4IS3A

Crystal structure of a 3alpha-hydroxysteroid dehydrogenase (baia2) associated with secondary bile acid synthesis from clostridium scindens vpi12708 in complex with a putative nad(+)-oh- adduct at 2.0 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
249
Chain Sequence
b'MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAYRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bile acid 3-alpha hydroxysteroid dehydrogenase
publication title Crystal structure of a 3alpha-hydroxysteroid dehydrogenase (BaiA2) associated with secondary bile acid synthesis from Clostridium scindens VPI12708 in complex with a putative NAD(+)-OH- adduct at 2.0 A resolution
rcsb
source organism Clostridium scindens
molecule tags Oxidoreductase
total genus 82
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.395: 3-alpha-hydroxybile acid CoA 3-dehydrogenase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4is3A00
2R00C 3JQ8A 3COSA 3HDYA 3R6DA 1TVEA 1GYPA 2VOJA 1E1NA 4CM7A 2AE2A 2UYYA 1NWCA 3PPIA 3H4VA 2R00A 3NDIA 2PZMA 5TS3A 4UUOA 4NH4A 3PGJA 1B16A 3DZKA 3QWAA 2OHXA 4NDNE 3RVDA 1QYCA 1M2WA 2NUAA 3QE3A 5KNLA 9LDBA 2NNLD 5HTOA 3IS3A 1XU9A 2BFMA 2VZ9A 1DIHA 1GY8A 5F5NA 2PLAA 3W8FA 3KYBA 1NR1A 5JO9A 4J9VA 4CV3A 2J3KA 2GD1O 4GLLA 1DIRA 3ADPA 3HFGA 2DVMA 1YOVB 1EZ4A 1M75A 2DTDA 3ITKA 4BMSA 4J4TA 1MGOA 1A5ZA 3OMLA 4PLPA 1NFFA 2CF6A 3A28A 2FR8A 1OOEA 2PD4A 4AJIA 4JGBA 5L45A 3RFTA 3EMKA 1AHIA 2PV7A 2VZ8A 1E3JA 5C3MA 2E49A 3MJVA 3OF2A 4GLOA 1VM6A 1EVJA 1T2AA 3RD5A 2FRDA 1ARZA 1O95A 4L0QA 3ZW8A 4RVDA 3H7AA 3JQAD 4YJFA 2Q1WA 4ND3A 3SXPA 2BRUA 3V2HA 2AE1A 4Q3EA 3QV1A 5KVQA 4YVFA 4BL5A 3BMOA 1F17A 1I30A 1Q7BA 4K6CA 3HWRA 1ISIA 2Z95A 3L4BC 2WSBA 1PS0A 1GUYA 1HE2A 5ILOA 1XG5A 3EAGA 4CJXA 1WXDA 3W4JA 2G0TA 2Q1UA 3L4BA 1N7GA 3GN2A 3VPGA 1M66A 3EDMA 2O3RA 3KZVA 4WLFA 2VRCD 3JYQA 3L4SO 4L4SA 3P7MA 4FFLA 4WGGA 5KVVA 3K6JA 4L8VA 4JXKA 3JD2A 2O4CA 3IIEA 1ZKMA 4ZQEA 2BGMA 4M55A 2PD6A 4GWGA 4TSKA 4A03A 3K73O 1O89A 3ICPA 5LDGA 4BO8A 1QRRA 2GERA 1B3BA 2Y66A 4AJJA 3DC2A 1U2DA 3RQSA 1ZK2A 5A4DA 4YAJA 5EQFA 1C3VA 1HL3A 1PWZA 1GQ2A 4GVLA 3A4VA 4BGEA 5C5IA 1E7SA 1MFZA 2QYSA 4P4NA 1OC4A 1DRVA 4XRRA 3AUTA 2FMUA 2HQ1A 3O26A 4RVHA 1D4FA 2VHWA 5DDIP 4G2NA 1RWBA 4K6FA 4CM9A 2BHLA 2NVUB 2FP4A 4IZHA 5IDQA 2X1HA 3I83A 2BMAA 4NK4A 2O3TA 4ND4A 1WZEA 1F8GA 5U9CA 5DOZA 3UOGA 1R66A 3VZSA 5CDGA 4M86A 1W8DA 5FFFA 3GVXA 4E5YA 2VYNA 1HDCA 1S7CA 2ZKLA 4JJIA 2GN4A 3WYCA 3BTVA 2Y05A 4CMAA 1T1RA 5ER6A 1TA4A 4DIOA 2OO5A 3L9WA 4E30A 4KQXA 5IJZA 1X13A 1E1KA 1N1GA 4AICA 3FTNA 5TT0A 4ALKA 3WLFA 2HMVA 3U62A 3H3JA 1P44A 2RAFA 3P5SA 3SBOA 1PL8A 5T57A 3NT5A 4H16A 5JSFA 3KETA 4QXMA 4GWKA 1KVUA 3O8QA 5B1YA 3E8XA 4Y6RA 2D4AA 2HRZA 3AFMA 5FF9A 3U4CA 4II2A 4N5MA 2BI8A 3GZNB 1ONPA 3WTCA 1PJQA 2EV9A 3PI7A 4BNXA 3NJ4A 3UICA 3ZN2A 4AJLA 1C1DA 4G65A 2Y93A 3Q1LA 3RBZA 3TSCA 1YE3A 2O3SA 4CLOA 1EBFA 5CG1A 2NTVA 3PJGA 2A9FA 4JP3A 4WPGA 3V2GA 3AUSA 3VZRA 1GZ6A 3V1UA 4J1TA 1V6AA 1LA2A 4AJ4A 3HFSA 4LRTB 3OFSA 4EGFA 1OC2A 2VUSA 4PFJA 4IDCA 4R54A 3FTPA 4D41A 4E5NA 2Q4EA 1KVQA 4HWKA 1QORA 1C14A 1XIVA 1T2CA 4BNKA 5EN4A 4Z0HO 1WMAA 4WJZA 3QVTA 2DT5A 3F5SA 1HWYA 1DRWA 2X58A 4CM9D 4PG8A 5KJCA 5LDHA 5KJFA 3GEMA 2I6TA 4E2XA 4YAEA 3JQ8B 2WYVA 1D1SA 5FYDA 5AVOA 3AM3A 3QW2A 4IMRA 3GEGA 3QWFA 4RLSA 1RM5A 4DL9A 4DGSA 1YONA 2ILTA 4YBZA 4RQUA 3O4RA 5DP2A 3S55A 2I9PA 1HYGA 4XB2A 1X7HA 2ZIZA 4XCVA 4G81A 1G0NA 1GU7A 2Q45A 4L4XA 3DBLA 5TF4A 4CMKA 3I9OA 1GCOA 3UN1A 3FR7A 4DLLA 1KIFA 3OBBA 4RVGA 4XGKA 3L6OO 1T1SA 3DBHA 4MVJF 1PQPA 3JYNA 1PS8A 3K5PA 3OJLA 2ZK7A 4YA6A 1LLCA 1ZJYA 3LLVA 1IPEA 3BTOA 1LLDA 3KEOA 4OOEA 1DC3A 4LK3A 1T2FA 2NTNA 1KEVA 5ES3A 4RPLA 3VHRA 1PTJA 2D5CA 1VI2A 5G0VA 5A9RA 1PZHA 4AJ1A 1PQUA 3CSDA 3FRJA 3PWSA 3QLJA 3IKTA 4YJFB 4GSLA 5IAAA 3OM9A 3JYOA 4E3ZA 3WMXA 2WWRA 1I2CA 3HDJA 3TZCA 4DMMA 3VVBA 2VHXA 2I76A 1H6CA 3DBVO 4PRKA 2AA3A 4PLCA 5L7YA 2C5EA 5AXBA 4EJ6A 3MJTA 3TN7A 3RU7A 3JYLA 1Y5RA 1BXZA 1RM0A 3LYLA 4Q3NA 3EK2A 4IDGA 4Z9XA 3ONFA 1MXHA 4IQGA 4ZD6A 1SOVA 4K9DA 3CE6A 3ABIA 3KRTA 2ZTMA 4BMNA 2ZQZA 4NU5A 3ULKA 2O3UA 3WYBA 1HETA 2IEDA 1NQOA 1UZNA 1NHGA 1X7GA 5COAA 4XDYA 5AYVA 5I9MA 4TRJA 4NIMA 2HJSA 4GVXA 4Q3CA 3ZI0A 3F1KA 2EKQA 2DQ4A 5JCJA 3INGA 3PQFA 1R0SA 1VSUA 2HK7A 4BKOA 1Z74A 1PJCA 1QLHA 3G3EA 5L9AA 4DC0A 1ZXBA 3FSRA 1GQYA 1ZSNA 3WICA 3E18A 1GZ4A 2YDXA 3SLGA 4ALIA 2FZEA 1IULA 1YXMA 2PGLA 5L7WA 3DZIA 4L75A 4DA9A 3K96A 4XDZA 4YRDA 1EDOA 2NADA 3LK7A 2V65A 4WOKA 3NJ8A 3H65A 5F1KA 1KETA 3C1OA 3FWZA 3KB6A 4TKMA 5JYEA 1K2WA 1GFSA 1XKQA 4GKVA 5F1PA 4B7XA 4BKRA 4WLNA 2HK8A 5DNAA 5JYDA 2QZ9A 3GA0A 3C3XA 1PJTA 3U4IA 1XGKA 1IE3A 1MG0A 3U09A 3OJOA 2WYWA 4J4HA 1U3TA 4KUHA 4CLHA 1JLLA 4XEHA 1NHWA 3FN4A 3BMNB 2J3JA 1E6WA 1U9JA 4R69A 3ZWPA 4PG6A 1LNQA 3IQDB 2IXAA 4W7HA 4BNZA 5BNTA 5T8KA 3TL2A 1NBOA 1YBAA 3MJ4A 1EK6A 3AWDA 3VKUA 3W4IA 2DTEA 2VHVA 4Z3DA 5JY6A 4J16A 1MG5A 4WK6A 2X9VA 4II3A 1KY5A 1P1FA 4XYGA 3DTYA 5COQA 3Q11A 2YQ5A 3LU1A 4NFHA 4BO3A 2C0CA 4B4OA 2D8AA 3GG9A 1IB6A 4OYRA 4PG4A 3I9NA 3NTQA 3CZMA 4YQZA 2Q50A 3CKYA 1QLJA 3O8QB 3GPIA 3DHNA 1VC2A 3PJDA 3D4NA 1RYEA 