4IS5A

Crystal structure of the ligand-free inactive matriptase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
241
structure length
241
Chain Sequence
VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDAGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppressor of tumorigenicity 14 protein
publication title Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 58
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4is5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4is5A01
8ESTE 1TPSA 4NZLA 4O3UA 4JZEH 3FVFB 1C1SA 2P16A 1F5RA 2VVCA 3ODFA 5C20A 5DP4A 1A5IA 1KSNA 4CRCA 1IQNA 1H8IH 3RXTA 1C2HA 3PM3A 1LKBA 3T5FH 3FFGA 2ZNKH 4JCNA 1O2MA 2GX4A 2OBOA 2FWWA 3UUZA 3WY8A 3LGUA 4VGCC 3QK1A 4YTAA 1C5UA 3BTWE 2V6NA 1YBWA 3A85A 4YESB 4CBNA 4ZMAH 2YOLA 4BTUB 1V2WT 1RS0A 2KAIB 3VXEH 1DY9A 1EJMA 4R8TB 3OYPA 1E35B 1EZSC 1QQ4A 3AVZA 1QNJA 1JRTA 1QHRB 1O30A 3UNRA 1C2GA 3V7TA 3SGQE 3F9HA 1O5BB 4XFQA 1H9HE 3VB3A 1A3EH 2XBWA 2GKVE 2ZGHA 2SNVA 5EQQA 3HGPA 4DOQA 4CRAA 1NFWA 4PROA 4BTTB 3SU6A 2QXGA 1LCYA 1XX9A 1CO7E 3TK6A 5LPEA 3SU1A 3ODDA 2F9BH 4D7GA 1YGCH 1VCQA 4CHAC 3LIWA 3A88A 2FOFA 1T8LA 2UWPA 1AWHB 1FDPA 2J95A 1DUAA 1IQEA 3U8TH 1TX8A 4FUJA 3UWJH 1J9CH 2G81E 2RA0A 1FI8A 2C3SA 4ZHAA 1TMTH 2SGFE 5C5NA 2W7UA 4F49A 1FY4A 1YP9A 4A1TA 2BDBA 1IQIA 4VGCB 1P2QA 3E0PB 2BVRH 1ABJH 5CE1A 1TRNA 1V2ST 3TPIZ 3A81A 4O97A 4DIHH 1W12U 4I8LA 4ABBA 5E2OA 1B7XB 5DPAA 2G5NA 5H4IB 2BVSH 1UTQA 1O3MA 1UK2A 2BD8A 1EX3A 1ESAA 4NCYA 2ZGJA 2ODPA 2A32A 1GJ6A 1EB1H 1C5SA 1O5EH 2VWLA 1QQUA 3PMBB 2PKAA 1CHGA 3SNAA 1WTHD 4KGAA 1O3OA 1ZR0A 1RTFB 5FHTA 5EQRA 1C2DA 3GCTG 2PSYA 3VB5A 1EP6A 1S83A 2C8YB 2XBYA 1DY8A 1V2TT 1SOZA 5GPIB 4CHAB 2D1JA 1KDQB 1TRMA 1DOJA 1YKTA 4AORA 1FV9A 1D6WA 1HJAB 1S81A 3S7KB 2ZGBH 1XVMA 3D23A 4MNXA 2Z3EA 3RU4E 2FOGA 3F6UH 5C1XA 3LGVA 1GBKA 4DCDA 1CBWC 1EAIA 1CGIE 1K22H 1O35A 3L33A 5A2MH 4AYYB 5FPYA 3EA7A 1BRAA 2GCHG 3RUOA 4WVPE 1MAYA 2A31A 2FMJA 8KME2 3KQCA 1BTWA 4NA7A 2VVVA 1TABE 1O3FA 3VB7A 4DGJA 3HATH 1VCPA 3MNSA 4RKJB 1A61H 1W13U 2GV7A 4ZHLU 1WUNH 3RXJA 3IWMA 1NRPH 1RTLA 1ZYOA 2B0FA 4ZKSU 4AB9A 1QJ6B 1FZZA 1V2NT 3FP6E 5K0HA 3MH7A 1GI0A 1ANBA 4SGAE 1CGJE 5L6NH 