A 1RM4A 1BSVA 3WYCA 3ZHBA 3PTZA 1D1TA 4GL4A 2J3HA 4J1TA 2BFMA 1SEVA 4J7XA 1VL8A 1LQUA 2D5CA 2HMUA 4F6CA 1MUUA 5JFOA 2GZ1A 2ZTVA 5JCXA 1H2BA 2CMDA 3PHIA 1PR9A 1BW9B 3S2IA 5EJ2A 4ZU3A 3VOSA 1YB4A 1SB8A 1BXGA 3C7DB 4TQGA 5DCYA 3TOZA 3QP9A 4EUHA 4IMRA 3DO5A 4J9VA 2IYOA 1EDZA 3LVFO 4D79A 2JAHA 1LEHA 1K5HA 1KS9A 1Y8RB 4O0LA 4OYRA 4YXFA 1KVRA 1HLDA 3I9JA 1R4MA 1PJTA 5IG2A 3RD5A 4IGEA 1Q0HA 4ZRNA 2EP5A 5HWSA 4ALJA 1A71A 3BAZA 2C07A 2P2SA 1CYDA 1GYRA 3R0IA 3OIDA 2QG4A 4D46A 2BGLA 2FR8A 1U5AA 4QT0A 5TQVA 3OJLA 2C2XA 5IF3A 3RKRA 2YV2A 3B1JA 1X15A 2J3JA 5C5IA 1TXGA 1BXKA 4UUPA 1QYVA 3RJ5A 5MDHA 1C0LA 1JAYA 2D1YA 3HZZA 2RCYA 5KCZA 4RCVA 1YOVB 1Z45A 2VYVD 3A4VA 4Q3BA 4N54A 2X23A 2BFOA 4N18A 5F1OA 1M66A 1ZIDA 5A9SB 4JCOA 1ONPA 3DZIA 3ETEA 4AJPA 5JYEA 2QZ9A 3EVNA 2CVZA 5LDGA 2I76A 4DQXA 3EGOA 4B79A 2R00C 2B4TO 1WVGA 2X7HA 3JQ6A 4P4LA 3RC2A 3SC6A 3GMSA 4FOOA 2RAFA 2IEDA 4MVJF 3GOHA 4HBGA 1KC1A 1R0SA 1ISFA 2B36A 3TZQA 1XR3A 4DVJA 1TLTA 5DBFA 4YAGA 5T6BA 3E03A 3ANNA 2GYYA 3B6ZA 2X0IA 4E3ZA 4I8XA 2DAPA 1K6JA 4KWIA 3AUAA 3VDQA 3FSRA 4II3A 2DTXA 3AI1A 2DBVO 4GMFA 2IE0A 2NUAA 2Q2VA 4MP3A 3QQPA 5U1PA 4I9UA 3DHNA 2J8ZA 1NYTA 3HG7A 4F6LA 1BDMA 3T7EA 1V3UA 2CDBA 1YXMA 3GC6A 3VH1A 1YVEI 3I4CA 3QSGA 3QJ5A 4MP6A 3T4XA 5C7IO 1CDOA 2Q3EA 2P68A 3WLFA 1UZMA 1DC5A 3L07A 2YQ5A 5A9TA 3Q9UA 5DN9A 1FDWA 3ZWYA 3NTRA 3NT2A 4BKQA 1CQJA 1HF3A 1ISJA 3K8ZA 1N92A 3D3WB 3Q0EA 2NU8A 2W90A 4P38A 2QHXA 4W9NC 5DDIP 5GMOA 2VUUA 2PGDA 1LU9A 4XYGA 4N5MA 4PVCA 3ZNPA 4BS9A 4J91A 2EGHA 2ZJ0A 5JDIA 1GYQA 2I67A 3W1VA 2Q45A 5GZ3A 4CUZA 2DM6A 2PD6A 2IEBA 2UVDA 3U4CA 4MKXA 4IDEA 1I2CA 4YT4A 1DIHA 4IPTA 4GQAA 3A14A 4HFNA 4OH1A 1EFKA 4CR7A 2YW9A 1LLDA 3H3JA 5B12A 3NV9A 5AYVA 3H9UA 5I7EA 3IJRA 2A92A 3ROMA 3G1TA 3LYLA 5T64A 1HEUA 4RGBA 4CUKA 4I5DA 4O63O 2PGLA 3DDNA 4J7CA 2GF2A 4D3SA 1BDBA 3ROPA 4EITA 1A7KA 5IZCC 1EUDA 1E3WA 3C1TA 2EKLA 5JXWA 1AN9A 4E33A 3JQAB 1LA2A 3DBHA 5ITWA 4MVJI 4TZTA 4A03A 5ENVA 1L7DA 4W4TA 4YTEA 3GFBA 3AY3A 4BNHA 2Q4EA 2Y1CA 2YHIA 3ZNOA 4S3MA 1WMBA 4FSHA 2LDXA 3ZW8A 3E9QA 3DBRA 2AE1A 4ZHSA 2VOJA 4MVJG 3WWYA 3RU7A 4Z0HO 1DDOA 1J6UA 3WBBA 1VJTA 4J4TA 5ITVA 2AQKA 5AXAA 4J9UE 3GEMA 2GZ3A 4W7IA 3OEYA 3GEDA 1P45A 1QXSA 3KYCB 1Y1PA 3JCZA 3PK0A 2X0NA 1R6DA 3D4OA 1WW8A 4NBUA 4ZQEA 3FCOA 3C1AA 4YJFB 1PL7A 3WOHA 3DOCA 3FHLA 3N7UA 3K9QO 4NMHA 4MJLA 1UJMA 3Q9NA 5BQFA 4QO8A 4WGGA 1NPTO 1G0NA 5JW6A 4R9SA 5LDHA 4DPLA 2JKVA 5BNTA 4YAJA 1PJBA 4NFHA 1SO8A 4Q3AA 4XYMA 3TQHA 3ZU3A 2PKQP 1NBOA 2YDXA 4H15A 2FMUA 1P3DA 3U4IA 4II2A 1P44A 2HK7A 1U2GA 1HE3A 2ZB8A 4K6FA 3GHHA 1UP6A 5IDYA 3JYOA 1HDOA 1ZXBA 2H1SA 3HN7A 4WOKA 1HE4A 1O95A 1L7EA 4BNTA 3FNEA 4DYDA 2NWQA 4GWKA 4TKLA 4A26A 2C20A 1ENPA 4ALNA 1GTMA 4FFOA 1UR5A 1DB3A 3H9QA 5THQA 1GL3A 4PN3A 3HNPA 1ZFNA 2UV8A 4IIVA 4XDZA 3STHA 2HMSA 3BTVA 1X0XA 4MVJA 1ZBQA 1KOLA 4A2CA 5COQA 1LXCA 4BMVA 4CMKA 2CZCA 3ZWAA 1ML3A 1H6BA 3LT0A 1CWUA 1PGQA 1XSEA 1E3EA 4Q3EA 4YQZA 3PYLA 5B1YA 5I8WA 3UCXA 2AQHA 2DPHA 1R16A 4NPCA 4G81A 4BGVA 1PJ4A 4E5NA 1A7AA 3HDJA 5TT1A 4R69A 4ZGWA 3GGOA 2W98A 2X22A 1O5IA 3OM9A 4J4HA 2YUTA 3BTUA 3MJSA 1PGJA 2ZTMA 4FIZA 4YCAA 3OHSX 5KOIA 5L95A 2FP4A 2QX7A 1XHLA 4EYEA 4HP8A 3H8VA 5DT9A 3KYCA 5JAMA 1XIVA 2OUIA 4KDFA 1OOEA 4K28A 3UCEA 3GG9A 3S2EA 3G1UA 1QLJA 1MXHA 4Y9DA 5JAZA 1EMDA 3LU1A 5BSEA 3PVZA 4BL5A 1RYDA 2WYUA 4NHEA 1DEHA 3GVPA 4IJWA 2VZ9A 4XGKA 3SC4A 3HJAA 3MCVA 2BMAA 5BR7A 4B8WA 4FGWA 1LQTA 2OP1A 3F5SA 4J1NA 3X2FA 4CM4B 3COSA 3RBVA 2W2KB 1T2AA 4G65A 4Q9NA 8LDHA 4CMHA 4F45A 1LDEA 1VLLA 1S6YA 4E12A 2RH4A 3JQAD 4WLVA 1OZAA 2DBRA 3WNQA 2X8LA 1KY4A 4IXWA 4RF3A 3BMNA 1U8FO 4NJOA 1P74A 3EAGA 4E32A 2E82A 4ZQBA 5K9ZA 3KSDO 3CIFA 4B4VA 3E48A 3JQDA 4GPD1 3TZ6A 2C82A 2HMVA 3MJTA 4Q3NA 4BKPA 1ADCA 3GN1A 5IFLA 1BVUA 3I1JA 2OHXA 3FNGA 2DTDA 1SC6A 5T8KC 3B1FA 2HSDA 4P4NA 4QO7A 1I0ZA 2NACA 5TJHA 1H9AA 3DAPA 3FWNA 2C0CA 3JD3A 2GRAA 1U2DA 4CR6A 3FTPA 4ND1A 4Y8VA 1VL6A 1HYEA 4H7PA 4B7CA 3PYMA 1IYZA 3CPSA 3G17A 1GCOA 2NTJA 1B26A 1Y6JA 1W73A 2PK3A 5KJ1A 4BNXA 3GVCA 1N9GB 3OJFA 3HHPA 3PI7A 4IS2A 1DC3A 1LSOA 1ISHA 2EKPA 2DU8A 3D1LA 1DBVO 1V3VA 2J3KA 2ZCVA 3CXRA 5G4LA 3DBHB 5DBIA 3WQQA 2B37A 4AJEA 1HYGA 4CLOA 1ULSA 4RDHA 3V2GA 3TL2A 2XPCA 4QQRA 2HRBA 4GX5A 4ALKA 4B4WA 3A1NA 4M54A 1U7TA 2AHRA 1PZFA 1WP4A 3JQGB 1EVIA 2BELA 3F46A 1PGPA 3KO8A 3UFXA 2CVQA 1E6UA 4PLVA 4TWRA 1P1FA 3RFVA 2VWHA 3PYXA 3F47A 3WSVA 1CF2O 1KERA 4OXKA 4HY3A 1HTBA 1LUAA 3TOXA 5K0ZA 3BHJA 4RVFA 1Q7GA 4M89A 4NZ9A 1F12A 3QWHA 3HN2A 2A94A 2G0TA 3NJ8A 4QFCA 7ADHA 1IY8A 3LF1A 4OOEA 1AHHA 4CL8A 2VRCD 1PL8A 4CM6A 4ZN6A 4BNGA 4BIIA 1IOLA 3AOEC 9LDTA 4WUVA 4CM3A 4R1UA 3OJ0A 5BSHA 5JDCC 2YHUA 1I3NA 2QYSA 1U4SA 2NVUA 3PHHA 4FFRA 4GX2A 1HZZA 1UAGA 4DIBA 1Z7BA 4DMMA 3V1TC 1L1FA 3NUGA 1LDBA 4BO4A 4Z3DA 2NQ8A 3CTMA 3I9MA 