1I24A 3DHYA 4BNNA 4UUPA 2HJRA 5I7SA 2C2XA 2JD2A 2PKQO 3SEFA 3TRIA 3TZKA 2GZ2A 3GFBA 3IAHA 4CMBA 4CUJA 4CUKA 1EVZA 3H9GA 4NI5A 3WBFA 3AFNA 3X2EA 1LSOA 3HHPA 1U1IA 3ZV3A 5JAIA 1R37A 2ZB4A 2RH4A 3FBTA 4WNCA 1I3LA 5J23A 2YZ7A 5T67A 1T24A 1NPTO 1QG6A 4AJOA 1EFKA 4AFNA 4BNUA 3E5MA 4J7UA 2DC1A 2X23A 1C1DB 5IG2A 4FFPA 4ND1A 4J0FA 5HRUA 1GTMA 4CLOB 3ANMA 3ZU5A 3QJ5A 4YT5A 5BNFA 4CV0A 2D0IA 4XJSA 3WIEA 3B6ZA 5JS6A 3TFQA 4BNGA 4HP8A 1W73A 4QX6A 1VPDA 4TRNA 4O63O 2JKVA 2DBVO 2B37A 1DRUA 1KY4A 4XKJA 5TX7A 1MUUA 2C82A 3W6ZA 3LZ6A 5A03A 4QT0A 4FJ1A 4IMPA 3GHYA 4JJFA 1KEWA 3ASVA 2VRBA 2E37A 3W6UA 1MC4A 5TQVA 4JBGA 1QV6A 1SAYA 4YJDA 3KEQA 3TF5A 2E48A 3OQ6A 3KSUA 2Q2VA 4S1VA 3VAZA 5BSGA 4XA8A 2F1KA 3OHSX 1GQQA 1PEDA 3ON5A 4CMJA 5TLSA 3JD1A 3K9QO 4MIEA 2O2YA 2OXIA 4PZEA 3RUHA 4IPTA 1XWFA 4DRYA 1DAOA 3DBLB 1ISFA 5CEFA 3GR6A 4FOOA 4GX1A 1GADO 1EUDA 4MVJI 1LDYA 2H63A 3RKRA 4BO4A 3C8MA 4LSMA 2YHIB 3DBHB 1N92A 5FI5A 1UXIA 3WTBA 1ONNA 5JAMA 2ZJ0A 2FWMX 5CDUA 1DXYA 5GZ6A 3SC6A 3KHUA 4IDBA 3KSZO 4KWHA 3RC1A 1B8VA 4NR0A 3E6AA 1EQ2A 4K26A 4OSPA 5ITVA 2PZJA 3K8ZA 4XGIA 1ZSYA 1UZMA 4Q9NA 3DBRA 3EZYA 4XYLA 4R1NA 3AY7A 2YHUA 5BQFA 3WSVA 4EDFA 3VPXA 1P77A 4E32A 2Z1NA 4IXWA 2GCGA 4D79A 4BNFA 3JTMA 4DQXA 5DCUA 3RASA 1B3RA 3QVXA 1YVEI 4R68A 1YB1A 3P2YA 3VPHA 3DAFA 2Q2QA 2RBEA 4FC7A 1JA9A 4RF3A 4GBJA 3HE3A 4DREA 2FR1A 3GDFA 1Y7TA 3P19A 4ALMA 5C7LO 2XPCA 3VPSA 5IN4A 1N9GA 2Y68A 3DZHA 5A04A 2VN8A 1ZEJA 2X8LA 3ZWXA 1P74A 2O3JA 4FFRA 2DAPA 3CMCO 4B4WA 1XYGA 4Q39A 4NFYA 4F45A 3QVWA 1ZO8A 4CMCA 4CM4A 1DOHA 4XJTA 1Q0LA 4LVCA 1HSZA 1H6BA 4J4BA 4WCDA 3ASUA 4IDFA 3L9XA 1K89A 2GGSA 1ONOA 2PTGA 3DOJA 4LN1A 1SEPA 4QQRA 4B4UA 2CSUA 1X7DA 3T4EA 2QZZA 1UDBA 1WP4A 3BHMA 4UVDA 1M76A 2XOXA 4PRLA 1DC6A 3VC7A 4E21A 5CDTA 2J5RA 5U4QA 2FOIA 1Y81A 1O6ZA 4HFMA 1A9ZA 3NX4A 1NPYA 4F46A 2EHDA 1JW9B 2VNAA 4P8RA 1SB9A 4IQ8A 4PLWA 3C1AA 4Z0TA 5G2OA 1I3KA 1JN0A 2P9EA 3MTGA 1TXGA 4BUCA 1EFLA 3NRCA 1ISJA 1BW9A 4F6LA 1BXGA 3BTUA 3BMQB 3LC2O 1AE1A 2OBYA 2PK3A 3ZGYA 1ZK1A 2OUIA 3HUDA 3HJAA 4WEQA 1YBMA 2FPIA 3W8DA 4F6CA 3PLRA 3EGOA 1ORRA 5KWEA 3ZWBA 3CINA 2EWMA 2Y99A 2ZTUA 1D8AA 1LQUA 4BNIA 3E5RA 5EL0A 3AU8A 4CLEA 1NX6A 4R5MA 4U8GA 3ROQA 3UVEA 1B2LA 1E3LA 4Y8VA 2VYVA 3B70A 3ZW9A 3A14A 3Q9UA 2CMDA 3S2GA 1LI4A 1HXHA 4B8ZA 4LGVA 2IE0A 2ET6A 2NM0A 3I6QA 4JCOA 2ZTLA 4JX8A 3Q3CA 1X0VA 2B69A 2X86A 4J3FA 3GGPA 3GVIA 4U5QA 1YL5A 5L95A 4MKZA 3Q6IA 3S2FA 4FSHA 5EQDA 1KS9A 4FC6A 4D45A 5CDYA 3H3FA 4MP8A 1H5QA 2AQKA 2Y1DA 1Q0HA 2VCYA 1CF2O 4OKNA 3SVTA 4LMPA 4JQCA 4KDEA 2Q46A 3OJ0A 3V2UA 3ZHBA 5L40A 3ENKA 2CY0A 4CR6A 1EE2A 4BKUA 4PLGA 3U5TA 2DPHA 2AXQA 3WOHA 2Y1OA 2P4HX 2D59A 2W2LA 3DOCA 1YBVA 2HUNA 4BVAA 2HMUA 3CZRA 4JLWA 3IKVA 3GAZA 4M49A 5KOIA 4IM7A 4YXFA 2YQ4A 3AI2A 4EZBA 1PWXA 1ML3A 2RHCA 4BO2A 2W4QA 2GRAA 3GUCA 3OEWA 3T7CA 3VKVA 4ZN6A 4QTZA 2HMSA 4I1IA 1L7EA 5G0WA 3KBOA 2AHRA 4D0RA 1PJSA 4RVSA 1XLTA 1CWUA 2GSDA 1SMKA 1LDMA 3PWZA 3HN2A 2X0NA 6LDHA 1LDEA 1ZJZA 3H9EO 2POQX 5DOVA 2Y0DA 4OHUA 1Q0QA 1SBYA 3RFVA 3WXBA 2VTEA 1E7YA 3ZHXA 2JCYA 3F5QA 3L0DA 4NBVA 5GZ3A 2Y1GA 4BB5A 3ETDA 4BNTA 1SZJG 4D46A 3B1FA 3VDRA 3LLSA 3B1JA 1E6EA 5KTKA 4D7AA 1V9LA 5JY1A 7ADHA 2BGLA 4RORA 4H7PA 5HA5A 4UULA 4YT8A 3H9JA 1LTHR 3K2EA 3DBRB 4GX5A 3WX0A 3ZWYA 3RC9A 4JN6B 1EK5A 2NQ8A 2OL4A 3EVTA 3Q9NA 2ZJ1A 5I9LA 1PS9A 3WIDA 1GR0A 5U1PA 4A5OA 3QVSA 4HADA 3AUAA 4UEJA 1I8TA 1UP7A 4MP3A 2X5KO 4NFSA 4NHEA 4Y9DA 1YDEA 4E5KA 3V1YA 3RC7A 3X2FA 3OH8A 4I8XA 2B35A 2I66A 3FNEA 1Q7CA 2F00A 2J3IA 1PJLA 3E9MA 1NXQA 4OIMA 2CZCA 4IZIA 3LT2A 3VZQA 5F1OA 1W4ZA 4XYEA 2W2KA 4U7WA 4AJPA 2EEZA 4BMVA 4R1UA 1WDLA 1GZ3A 1YH3A 2BGKA 1ISHA 4O1MA 4E4YA 5JC1A 1SOWA 3VVCA 4CV2A 2O7QA 5IF3A 4CM4B 5TIIA 4N18A 2VZ0A 1HF3A 2IDZA 4NNJA 4IIVA 4XIYA 1DC4A 4YAGA 4YT4A 5BR7A 3ETGA 1PJ3A 1ISMA 1VL0A 2AMFA 4R51A 4R5HA 4DQUA 2DFVA 2NQTA 4J6FA 1HDRA 3WNQA 4DMLA 1IHYA 1WNTA 4XQ9A 4GMGA 1GL3A 3GVHA 3K92A 2JCVA 4CM8A 2WMDA 3MJCA 1JVBA 1NQAO 3U3XA 1DHRA 3EYWA 4ZJUA 1Y8QA 5CPFA 2W8ZA 5EERA 2X7HA 2FSSA 4TZTA 1ADGA 3K2BA 5KVCA 1M6WA 3NTOA 3ZWNA 3PHIA 4B79A 3MZ0A 4OL9A 2AQHA 1LDGA 4ZQHA 4AJEA 4I9UA 1WAMA 5EMHA 3WFJA 1BW9B 3AM5A 2YDYA 1BXGB 3LDHA 5ICSA 4WUVA 3DFZA 3OIGA 3RI3A 1Q1NA 4OXNA 4WASA 4WLOA 4KDFA 5T6BA 1IUKA 2QRKA 4AJ2A 4DXHA 4FBGA 3EY4A 1NTOA 4URFA 4CMGA 1LXCA 1DIBA 3D5QA 4L9RA 4E12A 3BHJA 2X0JA 1DJNA 2RH8A 3ANNA 1ULUA 3WLEA 3ZNNA 2WD7A 5L4LA 2CUKA 3QWHA 4QUKA 1BG6A 2QX7A 2YFQA 2QIOA 1FF9A 1R15A 1B7GO 4IUYA 5B37A 4AJKA 3VTZA 3ZV6A 1CRWG 4YQYA 3DZJA 4LISA 2FZWA 4MINA 5C37A 2NU7A 3TL3A 1XEAA 2H1SA 5L4NA 1TLTA 5AXCA 1V3VA 1ZMOA 3IC5A 4ZHSA 3SC4A 4O59O 5MDHA 2V7PA 4IJWA 1LRKA 3PQDA 4GL4A 1HTBA 3R1IA 4J43A 3KUXA 3DOOA 4ALJA 1PZEA 3GNQA 2V6FA 1J5PA 3QY9A 1GD1O 1HYHA 2G76A 4FCCA 1CEQA 3RUIA 3WFIA 4CQMA 3FWNA 1R0KA 3WGIA 1P0FA 5FWNA 4ZRNA 4OM8A 1LUAA 4Z9YA 4BV8A 1QYWA 4CR7A 2D2IA 2OP0A 3IUSA 1DBVO 3WGHA 1E3EA 1LDBA 3JQDA 1QSGA 4EJ0A 1B8UA 1E3IA 5F5LA 3CUKA 1ENOA 3FF4A 3ZU3A 4RQTA 1NR7A 1YRLA 3JV7A 3WBBA 1CQIA 4EUHA 3OSUA 2D5AA 1QYVA 1Z7BA 4CODB 5DT9A 1UUFA 3RUEA 3OJEA 1WW8A 1WDMA 3PVZA 2VYND 1IZ9A 2X22A 2XXJA 2EKPA 1K0UA 1PGOA 2VTDA 2IYOA 