1SFQB 1Y3WA 2VIQA 3H5CB 5T3HA 3M36A 2QXJA 2XYAA 4I7YH 3DFLA 1SVPA 1O34A 1V2VT 1TB6H 1AUJA 2C4FH 1D9IA 5F6MA 1KYNA 1ZSKA 3DT0H 1UTKA 5C1YA 4X6PA 1O2GH 2VIPA 1B0FA 9LPRA 1GHAF 4Z0KA 1JWTA 2FS9A 1Z1JA 1HCGA 1J8AA 1CBWB 4NIYA 4AFZA 1XUHA 3Q3YA 4Y11E 4AZ2B 2AIQA 4OS7A 1MTUA 1AI8H 1F2SE 1HFDA 1ELEE 1O3HA 1ZPCA 4WF8A 3LH3A 2BZ6H 1H9LB 4Q7ZA 1AB9C 5G4BA 4K1EA 2QAAA 2FPZA 5BPEA 1A0JA 4K1SA 1PQAA 3TH3H 2JH0D 1DSTA 4QT8C 4INKA 3NK8A 2PFEA 1MU6B 1DWDH 1THPB 4TYDA 3S9CA 4ASHA 1NESE 4ZAEA 2WPIS 1MBQA 1EB2A 2V35A 4I8KA 4K3JA 1L1JA 2JKHA 1K28D 1BT7A 4FXGH 2J94A 1RTKA 1BOQA 1LHFH 2R9PA 1V6DA 3V0XA 2G55A 1IQHA 2ZU5A 1ZZZA 2FTLE 1SGNE 1M9UA 1GMDG 3OY6U 1C2EA 1QRWA 3D62A 4ZKRU 1LVBA 1SR5C 2Q6DA 3SU5A 3ENSB 3BIUH 5DGJA 3H7OA 2ZA5A 3LC5A 4X6MA 1EATA 2PKAB 3PROA 2ZHEH 1TOCB 3RC6A 3GY3A 3LDXH 4TWWA 2AMDA 3SUEA 2ZFTA 2Z94A 3BTGE 1P8VC 2TBSA 4A7IB 1C5VA 1ZPBA 1A5GH 4FUDA 4WMDA 1FY3A 3B9FH 3VB6A 2PTNA 1AB9B 3M7UA 3LGTA 2ZQ1A 1PPGE 4MPWA 1C5PA 1ESTA 3BEUA 2G4UA 2R3YA 4X1RU 4X2VA 1TNHA 4BAKB 4FU7A 4OGXA 1YCPM 2A1DB 4NSVA 4Y76A 1IOEA 4DY7B 2SFAA 3L3TA 4Y8YA 8LPRA 2BXUH 2F9NA 2CV3A 1CSOE 2BVXH 3M35A 4TY6A 1GCTB 4AFQA 4NA8A 2B9LA 2ZDMA 1Y59T 4CREA 1XVOA 1NRSH 3EA9A 3PLKA 5EW1H 1TFXA 3E90B 5DKMA 2XC0A 5IYTA 5I46H 3TH4H 4BAHB 5DO4H 1SL3A 3T29A 3RXQA 2J9NA 1THRH 2TGTA 1L0ZA 4NIWA 4JZFH 5FPSA 3DFJA 1VCWA 4D76A 1V2MT 5GCHF 4X8VH 3UR6A 2A5AA 1TX7A 1N1LA 2B7DH 2JH5D 4RSPA 1LVOA 2FEQH 1NZQH 1IQJA 3UY9A 2Z9IA 2J4IA 5J4QA 1DXWA 2EC9H 3PB1E 1SLUB 1TONA 1GBLA 2PTCE 1C1TA 4HZHA 2EI6A 3M3TA 1TNKA 2TIOA 3MO3A 2PLXA 2PW8H 1O2UA 1C1UH 2FOEA 2Y7XA 1BB0B 3PV4A 4Y10E 1S84A 5JB8S 1ARBA 2BYAX 4KELA 3RMLH 5JB9S 1O36A 1GVZA 1Y3XA 2IOTA 1HPGA 2F9OA 4CH2B 1K1OA 2P3TB 1GJAB 1FXYA 2XTTB 2XWBI 2FXRA 4MPUA 3EGKH 3B8JA 1O3KA 7GCHG 1C2JA 4I8GA 3RXEA 2Y5HA 3MMGA 2O9QA 1SQTA 1ACBE 2G52A 3E91A 3OY5U 1A0HB 1GBCA 2A2QH 1LVMA 2QY0B 1QY6A 2VINA 2G5VA 1ESBA 1KXBA 4ZUHA 3ZZDA 5DG6A 4FUHA 1VZQH 1BTHH 1ZPZA 3O8BA 3CS7A 1AIXH 1KTSB 1YPKH 1C2IA 4E7NA 4X1NU 2GZ7A 2WYGA 5C2ZA 3SHCH 1RD3B 3E6PH 4LZ1H 4B74A 4NFFA 3TGKE 1C1QA 2OQUA 4IN1A 4TWYA 4AN7A 3BTFE 5EXMA 4IC6A 4UFGH 2OD3B 1C5OH 3ATWA 1WV7H 4AOQA 1FMGA 1XMNB 3TJUA 4DJZB 2QV1A 