1P0FA 3RROA 4U6QA 2NU7A 2VHYA 1NAIA 4TRJA 3GZNB 1E92A 3IP3A 2EP7A 1IPEA 1ENYA 2JFHA 5CP8A 5TRTA 4QUKA 5JY6A 1HLPA 1A72A 2P9GA 4BHTA 1Z73A 4UEKA 4X54A 4Z9YA 3WGGA 1F8GA 1DC6A 1Q0LA 5IZCA 5BSFA 3AWDA 1GY8A 5AOVA 4NFSA 4BOYA 5JCJD 4UULA 5JYDA 2QRKA 5CDUA 3PHJA 1IZ0A 5ADHA 3FN4A 1HXHA 3M2PA 4D3FA 1DJNA 4MP8A 5KIAA 1QRRA 2C29D 3L6DA 4B7XA 3TRIA 2DT5A 3DXFA 4JBIA 2P4QA 4C4OA 2VWPA 2Y99A 4J6FA 1ZNQO 4YA6A 2IXBA 4O6VA 3E5RA 2AEFA 1ISIA 1U28A 4GSKA 4LMRA 4L74A 3RU9A 4WE3A 1LRJA 5GZ6A 4FB5A 1R0LA 2Z5LA 4MVJE 4GWGA 1GEEA 1MG5A 4GBJA 1VJ1A 3VDRA 4EEXA 3C7AA 2GD1O 2QQ5A 2HK9A 4P4GA 5A04A 1UDAA 5K6AA 4WEQA 5EL0A 4CMEA 2AEJA 1NTOA 4DBVO 4D0SA 1RM0A 2SCUA 1H0KA 2O3TA 2NU9A 2I66A 3I9OA 4ZRMA 5C7OO 1AHIA 2Y1DA 3INTA 4CQMD 5EINA 3TZCA 4C7JA 1ISGA 2Y1OA 3OFSA 4B8ZA 3D3WA 5TNXA 2X86A 5F5NA 2RIRA 3ZWBA 1DAOA 2B4QA 3ZHXA 5G0VA 3KLPX 4E30A 1U7HA 3WQRA 1Y8QA 3ON5A 4FDAA 5KKCA 3HWRA 4IDDA 3H9GA 1YJ8A 3U4DA 4EGFA 3QRWA 3JYLA 3W8EA 3RFXA 2UAGA 3FTNA 4HADA 4S1VA 3TSCA 5IXYA 3NTQA 1M67A 2BKAA 2WYVA 2AQIA 4BO8A 4E2WA 5JAQA 1Z7EA 2D3TA 2EKQA 1YKFA 1PJ2A 2VHWA 2OGUA 4XRRA 3GH3A 3DBLB 1GV0A 2X0RA 4UAGA 1R12A 2PZJA 3DOOA 3ONDA 3PQFA 3ROQA 4FW8A 3WYBA 1E7WA 1GR0A 3WGYA 1U3WA 4M1QA 3DZKA 1H94A 2EERA 3F4LA 2I65A 6ADHA 1EZ4A 2CUKA 2WD7A 3HQ4O 4FOSA 4KZPA 2AEMA 5TX7A 1YB1A 1BXZA 3PQDA 3CKYA 4BNNA 4KUGA 4RO0A 4I9HA 3ENKA 5G0TA 3SLKA 5ICMA 3H7AA 1JKIA 4OXNA 2GLXA 1IPFA 1UDBA 4AJ1A 4QX6A 2AMFA 3LDHA 4QSMA 3WS7A 2P5UA 1MP0A 4MIOA 3ZHZA 4O5OA 1GQQA 3GRPA 4J2HA 3SJ7A 5FI5A 1R4NB 1DPGA 2PH3A 2ZYAA 1DRVA 3HDHA 3RUDA 3CUKA 4JLWA 3AOGA 4KDEA 4LVCA 1G6KA 1ZH8A 3OBBA 3KEQA 4NJMA 3GHYA 2NU6A 4MINA 4B3JA 3JQ8B 1N2SA 2G76A 1ZMTA 2D4AA 1BWSA 3F3SA 3H2SA 4RPHA 4JNKA 2BFPA 1Q7CA 5A5FA 1SB9A 4WEOA 3GQVA 1O9BA 3UN1A 3NKLA 1WWKA 1BGVA 3UHAA 1MX3A 1HETA 3JQGA 1A5ZA 4GVXA 1LSUA 2H9IA 5G0SA 2X0JA 4GGOA 1FMCA 4UREA 3ETDA 3WG9A 1WAMA 4AJNA 4LRSB 2CNBA 2PGJA 1IB6A 1PGOA 2PV7A 4GKBA 4W99A 1PQWA 1D1SA 3H9EO 1ZK1A 1QR6A 5TJ9A 1XGKA 3U49A 1V9LA 4PLGA 1VC2A 4CMEC 2DKNA 1NFQA 4MO2A 1N7GA 1J49A 4TZKA 3ZV3A 1TA4A 3ZNNA 1OFGA 5F21A 5FF9A 2VCYA 4M55A 3P7MA 5J23A 1H5QA 4J7UA 3H65A 1ZK3A 2WEKA 3AM3A 3WFIA 4ONEA 5TSDA 4FCCA 4I9NA 4YJHB 1EE2A 3RC9A 4CM8A 4XEHA 1BTOA 1KY5A 4PLYA 3GAFA 4DC1A 4DIOA 4EW6A 4JBGA 1T25A 1SNYA 3ZH2A 2VNAA 4JX8A 3ITKA 3C8MA 3AUUA 1P1KA 4OKIA 4BNJA 2C54A 4GSLA 3N58A 4NQZA 3WTBA 1YL6A 4BVAA 4R3WA 3IIEA 4R3NA 3WNVA 3IAHA 3CEAA 2B5WA 3EZLA 3LLSA 3BMQB 3N74A 2W2LD 4WK6A 2GSDA 3F4BA 1KVQA 1YL5A 1IULA 2Q49A 3GR6A 4INAA 1B3BA 5FFFA 5CDYA 3RBZA 1ZEMA 3F1KA 5L3ZA 3NRCA 4ZQHA 1LTHR 2GN6A 3S2GA 4IY1A 1GYPA 4RZIA 3GA0A 2VN8A 1Z75A 1ZSVA 1HRDA 4NFYA 5F1KA 4JP3A 2PLAA 1I33A 2RH8A 3I9NA 4BB5A 4CMBA 4FC6A 1LNQA 2FRDA 3CH6A 4H3VA 5EQFA 3PIIA 4RF5A 1R4MB 2PNFA 2Q1SA 1EQUA 4NBWA 3Q3CA 2XF8A 3MWEB 2BI7A 3ZWPA 2BF7A 1T2FA 3RWBA 3O4RA 2Y1GA 3Q6IA 1EVJA 1NHGA 2GUGA 4MPDA 2VUTA 3MOIA 2QRLA 4EEZA 4RL6A 2DTEA 3PQEA 1UXKA 2ZQYA 3MJCA 4OSPA 4NIMA 4U0KA 1IE3A 4EJ6A 3O8QA 2OZPA 3L9XA 1NQAO 3R3JA 2Y0EA 4FFPA 4JQCA 3WGIA 4KQXA 5AQ1A 4YBZA 1K2WA 1PS0A 4A0SA 5FWNA 1EBUA 4YJGA 2O23A 3VKUA 1ZJYA 4EBFA 2B0JA 4IUYA 2NVUB 3R1IA 3PWZA 4ZVVA 3IKVA 2ZYGA 1ZO8A 4PG7A 5CG1A 3KB6A 3H5AA 3IL2A 2GASA 2YJZA 4R16A 2C7GA 1KEUA 4DMLA 4J90A 3UF0A 3PJFA 5KJFA 2HK8A 2FZWA 2I9PA 3M1LA 5ES3A 5JY1A 5CEEA 4QFDA 4FN4A 1PZEA 3O26A 2JHFA 2EHDA 2R00A 1E1KA 4PLPA 3RC7A 1K89A 1ARZA 3D0OA 4QEDA 3HFGA 2YFHA 2ZKLA 1DRWA 4NU5A 3JQEA 4HX5A 2V6FA 1JKJA 5EMHA 1J0XO 1H6AA 2DQ4A 2OORA 3L9WA 1SMKA 1QORA 3ANLA 4R01A 1HSZA 2VWGA 3K92A 4J1SA 4JGBA 4NI5A 3LLVA 1BHSA 4BNUA 2O3JA 4OM8A 4ZJUA 2Y0DA 4BGEA 2P9EA 3PHGA 3UH1A 2C5AA 2IZ1A 1H93A 2YY7A 4OQZA 1HDYA 2CF5A 3WJ7A 2OO5A 4CV2A 4GLLA 3UVEA 2Y1EA 3IJPA 5JDCA 1OI7A 3JV7A 2X4GA 4BO6A 3WB9A 2YZ7A 4J2OA 1ZSYA 4R1NA 2OFPA 4PG5A 2X5KO 1KVTA 4DA9A 4HFJA 5IAAA 4AG3A 4NBVA 3DMYA 1P1IA 1GCUA 1IHYA 4GLOA 4GX1A 4A5OA 1ZK4A 1XG5A 2O3UA 4BNLA 2B5VA 3LT2A 1JU9A 2D59A 2RHRA 2NVBA 5DULA 4D7AA 4EUFA 1E7SA 1IHXA 3H3FA 1M6WA 3H9JA 3DBLA 3L77A 1DIGA 2WE8A 3QVTA 1J4AA 1SBYA 2BHLA 1C0IA 4NJMB 4ILKA 4AJOA 4OAQA 4N5LA 1ULUA 4E2XA 3K5PA 3OA2A 1KEVA 1W4ZA 4ALLA 5B4TA 4WNCA 4KTTE 4TVBA 2A9FA 1WMAA 4TMFA 3ZV4A 4W9NA 4XQGA 1EUZA 1DOHA 1JW9B 2VWQA 4E6PA 3OF2A 4CV0A 1LJ8A 1OMOA 4L4SA 1M76A 3O38A 1MLDA 4L75A 4KQWA 4XQEA 3NT4A 2VYND 2DUUA 3JQ9A 3KYDA 2GR9A 4HUJA 4OXYA 3GMDA 4BQRA 4WNIA 1UXIA 5DP2A 1MXFA 5DNAA 1I32A 1KIFA 3V8BA 3U09A 3ZN2A 1CQIA 3UAGA 5DZSA 1OC4A 4U7WA 3ST7A 4B4OA 1E3JA 1MC4A 1I2ZA 3Q11A 3VPXA 4YJHA 4CM8B 3OQ1A 5DF1A 3U3XA 1P1RA 1QKIA 3P5SA 5L7WA 1Z74A 1H2HA 4DGSA 2V6MA 1IUKA 4PZDA 1V6AA 3W4IA 5I9NA 3ASVA 2YQ4A 1NM5A 1KEWA 4UUOA 1LLQA 1X1TA 2FPIA 4YYZA 2CDCA 2UYYA 1MG0A 5BSGA 1LC0A 1LX6A 1VKOA 3VPGA 3RVDA 2FOIA 2UDPA 1SEPA 3BMOA 3GT0A 2FPGA 1EQ2A 