3GGOA 3PZRA 1K6IA 3VDQA 5HS4A 1M6HA 4EITA 4JBHA 1HE4A 1YL7A 2B0JA 2BF7A 2CVQA 5IDXA 4C7JA 3C24A 4W6ZA 1A7KA 1K3TA 1PJBA 1EUZA 2W98A 5I7EA 3WG9A 4BKPA 1R16A 1ADCA 5A1TA 2B4RO 1BVUA 1H6AA 1PL7A 1QV7A 2NU9A 4OQZA 3GRPA 5B4VA 2DBRA 4J91A 4MVJA 1KVSA 1UDAA 1PL6A 1EDZA 2GASA 4EEXA 3ZWOA 3KLMX 5DBIA 3WJ7A 8LDHA 5IZ4A 2JCXA 2YUTA 3U9LA 1VKNA 2PR2A 2YYYA 5HS6A 2EP5A 3I4CA 5BSHA 1U3WA 3DXFA 3OA2A 1F12A 5BSEA 1H2BA 3WB9A 3RJ9A 3BMOB 1AUPA 3INTA 4FDAA 2G82A 1N5DA 1UP6A 4BNWA 3UUWA 4CM1A 2JAPA 1WDKA 3N74A 1U7TA 6ADHA 2HSDA 5ICMA 2Y0CA 3RUCA 4YACA 2P5YA 1JVSA 1HE5A 1IL0A 4ZQBA 4Z0PA 4RVFA 3ZWMA 3PTZA 3MOIA 3V1TC 3D4PA 5JNLA 3JCZA 2P91A 1UJMA 2H9IA 4NQZA 4YYZA 4RVUA 1F0YA 3ANLA 3H5NA 1V0JA 2VUTA 1SEVA 2ZB7A 4CLXA 3E48A 3ONDA 3GZ4A 4OKIA 1XQ1A 4KWIA 1CIVA 3INRA 2Q1SA 4IS3A 2B4QA 2G17A 2NVBA 4BO6A 9LDTA 1NQ5A 4WLUA 3OQBA 4RV9A 3T4XA 2DM6A 2IRWA 4XWYA 4FOSA 1IPFA 2W2KB 3KLPX 1PU2A 1YQGA 2NVWA 1NASA 1EVYA 1ZSVA 2ZCUA 2DPGA 4TVBA 2C20A 4TWRA 1V35A 4BGVA 3ZHYA 3BZUA 1BGVA 3WQQA 1CYDA 3SLKA 3DMTC 5ITWA 3PYMA 1K6JA 2GNAA 2EGHA 4D42A 3KYCA 2Y1CA 4GGOA 1QYDA 1GCUA 5ER9A 3DMTA 1LSUA 1UXJA 4ROSA 4N7RA 3FI9A 3BMCA 1EEHA 3MCVA 5T64A 1KVRA 3HADA 3JQFC 2EW8A 1TT5A 2DTXA 2WTBA 4Z6KA 1HEUA 5JFOA 2EGGA 2X9GA 4NJOA 4CM8B 1Y1PA 1LLQA 3O03A 5CP8A 1E7QA 5T8KC 1Y8QB 4I9NA 1I33A 3JQFA 2GDZA 4FFOA 3C85A 4YWJA 2C5AA 1V8BA 1EBUA 1CETA 3ORFA 3PIDA 4MVJD 4WEOA 1FDUA 2PFGA 4WKGA 2IZ0A 3TZQA 3C7CB 2D1YA 1YS4A 4YJHA 3I9JA 4Z9FA 1DIAA 1IZ0A 1P31A 4IXTA 4R4JA 5LCXA 2AG8A 4M89A 2Q2WA 5TJ9A 2EIHA 3RBVA 5H82A 4PLFA 3JQGA 3R3SA 1EMDA 4UEKA 2BD0A 2DBQA 4BB6A 2FPPA 1PGJA 2UVDA 4Q3BA 2DU8A 4K28A 5TGDA 1HDYA 2AQIA 1T4DA 2WD7B 2PGDA 2CF5A 3NYWA 1LJ8A 3PK0A 1UAYA 3RU9A 3WQSB 1NFRA 2I5PO 5JDCC 1ZH8A 3RUAA 1T26A 3ZNPA 3IP1A 4WCFC 2BI7A 3JD0A 2VNSA 5JCXA 2J6IA 5JDCA 5IZCA 4IDAA 5CFZA 4Y6SA 1LBEA 5JCJD 1LSJA 4BQRA 4HNGA 2Y67A 1Y9AA 1J0XO 3WSWA 1CDOA 4WCFA 3ZWWA 4HFJA 2VQ3A 1QP8A 2AQ8A 1YB4A 3WS7A 4J2HA 4LCEA 2JJYA 4EUEA 3DFUA 1BMDA 1QR6A 2QQ5A 3PHHA 4CQMB 1JAXA 2VHYA 3WR5A 3EW7A 2GN8A 1R0LA 1A27A 3UHAA 3OECA 1BDMA 3MOGA 3S8MA 1WLYA 5HM8A 2YV2A 5COBA 4YT2A 1FK8A 1S6YA 1Y8RA 2QYTA 1MFPA 3H8VA 4RDIA 1NWHA 5KKCA 4NBTA 1H9BA 1PJ4A 1HSOA 3BTSA 3IP3A 2J5QA 3NDJA 4R16A 5BT9A 1A9YA 2WM3A 4OMUA 4A7PA 2Z5LA 1ADBA 1OI7A 4NBUA 3RJ5A 4QFDA 1P1IA 1GEGA 2DUWA 3STHA 2Y1EA 4XQGA 3ROMA 3GLQA 1M67A 1H0KA 4M8SA 4IJUA 3PRJA 5IXSA 5B4UA 3ITDA 2YY7A 3DONA 4LSWA 1O8CA 2O2SA 4YEDA 1E7RA 4HY3A 4BGUA 3ROKA 2FPGA 1GYRA 3O38A 3KO8A 4J7CA 1VJ1A 4DUPA 1GUZA 3IOYA 5GY7A 1T25A 5JDIC 4E2WA 3UW3A 1TEHA 1NAIA 2A94A 1B14A 4RGBA 1RJWA 4UVEA 1YOVA 2NWQA 2J3HA 5JPIA 2XAAA 5JDIA 2C07A 3C7DB 1LSSA 3WGOA 4GAEA 1G6KA 2GYYA 4U0JA 3WGZA 4CLDA 1MLDA 3AW9A 4J1NA 4OSOA 2G5CA 3JQBA 4PLVA 1DFGA 4A27A 4R3NA 1LLUA 1E7WA 3ENNA 1O5IA 4UEOA 4UVHA 1A4IA 1AXGA 1WVGA 3MEQA 3WGQA 1U3VA 2AEJA 3D64A 1DLIA 4JROA 4XYBA 2Y1FA 5B4TA 3KSDO 5BNIA 3GAFA 5EIOA 4B3IA 1KEUA 3LF2A 4QO7A 3B20A 1LX6A 2OP1A 2NACA 1EQUA 1O9BA 4PLYA 5LC1A 1X14A 4P4GA 1SB8A 3VOSA 1LC0A 1R12A 2CVZA 4CMHA 1LDNA 3PYXA 3ZV5A 1SCUA 4QEDA 1E3SA 1IOLA 3VH1A 5K6AC 3OETA 5JAQA 1GAEO 3GDGA 4MPDA 5C7OO 1L1FA 4TKLA 5JC8A 2Q4BA 4GQAA 5DBFA 3NAQA 2BKAA 1E5LA 5K6AA 1VKOA 4E0BA 5DN9A 3JQ7A 5L53A 4ZICA 5L7TA 4NBWA 2PKQP 4HX5A 3LVFO 3C1TA 3KYCB 5KCZA 4KZPA 5JXWA 2P9CA 3BYZA 1UXKA 3U49A 1YQDA 1IHXA 2VUUA 3PGXA 4FGSA 2Q1TA 4RDHA 2OORA 4IIUA 3FNGA 4XR4A 2B4TO 3BMCB 4AG3A 1SC6A 3D4OA 4XYMA 1P1KA 3DL2A 4H15A 4KP7A 1TT5B 3ROPA 3W1VA 3JQCA 1UXGA 2C2YA 4KTVE 5ENDA 4EYEA 1KERA 5G4KA 1XSEA 3TWOA 1QMGA 1OZAA 1KYQA 4B3JA 3I9KA 3UCFA 4M54A 1I5RA 1IYZA 2FY8A 3F9IA 2QW8A 4U0KA 3FNHA 2OBNA 5CAEA 4XR9A 1UP4A 2VWHA 5F3RA 1LQTA 5CPBA 5TT1A 1ZNQO 1NVMB 4UUNA 4YJHB 5DULA 3HQ4O 4CMEC 5AQ1A 5CG2A 1DSSG 4BQPA 4XB1A 3PYLA 3E9QA 4TVOA 4TRMA 3A1NA 3KVOA 2ZATA 1JDJA 1GYQA 2EP7A 4MP6A 4YJGA 4CMEA 1P1HA 1Y6JA 3TDKA 3NGLA 3JQGB 3GFGA 1YJQA 3NDRA 5IN5A 3SJ7A 5JMPA 4HBGA 3UXYA 4Y98A 4E5PA 4NU6A 3UH1A 2WE8A 4E2YA 4YAIA 3ICCA 2OOSA 4L76A 3E9NA 4W4TA 4BNHA 4N5LA 2O7SA 3DTTA 1Z75A 4P4LA 1I36A 4C4OA 1T2DA 2EXXA 4W7IA 3JQAA 3ZCXA 4LVUA 4BNLA 2AW5A 4ZU3A 3IJRA 3M6IA 4FFNA 3HN7A 1ZK4A 1MXFA 2AEMA 1I2ZA 4HFNA 4LW8A 4RLHA 4W9NC 4WCFB 3CXRA 3F1LA 1I0ZA 3A06A 4IGFA 2FN7A 3I9MA 5KJ1A 4GPD1 1DIGA 4W9NA 4YR9A 3DEYX 1U28A 4JNKA 2A35A 2UV8A 2OZPA 1U8XX 2CDCA 2JHGA 2VRCA 1FDVA 4O0LA 1Y8RB 4CLRA 3L6EA 1X1TA 5A06A 1DC5A 2ZYDA 1PGPA 3OP4A 4GSKA 5A3JA 1YB5A 4BO9A 4DC1A 3AUUA 1VJTA 2AEFA 4EW6A 3ZU2A 2YFHA 3ZV4A 1E1LA 1C0KA 2GF2A 5THKA 3WDSA 3AM4A 2VT2A 1ZBQA 2B5VA 2DFDA 3EHEA 4NMHA 4I08A 1MX3A 3E03A 3JQEA 1NQTA 3PDUA 4PGFA 4QSMA 3UCEA 1A72A 2HCTA 3HSKA 1HDXA 3ZWVA 3PP8A 4YRAA 1VLLA 3WGYA 1NAHA 2P2SA 2PKRA 1XDWA 3I5MA 4GI2A 5TSDA 4A2CA 4ALNA 1W6UA 2FHSA 2X4GA 4OJNA 4RPJA 1C0PA 3GK3A 2PH5A 2JFHA 4GKBA 2IZ1A 2VYVD 1DB3A 1ZXLA 3NGXA 3GMDA 2WDZA 3E1KA 4RPKA 3M2PA 1RYDA 3M2TA 3IL2A 2PY6A 4XX0A 5A9SA 1I2BA 4MVJM 3TZ6A 3PHGA 4MO2A 3D3EA 1G0OA 1X1EA 2O23A 3HNPA 4RJTA 3LF1A 4J0EA 4UVIA 3RAJA 2ZQYA 3PQEA 1XCBA 2BFOA 3RUDA 2IEBA 4IBOA 1BXKA 4CR8A 2PZLA 2EG9A 4WLVA 5AXDA 1U5CA 3CH6A 4JBIA 3UAGA 1NYTA 4DQVA 3ZDFA 