2BY5X 2XW9A 1NRNH 1HYLA 2F9UA 3TGIE 1LHCH 1KXEA 2TPIZ 1BA8B 4A6LA 3SUFA 1O3BA 3HK3B 1JRSA 2ZECA 1HAZB 2LNCA 2ZHFH 2BY7X 2OC7A 2VB0A 1O31A 5EPYA 4YT7H 1TMBH 3UPEA 3P92A 4XDEA 5EPNA 1GWAA 2H5CA 4ISOA 5FCRA 2BD7A 2G4TA 1Z8IB 1FY1A 3MNBA 4WMFA 3PMJA 2AS9A 4IMZA 2A4RA 1GBJA 3LOXA 2BM2A 3P8GA 4BAQB 5DP9A 3GY2A 1S6FA 1SGCA 1T31A 2PHBA 3M5MA 4NIVA 1BBRE 1GDNA 1O2OA 2CF8H 3EE0B 2QYIA 1IAUA 1DS2E 2ZTZA 3PTNA 4AG1A 1HJ8A 4IBLH 3RM2H 1L4DA 2SGPE 2C93B 1LPKB 2GZ8A 4UFDH 1CT2E 4RN6A 4UD9H 1O2RA 4NG9H 1GJ9B 1ZGVA 1O5DH 1AKSA 3UNQA 2Z3DA 4MPXA 3LPRA 1P01A 4JYVH 2H1UA 1X7AC 3ZYEA 2BLVA 6LPRA 3SQEE 4XSKU 2WYJA 2Y7ZA 3LT3A 3ZZAA 2CJIA 3ESTA 4D9RA 1P02A 1UVSH 1EJNA 1DWEH 5ESBA 3ZZ3A 3MWIU 3BG8A 5JBTA 4XOJA 1DICA 1DPOA 1GPZA 2HOBA 1FY5A 2O8WA 3KN2A 3TH2H 4GVUA 1YLDA 1JMOH 4YLUA 2BLQA 3FZZA 1DITH 1EP5A 3GCOA 3SN8A 1UHBA 1PFXC 1FONA 4GUXA 3S69A 2FYRA 2XNIA 1NU9A 5EODA 1TALA 2BD5A 3RXDA 4MVNA 3RXIA 2ANWA 1JIRA 4HI3A 3K6ZA 1TYNA 5C1UA 1P2NA 1GI8B 1BMNH 1CT0E 1SGIB 3NZIA 1GI1A 1UVPA 2I6QA 1O3CA 1FIZA 1HAVA 1GI7B 1U6QA 1J16A 1ZGIA 4LOYH 4MNVA 5A0BA 3M5NA 3ZVDA 1WQVH 3ATIA 1AE5A 3A86A 1V2PT 2Z9KA 3SU2A 1VITG 1FUJA 3TU7H 1CE5A 1OWDA 1ZRKA 1SHYA 2ODQA 1C5MD 3BSQA 4AFUA 6GCHF 3RLYH 4ABGA 3S7HB 3A8CA 4GHQA 1ELVA 3E8LA 2BQ7B 1O32A 2BDHA 1AE8H 2LPRA 1O3GA 2NU0E 2R2WU 3O8DA 1G3CA 3SJIA 2P3FH 1J17T 1ZLRA 1O3DA 3ZV8A 3T62A 1OWJA 4E7RG 3QLPH 3SNCA 2UWLA 5BRRE 2FI3E 1GGDC 1UMAH 1V2UT 5K7RA 5A0CA 1YPEH 2G51A 4HFPB 2EI7A 3LC3A 3STJA 5L2YH 5PTPA 1SGDE 1F0SA 1C5NH 2D8WA 2BQ6B 1SI5H 2VH6A 1GHBG 3KQDA 4X6NA 4X1PU 5HXFA 2CN0H 2CMYA 3SOSA 1DSUA 1AZ8A 1V2LT 4SGBE 5F03A 1MD8A 3A89A 3RXBA 1FPHH 1Y3UA 5E0GA 4DIIH 2ZF0H 3LH1A 4ISNA 2CXVA 1P05A 1QR3E 2PUQH 3UWIA 2A4OA 5HGGA 3Q3XA 5C3NA 1O2NA 2ZFRH 1GMCF 1P11E 3KQEA 1MAXA 3RMMH 1B5GH 1RIWC 1OKXA 3M7TA 1LDTT 1PPCE 2OC1A 2TGDA 4J2YB 2M5TA 3RXRA 2ZDAH 7LPRA 3GICB 2AMPA 1AFQC 4OGYA 3SV7A 2PGQB 1SG8B 3D65E 2F9PA 1Z6EA 1P2OA 2SGQE 1L1NA 1GHVH 4I8HA 2FM2A 1GMHG 4JZDH 2VGCC 3FP8E 2QXIA 3RC5A 4AGKA 4THNH 1GI9B 1AKSB 1OPHB 2CGAA 3HGNA 4WWYA 1UVOA 1P06A 1DVAH 4B71A 1GGDB 1G3EA 3GY8A 2WPKS 2C8XB 1AFEH 1GI6A 1BRCE 1TGTA 5EQSA 1MMJN 4YLQH 5FCKA 1GI2A 1P04A 1RJXB 2OINA 