5EIOA 1F06A 3K31A 2FPPA 2I3GA 4PCVA 3GZ4A 1PS8A 3E9MA 4R1TA 1GPDG 3KZVA 4XD2A 3TF5A 3U5TA 1P1JA 4BMSA 2ZJ1A 2JCXA 4R41A 1WLYA 1LSJA 2FR0A 3OP4A 5ER6A 3WGOA 1LDMA 4CL3A 4DIFA 3JD1A 2RHCA 4ESOA 4XRGA 1ZEJA 3JYNA 3GUYA 1ID1A 3RUCA 1B15A 1NQTA 4WPGA 5CDGA 3PEFA 3Q2IA 1QV6A 4YRBA 1YGYA 1I30A 3JQFC 4XKJA 1RWBA 4CODB 2O4UX 3ZWWA 4J49A 5JBIA 1QYXA 1XELA 4PZCA 4BO7A 3GK3A 4L9RA 3BTSA 1XDWA 3AW9A 4IGFA 5I7SA 3H5NA 5G0UA 2F00A 2ZCUA 3S8MA 4WCFB 3QV1A 1XCBA 1U4OA 5HRUA 4MVJP 4XWYA 5GZ1A 4BNYA 2P91A 3TN7A 3PHLA 3S1LA 5B4UA 4LW8A 3CZRA 1AGNA 5LCXA 5C7LO 4RORA 3GGPA 4ID9A 5A1TA 4RPKA 3QY9A 1GUZA 4HKTA 4CM9A 4FFNA 1T2EA 4BMNA 4J3FA 1LLUA 3AU8A 4IJKA 4D42A 3X2EA 3IOYA 1UH5A 1P9LA 4RVUA 2PA3A 4OKNA 1GZ3A 2GDZA 3SBOA 1P1HA 4AJJA 3NX4A 1N5DA 1T1SA 2QYTA 4I1IA 2JJYA 3D3EA 4L4RA 3DBRB 4E21A 2NLOA 2YDYA 4ZD6A 4IDAA 1D7OA 3NGXA 2Y67A 4U8GA 3W4JA 1ENOA 4LVUA 1V3TA 5T57A 3O03A 4BNKA 2Q50A 2UUOA 3D7LA 4CMGA 4R5MA 3QWAA 5JS6A 3FNHA 4XGNA 4AJLA 5A4DA 4PRLA 1E77A 1SOWA 4JBHA 4RLSA 4DWVA 3VZQA 1QMGA 1GQYA 3R3SA 4GX0A 1YJQA 5IDXA 1C14A 3O8QB 1TB4A 4DLAA 3KBOA 1ZW1A 1DFIA 2V6GA 1NR7A 4TVOA 4XQCA 3JD2A 5IN5A 1E6WA 1M6HA 1T1RA 4HWKA 2X9GA 4WECA 4XA8A 2Q1TA 1HDZA 4PLZA 3LSYA 1UDCA 4ROSA 3EYWA 4XB2A 5CFZA 3QWIA 3I9KA 3LT4A 3OQBA 4XX0A 3WWZA 1RYEA 3P19A 2DUWA 3H6KA 3K6JA 1QV7A 2XOXA 4CJXA 1B2LA 3HUDA 4D41A 4CMAA 2QIOA 3QLJA 2Q46A 4AJKA 1GZ4A 3NAQA 4L4XA 2W4QA 4KOAA 9LDBA 4E0BA 4BUCA 4R68A 1FK8A 4IIUA 3RASA 3BMCB 3RFTA 3G79A 3ZGYA 1LRKA 3GFGA 3TDKA 1EE9A 5CG2A 4PG8A 2VTDA 3G0OA 3K30A 5H82A 1LDYA 1EEHA 4FFLA 3VZSA 4ND4A 3PDUA 1ZMOA 2J3IA 1VE9A 4D3DA 5JO9A 1E1MA 4YVFA 2ZYDA 1DLIA 4DREA 1E7RA 2NQTA 1VSUA 3I3OA 4HXYA 3ZHYA 3L4SO 4BGIA 1Y8RA 3BMQA 5KWEA 1RM3A 3NTOA 1PJSA 1VL0A 1NASA 1I3MA 4NH4A 5EPOA 3D4PA 1U9JA 2WSBA 4FGSA 4FJ1A 3RCBA 4RLHA 4CLHA 1I10A 4RF2A 4WLEA 2NTNA 2ZQZA 4JJGA 1ZK0A 2BFAA 3KYBA 5L51A 3ZZNA 3KOUA 2VYNA 4RQUA 4QECA 3IUPA 3AI3A 4YAEA 5DBGA 4DUPA 3FWZA 4PVDA 3C24A 4F46A 2IZZA 3DL2A 3HE3A 2UUPA 3MTJA 1T24A 5HBRA 5TC4A 2Q1UA 4RPJA 4Z0TA 2D8AA 1MV8A 1ORRA 4CMCA 2HJRA 1BXGB 2O7SA 4IS3A 1RJWA 3C1OA 4E5YA 1CERA 1OAAA 4MVJD 3INGA 5A9RA 1T4DA 4AL4A 5KJ6A 1HE2A 3DOJA 4PLFA 3GDOA 2POQX 2WTBA 4P22A 2WYWA 1SPXA 4J4BA 3QWBA 2Y05A 5KVVA 4EJ0A 4E5KA 3GNTA 2PZKA 4BO5A 2IXAA 3KYDB 5C37A 3PRJA 4OOFA 3WBFA 3L6EA 2NADA 5ILGA 4D0RA 2J5QA 1N9GA 4AICA 5B4VA 3FD8A 3AFMA 2X58A 3ENNA 1XLTA 4YT5A 3VH3A 2PWZA 5KJEA 3JQ7B 4IJUA 1T2DA 3WX0A 3HDYA 4D44A 3DB2A 1MFPA 3GVXA 4CM5A 3ZV6A 4R9RA 2Q2QA 5DCUA 3E9NA 4J0EA 3VTZA 2QZZA 1GUYA 1TVEA 5A02A 3I6QA 5CPBA 1Q2XA 1HDGO 4GKVA 4BB6A 4CM1A 3M6IA 3FF4A 4MKZA 2ZB7A 3ZWCA 3D64A 1HDXA 2CVOA 3PGXA 1NWHA 1QYDA 1EUCA 3EY4A 1GADO 3I52A 4CQLA 3A06A 3E18A 4BNFA 4JK3A 4Y67A 2NSDA 1NPYA 3V2UA 4WOJA 2NTVA 1HT0A 5JMPA 3ZWOA 4OHUA 3M2TA 4FJ2A 3CINA 4BV9A 4OSOA 1LSSA 1H9BA 4YR9A 1I3LA 2VYVA 3OJOA 4KUHA 4ND5A 2HUNA 4LGVA 3GRKA 3QVOA 5JC1A 1U8XX 3EC7A 3WGTA 3NDRA 4P8RA 3DAGA 4HV4A 1C3VA 1N7HA 1C1DB 1FDSA 3PP8A 3VVCA 2JD0A 1SCUA 3OJEA 4ND3A 2VZ8A 1DAPA 3IC5A 3ULKA 2HJSA 1XQ1A 1CRWG 3JQBA 2TMGA 1H6CA 2HU2A 3INRA 3ETGA 4I08A 1W0CA 4TKMA 3BXXA 4RF4A 2IDZA 1I5RA 1V8BA 2ZTUA 2VHZA 1PL6A 1O89A 5BT9A 3JYPA 1B8UA 1ONOA 2GPTA 2OBNA 1NHWA 1A4UA 1NPDA 4RPGA 4GVLA 3O9ZA 3ICCA 1KYQA 3OIGA 5DP1A 3AY6A 1XEAA 2EV9A 5TT0A 1TT5B 3EDMA 3HSKA 1I3KA 3KSZO 4CUJA 5IJZA 1N1EA 5T8KA 1ZCJA 3DFUA 4W7HA 1ADFA 1QLHA 5L9AA 1NVTA 2YHIB 4CM4A 2BGKA 1GDHA 5I9LA 1NNUA 1KVUA 5JE8A 2HRZA 3EZYA 1D3AA 2IYPA 3AM4A 5GY7A 1GD1O 1NQ5A 1QP8A 3D5QA 4MOWA 3SXPA 1XA0A 1B7GO 2AG5A 4IMPA 3HB4X 3ADPA 1JWBB 3GLQA 4WCFA 4CR8A 1K0UA 1EDOA 3ABIA 3RC1A 1H6DA 1K6IA 2DPGA 4MDHA 1A9ZA 3VPHA 4JXKA 2AE2A 1GZ6A 3W8FA 4BNIA 5L40A 5EN4A 3WGHA 2JFFA 4JJIA 1E1NA 4L76A 2GN9A 1ONNA 4A10A 1RPNA 1X7DA 1LC3A 3RAJA 3FBTA 1AXGA 2XXBA 1UAYA 2FZEA 3WDSA 3JQ7A 2AG8A 3LC1O 3MZ0A 4ZICA 5FEUA 4NK5A 4IZIA 1DXYA 4BKRA 4IQ0A 3BMOB 3KM0A 4QTZA 1U3VA 4Y98A 1TT5A 3NT5A 2ILTA 1DIBA 4E5MA 3AOEA 3ZU5A 3BMNB 2VOEA 2VUSA 2HMTA 1A4IA 3DZHA 3OIFA 1C1DA 5L4SA 1P31A 2EXXA 3IMFA 1CJCA 2DFVA 2DFDA 1T26A 2C7VA 4PLHA 3I4FA 3TL3A 1X1EA 4Y6SA 2VHVA 5JMWA 1F17A 1MC5A 4I5FA 3MEQA 3PWKA 3ONFA 1B8VA 3BZUA 3EVTA 3JYQA 5CEFA 4KTVE 1LDNA 3RQSA 3U0BA 3MTGA 1IL0A 3QVXA 3OICA 2ZB3A 1WDLA 1B3RA 4DPKA 1PTJA 4EZBA 3FRJA 4MVJH 4DQUA 5HS6A 2D2IA 4DYVA 3VHRA 2BRUA 1VKNA 3DZGA 1XQ6A 2ZTLA 2G82A 1B0AA 4BNVA 4PG4A 4Y6RA 4K1LA 2OMEA 1HE5A 3G3EA 1I2BA 1YE3A 1XU9A 4WCDA 2PD3A 4LSMA 2V65A 3TFQA 4BO2A 4JROA 1UXHA 1YQXA 3QE3A 1TT7A 1G0OA 2JL1A 3FPCA 1YRLA 3ORFA 3WXBA 1F14A 1JDJA 3MJ4A 4BO1A 3WGQA 1GU7A 1DSSG 1VI2A 3KXDA 1B8PA 3CMMA 1A9YA 1U3UA 4FBGA 4UVGA 5DOVA 5CHEA 2E37A 1EVZA 1XU7A 3AK4A 1ADGA 3HB5X 1FDUA 3P2YA 4Z9XA 2OL4A 3AFNA 5AVOA 4CMJA 1NFRA 1P33A 2BI8A 2YYYA 4XYEA 3AI2A 1AE1A 4GH5A 3GVIA 4N5NA 