2GR9A 2Q99A 4D3SA 1RPNA 2HRBA 3SJUA 5JW6A 1UZLA 1N9GB 2V6MA 4ZQGA 5I8ZA 4WOJA 4B7CA 1N8KA 3IMFA 2E82A 2W2LD 4HFRA 4BGIA 2EKLA 1GDHA 1OFGA 1H6DA 8ADHA 5TRTA 1NVTA 4XRGA 3FHLA 5A5FA 1R6DA 1PGQA 2EJWA 1I10A 1U8FO 3ZU4A 3DB2A 3JQ7B 1Y5MA 3ZWAA 1WZIA 3VH2A 2JD1A 1E0DA 4OQYA 2LDBA 5L3ZA 4KMSA 3AOGA 4XGNA 4UREA 3CPSA 2XF8A 4JK3A 4YDRA 4CM6A 3F6YA 3TOXA 3PXXA 4ZGWA 2QG4A 1B8PA 3KYDA 1U7HA 1HLDA 1LRLA 2HLPA 4B8WA 3OIFA 1GUFA 1QYXA 5G4KB 2WE7A 4I5DA 3JD4A 1HKUA 1E3WA 1EUCA 4RCVA 3GDOA 3JQ6A 4MKXA 1AXEA 3W4KA 2JFFA 4OXYA 1E77A 2WJPA 4ESOA 1VJ0A 4CL3A 1R4NA 1O94A 4PLZA 1YDWA 1FDWA 3ST7A 3BMNA 3FPLA 1DFHA 1LRJA 4HNHA 4IGEA 4MIYA 4DYVA 4FIZA 5H81A 1DFIA 4CPDA 3HDQA 4M87A 1WPQA 2I3AA 4R3WA 2GPTA 2P4QA 1C0IA 1G1AA 2UDPA 4J49A 4YJGB 4GH5A 1JAYA 3H2SA 1ZVMA 5K9ZA 1E1MA 3F47A 1YKFA 1F14A 1NM5A 4BO0A 3BIOA 4PZDA 1IY8A 2O3QA 1FXSA 2BH9A 3F4LA 4CV1A 1ULSA 3CIFA 4P22A 3DZBA 5EJ2A 4PLTA 4OGWA 4L4RA 4XZ3A 2PA3A 3PHJA 1F8FA 3GEDA 5CEJA 3QA9A 4JIGA 4RO0A 5TNXA 3Q2KA 4D3DA 5IXYA 5KJEA 5THQA 3R0IA 4D0SA 5JMWA 3JQAB 1JWAB 3TOZA 2I67A 4HUJA 3NV9A 4I5FA 1H9AA 4AL4A 4FS3A 5I9NA 5FI3A 1Z6ZA 1PR3A 4ND2A 4FFMA 5ILGA 1ZFNA 3RWBA 4CM5A 1N2SA 4YAKA 5CDSA 1XQ6A 1NPDA 2W90A 1XA0A 1H93A 3PJEA 2JHFA 4B7UA 1EVIA 3GH3A 4FPXA 4YRBA 4DLBA 1XHLA 4ALLA 1PSDA 3QSGA 1DPGA 1ZIDA 1K5HA 1BDBA 1SNYA 2ZB8A 1L7DA 2VWQA 3GRKA 4PCVA 4MVJP 3WYEA 4NZ9A 4CLRB 1NNUA 4BIIA 1JKJA 3WGTA 3E82A 3AI3A 4WECA 1R4MA 2DLDA 4DLAA 4YCAA 4LRSB 1PJ2A 3NUGA 4GGPA 3U0BA 4Y6PA 1MC5A 1WMBA 3DQPA 2C7VA 3H9UA 3OIDA 1Z45A 1RKXA 3L07A 3GOHA 5L4SA 3NTRA 2CNBA 3WWYA 5JO0A 2I65A 2JL1A 3RKUA 4O6VA 4PVDA 4I5EA 4FD3A 1E6UA 3B1KA 3PFFA 3EUWA 2DBZA 1PR9A 2PH3A 1QXSA 4GMFA 4E13A 1WWKA 3GHHA 1JQBA 2VWPA 1LEHA 1T2EA 4ZA2A 4FN4A 3I3OA 1YGYA 4BNJA 1V3UA 2JAHA 2R6JA 1KC1A 2WEKA 3M1AA 1K6XA 5A3VA 2EF1A 1C0LA 3MWDB 1KBZA 2C7GA 3ZH2A 3A9WA 2YHIA 3EC7A 2QHXA 3UF0A 3RC2A 3O9ZA 4RL6A 2B36A 1GPDG 1SPXA 2BFPA 5A9SB 3I6IA 1GV1A 5A02A 1YWGO 5L51A 4OAQA 5F21A 4MKRA 1P1RA 4ILKA 4Y67A 1PQWA 3WGGA 2V6BA 1YL6A 2VOEA 2GO1A 3QIVA 7MDHA 4ZQFA 3I23A 3BA1A 3QWIA 2QRJA 4JP2A 3WNVA 4DBVO 5KIAA 5JE8A 4A26A 1TI7A 1U3UA 3H5RA 1C1XA 1AN9A 3LQFA 1DJQA 2TMGA 1ZCJA 4KTTE 4TRRA 4BOYA 4B4VA 5KKAA 4G5HA 4CQMD 2FSVA 2LDXA 4KQWA 1DAPA 3UCXA 3OQ1A 5BSFA 4R1TA 4CL8A 3EZLA 3DZGA 1GEEA 2I99A 3BHIA 1I3NA 2CD9A 1BVRA 4QFCA 4PLHA 4AJNA 1KC3A 2X0RA 1UR5A 2X5OA 3GVCA 3JYPA 5IDYA 2P68A 3ETEA 4A73A 4CMIA 3R3JA 2BELA 3HB5X 1JKFA 2GUGA 2EJVA 1F06A 1BWSA 1PGNA 4NBRA 4EBFA 3KOUA 2UAGA 4QECA 4R41A 5KVSA 4Q3DA 3KXDA 5C7IO 1HYEA 1NFQA 2FR0A 1HT0A 2HMWA 2WD8A 3KV3O 3H5AA 4MDHA 4CQLA 2C29D 4DTIA 3AOEC 4OOFA 2R2GA 4J1QA 2E4AA 2HDHA 2HK9A 4I5GA 2CDAA 3AY6A 5EPOA 4E33A 2A4KA 1N7HA 4UUMA 3DZFA 3AOEA 3U4HA 1U4SA 1GPJA 2QRLA 1CQJA 1P9LA 4FGWA 1UH5A 4AVYA 3GMSA 3G49A 1PZGA 4IJVA 3LC1O 3KYDB 2RCYA 1U5AA 2IYPA 4FQ8A 2OGUA 1HRDA 3PZBA 3MTJA 3RCBA 3VTFA 3TNLA 1RM4A 1D3AA 2NV6A 2Q49A 2YW9A 4YB8A 3IJPA 4NJMA 4RZIA 4UVGA 2CDBA 4KUEA 1E3WB 2X5JO 3CTMA 3PIIA 3GN1A 4BHTA 1DDOA 1PIWA 3GQVA 3ZWCA 3W8EA 1R4NB 1Z7EA 3D3WA 1MV8A 5DBGA 4DBZA 1HDGO 5EINA 5B12A 2HO5A 2NU8A 4IDEA 3BMQA 1XU7A 3K30A 4LCJA 1ZUD1 5G0UA 3U4DA 2G1UA 4NPCA 2J8ZA 3PFWO 1P45A 3RROA 3KM0A 2Y0EA 2C54A 1T4BA 2ZYGA 4MVJG 2B5WA 5IZCC 1VRWA 1OMOA 5DZSA 3FNFA 4DVJA 2NSDA 2PZKA 3ADOA 4ND5A 1E92A 3WWZA 3DHEA 5FEUA 2UUPA 5G0TA 1ENPA 1Q7GA 5CHEA 3VPFA 5ENVA 3I52A 1E7MA 4E2ZA 1PX0A 3PJFA 4BNMA 1Q2XA 1HE3A 1YQXA 2BLLA 5TC4A 5T5QA 2HAEA 4MJLA 5AOVA 2OFPA 1E5QA 1SO8A 3LT0A 4J2OA 4RZHA 2PGJA 2PWZA 1ZK0A 1ZMTA 4CM3A 2AG5A 2B83A 4EJMA 4PZCA 4UAGA 1J49A 4W82A 4CUZA 4U6SA 3PWKA 1P33A 4RPHA 2O4UX 2GZ1A 3UFXA 3GPDG 3PEFA 4XQCA 3K31A 1QKIA 1V3TA 2NLOA 3GGGA 2WYUA 3OEYA 3UGKA 1KEPA 2IODA 4FJ2A 1B26A 2UUOA 2O50A 3L77A 4IDDA 2V6GA 3PDJA 4H3VA 4WNIA 2GN9A 1YO6A 1O0SA 4P38A 2HU2A 3H9QA 4FR5A 1R4MB 4EEZA 3D1LA 4O5OA 1AHHA 4YTEA 3P2OA 3VH4A 4TROA 4I9HA 4BKQA 1OAAA 1ENYA 1VSVA 4E5MA 3PLNA 3G1TA 1P0CA 1UXHA 3EVNA 4EI2A 3V5NA 1U2GA 3CEAA 4RPGA 2CFCA 4PG5A 2EW2A 5HWSA 1B0AA 4D43A 2XXBA 3PHLA 3QP9A 4DYDA 5KJ6A 2IZZA 4HKTA 3GVPA 4J7XA 3ZNOA 4LMRA 3G79A 3RFXA 4D44A 3QRWA 1DLJA 1A71A 1H2HA 1Z73A 2VT3A 4U6QA 3GNTA 1BTOA 1XR3A 2VWGA 1UAGA 3JQBC 4RF4A 1J6UA 1HLPA 2YV1A 2O48X 1U4OA 4IINA 1FJHA 4BV9A 4A0SA 1VL6A 1ZEMA 3S2IA 2ZB3A 1D7OA 4JJGA 3GNSA 3LSYA 3FD8A 4HV4A 2PD3A 2HMTA 3LT1A 4IJKA 4OO3A 4Q3AA 5ADHA 1ENZA 1YJ8A 5TJHA 4W99A 4EUFA 3M1LA 4ITUA 3G1UA 5JLAA 1I32A 4INAA 1TB4A 3V8BA 1JU9A 3FR8A 4XQEA 3JD3A 3MJEA 4A10A 3QQPA 1FDSA 4C7KA 2Q3EA 1ZW1A 3G17A 3IDSA 5K0ZA 2BFAA 4ZRMA 3QWBA 1C1XB 1N1EA 4R9SA 3ZHZA 2C59A 3MJSA 2VHZA 3C7AA 3F46A 3DMYA 3RSHA 3ONEA 4XIJA 4PN3A 4ZVVA 2GLXA 3OA0A 1CJCA 2YV3A 5GZ1A 4J9UE 2GZ3A 5G4LA 1ZK3A 3FPCA 4BNYA 4B3HA 1P3DA 1UDCA 3I4FA 2A92A 4XD2A 5HBRA 4MVJE 4D3FA 4NG5A 2E6UX 4CMIB 5JAZA 4IS2A 4X54A 4BO1A 1MA0A 3AK4A 4MOWA 4MVJH 4OH1A 4DWVA 1JTVA 2X9NA 4Z3KA 3AJRA 3KTDA 1GV0A 1BRMA 5DCYA 4KUGA 2NU6A 1OBFO 2J5KA 1W0CA 1DHTA 4S3MA 3LC7O 3HDHA 1A4UA 5EESA 2H6EA 1B15A 2HKIA 4CQLB 5CEEA 5DCWA 4HXYA 4N5NA 1TT7A 3MWEB 4BO7A 1Z82A 4FW8A 5DF1A 4AJHA 1CERA 2Z1MA 1HDOA 3ZZNA 4GX0A 3WJAA 3AU9A 1A7AA 3FBGA 