1Y5UT 4ZROA 2RDLA 1P2KA 2W3KA 3P8FA 1BTPA 1O2KA 5LGOA 3AAVA 1YPGH 3JZ1B 4AX9H 1C1OA 1PQ8A 4U2WA 1DANH 1GVLA 2R3UA 1MKXK 3ITIA 1NU7B 2ZI2H 1MTVA 1PQ5A 3FP7E 1Z7KA 3MTYA 1UHBB 1WCZA 4FUBA 4ISIH 1RIWB 2ZKSA 2BLOA 2PSXA 2QGRA 1KXAA 4K2YA 5GWZA 3SV9A 1D6RA 2Q6GA 1AFQB 3EYDA 2XCFA 3RXMA 1IQKA 1ELCA 2FI4E 2VNTA 1TBQH 1DUEA 1ZOMA 4YO9A 5HMAA 2VGCB 4ABHA 1AGJA 1MTWA 1NTPA 4MTBA 5LH8A 2ZU2A 4B2BA 2RG3A 3U1JB 1HAVB 1CHOF 1QJ1B 4B73A 1V2QT 2HLCA 1AMHA 1L2EA 1OP0A 9ESTA 2R2MB 4H6SB 5HM9A 1MU8B 3S0NA 2GGVB 2RCEA 3RMOH 1N6YA 1BMLA 3DD2H 1KXCA 1KY9A 3PMAB 5EGMA 4JZIA 4KTUA 4LZ4B 2Q1JA 1C2LA 5ETXA 4A92A 3TK9A 1HXFH 2Z7FE 2ODYB 3A7YA 1ETSH 2GZ9A 2ULLA 2DUCA 2XCNA 2H9EH 4JMYA 1W11U 1LO6A 3QX5H 1HAGE 1ELTA 1Q2WA 1GJBB 3NWUA 1O0DH 3O8CA 1D3QB 1ID5H 3EA8A 1E38B 1QURH 4D9QA 1P10A 2OCVB 3LJOA 4WH6A 3ZZ9A 1A0LA 1YPHC 4ZXYH 3GOVB 1T4VH 1O2XA 2YNAA 1AU8A 1MTSA 1WSSH 5A8YA 1KLIH 3Q77A 5JBBS 1UCYH 4BAOB 1TGNA 1SPJA 5FXLA 2H2ZA 2UUKB 2A0QB 1CA8B 1A4WH 5DP5A 1C5LH 2QN5T 1LPZB 2BDCA 2BB4A 3GY7A 5E8EH 1ZRBA 1W3CA 8GCHF 2G00A 1QBVH 1NRRH 4BTIB 1GJ5H 1IHTH 2BD2A 1WOFA 1HUTH 1IQMA 1TPOA 3FANA 2QIQA 3KQBA 1OWEA 3KGPA 1E34B 1BRUP 1LHEH 1ZMNA 3UNSA 1BHXB 2BY8X 4NFEA 3ZZBA 4ABFA 1WQSA 1C1WH 3SU0A 1FY8E 1C1VH 1S6HA 5AHGH 1OWKA 1PJPA 1GJCB 5A8ZA 3GYLB 1HAYB 1GJDB 4LXBH 2NU1E 2J38A 3U8OH 5AFYH 3UFAA 3W94A 2HGTH 1CA0C 1Z8JB 3BTTE 1SGTA 3A8BA 1CU1A 1SHHB 2FO9A 1YPLH 2FX4A 1A2CH 4YOJA 1HAPH 3BTKE 2IJOB 2P94A 3K2UA 2Y82A 2AMQA 1G37A 4O03A 4A5TS 2STAE 2XBVA 3VXFH 4GCHG 2QXHA 5GXPA 3KL6A 2ZFPH 2AGGX 4K8YA 4Q7XA 1O3EA 4CR5A 1VITH 2F9VA 2AGIX 3UQVA 2UUJB 4INHA 1RGQA 1JBUH 2FP7B 2OTVA 3MH5A 1YPJH 1C2MA 3I29A 1C1RA 1EOJA 3UQOA 3HK6B 2K1QA 4XE4A 1LPGB 3QWCH 1O3LA 1T7CA 1QCPA 2ZU4A 3U9AH 2Q6FA 1G36A 3W95A 1O2YA 1P09A 4GHTA 3LU9B 3SZNA 2FLRH 3ZVEA 2WV5A 3HPTB 2SGAA 1LHDH 1S85A 1CA0B 1BZXE 1BBRH 4INLA 1EAUA 4BNRA 5JYIA 5I25A 3PMHB 3A8DA 2ANYA 3MHWU 3SU4A 1UTMA 3OU0A 1EUFA 1GBIA 1LVYA 1SMFE 1NROH 1KIGH 5E0JA 2P3UB 1NRQH 3BTEE 3T26A 1V2OT 1C2KA 2AYWA 1Q31A 1GHBF 4BANB 1TWXB 3SQHE 3TJOA 2VWMA 4A1XA 1GBEA 3RXAA 3TNTA 2Y80A 1GG6C 2ZP0H 7KMEH 3PTBA 1O3NA 4CRGA 3EQ0H 4U32A 1PYTD 3SBKA 1O2PA 3R3GB 2WINI 4O9VA 2ZFFH 