1Q0QA 1DO8A 1E6EA 4GMGA 4RVDA 3LT1A 1MB4A 4RVHA 4LCEA 4GGPA 4O59O 2ZIZA 3H2ZA 3ICPA 2FR1A 2Q99A 2R6JA 4IBOA 4BNZA 3SLGA 5IZ4A 5JC8A 2NV6A 8ADHA 1R15A 1E7MA 1PEDA 3RUFA 3DR3A 2WD7B 1P0CA 4IINA 2E6UX 1C0PA 1O8CA 3AUTA 3FPLA 3L0DA 4E31A 3ZU2A 3L6OO 1M75A 2EG9A 2GO1A 5COBA 1EK5A 5A03A 1UP4A 1UP7A 1WDMA 1NWCA 4LRTB 3SVTA 2GERA 3OH8A 3DC2A 3WFJA 3PWSA 5IDQA 4AJHA 2GZ2A 1MA0A 2O7QA 1B14A 4K9DA 3UXYA 3D5TA 4LMPA 1KETA 1LDGA 1X14A 1FF9A 3WSWA 1PSDA 2JAPA 2YV1A 3V1YA 1UXGA 1X0VA 3GPDG 4HFRA 3T7CA 5JSFA 2C2YA 1PIWA 3DFZA 3I6IA 4RV9A 3F9IA 4YB8A 4CV3A 5T67A 4ITUA 3SEFA 2VRBA 1KVSA 4H16A 1CETA 4PRKA 4NDNE 4RJTA 1DHTA 3UKOA 4NU6A 2Z1NA 2PY6A 2Y68A 1ZVMA 3DHYA 4KWHA 4BQPA 2P5YA 3L4BA 3UUWA 2B4RO 2GNAA 3PJGA 3WTCA 3QA9A 2Z95A 2H63A 2VQ3A 1C0KA 1D8AA 1HL3A 1NVGA 4W82A 5I8ZA 2O3SA 4I5EA 5A05A 1EVYA 4AFNA 3AUSA 3E1KA 1KBZA 5KKAA 3VKVA 1E5LA 3OETA 2W2LA 4Z3KA 2LDBA 2I6TA 4BV8A 3LC7O 2Q4BA 4XR9A 3GEGA 3NGLA 2IODA 3ZW9A 4FS3A 3RJ9A 4TROA 2CFCA 1DLJA 1I8TA 3KETA 1E5QA 5H83A 1T4BA 3G49A 4A7PA 1I36A 3W8DA 3ZWVA 1X7HA 3FR8A 3TNLA 4B4UA 1WPQA 4AJIA 4RVSA 4R1SA 3ITDA 3A9WA 4BNWA 1EFLA 1K6XA 1JAXA 4CMIA 2X5OA 4LK3A 1YWGO 5A5EA 1JLLA 3PDJA 1AXEA 4PLCA 3RSHA 4ALIA 1YDEA 2GGSA 2HMWA 4G5HA 1Y5RA 1B16A 3VH2A 2FWMX 4R54A 5ENDA 1OC2A 4PZEA 1JVBA 3NJ4A 3VPFA 3U9LA 4RDIA 2I5PO 4DLLA 3DHEA 4R4JA 2HKIA 3HADA 4IDCA 4Z6KA 3IQDB 1PQUA 3F5QA 4URFA 2O48X 2OOSA 1E1LA 4YPOA 1GQ2A 1E3SA 2VTEA 4IXTA 4J0FA 2D5AA 3JQCA 5F1PA 3VZPA 4BKUA 4U6SA 2NM0A 3OQ6A 4CQMB 4WJZA 5CDTA 3DZFA 2RBEA 3ZWNA 1UXJA 1E3LA 2C5EA 2X9NA 4FJ0A 1Y81A 1TEHA 5KVQA 2PD4A 2AQ8A 3LQFA 1PJCA 1S7CA 3F6YA 2VRCA 2OP0A 3B1KA 5TIIA 4DL9A 1FJHA 1DIAA 3I9LA 1PJQA 3AJRA 4QXMA 1M2WA 1GV1A 4NBTA 4E5PA 1VJ0A 1PQPA 2DBQA 4JIGA 1C1XA 2EW8A 4RQTA 1NAHA 3DWFA 4A27A 2Y66A 5FYDA 1GUFA 1BVRA 3UW3A 5I7FA 5L53A 1YQGA 4I5GA 1JTVA 2WWRA 1WZEA 2EWMA 3KVOA 3UOGA 4XIJA 4IZHA 4D45A 1XYGA 3ZWMA 2EEZA 3W6UA 2OBYA 2G17A 1JKFA 3RUAA 2O3QA 3QHAA 3IP1A 1Y9EA 5KVCA 2EJWA 3GDGA 4FC7A 4FR5A 1E3IA 1JN0A 2DVMA 2YV3A 3DEYX 3ANMA 4R5HA 4YDRA 3FBGA 5L7TA 1XWFA 1NVMB 2IRWA 3DMTC 2F1KA 2WJPA 5I7VA 4W6ZA 1ADBA 3PGJA 2NNLD 1YONA 4ZQGA 3KHUA 4UEJA 4PLTA 3KEOA 1I01A 1ZSNA 5A3JA 4M49A 1HDCA 3JQFA 1JA9A 3CSDA 3U62A 1PZGA 4F3YA 1KC3A 3FNFA 1U3TA 3EMKA 3K2EA 1UZLA 5C3MA 4CV1A 1DHRA 3PLRA 2Y0CA 1Y7TA 4PIVA 4AJ2A 5G4KB 5L4NA 3PFFA 2B35A 3VH4A 3AU9A 3RUIA 3LK7A 3K2BA 3V5NA 4UUMA 4CLRB 3OA0A 4Z0PA 5IDWA 3W6ZA 2E48A 2HDHA 5U4QA 3VPSA 5HA5A 2B69A 4OIMA 2O2YA 1Y9AA 5HTOA 1V35A 2DC1A 3WYEA 1R37A 3JQ9C 3KSUA 3QW2A 3A28A 4CMIB 4EJMA 3JQAA 4M87A 1MFZA 3LF2A 4Z9FA 4CLXA 2XXJA 3GNQA 4XJTA 3LC2O 2DBZA 4DRYA 5CDSA 2X9VA 1JWAB 4BNMA 3PFWO 1U1IA 3TPCA 3ZV5A 4XDYA 4MKRA 1PR3A 1YQDA 2JCYA 4UVEA 4NNJA 3W4KA 1W8DA 2ET6A 3GF4A 4RZHA 4CM7A 4Q39A 2FHSA 1LRLA 1BW9A 5BNIA 3TFOA 2BLLA 2HLPA 1DJQA 2NVWA 2O50A 1XKQA 4YQYA 1IZ9A 1V0JA 5I9MA 1E7YA 1HKUA 3DZJA 2H6EA 3GGGA 3RKUA 1YL7A 2PR2A 1X13A 1F0YA 4FD3A 5HM8A 4XR4A 1X7GA 4XQ9A 2Q1WA 4PFJA 4BO3A 2PH5A 3MWDB 3CE6A 4TRMA 3ROKA 1ZXLA 3WIEA 1RKXA 3AY7A 1O94A 5JPIA 5G0WA 3BTOA 4FFMA 1JQBA 2YFQA 3JQ8A 3HFSA 1WXDA 4G2NA 3ZCXA 4TRNA 1FDVA 3V2HA 3BHIA 1Q1NA 4ND2A 3QWFA 4XB1A 5CPFA 1Y5MA 3GN2A 3UICA 5G2OA 4M8SA 4OL9A 4YJDA 2X1HA 4LISA 3C3XA 4IDGA 5A9SA 1LLCA 4GAEA 4OQYA 2TMDA 2VT2A 3FI9A 5FI3A 5A3VA 3WIDA 1WZIA 4R51A 1SZJG 1EK6A 2PKQO 3NDJA 3BIOA 3H4VA 4EDFA 4Q3DA 2G1UA 2G5CA 3RI3A 5JNLA 3ZNQA 4NBRA 2J6IA 4EI2A 3I83A 2PZMA 5B37A 2BD0A 1ISMA 1BRMA 3SJUA 1ZJZA 4O1MA 3Q2KA 3M1AA 3RUHA 2XAAA 4DTIA 3QVWA 3NYWA 4E13A 4E2YA 6LDHA 3B20A 1FXSA 4JN6B 1SOVA 3E82A 4HFMA 3ZDFA 3KTDA 5AXBA 5DCWA 4E4YA 2GN8A 4PGFA 4B3HA 4UVHA 3PLNA 2E4AA 4ZA2A 5IN4A 2ZK7A 4TSKA 1NQOA 4E2ZA 5JLAA 3KV3O 5TLSA 5COAA 3WQSB 3QVSA 2AA3A 3WMXA 4J16A 4K26A 4WLOA 1R66A 4NR0A 1NR1A 3IS3A 3C7CB 4MIEA 4MIYA 1Z6ZA 4TRRA 3GVHA 2A4KA 1N1GA 3GZNA 5KNLA 3IUSA 2O3RA 5DOZA 5U9CA 1OBFO 1HYHA 3PXXA 4OO3A 1GAEO 4J43A 4YJGB 3ASUA 1PJLA 3GDFA 4WCFC 2IZ0A 1A27A 4B7UA 3EK2A 1EBFA 3B70A 4WLFA 3VAZA 1FDTA 4J1QA 2JD1A 3WR5A 4CLDA 3E5MA 4IM7A 1SAYA 5L45A 3AM5A 2PZLA 3FR7A 5TGDA 2P4HX 2Y1FA 3CMCO 1O0SA 1VPDA 4DLBA 4HNGA 2VNSA 4YEDA 3RUEA 1HWYA 3K96A 5KJCA 1T2CA 4FQ8A 4UEOA 4JJFA 2WD8A 5F5LA 4WASA 3CZMA 4KUEA 4GI2A 2ZATA 2PFGA 1DFGA 4YWJA 3BHMA 3PIDA 4IDFA 5THKA 3S2FA 3V1UA 2AW5A 5L7YA 2EJVA 1VSVA 1ZZEA 1YBMA 5JDIC 3E6AA 1PZHA 4ALMA 2CY0A 4XYBA 3DZBA 1DRUA 3ZWXA 1VM6A 4CPDA 1NP3A 3F1LA 3OEWA 1BG6A 3IDSA 3LZ6A 4LN1A 2A35A 3DBVO 1U5CA 1DFHA 1YDWA 3MJVA 3KLMX 4KP7A 5T5QA 4DBZA 5AXDA 2JD2A 3PJDA 4PG6A 4XIYA 1ZKMA 4CQLB 3BMCA 3IKTA 3VZRA 1LBEA 3GAZA 2O4CA 1CEQA 4M86A 3T4EA
chains in the Genus database with same CATH superfamily