1ZZEA 1HZJA 3NT4A 3VZPA 4F3YA 1X15A 4J90A 4WE3A 3D7LA 1DEHA 2TMDA 4OXKA 1KVTA 2NVUA 1P1JA 3H6KA 4R1SA 3G0OA 3RUFA 3T7EA 4TMFA 4BNVA 3D5TA 4N54A 5I8WA 1I3MA 3RIHA 4TZKA 4E31A 5H83A 1MB4A 4FJ0A 3FCOA 4NJMB 5A9TA 3AI1A 1I01A 1X0XA 3JQ9C 5I7FA 3WQRA 3I1JA 3VH3A 1LU9A 4K1LA 3QHAA 3Q2IA 4ID9A 1ID1A 4E6PA 5A05A 4IQ0A 3JQ9A 4IY1A 3DAPA 3DR3A 3D3WB 3IUPA 3OICA 1FMCA 3SX2A 1NP3A 1LC3A 2X0IA 3BXXA 3TZHA 1PZFA 4MIOA 3ZNQA 4J1SA 3NEPX 4DPLA 5DP1A 5A5EA 3UKOA 1NVGA 3N58A 3TPCA 3CMMA 2P9GA 4DIFA 1J4AA 4R9RA 1ADFA 1ISGA 3TQHA 1HZZA 2PNFA 3HB4X 4DIBA 1HDZA 3GC6A 4RF2A 3BAZA 2NTJA 1JKIA 4R01A 4TQGA 2SCUA 3QVOA 2ZCVA 1AGNA 1JWBB 4NK5A 4QO8A 3DO5A 3I9LA 2DUUA 4BO5A 2GN6A 2OMEA 4RF5A 5MGBA 1VL8A 3LT4A 5JBIA 2RIRA 4L74A 3WMWA 3S2EA 3GZNA 1BSVA 3JSAA 3GT0A 3F3SA 3L6DA 1KOLA 3NT2A 4YPOA 2IXBA 2ZYAA 2YJZA 3DWFA 4PVCA 3RBXA 5I7VA 2JD0A 5AXAA 1DO8A 4GX2A 3TFOA 4PIVA 4FB5A 3NKLA 3OJFA 2X6TA 5G0SA 3GUYA 3HG7A 5IFLA 2JFGA 4DPKA 1VE9A 4L73A 2D3TA 1RM3A 1EE9A 2P5UA 2RHRA 4M1QA 4ONEA 2H5LA 2ZTVA 3GG2A 4WLEA 2DKNA 1FDTA 3AY3A 3DDNA 3GY0A 1Y9EA 4PG7A 4BS9A 3Q0EA 4DPMA 3S1LA 5IDWA 2I3GA 1D1TA 3DAGA 3F4BA 4KOAA 2EERA 3D0OA 1XELA 3TJRA 1BHSA 3GF4A 5GMOA 1MP0A 3N7UA 1H94A 3H2ZA 2CVOA 3HZZA
chains in the Genus database with same CATH superfamily
1BWQA 1UJCA 3HRKA 2MINB 1TYCA 4XDHA 2GZMA 2GK3A 5JWRA 1IVSA 2XUZA 2EJUA 3IDOA 2VOJA 3IV6A 4GRDA 2PZFA 4UXJA 5CLQA 5I4BA 2AE2A 2UYYA 4HB3A 1NWCA 2BKVA 1KEEB 3VDMA 1SZPA 3L04A 5CVVA 5AMXA 3EX7C 2Q3MA 3K5HA 2V3CC 3GA7A 3QWAA 2OGTA 4UEWA 3S3TA 5KNLA 2NNLD 2RONA 1E4EB 3MFQA 1XU9A 2HSWA 2ZJ6A 2BFMA 3FGOA 3JW8A 2VZ9A 2GXSA 4J75A 5F5NA 1PT8A 4ETNA 3KYBA 2P11A 1QX4A 3NEJA 4HZIA 3EGIA 3EIXA 5DXAA 2GD1O 5JO9A 1XNQB 4WKPA 1XT6A 3ADPA 3WISA 1NN1A 3TDMA 1Z4KA 2XTJA 3NFYA 4PLPA 1NFFA 2JHCA 2CF6A 3D3JA 3A28A 3UV3A 2QBYA 1YC2A 1OOEA 2ETVA 2PD4A 4JGBA 4BC1A 3RFTA 4NZMA 1HA3A 4FU0A 2CLHB 4JC5A 1AHIA 1ITZA 3L7KA 5CNMA 1E3JA 4D4IA 4DG8A 1VA5A 4DWWA 5C3MA 4G8BA 3RD5A 4DKXA 5BOSB 1VMIA 2W6PA 1HC7A 5GIOE 1UIRA 1JVNA 4LF8B 2QD4A 3WK7A 121PA 1XEWY 2W0SA 2PMBA 1T36A 1WKCA 4ESEA 5C46F 5K3OA 1SQ0A 2HIAA 1G7CA 1SBNE 3AWIA 1P18A 3I12A 4OK3A 3V2HA 5ISMA 1I4LD 1ZKDA 1TC1A 4Q3EA 4C4YA 1UZAA 1GAXA 4ZO4A 1R5BA 2WW8A 4YVFA 1QZUA 2E4YA 3BMOA 3V7WA 2Q6IA 1Q7BA 2Y1LA 3HWRA 4K6CA 3FCUB 2Z95A 3T52A 2CW5A 2F3PA 2WSBA 4LK2A 4ZKDA 5IBCA 5AW1A 1GUYA 1HE2A 4MIKA 1L0BA 3CRVA 3ENVA 2Z1DA 2IH2A 4BXOB 1UJ6A 1AG9A 2EATA 2GJ9A 2Y1KA 2JFVA 1TJYA 2B78A 1HQYE 2Q6LA 4HDNA 4EMTA 3GN2A 3W34A 5LWQA 2BLNA 3TX6A 5HF5A 2O3RA 3KZVA 4BX8A 3G85A 3LXXA 1R27A 5EXTA 2PT7A 4AUMA 3MIZA 5HKLA 2YWRA 2GPJA 3DEHA 3C6BA 2HWKA 3P7MA 4WGGA 2GF0A 3IOMA 4JXKA 3JD2A 2FWIA 2IU3A 2FPLA 4I6JA 4XGRA 3LS2A 4DLWA 4P3XA 4YV7A 5JRJA 4KL8S 5TVKA 4MW6A 2YJGA 3L0SA 1NVXQ 1XDDA 3N7TA 5BV7A 4GWGA 1QE5A 4ZI2A 5KYTA 2H7YA 4XFDA 1QDLB 1CRLA 1U2DC 1M9NA 5FXMA 721PA 4QPDA 4GIBA 4M1OA 1V26A 1EG7A 2VQ6A 1P9OA 4RY0A 2GERA 2CWWA 3GIWA 1NVVR 2AUTA 1QGZA 1U2DA 1T13A 1U1CA 1V96A 1ZK2A 1NJ6A 1T6ZA 2CLMB 2XA9A 4HAVA 1C3VA 4YAJA 2X4LA 1S3SA 5KQGA 3VNUA 3IYLW 2RGEA 1E7SA 4L0MA 1WF6A 2B25A 3KE8A 4FHZA 4ZU6X 4V0OA 4WBNF 1V4NA 2HQ1A 4ZQIA 1U3CA 2VHWA 3EG5A 5C80A 1RWBA 4K6FA 5CDHA 2OD2A 3G9ZA 1DQRA 1FVOA 2BHLA 3TG2A 2MSCB 4X94A 4D4LA 5KTMA 1M2OB 2FUEA 1KH1A 3E15A 3WHLA 3ZIDA 2X1HA 2V55B 1FYDA 4Y2GA 4UE6A 3WQBA 1KMNA 3AUYA 1WE2A 3KR9A 4S1WA 1WZEA 2P69A 1HFEL 4WBNA 5U9CA 1KJWA 1V8PA 2A30A 2PJRA 1M1YE 2B6HA 3CWZA 1M34A 2ZWVA 1J9GA 2VDWA 2ZGVA 1A95A 3HDGA 3JX9A 3FLMA 1DX4A 3ND8A 3U40A 5IT4A 4NOMA 1QO7A 4JI3B 3OTWA 1E9RA 3ZKAA 3KDPA 3HBMA 3VOTA 4O2BB 3FWKA 5LN1A 2OO5C 1EB9A 3TLEA 5BR4A 1BQ3A 4Z2YA 1VBMA 2NXWA 3KPJA 2O07A 5AK0A 1T1RA 5DNDA 1FEZA 5IABA 4JP1A 4XTCS 2ZT7A 1GQSA 3DEZA 4DLSA 2OO5A 3M6LA 2PX3A 3GLGB 1K75A 4KIJA 1X13A 4PR3A 4AICA 4EZIA 1ODFA 1ZX1A 2HMVA 5CM2Z 4DZZA 1JYFA 4ZV4A 3Q7PA 3ZWKA 1PL8A 4UCQA 3C4VA 3T12A 3NT5A 3P32A 2HCBA 4JJZA 1SK8A 1XXHA 3H2HA 4GWKA 1BEUB 1ZM4A 2GD6A 1WY5A 5B1YA 2F9LA 3MT9A 3WLLA 4O0MA 2HRZA 4D8YA 2BWJA 3OCZA 1JQDA 1EX9A 3U4CA 2P27A 4N5MA 2BI8A 1MV5A 2FDXA 2ILVA 3PNSA 3UXHA 3TECE 4C6SA 1SKYE 5JFGA 2N3ZA 2ZRBA 3GCXA 1JNXX 1OILA 3HWX1 1UBJS 1H23A 1A3CA 5KPJA 4UZFA 3UICA 1NI3A 1SKBA 2FQ1A 3A36A 4WVLA 3WKCA 4OQPA 3K6KA 1DG3A 4LBZA 2C2WA 3C48A 3Q1LA 2JVJA 3H5VA 4HRAA 3RBZA 3TSCA 1YE3A 1Z6PA 2QN7A 2PE5A 5BN5A 2CE2X 4ADSG 3UC9A 4AW9A 2HMYB 4JP3A 3AVWA 3AUSA 1GZ6A 4OQEA 4LWQA 1N7JA 5HFJA 3AJDA 3KLBA 4TM7A 1V6AA 1LA2A 2XWPA 2VXYA 3HFSA 1IFXA 3PKZA 2R7LA 3I9V6 1OC2A 4RPCA 3MT8A 5FPSA 1CZRA 1QK4A 1U90A 2XBLA 2VUSA 1ELOA 4H7HA 5AI4A 3MJRA 1R8XA 1KY2A 2ONZA 3DPUA 5ALRA 3L7AA 3TR6A 1QORA 3CUWA 2WLTA 1C14A 1T2CA 1FYFA 2B4KA 4F06A 5EN4A 4Z0HO 3BE8A 3SQWA 3VO1A 3ND6A 1DRWA 1UF9A 1Z56C 4YJ2F 3OMXA 3E5HA 1COWD 3NUZA 1G55A 2HB6A 1H2XA 2I6TA 3B7WA 1WZ2A 4BEJA 1UL1X 5FYDA 1D1SA 5AVOA 1P3JA 1UKYA 1CSEE 1Y1QA 3JARA 4E51A 3KEFA 3QWFA 3NR2A 3B6MA 1J33A 4IDQA 1RMQA 2Z6VA 3IHLA 3Q10A 4P36A 3MRXA 4R2XA 4WN3A 4BLQA 4YJ2A 4UUAA 3GJ6A 1MO6A 1DC8A 1V5GA 4RQUA 3AR6A 5DP2A 4QM7A 1D6MA 1E1QD 4HN2A 2I9PA 4BBJA 5AP9A 4XB2A 5IUNC 4F4HA 1ODJA 3HA3A 4XCVA 2HRRA 2E18A 3UN1A 4YRPA 1H8HD 4XWGA 