3LGWA 2BY9X 4DURA 1AVXA 1ELAA 1C2FA 5T6GA 1UCYE 2R0KA 1N6XA 1TBRH 4B2AA 1UTLM 3QGNB 4UONA 3BEIB 3VGCC 4YZUA 5FAHA 3KCGH 1WAYB 3UOUA 4I32A 1HXEH 1AUTC 3BTDE 1BUIA 3MH6A 1DX5M 3GCNA 3RXPA 1QRZA 2HWLB 1YLCA 2OLGA 1NY22 3SGAE 2Y81A 1NT1A 1MCVA 1MQ5A 2Y5GA 4Z6AH 3DUXH 2A5KA 3RXSA 2STBE 3MU8A 1MQ6A 2F91A 3MO6A 1BDAA 2ALPA 2J2UA 3MNCA 1FAKH 1O2QA 2NU3E 2O8TA 4FUGA 1FNIA 4MDSA 3V3MA 3GCTF 1XM1A 2EI8A 4LK4A 2HNTC 1TNJA 4R0IA 1UTNA 1AD8H 3GDUA 4TPIZ 1GG6B 3SU3A 4X0WU 4UEHH 3SO3A 4JYTA 1SOTA 3QUMP 1QGFA 3E3TA 2V3OH 4K5ZA 3ZYDA 1NM6A 1PYTC 2ANMH 3ZZ5A 2ZIQH 1ZJKA 2H6MA 3U98H 1DM4B 1SLXB 3TJVA 1O39A 3TJNA 1QIXB 2JETC 3VGCB 1IHSH 1SGPE 3VFEA 3PLPA 2NU2E 1XXFA 3QZRA 4BXWA 3RC4A 1MH0A 1VJAU 2GCTC 2ZQ2A 5JBAS 5DP6A 2GCHF 1ELDE 3O8RA 1ZHMA 1P9SA 1BHXF 5GDSH 4BAMB 3K9XB 1UVUH 1BTYA 1DXPA 1SQAA 1ZHPA 3KHVA 1UK3A 1GI3A 3NPSA 1W0ZU 5DP7A 1TA2A 1ZJDA 1C1NA 4X8SH 2O8UA 3TITA 4J1YA 4FVDA 2AFQB 3BTQE 3T25A 1QTFA 3M61U 1TGCA 2EA3A 3SUDA 1O38A 3EDXB 1HAIH 1ETTH 3SV6A 3ZZ6A 2FDAA 1MZDA 1Y5AT 3BN9A 3M37A 1AQ7A 1GI5A 1JOUB 3URCA 3NUMA 1P0SH 4NWKA 4I31A 3AASA 1ELGA 1W0YH 1AWFH 3P6ZB 1O2HA 1YF4A 3FAOA 1O5GH 3TIUA 2VVUA 5IDKA 4H4FA 2JETB 4GLYA 1P2MA 4IC5A 4OS5A 4BXSA 2NWNA 3C1KA 3TNSA 1GHAG 1C5XB 2GCTB 1OWIA 1QL7A 1BIOA 1GI4A 1W7XH 1OP8A 1NFXA 3MYWA 1HB0B 1C5ZB 1MUEB 3SHAH 1G2LA 1XKAC 3VB4A 2SNWA 5J4SA 2A7CA 2GVFA 1AVGH 2W3IA 3ZVAA 3ZZCA 1EQ9A 3K6YA 4NZQA 1GL0E 1C4Y2 1O5FH 4ZH8A 2O8MA 4IMQA 1XKBC 2PWXA 3A7TA 1QB9A 1XUIA 3MOCA 1VJ9U 1GDQA 4X8UH 3RXFA 2TGAA 4XBCA 5TCAA 1EXFA 1OYQA 3GCHC 3G01A 3E1XB 1IQFA 1SGFG 3M5LA 3QDZB 1S0QA 4JK6A 2PV9B 1GMDF 4Y6DA 1UO6A 1HGTH 3CENA 2D2DA 4Y8XA 5F8TA 4FU9A 5GJ4B 3RXVA 1GBMA 2JH6D 1PPEE 1T8MA 4MQAA 3OTJE 4I33A 2GD4B 2WPMS 3PO1C 2IN2A 3M7QA 3BIVH 3V12A 5LPRA 1EJAA 3A83A 2AGEX 2VIDA 2C90B 2DE9A 3QTVH 1TNLA 1WYKA 4UDWH 2FTMA 2GDEH 3GY5A 1ZMLA 1ZSLA 1PQ7A 1Z8GA 1ANDA 1NN6A 1W8BH 3KNXA 1C9PA 5CHAC 2ZCHP 4B1TA 2GT8A 1Y8TA 3RXUA 2XC4A 3MU4A 1FLEE 1F0TA 1H8DH 1CVWH 2R0LA 1UTOA 1GCDA 5E2PA 1HDTH 2BTCE 2ZZUH 1GL1A 1UTJA 4ABIA 2A4QA 2BQWB 4DT7B 1FAXA 1C5WB 1TNIA 1Y3YA 4IGDA 1F0RA 1O2IA 5TJXA 4B76A 4KKDA 3GCHB 1O2ZA 1S0RA 3EAJA 5T6DA 4DG4A 2Z9JA 2FYQA 4ABAA 1V2KT 