3AHDA 4LMBA 2J31A 4W5WA 1UZAA 1WG8A 3SX2A 3DE3X 4XZ3A 3GG2A 4IQ8A 5FNVF 5AIAA 4OHBA 1K0FA 4FWBA 1ZOOA 4XFJA 1XTBA 1E2BA 1L5SA 2R47A 1Z63A 2AI1A 4O4HB 1KE2A 5KQPA 1PE0A 2CCKA 2KX7A 4DNOA 5K8VA 4PYIA 5KSZA 1W46A 3ZGZA 2CXXA 3RT7A 4XUCA 4IYJA 4OMUA 2R2GA 1ZPDA 1ZHFA 5CX1B 1KP3A 1ETUA 1TM4E 2BEUB 1UK8A 2HU7A 2ZJ5A 4DR7B 2ZUSA 2HADA 2X6TA 3SXUA 4ZCQA 3UPDA 3WLJA 1GPJA 2IS6A 1SHUX 4LJLA 4TV8F 2UZ3A 4XYLA 2CD9A 3WK6A 5K3SA 1RWMA 3U4HA 2GHTA 4M9XA 1XVLA 3BD6A 3LCMA 3WGVA 2AV6A 3DMTA 1E32A 5TQ2B 2CF6A 3NVKI 1VRWA 1PT9A 2EQAA 2FN7A 1NUAA 4AVYA 3H1AA 6PFKA 1LS6A 3LCUA 3F96A 4U5QA 4LC9A 4ZVNA 4YRAA 4WH0A 4TVSA 2VHXA 2H1IA 3NEAA 4FDMA 1N5LA 3RV4A 5F2KA 2XZTA 5ER9A 5IFKA 3ZYCA 2XD4A 4HNHA 1K7CA 3BWYA 5IBRA 3DTTA 1ZK2A 3EGEA 3LW7A 6REQA 5AUPB 3KPJA 2QRVB 1VMDA 4NNOA 4OQFA 1V5IA 4ENRA 1GTSA 3QUAA 4IVQA 1M2NA 1W1IA 4BBPA 4DSUA 3QVLA 2QVZX 3OMXA 4GWLA 3FCEA 1RHQA 1HZZC 4IQGA 4YAKA 1LBIA 4RDXA 2OSBA 4NHOA 4K6CA 1YQ9A 3NBYC 4U1RA 3WICA 1C9KA 1UJ2A 3K73O 2WY2D 3GLSA 4N8DA 5A5DA 3OLZA 3Q1LA 1D04A 2OXIA 3TWOA 2VXOA 4YRDA 1EX7A 3VISA 5DX8A 4CLRA 1IPHA 3U3KA 1C5KA 5HOQA 4G67A 1ULHA 4PRZA 1QTQA 4NAUA 3E2PA 5IF9A 1RWKA 3NYRA 1K2VN 4PO1A 5A62A 3PJEA 3L02A 5FOXA 2IW1A 1I5OA 3PZBA 1H3NA 2GZHA 4Q12A 4AMGA 1HFKA 3X0DA 3S5UA 4Z51A 3LPNA 1J9GA 1PG0A 1YR6A 4KRFA 1FMFA 1ONSA 2GJ8A 2O6LA 4JL8A 2O2SA 4QG7A 4JJEA 1F8FA 1F38A 1ENZA 2BR4A 2B83A 4TSRA 2F43A 4MR9A 4A4DA 1E69A 5JCJA 5IX8A 1CR4A 1HY3A 5JCZA 1UL1X 2CSUA 3FPSA 3ABRB 4B17A 5KTKA 1XV5A 2BGMA 3DEKA 4HAUA 4CQMA 4RFSB 3OCYA 1R18A 2C4TA 1QG6A 4AIRA 1BH6A 1PR5A 1XAJA 4HWTA 1HZJA 1YFJA 3WGOA 5EXSA 2WE7A 4ZEWA 3V46A 2K2WA 3F5MA 4NKRA 2GCGA 3E8XA 4BWVA 3ZIAD 2ACVA 2BJWA 4CU5A 1DXHA 5B7NA 2ZB4A 4X20B 4Y18A 1TI7A 3LKDA 1C3LA 2W8ZA 3QEMA 2UZ4A 2A5FA 4M8LA 5EQTA 2W2KA 5DN6D 2V6BA 2VSQA 3VC7A 4H7DA 1GEGA 3FYUB 1SKBA 5CJ2A 4BN5A 4EFNA 1HK7A 4X66B 2I55A 4JP2A 4DIKA 5ILOA 3IJ5A 4W9RA 4CLOB 1KZGB 1NVVQ 3GLVA 5ICSA 1JAHA 4WZAB 2F3SA 4OJNA 2X2PA 4UVDA 3DLAA 2FVYA 1CY2A 1RZUA 3KS9A 3MLAA 3GPIA 4KXMA 4NYMR 4OHMA 1BOFA 3LD9A 5JASA 3FTCA 2H5LA 3ESBA 121PA 5FTWA 4RTPA 1D03A 3WDKA 3DAYA 5KVSA 4G9GA 5DTJA 1JEYA 1GTL1 1LWNA 2FSVA 1RI4A 2YFYA 1YZYA 1GSOA 1QDUA 1QNFA 2PFSA 3B5JA 5LIPA 4BO0A 3I5MA 4XGIA 4C01A 2IBTA 1VFPA 5AK5A 3SJAA 4TMWA 4P93A 2FMTA 1UT8A 2ZT6A 4BFLA 5K03A 5KYWA 3ILYA 3QKUA 2P67A 1MIOB 3Q12A 4B82A 4D5EA 1U11A 1WQ4A 4KO2S 1QLWA 5I9BA 3ER8A 3TZKA 4CM9D 2PXAA 2Z08A 5HQ3B 1NJGA 1NXQA 1NSTA 3LBNA 4M36A 2ZBGA 5AKHA 3UT6A 4V0OA 4PSDA 2NUPA 4X84A 3JTMA 1NX6A 1RWQA 1K4YA 5AK0A 5TS3A 4AJ4A 5K0FA 1TAUA 3SU8A 2Z30A 5LP6B 1WR8A 2IDKA 3PTZA 4M9QA 4JYZA 5JXIA 2PMBA 3R4VA 4RLQA 3UK6A 5A1JA 1ND5A 3M5PA 3MUOA 4P5DA 3V7YA 2MIIA 3O83A 4Q15A 1TTTA 2HMUA 3LY7A 1MUUA 1JIUA 3L6UA 5KAPA 1KJQA 1P91A 3GJXC 1H2BA 2CLOB 4FW9A 4IHKA 5AVJA 3THOA 4FE3A 4XGQA 1VL1A 3HU2A 2P3QA 2GKSA 2HRRA 5EJ2A 4AN4A 4YQFA 3NBKA 1R0CA 1UDWA 1SB8A 2PX6A 3C7DB 4TQGA 5DCYA 4ZALA 5FORA 5LVAA 2EJBA 1JMVA 1PRYA 3OPNA 3PXBA 4EUHA 1KQ3A 4HYYA 4YNBA 5EUMA 1SUCA 4EFLA 5KTPA 2FU5C 3HLKA 4D3XA 5I6DA 1EDZA 1E98A 3LCRA 3LVFO 4K9KA 4O0LA 3P2MA 4OYRA 2Q1XA 4JEHA 1PJTA 3BK2A 1A8PA 2Z8YM 4KK4A 3BN3A 4YH1A 1Q0HA 4ZRNA 5JJBA 3WHLA 3PVSA 4G85A 4BX0A 3HY4A 4K5QA 2EJCA 1K3FA 1N9KA 4FXPA 1CYDA 4HDOB 4OJTA 4D46A 2BGLA 2H1FA 4QT0A 1HOTA 4A8TA 1TKRA 3QE4A 1PK7A 2ZUTA 3ICQB 1QH0A 1UFQA 1W581 3OT1B 2YV2A 4G0QA 4QFMA 2X5XA 4YRNA 4HAYA 4RC9A 1UM8A 4BP9A 1Y63A 1TMYA 4WBNB 1K1EA 1GA4A 1SC1A 3HZZA 2VDKB 4LNUB 3H1BA 1M2HA 3G0BA 3U5ZB 2HLDD 2CB0A 2H16A 3GWGA 3G5MA 2W9XA 4WRRA 5F1OA 4BPBA 3J7TA 3UYKA 4U9UA 4MCAA 2VRWA 3ZDDA 1EP2B 3B9PA 1FSPA 4F38A 1VMIA 3H2BA 1A2OA 5EEHA 3RS3A 3WVNA 3DL4A 3EDOA 3ENVA 4EIWA 3HEAA 4ZI7B 2QZ9A 2RGYA 4MPTA 2PGXA 4TV9A 3STUA 4DQXA 3EXHA 2PEZA 4B79A 3LK6A 2R00C 5H9WA 1YTUA 5HR5A 2HZ7A 2Z6UA 3BL8A 3W5VA 4OHKA 2FCAA 1XZNA 4R7GA 4Q1DA 4FOOA 4YJ2A 3WRWA 1FY2A 1Y0BA 1OZFA 1QVAA 4QUEA 2D74A 3GOHA 3WIVA 4BAZA 1KC1A 5BYKA 2B36A 1GGEA 2YRXA 2I2XB 2IH2A 1J5XA 2FN9A 1BEUB 1VLMA 4QQKA 4QNRA 1V37A 1V1MB 4E3ZA 2J9GA 4KWIA 1MAHA 2C2ZA 3FSRA 4B2LA 3AI1A 2CHQA 2DBVO 1AO0A 3DE2X 5GIOE 2KWIA 1L4FA 4YRKA 2FFBA 4LZAA 2Q5FA 3DHNA 1XDGA 3W06A 2XRZA 4I0WB 5KYXA 4CTNA 4Q9DA 1BDMA 2C78A 2AYYA 3JYHA 4MAAA 1YXMA 2WJAA 3VH1A 1P81A 2DSTA 4PAMA 1HQCA 3QSGA 3T4XA 1CEXA 1DG9A 1ODJA 2B7LA 4MRRA 1CUHA 3HO1A 1WB5A 2E5WA 2R5NA 4KQGA 3MWYW 3ZXYA 4F1JA 2VNJA 1UZMA 1DC5A 4K3UA 3A3OA 4JUFA 5A9TA 3TRJA 2RHJA 5A6VA 2BR3A 1ESMA 4QJIA 4QQ8A 1HF3A 3ILHA 3K8ZA 2CNDA 4Z8YA 5FWYB 3DNPA 2I78A 2W90A 2XTNA 4Y0VA 4UU0A 1CY4A 1SU7A 4MUBA 3OX4A 3WAKA 1N6RA 5DDIP 5GONA 1K63A 2WJYA 3E70C 1L4NA 2HU8A 3RVMA 2PGDA 3GCGA 1P9WA 5ADVA 1BAPA 1MN6A 4BS9A 4NXMB 4BLQA 4J91A 1C7QA 1GARA 2FWJA 5KYNA 1GYQA 2WJGA 4EFDA 1WXHA 5E8JA 3RLFA 1CVIA 3KKPA 2GHRA 2DM6A 4P7GA 2UVDA 3U4CA 2D8MA 1DQNA 3UT5A 4YYEA 1ZBDA 3NUZA 4FYWA 4UHBA 2VUHB 4AY6A 1DIHA 2V5VA 3GJRA 3UK2A 1QKKA 4WK0B 