3SZLA 3A9CA 3DJFA 1T3SA 2JFUA 3OBBA 4P31A 4RVGA 1VMAA 3TZLA 3UMCA 3L6OO 1U0GA 2CXPA 2Q3FA 5G53C 1OH7A 2R6DA 1JX6A 3FKJA 5AJWA 1IN1A 5ESWA 1X9GA 2ZK7A 4CKBA 1XDSA 3QFFA 4KR3A 1P61B 2EJTA 5C34B 1LLDA 3VSDA 5C7YA 1R0ZA 3BWMA 4NF2A 2QBYB 2O54A 1L8LA 3EIUA 1T2FA 4G24A 2XKBA 2EL7A 4V0LA 2VCHA 5HUHA 2D5CA 1VI2A 5HJ2A 1Y1RA 1Z5VA 3DA8A 3A1WA 1EVLA 3AF2A 5A9RA 2NP6A 1PR5A 5A7FA 4Z4QA 1PZHA 4AJ1A 1G41A 2JIBA 2XTZA 2VUIB 3OLCX 4H1HA 3V8RA 1QNLA 3UT5B 3GLHA 2AXEA 5IAAA 1BX0A 1T36B 3TOSA 4YUVA 1RR6A 5DLDA 3GMTA 2E4ZA 1VI6A 1NTRA 1XC7A 4KQ2A 4DMMA 2D5IA 3HP4A 2CMKA 4DLUA 3VVBA 4XVCA 1TUBA 3Q9SA 4O29A 5DI9A 3BGVA 1Z4QA 1PEAA 4M98A 4AS1A 3BJZA 3AHIA 5CJPA 5D86A 2C5EA 2ABWA 5L7YA 1EUQA 1WP9A 3IJ5A 1O6BA 3QU7A 2QRNA 2J9YB 4QTXA 3HI4A 4G85A 1T1IA 4KXWA 3FTCA 3LXUX 2ZJYA 3EK2A 4G36A 5EMKA 1IXRC 1RHRA 2RAVA 4HDNB 4K9DA 4LYAA 3CE6A 3KRTA 6ABPA 3WLPA 3KPYA 1AD2A 2C4HA 2EBWA 3ULKA 4ZCQA 1RQ7A 3ZCSA 3LCMA 1J0BA 1UZNA 1NHGA 4D8UA 3U56A 4XDYA 3BD8A 3GXOA 4MZDA 1G8YA 4DMHA 2HJSA 1Z18A 3AIIA 3IJEB 1TAGA 1M5UA 3PA6A 4K9NA 4PZPA 1C8KA 1LFDB 3INGA 4EH1A 5FWAA 5GQSA 5JTTA 2E1PA 1RHJA 5L9AA 4KGXA 4RX1A 2ZTHA 2XLBA 3FSRA 2JLYA 3E18A 1ZVKA 3R3ZA 4FMDF 2YOGA 4CU2A 10MHA 1QP0A 2AH5A 4B4DA 4OHBA 2QM8A 3UQYS 4W5JA 2PBZA 4GI3A 2XD4A 4E1VA 2Z09A 4XDZA 5G1PA 2GZAA 3IHWA 2X2FA 4NX2A 4Z4FA 3WB2A 3OZUA 1Z2CA 2BV3A 1X42A 1MJNA 2G09A 2C3MA 3EVBA 3MSXA 3NJ8A 2JAOA 3QKRA 4FMBB 4PQGA 1Z0UA 4S0ZA 1KETA 1V5WA 1DAEA 1UPBA 2RIPA 3PNMA 5JYEA 4BKRA 1GG5A 2B7CA 2J48A 2HK8A 2VCEA 4MGIR 1OV4A 2HPHA 3BL5A 4YPVA 1J09A 3GA0A 1AA6A 1SM4A 1YR7A 2K2WA 4U2CA 3K1ZA 5B55A 1PJTA 3U4IA 4GRIA 4IH9A 4Q4DA 4UDYX 4X63A 2C8KA 1QF6A 2HOQA 2C9BA 3LUKA 4WBNB 1YRBA 4KMMA 1XLVA 1JJFA 4F0JA 7MHTA 4F8JA 1U65A 4J4HA 1UBFA 3W6PA 1M34B 4UOEA 4CLHA 2VDWB 3WV4A 1NHWA 3FN4A 4G26A 2ISSD 2C00A 3D8RA 2J3JA 1E6WA 4R69A 3OZGA 1GRRA 4PG6A 5K3SA 1BWPA 4JQOA 2EYUA 3TL2A 1NBOA 3GUZA 2IIQA 3W4IA 1Q1AA 3T3MB 3O3CA 3AGQA 4IEFB 2DTEA 4Z3DA 5JY6A 2W6QA 1JAHA 1DQPA 4WK6A 3PC4A 6NULA 2R47A 4XYGA 1P1FA 1XKLA 4G0MA 4ZYLA 2FPXA 3Q11A 4C2BA 4ZVTA 2F64A 2XNSA 1GG2A 4LBWA 1T8RA 3G59A 3W6NA 3I9NA 3U3KA 4EKDA 2CVPA 1XXHB 2Q50A 4N47A 4MGEA 3S29A 5C32A 3U7FB 3MWJA 3K32A 3THXB 4NOKA 2QM7A 4OQNA 1E60A 4UUPA 3K9HA 2E55A 3GJ4A 2Q0SA 2LRHA 2TMYA 1YFLA 3L7IA 5KSZA 3QU5A 3HVRA 1EVZA 3I58A 3F49S 3TRJA 5CK4A 1EJ0A 3D6MA 3HJCA 2WFAA 4C4PA 4E88A 3ZV3A 4ITRC 3EGWA 3WXMA 1R37A 2G4VA 2UKDA 4WNCA 1I3LA 2MYUA 4O33A 4BMCA 5DWVA 4AB1A 1SCQA 2GD0A 2QVZX 5J4KA 3P9QA 1ZWLA 3E5MA 4PR0A 2X23A 2RGXA 1G8GA 2XUHA 1JS1X 1W96A 4PF1A 3ANMA 4CV0A 5BNFA 3BDIA 3HZOA 4BVLA 1E2JA 2D0IA 2R11A 2WQZA 4QX6A 1NJ1A 3TUJC 4JR1A 2WKSA 3EZGA 2VBGA 4IFEA 3V8VA 3ANSA 4XKJA 4WZAE 3U4AA 1MUUA 2C82A 3W6ZA 5PGMA 1AF7A 3B78A 3IURA 3A2LA 2WUFA 1FFSA 3MINA 3GHYA 4DQ0A 1KYIA 1J0EA 4DDTA 1KEWA 3ASVA 3GWZA 3MJFA 3W6UA 2E37A 2ZQ5A 1SAYA 4YJDA 1NJ5A 4DMUB 5CCXA 4AMUA 3OESA 4B35A 2I78A 3KEQA 2R1ZA 2R7AA 4U5XA 4EYSA 2E48A 5KYNA 3A6ZA 1CR2A 1GNPA 2Q2VA 3JARB 4S1VA 4M21A 4MQFA 2RC5A 1WG8A 1R8JA 3CRRA 4XA8A 1AX9A 2F1KA 3K9NA 3MILA 4URWR 3OHSX 4PEVA 2NZ2A 2WR8A 3ON5A 4G5GA 3WGLA 3I2KA 4YJ2B 4CMJA 4QDTA 2JLZA 1BFKA 1VMDA 3KPUA 3H8SA 5DHSA 3MS2A 5EP3A 3E4DA 4X0EA 2OXIA 4CIBA 3T34A 5B1EA 5KOJA 2BEVA 1F20A 3ML1A 2LKCA 4HDQB 4Q4LA 3UNXA 4KH1A 5DU2A 2LCQA 4DRYA 4CHTA 1DAOA 3DAHA 1ISFA 1QVZA 3GR6A 4FOOA 2XT9A 4BO4A 1QS0A 1NW3A 2H63A 3RKRA 5JPCA 1TAHA 1QFXA 4X1IA 4ZODA 3NU1A 5I51A 3IE2A 3WTBA 1VE1A 2QXYA 1Y3FE 4CKBB 1TF7A 2ZJ0A 2IPXA 3IR7A 2UZ4A 1TAUA 5CB8A 2Q9CA 4F7DA 2IDMA 1JSZA 3QTBA 2XNDD 2PUGA 4MMXB 4ENTA 2NUTA 3KR1A 3WGVA 1FW8A 2FKNA 1JHYA 3WNCA 4MJ3A 3SC6A 1OVGA 5JZMA 4IDBA 3L93A 2C96A 1B8VA 2Z2JA 3EIHA 3LQRA 1O4WA 4MVWA 5UKDA 2QSYA 4BFYA 1OFUA 4BRZA 1FFGA 2R8PA 2GKSA 4XD7A 4N9QA 5ITVA 1D04A 1JXAA 3K8ZA 2RHLA 3GLHB 4QPJC 1HEYA 4XGIA 3EZYA 1BEEA 1GTG1 5JV5A 3AIKA 3NHMA 2YHUA 4O8ZA 5CGQB 2PWPA 1C4OA 2CXQA 4TMKA 1TUBB 1Z2NX 3GJZA 2X15A 4IXWA 4MO9A 1DJOA 3H04A 1FTWA 2CEAA 1Z47A 5DTJA 1G7TA 2BHSA 2HSJA 2RC6A 1Y5LA 1JJAA 2OCXA 3I1FA 4MR7A 4QU5A 4B83A 2XKKA 2FW0A 1YVEI 1W5FA 3MCZA 4JLUA 4X61A 5KB3A 2ZM5A 2JGMA 3CW8X 5KHLB 4IJQA 2G25A 1M8FA 2RBEA 4FC7A 4O4JF 4H0CA 4TTQA 3SF0A 3MTQA 1PRYA 4Q4HA 3W8NA 3GDFA 1Y7TA 1NMEA 4ALMA 4ARSA 2OFOA 4P7KA 2XPCA 4HT3B 5K7SA 5IN4A 5HQJA 1P1CA 1TTQB 2TECE 1UBNA 2O06A 1M83A 4FILA 5HG0A 3PNQA 3DL4A 4QYIA 2HJVA 1C4KA 3HJTA 4O4JA 3ZWXA 2GCOB 2Q5HA 2OAGA 4Q1CA 2AG6A 5MF6A 2QTVA 3KSBC 1Z28A 2D00A 5T4EA 4B4WA 4X3CA 1SRRA 4Q39A 4NFYA 3U3ZA 1XDUA 2GMWA 2ZRAA 5CLHA 2OGWA 3VHLB 4C1NA 3VC3A 1CZHA 2QQGA 4GZLA 2QVCA 2PUTA 5AVZA 1Q7RA 4KXYA 4GSYA 4P7GA 4XJTA 4Y3UA 4BJ3A 1HSZA 4DJFC 2DG2A 4KO4S 2C9YA 2RGNC 3HH8A 5ARDA 3UUGA 4BPRA 5IWCA 3ASUA 4IDFA 4ZI5A 1XE3A 1K89A 1T9CA 1AQIA 1W5AA 1SHZA 2B21A 2I3ZA 5DRTA 3FDZB 4OD0A 4FMDB 2OV1A 1SEPA 3QKRB 1N4AA 3TZBA 4AG6A 4H17A 5CR9A 1JR2A 5FUBA 3KX2A 4KAXA 4X64B 5SY6A 5ARBA 1ZR2A 1CFJA 1OB2A 2WAXA 2V4ZA 2ZROA 4ZHQA 1M76A 1GDDA 3HR7A 5F98A 3IQGX 2QSZA 3ZJ5A 1Y81A 1NZDA 1O6ZA 4OQFA 4IF6A 1OI4A 3N75A 3JQ8A 4ARVA 5KTTA 5BW8A 2CXUA 4B3BA 4ZCRA 4ZVSA 1NBEA 2EHDA 3A1DA 3N6VA 1LPMA 2XKAA 1JHAA 3UZUA 5DYGA 4Z0TA 