1F0UA 1BBRK 2ZGCA 2GMTC 1QBOA 3L6PA 1TQ7B 7ESTE 1DLKB 1F5LA 3PO1B 3GY4A 1P03A 3TVJB 1LQDB 1HNEE 2FOCA 5T6FA 1ZSJA 2ZDVH 1K1IA 1GBFA 1YPHE 4YT6H 1PPHE 2W7SA 5EW2H 3GDSA 1GJ4H 2UWOA 1XUJA 4JK5A 2ZHWH 2VJ1A 2OC8A 1E36B 2ZU1A 2TGPZ 5FPTA 1TX6A 3A80A 1ZMJA 5CHAB 1HAOH 2ZDLA 1OYTH 5GCHG 2O8LA 3DHKH 1F5KU 3QZQA 4XBDA 4MPVA 5C67A 1SGYE 1B0EA 1NFUA 1T8NA 1AZZA 5LPFA 3RM0H 1G3BA 3C27B 3NKKA 4Y8ZA 4Y7AA 1UTPA 2VIVA 6ESTA 3Q00A 1ETRH 1MBMA 3PLBA 4GPGA 3RXKA 1W10U 1OOKB 2VU8E 4IW4E 3MFJA 1SLVB 1O2LA 2BDGA 1TGBA 4CBOA 1HJAC 2ZC9H 1O3AA 4ESTE 1P3EA 4TY7A 2OP9A 3SJ9A 2OQ5A 1Q3XA 2GMTB 4U30A 2OUAA 1BTUA 1Y3VA 7GCHF 1AVWA 1F92A 1ZTJA 1DWCH 2HNTF 2FOAA 4XBBA 1MKWH 5SGAE 5AFZH 2OXSA 3ATLA 3LJJA 3E16B 3U8RH 1OX1A 1EZXC 1NFYA 1KXFA 3CP7A 4X8TH 1A1RA 1WU1A 4A1VA 2V0BA 2XRCA 1JIMA 2Y5FA 4X1SU 1HRTH 3N7OA 1D3PB 1F7ZA 1BCUH 4FUIA 2PKSC 3K65B 1Z71A 3UR9A 1XUGA 3BEFB 1AO5A 1HV7A 2ZO3H 2BMGB 3A7ZA 5ESTE 4E06H 2ALVA 2BDYA 3SJKA 4HGCA 3M3VA 3D49H 4ZKOU 4NSYA 1YM0A 5AVDA 1XUKA 3RXHA 1EOLA 4CH8B 5AF9H 1O33A 1TGSZ 2BLWA 4UE7H 2HPPH 2ZDNA 1IQLA 2BOHB 4B75A 4NIXA 3A8AA 2I6SA 1QA7A 3TK5A 2B8OH 1IQGA 1P57B 1H9IE 1PPFE 5E0HA 1YCPH 1GBTA 2WUCA 2Z3CA 3ZZ7A 3T28A 1C1PA 3BG4C 2A2XH 1RXPA 1GJ7B 2F3CE 2HALA 2UUFB 3T2NA 2WPHS 3KEEA 3RXGA 1BTXA 1JXPA 4IN2A 1EPTA 1P9UA 2P93A 5A8XA 5FBEA 3F9EA 2H9TH 2ZGXH 1G30B 1QB6A 1OXGA 1O3PB 3I78A 1C4U2 2PKSB 4MNYA 3GYMA 3FZDA 2NU4E 1SGQE 3RP2A 3U1IB 1G32B 3BF6H 4FVBA 1YC0A 2HPQH 5HM2A 5DP3A 1XUFA 2G8TA 3TLOA 3P70B 1L1GA 3SJOA 3SNDA 1CQQA 3SI4H 2BHGA 1C1MA 1YPMH 4ZXXH 2ZFSA 1GHZA 3SJ8A 2SGDE 3URDA 1T8OA 3AW0A 2A5IA 3ELAH 2XXLA 4JYUH 3AW1A 1GVKB 1P2IA 2AIPA 2FESH 3GISB 4F4OC 3PYHA 4ABEA 1TPPA 1J14A 5C5OA 3A7VA 1GJ8B 4CRBA 3RDZA 1C4V2 4ZHMU 2FI5E 3BG4B 1K1LA 4Y79A 2H9HA 3AAUA 1KTTB 6CHAC 1MD7A 1HJ9A 2THFB 3UREA 3IG6B 1C5RA 2HNTE 3RU4D 3F9FA 1HAXB 1FIWA 1L4ZA 1BRBE 1KLJH 1BJVA 1AHTH 1SGEE 4WXVA 3MO9A 1G2MA 2J92A 2RA3A 3SV8A 1W14U 3LKWA 4ZKNU 1G3DA 3F1SB 1W7GH 2GDDA 1TQ0B 2W5EA 2ZPQA 2XC5A 4K8BA 1GCTC 4Q80A 1AN1E 1CGHA 3ZZ4A 1Y5BT 4X2XA 1OSSA 2FOBA 2A7HA 2UUYA 1WBGB 2CHAC 1EPTC 2PR3A 3T27A 3MH4A 2GV6A 5EXNA 3F68H 1O37A 5EU8A 3TGJE 1BJUA 3A84A 5JDUB 1S5SA 2ESTE 3A7WA 