1S96A 4ZHQF 2I6FA 3WI7A 3A14A 4HFNA 4ERNA 5BSKA 4QGHA 5FV7A 1ZZGA 3OU6A 5B36A 4YRGA 1W30A 3DV0A 4K81B 5I5EA 4L2IB 3L7LA 3DKVA 2GFIA 1DV1A 1GKIA 3H9UA 4ZMSA 3NWBA 1M0EA 2AGVA 5I7EA 4R8RA 5A0TA 2P1RA 3SC3A 3HYTA 5E3IA 1GU1A 4MV9A 3I09A 3ROMA 1W9MA 3HPQA 4AIIA 1GVNB 4UDOA 1U9YA 3HBMA 4PWZA 3O4HA 2ONKA 2H2IA 1T5HX 2W6JA 2WRZA 3HI4A 4I5DA 4O63O 4YUWA 1QGUA 3DG9A 4J7CA 4KACA 2EL9A 4BQIA 3AIIA 5K3DA 5IZCC 1EUDA 1Z6XA 4U7PB 5DXAA 3GLHA 4W1PA 2VQEB 2HDNB 4GUAA 2CUTA 3DBHA 1VTKA 4IV8A 3EZNA 1R1DA 3O0DA 1MO3A 1YMQA 2ODPA 3RG8A 5ENVA 4W4TA 3R5KA 4WACA 5AMXA 4FM9A 2QLJA 2Q4EA 2Y1CA 3MTEA 3P0EA 4N3AA 1J8QA 4YROA 4S3MA 3HRHA 4MRVA 4INZA 4P5EA 5AJTA 4CIAA 3HL4A 1WETA 2PX0A 5EYPB 3T4PA 1G60A 2P0YA 2AE1A 2CXQA 3DBRA 4MVJG 4UHJA 3WWYA 4ZHSA 1T13A 1KYVA 3B1VA 1VSQA 3TAXA 4Q1BA 3KR2A 5LXTB 1TQDA 3RYCB 1VJTA 1B76A 2W2XA 5AXAA 5CA0B 3N76A 4JUIA 3ABQB 4LBWA 1US8A 2O0LA 5K3FB 3GEMA 5M34A 3AEQA 1CLUA 2WPDA 4EH1A 1QNLA 4G84A 4MR7B 1IBSA 4QYIA 5FTMA 3KYCB 4HL6A 4UFPA 4ENPA 4HJRA 4GZ5A 3ZU6A 5E9QA 2RHGB 1TDJA 3E5HA 4MQ5A 5CTJA 2UZ1B 5C18A 5CA1B 4LHZA 4P35A 1NUSA 1CR2A 1SC9A 1XQXA 1QB8A 2NO0A 2DPMA 4NMHA 1YVPA 4U39A 3CONA 3OZBA 1A3CA 5BQFA 5BYBA 4Q03A 3V4OA 1NPTO 5K8CA 1LI5A 1UC8A 5LDHA 2QAGA 4XWAA 1OXVA 5BNTA 4W5RA 4OD0A 1R5BA 3UJ8A 2NZXA 3ZU3A 1RADA 1E5TA 2AFIB 3QXCA 4FT4A 3UW1A 2PKQP 1OAOA 3H0EA 2NZWA 2HDWA 3UWDA 4IP0A 1M83A 4Q9JA 4KQJA 4II2A 1YBFA 3KBBA 1P44A 3KUDA 1Z16A 3R09A 2OV6A 3CFYA 3VYWA 3T3NA 3FJOA 4CKCB 3IQGX 3CZQA 3TPZA 4YUZA 4LFBB 1EUYA 1KFEB 2QWXA 4JC5A 4F9FA 1THZA 4M0KA 2FSFA 3WXMA 5JTTA 5KWJA 1I7NA 3P1JA 5DIZA 5LBIA 2I2DA 1YFZA 1A9OA 4WOKA 1M0WA 1A95A 3HCWA 4IMIB 3CVUA 1IZ8A 4C03A 1EFVB 4A26A 1WNFA 3SEQA 4ZXPA 3OKAA 4B34A 2W4MA 1GTMA 3Q7PA 5CH5A 1E6KA 3H11B 3ROEA 1HH4A 3K70D 3Q88A 1J09A 1DBPA 3HNPA 4DJTA 5BWCA 5HIKA 1T1IA 2HMSA 2J46A 1QGUB 3F6RA 3HCEA 1E64A 1XVAA 1I94B 1KOLA 4BMVA 3VHLB 4KGXA 2O6HA 4MB6A 1D1QA 1YCGA 3FYTA 4FFBB 3ZWAA 1GSHA 4A23A 1PGQA 4YQZA 3QXHA 1A8QA 2ZPAA 3DVQX 1X19A 4MQFA 3UCXA 5B1YA 3BIJA 4RD3A 4RY9A 1PJ4A 1ZLYA 2WZQA 3EXFB 3R41A 3WLSA 4M7WA 1CFJA 3EFEA 5E1DA 2HF2A 3PE6A 4GP6A 2HFJA 3DV0B 4HXGA 1SKAA 2H7XA 1PZNA 1ZUNA 1GXSB 3BFVA 4AMYA 3VU3A 5ALYA 4J4HA 5HEKA 2A9RA 1GPMA 2FA9A 2AD5A 3SVLA 3HDTA 3A04A 2QN8A 4FIZA 4W5TA 1ZM7A 4PBTA 4PZPA 3PU6A 2R1TA 4POAA 4CRWB 1SN7A 5KOIA 4ZP1A 4V1CB 1VHWA 2LCFA 4RYLA 5UKDA 3UG7A 1E3DA 1NDUA 1WUKS 3MUEA 2HNBA 3KYCA 1XIVA 2P9JA 3IBGA 3PRKE 5DT9A 2EBFX 4KDFA 4CFSA 4DT1A 4Z53A 3G1UA 4L1KA 2JJQA 4ON9A 2NYUA 4I8DA 2P3LA 3KKMA 3GUHA 5NLLA 1F6DA 4OU5A 5JAZA 2YS6A 3DT8A 4DA4A 1CNEA 1M74A 2NGRA 3CU5A 3JVIA 1KDRA 2FG7C 2IP4A 3HM2A 3KQQA 1Z28A 2GZAA 2WYUA 4IOLA 4NHEA 1Z5NA 2WMNB 2WUFA 5DSXA 3KD2A 5G40A 3CYFA 2WM2A 5J5VA 1HT2E 2NMVA 2VZ9A 4AK9A 1E2EA 1H8ED 2JLRA 1RXVA 1WXFA 4JODA 3R8FA 1NRIA 1PSZA 2ZTHA 3X2FA 4J1NA 4DLXA 2QX8A 1E5XA 1IIRA 4DMCA 2PKCA 1FJGB 1P62B 3RAFC 4F45A 4KC0A 2R751 1VLLA 3IAAA 3K9CA 3D9QX 3Q7TA 4D3ZA 5GIPE 3JQAD 4WLVA 1ODLA 3WNQA 5DT2A 2GCOB 2X8LA 1X9HA 4F86A 2ZM6B 1SKYE 4W1SA 1P74A 1XJQA 1CUWA 4JLPA 5CCBA 3EAGA 4BGDA 4PANA 5HOEA 2E82A 2OG1A 2PZAA 2AG0A 3MPOA 3FIJA 1PTJC 2FPUA 3TSWA 1E66A 2BGUA 1BS2A 1VMEA 4HB0A 2C82A 2NUTA 3W9BA 2V7QD 3MJTA 1WEHA 5IFLA 1BVUA 4EJFA 3I1JA 1NSFA 4H18A 3V8BA 1SC6A 3B1FA 2YYZA 4L2IA 3O84A 5IEBA 2ONZA 4C7OB 1ZY2A 4R2LA 2LRHA 5ALOA 5JNRA 1EGHA 2XMRA 3VPAA 3K09A 3KTFA 3PFBA 5BORA 1IHPA 4Y8VA 1VL6A 3M6FA 3ZQJA 5CA0A 3WP1B 4UDYX 3PYMA 2IHNA 1T3LA 1GCOA 5CXQA 3QW4B 3VC1A 3AZQA 2PK3A 5ALFA 1ZQ1A 5T6MA 4KQ1A 3EDQA 2NU9B 4I4NA 3DAOA 1W25A 2CYBA 1MAAA 4LXUA 2ICAA 1DC3A 4MO9A 4I2VA 2OYRA 3SZ3A 2EKPA 2A58A 4RCZA 3I42A 1RAAA 3D1LA 2XT0A 1KZ6A 2ZCVA 2ZRKA 5CVCA 1I7LA 3QG1A 3LO8A 4H17A 3D5EA 1OFIA 1ZM3A 5JPDA 2WICA 3ILXA 5EI5A 3WQQA 2B37A 4AJEA 3RFUA 3X43A 2VTBB 1ADJA 4Y2PA 4GR9A 3TL2A 2XUZA 3GLHE 1N57A 1NVVR 1C7FA 3SYLA 2WHYA 2XPCA 4URXR 3AEUA 4ALKA 2A5GA 4GX5A 3A1NA 5MF6A 1ZI9A 4IIEA 3SIXA 1PZFA 3E22A 1UOOA 3OOHA 1NXWA 2BELA 2ZRNA 3KO8A 5ALHA 3UFXA 2X5NA 4GICA 3DTVD 1P1FA 2VP4A 1Y8AA 3EG9B 1BH2A 1GGKA 4RELA 1VE7A 3ECAA 3NV7A 1W0KA 4GXRA 2RI0A 1EB8A 1CKEA 3PYXA 4NBKA 1EXMA 5IJWA 4FE4A 4IXMA 4HY3A 1JZQA 5K0ZA 3BHJA 3OE5A 2PSHA 1Y37A 3DNFA 3UM9A 4NZ9A 3WADA 1ZP6A 1TF2A 5DBEX 3TFWA 4BFWA 1QIDA 3HN2A 4H4CA 5AVSA 2A94A 3HKEB 1MJ5A 1CJUC 1P60A 3I0ZA 3Q5DA 3LF1A 2VP3A 2YH2A 1AHHA 1UK6A 4IHAA 3SICE 1MCZA 5AJYA 4HG2A 1IOLA 3OUTA 3MJDA 3O73A 5FWXB 2H1RA 4S1PA 2GCIA 3I8OA 3N1UA 3PQCA 4DF3A 3P9PA 1QIGA 4D57A 2WHXA 2YHUA 5EGNA 5P21A 4CT0A 1HZZA 1X80A 1DUSA 5AM1A 4BZQA 1C9NA 1Z7BA 1RWOA 2FQQA 1JG7A 3UJNA 5JVDB 4MV3A 4X63A 2O0MA 4RGVA 2IHUA 1AMUA 4G0NA 4Z3DA 4YMUA 4BMDA 2EBUA 3CTMA 3E81A 1P0FA 5BPFA 3WA6A 1NONA 2CXSA 1BHJA 3S1AA 5JI3E 2VHYA 3HVRA 1NAIA 4TRJA 4PAWA 3MAAC 2J3DA 3QOYA 5AVXA 3PUYA 