4RTPA 1DBSA 5H9VA 5IVIA 2BH2A 4HI0E 3A9TA 1EFLA 3JAWA 1ISJA 3TNJA 1VCIA 1BW9A 2J08A 2P3LA 2NU8B 4F6LA 2IHYA 3BTUA 4LRUA 4FEYA 1JTFA 3AQ4A 3L8MA 2OBYA 5CYPA 1PNOA 4PC7A 1JKXA 2OUIA 3HUDA 1V5EA 3DG9A 3LQYA 1YBMA 1Z5OA 4F6CA 3EGOA 1ORRA 4RHCA 3CINA 2J3EA 3LH5A 2ADOA 2QPOA 5HJ7A 4K1XA 1Q7EA 4JA2A 1K88A 2H0RA 1JBQA 5DWDA 3FUTA 2XUIA 3ECCA 3Q9UA 3IIJA 1MT0A 1WSAA 4MRNA 2QF7A 4BU0A 1W0KA 5F5XA 2ET6A 1USIA 3CQ9A 2IBMA 2JAXA 3NZEA 4OQMA 5IDVA 3SZUA 4DJEC 1X8XA 3R3WA 4HJRA 1TO2E 1Y33E 3GGPA 1PTKA 2REQA 3BWEA 1GNTA 1YL5A 4MK4A 4O4IF 4U5QA 4EKYA 1OWMA 4AUEA 5L95A 1O96B 5AVUA 3S2FA 2OG1A 3N5CA 4FSHA 1KQGA 2AFRA 2XLCA 3QEBZ 1NXVA 2XQIA 4WACA 5M04A 2W6JD 4LA4A 1T15A 3DFFA 3FHJA 4CF3A 3FOZA 3MRSA 2OQRA 3ENZA 1S96A 3M33A 3NHUA 4JVNA 4O4IA 2C7RA 2AQKA 4F9EA 3HEBA 2V5UA 3BAFA 1H2AS 4ME6A 4LMPA 2EBFX 2R8RA 1Y9ZA 1CW2B 2Q21A 3LX8A 4FOTA 2Q46A 3OJ0A 2E7ZA 3V2UA 5ERGB 4EO7A 5H1YA 1T8WA 1YZGA 2FN3A 2Y6UA 3DQZA 4RIEA 1E3TA 1W49A 4FZRA 2CY0A 2ZIAA 1G5PA 4YRNA 3VZCA 2JW5A 5K8CA 4F9TA 3ESYA 4BKUA 2V7QA 4L51A 3GGSA 4NAVA 3A1TA 4UHJA 2ZWPA 1V1JA 2AXQA 5THXA 4IVQA 4HDCA 4BZQA 1QB7A 2P4HX 2KMLA 3KKLA 3O1IC 2E5WA 5LB4A 3UBMA 4WH0A 2QW1A 3MINB 1EFUA 1OXTA 1YJAA 1IJFA 3IKVA 3L0YA 3AXSA 1CLEA 2VJMA 3GAZA 4ED9A 3UWDA 2XUPA 4YXFA 1NF8A 2YQ4A 1PG2A 3OPQA 1ZJ4A 4YS6A 1O54A 1XKTA 2IEIA 3Q3VA 2W4QA 2J4CA 3T7CA 3OEWA 1V4VA 3VKVA 4F4DA 4QTZA 4ZN6A 3BRWA 1WETA 1V5IA 4MQFB 3RV4A 4KLAA 5MGNA 3KKPA 4ZZ0A 3OQNA 4LYDA 4K9QA 1BC5A 4D0RA 4X7MA 1DO0A 1SMKA 3LLUA 2X0NA 1Q22A 3DR5A 4GWLA 4JYPA 5KOJB 5SZHB 4B6GA 4LRWA 5AVYA 2Z4TA 2BEVB 5BWLA 4ZI3A 5DM70 3K72B 2Y0DA 1MENA 1Q0QA 1R9JA 1J00A 2JFXA 3OQPA 3RFVA 1KR2A 2VBFA 4KXFB 1JGTA 1QS0B 2X8JA 4JI8B 4RMGA 1N2BA 1ZL2A 4Z7OB 1JFTA 4X1IB 1VHWA 3DCJA 2FPKA 4LJRA 1E1RD 3OZTA 3F5QA 5E4YA 1SVKA 2HV8A 4Z8XA 1W30A 4BQQA 2Y1GA 4N6OA 3WHIA 1R0CA 2JJ2A 3NYRA 4JUFA 3OG9A 1GGVA 2XW6A 1P5JA 4UASA 1SY7A 1MX1A 2FFHA 2NUTB 3B1FA 1ST3A 2CHFA 3S81A 1BHO1 5H5JA 2N9UA 2RHOA 3C41J 1V11A 1RSZA 3NPAA 4IIDA 5AKXA 3IQHX 1YCDA 4BZZA 4RORA 3RU3A 4H7PA 1X7XA 4JHLA 1VLMA 3H9JA 3K2EA 4GX5A 4IIEA 3WX0A 3ZWYA 3BOSA 2OO3A 4MS3A 1M0WA 4COOA 1WB4A 3TLCA 4E22A 2AK2A 2LCIA 1B43A 3O8RA 4N8EA 2BFEA 3LKVA 4QGFA 2W2OA 2IEGA 3AI7A 1XJCA 4LTNA 1DWQA 4EA9A 3EF3A 3CY6A 4DIMA 1POWA 4HADA 3QELA 2EG5A 3AUAA 4MR7B 4L78A 3WHPA 1CR0A 3ZUPA 3PEYA 1UP7A 3H2ZA 3BEOA 5AH0A 3RTGA 3WLMA 4I4TA 5HCIA 4NHEA 2FJPA 1GCGA 2W37A 4E5KA 2A4MA 2BGIA 3IBTA 3R3HA 4Q1AA 4RKQA 1NBMA 1MAAA 4Q4HB 3ELUA 3NWPA 3FNEA 1Q7CA 1R3UA 1B2RA 2XUQA 3KJHA 4BTVA 1TKCA 3HJBA 2OSBA 4QUAA 3LT2A 1DJLA 1LJUA 1W4ZA 3B48A 3RG2A 5LNK1 2A0YA 4QYIB 2W2KA 4U7WA 2RH9B 2EEZA 4O4JB 3SYMA 3QSYA 4CIYA 4EELA 4GBED 2QTVB 4I66A 4MUKA 1E32A 2TS1A 4Z1MD 4FR0A 1E2MA 2VPPA 3ZZMA 4D3ZA 4BQIA 1RJFA 5C35A 4DR6B 3A3NA 1AUVA 2PS9A 4M6WA 4K9OA 5C3UA 5SICE 2QV0A 3NAGA 3ZDQA 2NW6A 3RU2A 1T0UA 4UNSA 1EFCA 1K6EA 3BGDA 1HF3A 2IDZA 3KWLA 3NBZC 3PFCA 4PHGA 2D1QA 4XVUA 2R1VA 3GLTA 3KJNA 4YAGA 1QFYA 4JI7B 2QOEA 4INZA 3B60A 4BFSA 4NV3A 4US1R 4ZZIA 4R5HA 4WTOA 3CSUA 2GCPA 2EJBA 1HDRA 3F8WA 3P0EA 3TTWA 1DAFA 1PV4A 4KW7A 1WNTA 3H9BA 2ZE7A 2VHCA 1QHYA 5D3MA 5LJLA 3K92A 4HWGA 2WMDA 1JVBA 1ZESA 2F7SA 2QZPA 3EYWA 1Y8QA 4ZJUA 3PGLA 2QI9C 3SM3A 2AC4A 3D6AA 1LWOA 4A0GA 2FSSA 5HZKA 1YIOA 3I4LA 3QU4A 5TV2A 1V7ZA 2ZRFA 4N12A 4WOPA 4B79A 2DECA 2I8LA 1T0HB 4C4AA 3A4MA 2JJ2D 1V41E 4OL9A 2AQHA 2YRFA 1LDGA 1JJ7A 1A7UA 5EE5B 4I9UA 4AJEA 1O95D 2AJ8A 3CKLA 3JAWB 5EMHA 3T5MA 3WFJA 4L9AA 3ZG6A 1BW9B 1J0CA 4W5HA 1ZH0A 4FWIB 5ICSA 5G1OA 2GEFA 1W2WB 3V4RA 3DDZX 4UNRA 2ZT8A 5B3LA 4WASA 2O20A 2PX6A 3B36A 2QRKA 1AQNA 4DA7A 4RKWA 4MJ7A 4WADA 4URFA 4CMGA 1SUAA 2I2XB 3KZKA 3SJAA 4FR2A 4L0CA 1KH3A 1S9HA 2M1ZA 5BSMA 1XYVA 1G20E 3HB1A 3GPBA 1HO3A 4DHEA 4QBTA 1DJNA 1L5WA 1NY6A 4JFRA 4OJKA 3DE4X 3ZNNA 4DDMA 2WD7A 3RBAA 3GV0A 3QWHA 4HRVA 2VF7A 2J09A 3G9QA 5FWDA 4RBNA 1XTSA 1NW8A 4ND7A 3D1VA 4UZEA 3ESAA 3VTZA 1C50A 1JJIA 2CGEA 1AKQA 2REQB 3SAJA 3ZV6A 1T6NA 4MUMA 4YQYA 3DZJA 3OPVA 4ACAA 2FZWA 1XAIA 2PRJA 3TL3A 9LDTA 2H1SA 2ZR8A 4ZT6A 4GMHA 1TLTA 1NBMD 1TMOA 1V3VA 1ZMOA 2ENWA 2JJ1D 2WPDA 2ERYA 2AOTA 1Z7YA 3IC5A 4EPXA 4YQFA 1HNXB 4GL4A 2ACVA 1CJTC 3OURA 1DADA 3NWOA 1EWRA 1GZHB 2CFOA 5EQTA 4CDGA 3GNQA 5TR9A 2DERA 2MSEB 1CEQA 4V0MA 4R2MA 4IEIA 2H7XA 3RUIA 4CQMA 2JC3A 2NYVA 3GUUA 4YNBA 4B3DA 1Z63A 4IOLA 1P0FA 3EAFA 4IIXA 3GX1A 2XADA 4Z9YA 3F7TA 1QYWA 2C31A 4EZEA 5EVCA 4C06A 1PNQA 1POXA 2EZTA 2XB6A 1DBVO 2K5UA 3BN3A 3IUSA 3SG0A 2ZPUA 1NJ2A 4LJAA 1UPXA 3KPVA 3FE2A 4FM9A 1YRLA 1JU3A 3JV7A 3ZI4A 1QIFA 1N5LA 3AP2A 2XMSA 4QUEA 1KRHA 4C2TA 2D5AA 1QYVA 1Z7BA 4ZDIA 3QFTA 3HNRA 3MA0A 3P0RA 2VJMB 3VVMA 2JG3A 1K7CA 2GZHA 2JF0A 1SRQA 2GBCA 5BWCA 3ABRB 2XOKA 1OREA 1KZ1A 3U13A 1VDMA 3B3AA 3FF1A 3D4IA 4F4JA 1TYDE 1XK7A 1LTKA 2IXDA 3P20A 4CTKA 3URMA 1K0UA 5K0JA 3FMIA 1PGOA 4HWRA 2CLCX 2LW7A 3GGOA 1CZUA 1H2EA 3N0RA 1NV8A 2YOFA 5JZBA 4X1YA 4GOLD 5CLJA 3UHOA 2CVQA 2Q3CA 2M2IA 2P6MA 3ISVA 221PA 3NXKA 4U2DA 4C7JA 4DCGA 2W7TA 4DBLC 1BAPA 1NUPA 4QJ4A 2NO0A 3N0TA 1C30A 1KI6A 2XVZA 1OJLA 4WOBA 5H02A 2W98A 5CITA 5D5HA 1VBKA 2CK3A 3MMNA 4UMDA 1EK0A 3QE2A 1K4MA 1BVUA 1R9GA 