2Z9LA 3JZ2B 2QF0A 3RMNH 2AERH 3BV9B 4ISLA 2P95A 4Q7YA 5DJ7A 1C5YB 1FN6A 4M7GA 1VITF 6CHAB 2ZHQH 4NGAH 2J34A 2ZWLH 3RXCA 2BDIA 1ARCA 1BTZA 4O3TA 1PPZA 1G9IE 1H4WA 3GDVA 1LKAA 3I77A 2ZCKP 1OP2A 3UOPA 3LGYA 1MCTA 2ZTYA 1E0FD 2A4GA 4Y0YE 6GCHG 3R0FA 1QL9A 4I8JA 1SLWB 2BX3A 4CRDA 1V2RT 2FS8A 1HAHH 1TOMH 3UIRA 3Q76A 1EKBB 1EAXA 1W2KH 1TAWA 1ZHRA 1ZTLA 1HIAA 1SSXA 4D8NA 5A0AE 4UFEH 2CHAB 1C5QA 1EPTB 4X2WA 2BD9A 1TA6A 1TE0A 3ZZ8A 2ILNA 3BTHE 1A3BH 1QL8A 1A46H 1P3CA 1MZAA 4ABDA 2ZPSA 3RU4T 2ZG0H 5FX6A 2VIWA 1ELBA 3M5OA 1ANEA 5EXLA 1DE7H 2VWOA 1BITA 4KTSA 2H5DA 3QGJA 1TBZH 2GT7A 4HTCH 4X2YA 1FJSA 1GMCG 3ZVGA 1GMHF 3A82A 1DWBH 2IPHA 3ZV9A 4GSOA 3UTUH 3IITA 1EZUC 1WTGH 1LHGH 2BD4A 3VEQB 1TIOA 3GY6A 1UVTH 4K1TA 1FPCH 3E0NB 4IS5A 3SNEA 3RXOA 3F9GA 4OS6A 4DW2U 3S9AA 4WXIA 5A09A 1TLDA 1MKWK 4GAWA 2C8ZB 2FX6A 2FODA 2WPJS 5DP8A 4WJG2 2ZFQH 1O2TA 4K69A 2PGBB 3NCLA 1THSH 4RKOB 2XWAA 3KF2A 1O2WA 1K9OE 1K2I1 2OC0A 3SUGA 1DDJA 4Q2KA 1C5TA 3SV2H 4ABJA 1GBBA 4KP0A 2ZEBA 3PWCA 1K1NA 1DT2A 3ZVFA 4WY3A 3QO6A 1QFKH 1K1JA 2WUBA 1ELFA 3NXPA 1GDUA 1SBWA 3QTOH 1MKXH 5L30H 4UFFH 1QBNA 2Z6BD 1GBHA 1Z1IA 4AB8A 4Y7BA 4U01A 1UK4A 1ABIH 2QF3A 1PPBH 4B2CA 2EEKA 2GP9B 4H42U 2XBXA 2ZTXA 2B5TB 1O3IA 1NPMA 1HBTH 2BX4A 1O3JA 1KXDA 1SGRE 2Z9GA 4WMEA 1TMUH 3U69H 4E05H 1XXDA 1GHXH 1D4PB 1LQEA 1UJ1A 2ZPRA 4X1QU 3A87A 1P2JA 1V3XA 1YCPK 1QJ7B 5F8XA 1K21H 1TNGA 2ZU3A 4BOHA 1CHOG 2ZDKA 1SGFA 2QCYA 2F83A 4FUFA 4OS2A 1J15A 2KAIA 4NWLA 2FOHA 4AFSA 2ANKH 1N8OC 3LONA 3B23B 5EOKA 1KLTA 2QC2A 2WPLS 3OSYA 1S82A 4Y0ZE 1YYY1 4H6TA 5DK1A 4AG2A 3P17H 1DLEA 3SGBE 1LTOA 1O5AB 1VGCC 1FQ3A 2C8WB 4NA9H 5EG4A 2CF9H 2SGEE 1RRKA 4FUCA 3HKIB 5JBCS 3VPKA 4JZ1A 1HIAB 2GTBA 1D3TB 4OS4A 5HYOA 2QA9E 1E37B 3MNXA 2YNBA 1QB1A 2P8OC 1UCYK 3MU5A 3P95A 4K60A 2WV4A 3HKJB 2PUXB 3ZVBA 1GBAA 4OS1A 2A7JA 1RFNA 2HVXA 1C9TA 1QRXA 1GHYH 4MLFB 1CT4E 1A5HA 2BXTH 3SW2B 2TRMA 2BDAA 3KIDU 3DA9B 4X6OA 4CR9A 1BMMH 1AY6H 1BQYA 1Z8RA 2BD3A 4AGJA 1GHWH 1GBDA 1O5CB 2D26C 3LGIA 3ZVCA 1MTNC 1SQOA 4MNWA 2VH0A 2P59A 4KTCA 4ISHH 3MU0A 1O2SA 2BOKA 1N8OB 3SI3H 1FN8A 8GCHG 2A45B 3CS0A 1OS8A 3RLWH 5FX5A 1QA0A 1SFIA 1D3DB 1NS3A 2ZHDA 1ORFA 5B6OA 1T32A 2FOMB 5FBIA 