5KYKA 5CD1A 4EB0A 1KOGA 4L8WB 3N2EA 4N8EA 4MVXA 4QUKA 3OZXA 2CUZA 2XMCA 4RZ2A 3BXFA 3VZBA 4X54A 3PS9A 3WGGA 2C7QA 5KQLA 3UUGA 4OG2A 3ET4A 1Q11A 1XT6A 3R0JA 4O4LA 4ARZA 2R97A 3AWDA 1T5LA 1GY8A 3FVVA 4I7EA 1KBQA 4TL7A 3U40A 2O57A 4NFSA 3V8VA 1R0ZA 3VPBA 4JL6A 2QRKA 1MO5A 1VA5A 3DLIA 3JQRA 3CH4B 2YJGA 3HXKA 3KYJB 4HYEA 2V7BA 2OXTA 3M2PA 5ADHA 2WIBA 1PW5A 3CG0A 3LBHA 1QRRA 1RXCA 1T15A 2C29D 2PUJA 3L6DA 4JBIA 4U3JB 3TRIA 1KI9A 1W52X 2VWPA 1WHSB 4J6FA 1I9CA 1ORDA 3KXLA 1TO6A 4IOMA 3JVUA 3G9XA 1L8XA 3MGAA 4CKWB 4HH4A 1N2OA 2GF0A 3CCFA 2OCGA 1MDBA 4O6VA 1JSLA 1RKBA 1DOZA 3B38A 4LMRA 4WE3A 5EZQA 1R0LA 3SE7A 1C2YA 1G8MA 3UENA 4CG0A 1Y98A 1OB5A 1OYYA 5JAHA 1QBGA 2W00A 4GWGA 2C92A 1OVMA 3HB1A 5LN1A 3GRAA 4GBJA 1GITA 4RU1A 3VDRA 3A9CA 3EIFA 2CCJA 3F6BX 3ZKWB 2VT6A 4L6AA 1OYWA 3MGGA 4KGZA 5A04A 5JD5A 5K6AA 2AVDA 4AM8A 4D8UA 4R2WA 3ZJ4A 2Z83A 3EXHB 4DAOA 5A4KA 2XNJA 4DBVO 1TMKA 2F17A 3V8RA 2O3TA 4QTXA 2A9VA 1ZJ5A 3I9OA 4LDQA 2CE2X 4Q4DA 3INTA 2Y1DA 4RDCA 2HWWA 2VNKA 3B8HA 4XLTA 2IIQA 1PN3A 5HMMA 3TE7A 4EZIA 3VNVA 1ZR4A 4K8OA 4LSGA 4BLTA 3T7RA 5G3ZA 4B8ZA 1XAIA 4KPGA 3D3WA 4EA7A 4RTNA 2X86A 2HSJA 2WF5A 2RIRA 10MHA 2J4DA 3QUBA 2B4QA 4EUNA 3KYIB 1Z35A 2J1LA 4N3CA 2FGKA 3DKPA 2VXBA 4YCDA 3DDCA 1W85B 4OP2A 1VP9A 3MGCA 2X8WA 4JLNA 1Z8HA 3B1YA 3R7NA 2E5LB 3SBDA 1GNQA 1GCIA 2IHKA 2AXPA 4X91A 3V8MA 5HGJA 3KDSE 4GMKA 3F7TA 1CJMA 3JYLA 5TGZA 3OF5A 3Q8WA 3NVMB 4BQEA 1RT9A 2UAGA 2ZI9A 3NBFA 1Q0TA 3TSCA 4YAFA 5IXYA 4ARSA 1V96A 1PO7A 3NTQA 3K2IA 2ATCA 3QF4B 2JGEA 2ZPUA 3CLSD 4E2WA 4GEGA 4R8VA 4F4HA 1MX5A 1TF5A 4N03A 1X38A 4Q21A 4BKMA 2EKQA 2YZMA 2OVFA 1INLA 4XRRA 5HXAA 4MS3B 1VRVA 2A5DA 2X0RA 1T6XA 1E8DA 1KA9H 1R12A 4GECA 4X1KA 4Y0NA 2PQMA 4MKGA 3U13A 5DSTA 2V0NA 4OUDB 2ZE8A 3D2CA 3F7NA 3LNCA 4HQ0A 1GRNA 2OC4A 2XB8A 2QQ0A 2Q9UA 3CLRD 1TADA 3NXKA 2HJ9A 1ZGJA 4K9OA 3SZLA 3LQ1A 5TX7A 4M0CA 1EFPB 1S3GA 4K46A 4YIHA 1OHHA 1TFRA 4WVFA 1RE1A 2QOEA 1CB0A 3ZE0B 4B31A 4ER7A 3BILA 3ENKA 3PD0A 5G0TA 3ZQKA 2RIPA 2SECE 2JFBA 3WO0A 3H7AA 2GLXA 2A6PA 2Z8ZA 2ENWA 1H8HA 1IPFA 4AJ1A 1IEXA 2AMFA 3LDHA 2RG7A 4QSMA 3ZJUA 2DFKB 2P5UA 3KQOA 2FZLA 4LECA 4RY2A 4Z7OB 1U9CA 4J2HA 1AKNA 3L0IB 4HTFB 5C80A 5CITA 2BFEB 5BWOA 2QBYB 1E1QD 1R27A 3HDVA 1SZCA 3WLIA 2WWGA 4PC2A 2I0FA 2JI8A 3VSAA 2Y9PB 4MICA 5FHQA 3RUDA 5CK4A 3AOGA 4RIIA 4EGCB 3RO7A 1ZH8A 5JWOA 2QLNA 1FBTA 1E6LA 4I4IA 4BMOB 2H51A 2WF6A 2ZEJA 2J0UB 2R5WA 4LF4B 1KPIA 2G76A 1C3OB 1ECBA 5H70A 2D00A 1ZMTA 4BWYA 1FU4A 3W8RA 1XVIA 2R7MA 1XF9A 4JNKA 1Q7CA 4PE5B 1HBJA 4E70A 5A5FA 2ENUA 4BFXA 4QJ3A 3UN1A 3NKLA 1WWKA 2RKBA 4RH3A 3UHAA 2YVLA 5AHXA 3B6EA 3THXB 3D6TB 1TYBE 3BPSA 3UMMA 5G0SA 2A78A 1RI2A 2X0JA 4GGOA 4GKJB 5DTRA 5LKRA 4NLLA 3WG9A 4MB0A 1WAMA 4TQUS 4AJNA 1AJEA 4NJEA 2MTBA 1IB6A 3ASYA 4M1TA 1S9HA 4XWWA 1C50A 1N9ZA 1XGKA 3HUTA 3U49A 4RXUA 3B8EA 1KDPA 3VSDA 1NFQA 4MO2A 4UCQA 2YICA 4UTZA 3OLYA 4O29A 1QCDA 3D3JA 3HNOA 3OJCA 2KW5A 4Q34A 5F7ZA 5T4HA 4EPRA 3A37A 4M55A 1B8OA 5FWYA 4J7UA 1HR0B 1GFWA 4XVCA 2WKPA 4MWDA 2QIPA 5A6SA 3S40A 3UJHA 1J9EA 4YJHB 3NBAA 4KN9S 5T4EA 3ROFA 1UQUA 3VA7A 3LYHA 3R20A 4ZAYA 5CXXA 1M5RA 4DIOA 2O9JA 1T25A 2WKSA 1W2WB 3DKRA 3IODA 1EGMB 1QIKA 5AI0A 1WB6A 2B7CA 1P1KA 3CJRA 2Z3WA 2QNBA 1TPZA 1UM9A 3DD5A 4N7BA 4R3WA 4ZOEA 4YMVA 5BV0A 2BKEA 3CEAA 2B5WA 3GJYA 3EVBA 3D3QA 1V5FA 3VJKA 1XZIA 4WVLA 4NZNA 3SIRA 2C77A 3OG9A 1E61A 1KVQA 3GR6A 5AW2A 4INAA 1RLUA 1N6NA 1U9IC 3QQ5A 5L3ZA 3NRCA 3RBZA 1QVVA 2FVXA 3T1VA 2GN6A 3L4JA 3GJSA 4EMSA 4RZIA 5BR4A 1TW3A 1Z75A 4B0PA 3JS5A 1BQ4A 1CQZA 1HRDA 3QBTA 3G2LA 4X8MA 2IE8A 5F1KA 4JP3A 2PLAA 2Y0PA 2YS7A 4BWGA 4CMBA 1CPYA 5ALIA 5C1PA 5F23A 2JJ2A 2WQZA 2ZRAA 5JLJA 1Z4IA 5TR9A 1NF8A 3ACCA 5JJIA 4UARA 1G6OA 2Q27A 4KLNA 4JLKA 3ACBA 3W3ZB 1UFVA 2JFWA 3MWEB 3ANXA 3NBUA 3P45A 5C8YA 1YR8A 3ZWPA 5AW3A 1EXNA 3C8UA 2BF7A 2IYSA 1T2FA 2QF7A 4KXNA 5CDHA 3DULA 1M7GA 4UHCA 5IWCA 2Z2IA 2Y1GA 3QVGA 4X7MA 4I36A 1EVJA 2P3SA 4C3VA 5K0CA 2JJ8A 1JBQA 1Q1GA 2XYGA 2G83A 2WF7A 3PQEA 1FBNA 2PLFA 3QU9A 4X45A 4OSPA 4NIMA 3I8SA 3M9XA 1IE3A 3B13B 4GSYA 1IWPB 3L9XA 1NQAO 3S6JA 4QWWA 2Y0EA 2VHQA 4A8HA 4JQCA 1CY1A 2BGIA 4KQXA 3WGIA 4YBZA 1K2WA 5JAPA 1EBUA 1I4TD 2FYTA 2SKCA 1ZJYA 4FHGA 2I7DA 4HDRA 4YECA 3KLBA 3PXGA 5BRAA 2NVUB 4KW7A 4C87A 2Z6AA 4OK6A 4ZVVA 5DTQA 3NWOA 2PNJA 4BECA 3EA5A 3IEKA 2GRJA 4GZ3A 2IQ5A 3LY9A 3H5AA 1O6BA 5JS1A 2RGGA 2BFWA 4KQHA 4X6LA 2NU7B 5D85A 5FP0A 5KJFA 4KO3S 4M38A 4EB6B 4LF7B 4XLZA 2FNAA 4IRXA 4DRZA 3GQBB 4DR3B 4JIMA 4OXRA 4FFBA 4A8JC 1U8UA 1GQFA 2GOYA 1KMIY 1OY1A 4BZXA 2R62A 4PLPA 1T8UA 1VE5A 3H8WA 3CB2A 5EZYF 1M54A 2BFCB 4NATA 4GXQA 2OO5C 1QMPA 2ZKLA 3NBXX 5TPWB 4X00A 2QD5A 2CHEA 4K9LA 1J06A 2NYAA 4ZAZA 5JQGF 1JKJA 4HWRA 1T10A 5KTSA 3SPXA 4P3XA 3X1YA 4HYQA 2W2QA 1HSZA 2GEVA 1RMYA 2VJOA 2WF8A 2NPIA 3CGGA 1XJ0A 4J1SA 