1PL7A 1QV7A 1RQ2A 2ZUCA 2NU9A 2ZBQA 4OQZA 4ZRDA 4ACBA 2XXAA 2D7DA 4PWYA 1QTQA 4J91A 2F48A 1F0KA 1KDRA 3NGMA 1UDAA 1OQAA 2EZUA 2RH5A 3TTSA 4I3FA 3A05A 3D7MA 3HN6A 4O4HA 5GVRA 3TE6A 3SZGA 3FOFC 3CVUA 2PU7A 5IS2A 3HCDA 1N6PA 5EKDA 1JSXA 2C4NA 3LX6A 2ZI9A 5HS6A 4YCCA 1OXMA 4GZ3A 3I4CA 3IMGA 5BSHA 1N3YA 1U3WA 1CEEA 1Y7IA 3K9BA 4NYIQ 3BGOS 1F12A 1N2GA 2CMHA 4FBMA 1V11B 1I3CA 4LHZA 4RSMA 5I9TA 2K7ZA 3RJ9A 4DIKA 5JQWA 1X7XB 1TF2A 5AW5A 4BMXA 3UHPA 2PL5A 2G82A 5LP6F 4MS3B 1XALA 4BNWA 1QRSA 4ER6A 2WPDD 1Q6YA 2JAPA 3B1ZA 2QWXA 5CT4A 3SEQA 3UUWA 1WDKA 2PUBA 4RJJA 3C1UA 2CXRA 4IGAA 2BFEB 3FWPA 3G89A 1EBBA 3WE7A 4MRMB 3SHVA 4RHTA 3IV9A 1WY7A 3OQHA 4NP6A 4ZQBA 3QELB 1AF4A 1Z5NA 2RB4A 2HT6A 3RRXA 3V1TC 2VI5A 3JCZA 4NQZA 1NLYA 5DGXA 5B6PA 2OFXA 4I4TB 2H4HA 4DZRA 2PH7A 3GZ4A 4OKIA 3ZY5A 4F8EA 3INRA 2Q1SA 4IS3A 4P5DA 4V39A 1H1LA 4EENA 1DGQA 2NVBA 1VYHA 3CB2A 4RD2A 4TXLA 5DW0A 3V7FA 4IWNA 3I1IA 4KV9A 2CXSA 3I28A 1DIOB 1IPFA 2PX8A 2W2KB 3LL7A 2VDOB 5EAIA 3PSAA 2SECE 2X19A 4HXEB 1DBWA 2NVWA 1J06A 1NASA 2IVFA 3CCBA 3FNQA 4J0CA 3VUFA 2SBTA 2ZRNA 5IKXA 1V35A 1DARA 4L8YA 4M6WB 3N3AC 2XOKD 5ITWA 3PYMA 1K6JA 4B84A 2HHHB 2GNAA 3IVRA 4NU0A 1OA1A 4GGOA 3EMVA 1QYDA 1RCTE 3G9TA 4PFSA 5DHQA 4CT5A 5AVQA 2R1VB 3CPJB 4P1ZA 2I6SA 4BLRA 4TYWA 3NHAA 4TTAA 5JNTA 4LZNA 3C8HA 4FP9A 3ZJTA 2VJKA 1LSUA 2M9MA 3C5CA 3G7NA 3GLRA 4GNKA 3QBDA 4MS4A 4XAQA 4O3MA 2DLCX 4QAQA 4KRXA 3VQTA 3BXZA 5IH3A 4C43A 3BQ9A 4QC2A 2V7EA 3JQFC 4A1FA 2JVKA 2DTXA 1NF3A 1NDUA 5D3MB 2CK3D 2W5UA 1L5KA 4C7OA 4CKXA 2EZ8A 3CX7A 3EGVA 5F52A 3K4PA 2YICA 5CP8A 5T8KC 1Y8QB 3JQFA 1GTVA 3A25A 2ADFA 2C5AA 1EJBA 1YE5A 1TZCA 3NHPA 3PIDA 1CETA 1L5RA 1QQBA 3CH5A 4KI0A 2CBXA 1OUMA 5FH9A 2Q0QA 2RHWA 4PSVA 3OOWA 4LPKA 5AHXA 3TZQA 4LYFA 2UXDB 1SXJC 3C6YA 5AHWA 4Z99A 3T7AA 3T7TA 3W9UA 4AWXA 2DR2A 4Z9FA 1DIAA 1IZ0A 1SUSA 1H9CA 4IXTA 1QGUA 5LCXA 5KVAA 4B75A 3DW1X 1SXJA 3M5CA 4C7BA 3TKLA 2AG8A 2BEUA 4RC9A 4KU4A 1J8DA 1RWMA 2Q2WA 3LECA 2EIHA 4LOJA 5H82A 3JQGA 3KJEA 5IC4A 3X44A 3C3KA 2OV6A 1EMDA 3LY7A 1PF7E 1YFZA 2IBTA 5J2UB 1U04A 2UVDA 1VG0B 4Y2QA 4K28A 2OBFA 4J29A 4L07A 2WD7B 1GT6A 1Z17A 3B89A 1RYZA 1Y5IA 2BAGA 1LJ8A 1L7XA 1F2VA 3H99A 3HMKA 1VLVA 1XTTA 1NFRA 1MGPA 2I5PO 3MB8A 5EE0A 3WYAA 5BY2A 3EZNA 1CBUA 2QUJA 1L7RA 3ZBPA 3E3NA 5L8VA 4P4UA 4WCFC 2BI7A 3JD0A 1YV9A 1J07A 1OYVA 1H85A 1R74A 2AOTB 5JCJD 1LSJA 4JFAA 3KT6A 4OJQA 4YXWA 3EGEA 5JCPA 1Y9AA 4I50F 4WV3A 2ZI5A 1U7DA 3PTAA 3LJKA 3WSWA 1F4VA 4WCFA 5JJBA 3OEHA 2AQ8A 3WS7A 3BWYA 3EBOA 2Q7OE 1RQGA 4EJSC 4LCEA 2H51A 2EX1A 3DFUA 4QLOA 2XYPA 3IO3A 1QR6A 5D1NA 2QQ5A 3GFTA 2W48A 4C78A 4XWTA 5HDBB 3UJBA 4J94A 3IUNA 1GSOA 4CQMB 2WWYA 1FMFA 3UKDA 2IUFA 3KR2A 4EA6A 1GWNA 2IS2A 2P1RA 2V7UA 1KAMA 4EJSA 5MN4A 4XJXA 4YUWA 3KXKA 3E9ZA 2GN8A 3NOQA 4H27A 1MDBA 4RJLA 4Z53A 2WHPA 4R05A 5E95A 2YV2A 5HGXA 1ZOLA 1AGPA 4GOKA 1FK8A 1MPTA 4JEUA 5ITSA 4DCPA 3PGVA 4GP9A 2JDID 2OBLA 2Q3DA 2BJVA 5G3YA 3PITA 1F1JA 1H9BA 3BXOA 1HSOA 3BTSA 4TVKA 3DSRA 5HVNA 5A5VA 1A9YA 4HAXA 5K0FA 1IN8A 4RHXA 1OI7A 1H3EA 1SQFA 1P7YA 2J6BA 2PL9A 3DBIA 4QFDA 4R0NA 2GFHA 3TPZA 2VYFA 1GEGA 1JQAA 2WJAA 3STHA 4O5AA 1UWKA 2Y1EA 2HHCA 2CMFA 3HGMA 3W77A 4RXTA 5EE1A 3ZV7A 2QN6A 4IDOA 2EC5A 1K7EB 2FGKA 1ZN2A 2P2GA 3NHRA 3ZK8A 3ITDA 4YIKA 1TZBA 4RKEA 4Q7QA 1JQ3A 4X1YB 4D80A 3DONA 3K1JA 4WNAA 3RAGA 2WRZA 1VFNA 4YEDA 4BVEA 4J6EA 4HY3A 2X77A 3JTEA 4BGUA 2YVAA 4JKOA 4OYLA 4JVMA 1C30B 1KI6B 5LQSA 4NZOA 4B7AA 4INJA 1CNEA 1YR9A 2CBGA 2PJUA 3GBPA 2YXLA 2IUYA 3O38A 3PX3A 3U7GA 3NQ41 4DUPA 3IOYA 3S99A 1LF0A 2NU9B 2XXAB 5I4IA 5EXEA 2VDVE 5FTJA 3LCVB 1SZDA 2QQ0A 3F90A 1R6VA 1RJWA 4DRXA 2AKEA 4WK2B 2PJZA 4O4HB 4Q7LA 2DRIA 5JPIA 2C9ZA 2C07A 3C7DB 4JMLA 3WGOA 3OT4A 4GAEA 4P2GA 3TQSA 2R7MA 4U0JA 4RMNA 4EYGA 4ZGBA 2H0AA 4LJKA 3WK6A 2NXEA 3D6HA 2I1QA 3QXGA 4MHSA 3T7KA 3FCXA 4OSOA 3JQBA 4C3ZA 3KQVA 4A27A 3R5SA 1LLUA 4HLNA 2PG3A 3KXPA 1MO4A 3PENA 2YBDA 2ZBFA 1GPKA 1VKZA 3IQFA 4UEOA 2H1VA 2IYQA 4P3PA 4WFJA 4LOIA 2GVZC 1UODA 3ZD6A 2IIBA 4LXXA 1FMLA 4YXWD 4L3WA 1RDFA 3WZ2A 1JB9A 1Z6YA 4Y2YA 4JROA 3SMVA 4G9BA 4XYBA 3OEHD 1VKHA 1UZUA 4M8KA 5EJFA 1PUIA 4HWPA 3ZHVA 3HCAA 3LF2A 2JA2A 3W7VA 4X91A 3LYHA 3B20A 1LX6A 3EISA 4RSRA 2ATXA 5GAJA 5IKMA 1CUXA 3MRTA 5FHQA 2Y0PA 2DP4E 4P4GA 3S2YA 1LC0A 3FPSA 3HY3A 2JLVA 1VRVA 1NE7A 4DG5A 2H1OA 2CNOA 4CKEA 1FFAA 1LDNA 1CJSA 1H1LB 1SCUA 1QH8A 3U6BA 4LOKA 2P62A 1YU9A 3B6EA 2GAAA 3PR3A 3VH1A 4JLDA 5K6AC 1USKA 1XD9A 5ILQA 1YUBA 4IMJB 3WIBA 1J0AA 1GAEO 3GDGA 3KOXA 3BDAA 4ZANA 5CFRA 5LR6A 4M7WA 5EMLA 3C3BA 2RHGB 1SG9A 3OE7A 4Z2AA 2BKAA 1F60A 1E5LA 4LXGA 5K6AA 3GJ3A 1GNVA 3JQ7A 2VHQA 1FW6A 2I3DA 4G23A 4ZICA 3EVFA 3NNDA 4OVKA 2GPYA 1XPOA 1UDRA 3HRHA 4U7HA 1OAOC 1X3SA 2QL6A 3N76A 2RHHA 1PNTA 3VISA 5KCZA 4KZPA 1K27A 2P9CA 1SCAA 1ZAKA 3MBOA 4AN4A 4RDHA 5FNVA 4MS4B 1OAOA 1RYHA 2I4MA 2WIFA 4Q3KA 5IM4A 2DWOA 3IPRA 1JLKA 4XR4A 1KJ9A 5KWJA 5GONF 1VHJA 3K9LA 2JNWA 3DL2A 1UC4B 1M74A 3GYBA 2WWXA 2HWWA 3IEXA 5T6MA 1LFAA 3W1VA 4WZBE 1UXGA 2JCSA 4C7OB 2FKAA 1KERA 4D56A 2O0LA 2QQFA 1JLLB 2FE4A 4B87A 2BGJA 3TWOA 4ZVNA 3TEJA 4FWTA 4OK5A 2YS7A 2AN4A 3CIOA 4HK4A 5GONA 5CB4F 3KEMA 1QRUA 3UCFA 1WXFA