4JGBA 5JI2E 3WYGA 2QVCA 1NURA 4RVCA 4UMEA 4XOUA 5GOTA 3E4DA 4HX2A 4BNUA 1VZ3A 4DLNA 1XRPA 5EIWA 4EHIA 1JPNA 2IZ1A 2YY7A 4OGLA 2JI4A 4XFKA 2FPOA 4NOLA 4Q1AA 2CF5A 4URYR 3U37A 2OO5A 2P2CA 1C9MA 2WILA 4CW7A 2AC4A 3F8TA 3G2OA 3UVEA 4B3TB 2P7HA 1FNNA 2WIDA 2X4GA 3JV7A 3SF8A 1LJLA 3U81A 3UFBA 4EECA 2PUWA 5DXJA 2OCKA 3C3MA 4R1NA 2WU1A 2X5KO 1SULA 3AL3A 5D7NA 2PL9A 1KVTA 4KR6A 5FJIA 1XEXB 1RKQA 1U7DA 1UINA 2Q6LA 2WA2A 4H31A 4UKDA 1OJLA 3HVIA 2X0FA 5IAAA 3FPAA 3GRCA 5FTKA 4BJHB 1P1IA 1GCUA 1IHYA 4GLOA 1XG5A 4BNLA 2CXNA 2B5VA 3LT2A 1JU9A 2D59A 2Z5GA 4JJ6A 4QBHA 2QMHA 3QELB 4LF9B 1IHXA 1TRKA 1M6WA 5BMVA 2I54A 4C08A 4NRDA 1XTKA 4X3OA 5JG7A 2VRNA 3WGNA 3OZVA 3VYRB 3U4MA 4TTPA 1SBYA 2IHVA 2BHLA 1A5SB 2O07A 2R68A 3VR3A 1ZVJA 3HB7A 3D7MA 3LPLA 2TMKA 4NJMB 2PS0A 4MRMA 3BDIA 4N5LA 3I01A 3HUEA 4UMFA 4AJOA 1GPNA 1KO7A 4ZYZA 1NXTA 1V39A 4RD2A 4ALLA 5KREA 3VNRA 3W9YA 4CTJA 2J09A 1FQJA 2A9FA 1WMAA 1ZITA 2AH5A 3C70A 1WKBA 1YS7A 1Z4MA 4W9NA 3PC7A 1JW9B 4I14A 4E6PA 2A1TR 1OSNA 3OF2A 4CV0A 2JC3A 4L4SA 5DLDA 3UO8B 3A4YA 4QA9A 5HQTA 1THTA 2ZJFA 3E9EA 4KQWA 2I4OA 4XQEA 3LUBA 3NT4A 2FUKA 3MUNA 1KMCA 3KYDA 1SOUA 4U7DA 2AJBA 5JWHA 4WN9B 2B8JA 3QNUA 1BNCA 3GMDA 3O92A 3A6LA 3EZXA 4G8BA 4QEZA 1N8SA 4UJ5A 3G8AA 3SOPA 5F76A 2CMFA 4HNRA 5DNAA 4XDHA 2FW9A 3T7SA 3W2IA 2VDUE 4M9ZA 5D87A 4E51A 1CQIA 3C6YA 3UAGA 4YXWA 1OC4A 1E2JA 3FCCA 4KU4A 4OU4A 3JR3A 4D8VA 4PSUA 2EWWA 1AM4D 2I8CA 3ST7A 4CKCA 3PFIA 3H16A 1I2ZA 1ZWLA 2JZOA 4RMIA 4MHTA 1QKIA 3I39X 1K8YB 5F78A 5L7WA 4TYPA 4DGSA 1H2HA 4E09A 2W6NA 2Z9CA 2QDKA 1U9IA 2CLFB 3W4IA 5I9NA 1IEWA 1L5ZA 1QU3A 2PX3A 1YF3A 5D86A 1ATIA 1NM5A 1KEWA 2ACKA 4LJ5A 4RHUA 2B3TA 1UPCA 3BRSA 4NCIA 1JFSA 2VBCA 1X1TA 1N4DA 2FPIA 2X8JB 5ICFA 2UYYA 5BSGA 5FUBA 1LX6A 1VKOA 3WMFA 5CX1A 2FOIA 5T3UA 4OY3A 2FW7A 5K0BA 2VYCA 2EC5A 1SKQA 5GAJA 2ZXUA 1JDUA 5AK4A 1EQ2A 1WDTA 2N9UA 2C00A 4EYQA 4BZPA 1V8PA 2I3GA 3EQ6A 4BVEA 4LE2A 1E1YA 1KAMA 1X92A 4YMHA 3T5DA 3QENA 1Q57A 4QIHA 4XD2A 3U5TA 1JPJA 5ALVA 5FOVA 4E14A 1WLYA 1A50B 1RC1A 2FR0A 3OP4A 1LDMA 3JARA 2VSFA 2RHCA 1UBSB 4XRGA 4QG3A 2WM8A 3AT1A 4UPEA 3JYNA 4H7EA 2XWPA 1RQXA 2IUSA 5LZ5A 2WTAA 1FFCA 5DV9A 1NQTA 2Q7OE 1KNXA 3I01M 2JJMA 5DISB 5EJFA 2PUCA 3Q2IA 3P2IA 1QV6A 1A5TA 4LI0A 4F04A 4DEVA 1I30A 4PZ0A 3SSMA 3VGPA 4BVKA 2VHCA 2B34A 4D74A 1F5SA 4H1HA 1QRSA 1XHFA 4LYFA 2DHCA 4F8YA 5BT8A 2BH2A 1CTQA 5D8DA 1NULA 3HPRA 4BO7A 4L9RA 3FDFA 1BA3A 2QAIA 2ES4A 3GLHB 3QVMA 3OVMA 4PYNA 1XUOA 3H5NA 5G0UA 3SF8B 5I7SA 5CCXA 4IIJB 3KWMA 4QU8A 1UPXA 2B1IA 2GMWA 2XGSA 4WCFB 3A1EA 4KH0A 5HRUA 1HNXB 1P4AA 2YXEA 1R8QA 4XWYA 3WL8A 1FYDA 1KDTA 4L0CA 4BX9A 5KWVA 4YRRA 3UIEA 1FFXB 3ZDXB 4FMDF 5C7LO 2OV3A 4MNTA 3LQQA 4Q9AA 2GXSA 3M0EA 2EX4A 1J8FA 4L02A 2GXQA 5ECDA 4ZYVA 4RPKA 4EG5A 4M99A 5F98A 3QY9A 1GUZA 4IH1A 4ZAGA 4FFNA 4JLBA 2M32A 1CUXA 1WQ1R 2C5BA 1KR2A 2ZYWX 4AP5A 3QI7A 4BMNA 2M1ZA 2AKAB 4H77A 5DTEA 4EABA 1CQIB 1JEQA 2RHOA 1P9LA 1YZKA 3ES9A 1DZ3A 3IBCA 4TXJA 4X3CA 4XD7D 1JFVA 3SIWA 4FILA 1QRDA 2FKNA 3L40A 1QO0A 1WB4A 3LMKA 2Z2ZA 1X2EA 3MRSA 4GIBA 3S29A 4OTZA 3T5CA 5HE8A 1J1IA 2FSGA 2GDZA 2NU6B 3H0CA 3K1JA 1II8A 2BL4A 2YOGA 4JKOA 1YS9A 1ZM2A 4LBVA 3I5XA 1T8YA 2X0DA 1DU4A 4MDYA 4IEIA 2IKSA 4I1IA 3VTAA 1JKJB 2AKEA 2PKWA 3D3EA 1SURA 4MYRA 3QKSA 3DBRB 4ER6A 2NLOA 2XT9A 1O97C 1QWOA 1Z7YA 1E59A 1GTZA 4IDAA 2HJWA 4KAJA 3DV2A 4ZT2A 4NVRA 4B33A 4ND8B 3W4JA 1SHKA 4YP7A 2PA0A 2ZSHA 4LVUA 3T5TA 1AKYA 1RE0A 4DLSA 5BSRA 3N0RA 1W5BA 3KSAC 1GCGA 2UUOA 3EUAA 5TQ0B 1OT3A 3ADKA 1L5OA 1TO1E 1ZJ4A 2IHYA 3LLUA 3NP9A 3QWAA 1OA0A 3OUUA 4TS9A 1E2LA 2G67A 3GAMA 4DNFA 2XQGA 1FW8A 1Z6AA 2WU8A 2FX3A 1X3SA 3G23A 4JJ8A 4PRLA 3TIIA 5A4DA 1KQPA 1SOWA 2J9RA 1USKA 4JBHA 1PYGA 4MI3A 3ZQ6A 1Z56C 3C6KA 5F2EA 4C0LA 5BMVF 3VZQA 2E4UA 4MS1A 1AD2A 2OZEA 3GFVA 2ZWVA 1VPEA 1TB4A 1W19A 3O4GA 2FPIB 2V6GA 4TVOA 1NR7A 3W5BA 1F4VA 1T1RA 3OTIA 2OXFA 4QRIA 3FAZA 2EZ4A 4KR0A 3QE9Y 2RGRA 4PYJA 1V8DA 1YFKA 2NSYA 5ALJA 1UDCA 2FWRA 3AHCA 4REMA 3OSZA 4ROSA 4XB2A 3WZLA 2J9FB 2YZKA 3A7DA 4IG9A 4KXYA 1PL0A 3QWIA 5CFZA 2DXIA 3IEPA 3LT4A 2J7KA 3HN6A 4XX0A 3LUPA 3WWZA 2ZYVX 1VSTA 1WVMA 1F2VA 3H6KA 5DNWA 3V97A 2WDPA 3I61A 3WLAA 1D0IA 3TS1A 1QV7A 1SBQA 1ZUWA 3AR9A 1KZHA 5B5SA 3QEMB 4G0VA 3T34A 3PIRA 1G8JA 3TMAA 2WSSA 4DCMA 3MAGA 3AY0A 4HC4A 2ZITA 3BERA 1E96A 4M37A 4AJKA 4ODIA 2C3UA 1D2RA 1GKYA 1PUJA 4TUYA 1U0TA 3SKYA 2PSSA 2XGJA 1ETHA 3CNQS 3FMGA 3L1VA 4KL8S 2C1EA 3PQ8A 1C7JA 2OA0A 4DNQA 9LDBA 1CU1A 1NMYA 2YW2A 1UBUS 5EG5A 1EVLA 4BUCA 5ISMA 1KKUA 4F2DA 3RASA 2PWPA 1L3CA 1LW7A 1JJFA 3QKRB 2NP7A 2D1TA 3G85A 3BMCB 1G55A 1JQDA 1JHAA 1M8JA 3I64A 3ZGYA 2PANA 3GFGA 3TDKA 1TJNA 1R10A 2ODNA 3OD5A 4GM0A 2REXB 4KR2A 3IMCA 3K30A 3CM0A 4Y1RB 5H82A 2J3EA 4FFLA 3VZSA 4ND4A 2GK6A 4D3DA 1GG9A 4OYHA 3I76A 3KXPA 4MCIA 3C1UA 1Z8DA