3V13A 3RXLA 1NC6A 1O2VA 5ABWA 5L2ZH 1SC8U 2HRVA 1EASA 1K1PA 2VIOA 5TCCA 1VGCB 2AEIH 2OBQA 4MG3A 1Z6JH 4YOGA 3P8NA 1LMWB 2BZAA 2Y6TA 1K1MA 3Q3KA 3ATKA 3STIA 2BY6X 3A7XA 2FZZA 4FU8A 2FIRH 1EAWA 1BMAA 2ASUB 1P12E 4WH8A 1TRYA 1V2JT 3BTME 2P8OB 1ZTKA 3P8OA 1INCA 4FUEA 1KDQA 3MU1A 4CRFA 1DFPA 3SORA 3MI4A 2DE8A 3OX7U 3PWBA 3S9BA 1SB1H 4TPYA 5GIBA 1TPAE 2VWNA 3M3SA 4DVAU 2ZCLP 1O2JA 1EZQA 1OWHA 4YM9A 4GCHF 1H1BA 2AH4X 3SNBA 3H7TA 4AYVB 4YOIA 1T4UH 5CMXH 4Y71A 1HLTH 2V3HH 1ANCA 2FLBH 1MTNB 2W26A 5JPMH 1VR1H 4D7FA 1A7SA 3QN7A 5F8ZA 3ATMA 1NO9H
chains in the Genus database with same CATH superfamily
8ESTE 1TPSA 4NZLA 4O3UA 4JZEH 3FVFB 1C1SA 2P16A 1F5RA 2VVCA 1W0JD 3ODFA 5C20A 5DP4A 1A5IA 1KSNA 1KMHB 4Q4LA 4CRCA 1IQNA 1H8IH 3RXTA 1C2HA 3PM3A 1LKBA 3T5FH 3FFGA 2ZNKH 4JCNA 1O2MA 2GX4A 2OBOA 2FWWA 3UUZA 3WY8A 3LGUA 4VGCC 3QK1A 4YTAA 1C5UA 3BTWE 2V6NA 1YBWA 3A85A 4YESB 4CBNA 4ZMAH 2YOLA 4BTUB 1V2WT 1RS0A 2KAIB 3VXEH 2JJ2D 1DY9A 1EJMA 4R8TB 3OYPA 1H8HD 1E35B 1EZSC 1QQ4A 3AVZA 1QNJA 1JRTA 1QHRB 1O30A 3UNRA 1C2GA 2RDEA 2J97A 3V7TA 3SGQE 3F9HA 1O5BB 4XFQA 1H9HE 3VB3A 1A3EH 2YMSC 2XBWA 2GKVE 2ZGHA 2SNVA 5EQQA 3HGPA 4DOQA 4CRAA 1NFWA 4PROA 4BTTB 3SU6A 2QXGA 1LCYA 1XX9A 1CO7E 3TK6A 5LPEA 2WSSD 2XNDD 3SU1A 3ODDA 2F9BH 4D7GA 1YGCH 1VCQA 1E1RD 4CHAC 2JDID 3LIWA 3A88A 2FOFA 1T8LA 2UWPA 1AWHB 1FDPA 2J95A 4ASUD 1DUAA 1IQEA 3U8TH 1TX8A 4FUJA 3UWJH 1J9CH 2G81E 2RA0A 1FI8A 3UAIC 2C3SA 4ZHAA 1TMTH 2SGFE 5C5NA 2W7UA 4F49A 1FY4A 1YP9A 4A1TA 2W6ID 2K8IA 2BDBA 1IQIA 4VGCB 1P2QA 3E0PB 2BVRH 1ABJH 5CE1A 1TRNA 1V2ST 3TPIZ 3A81A 4O97A 4DIHH 2PP6A 1W12U 4I8LA 4ABBA 5E2OA 1B7XB 5DPAA 2G5NA 5H4IB 2BVSH 1UTQA 1O3MA 1UK2A 5KECA 2BD8A 1EX3A 1ESAA 4NCYA 2ZGJA 1OHHD 2A32A 1GJ6A 2ODPA 1EB1H 1C5SA 2YMSB 1O5EH 2VWLA 1QQUA 3PMBB 2PKAA 1CHGA 3SNAA 1WTHD 4KGAA 1O3OA 1ZR0A 1RTFB 5FHTA 5EQRA 1C2DA 3GCTG 2PSYA 3VB5A 1EP6A 1S83A 2C8YB 2XBYA 1DY8A 1V2TT 3DCLA 1SOZA 5GPIB 4CHAB 2D1JA 1KDQB 1TRMA 1DOJA 1YKTA 4AORA 1FV9A 3DSPA 1D6WA 1HJAB 2LELA 1S81A 3S7KB 2ZGBH 1XVMA 3D23A 4MNXA 2Z3EA 3RU4E 3H09A 2FOGA 3F6UH 5C1XA 3LGVA 1GBKA 4DCDA 1CBWC 1EAIA 1CGIE 1K22H 1O35A 3L33A 5A2MH 4AYYB 1YY3A 5FPYA 3EA7A 1BRAA 2GCHG 3RUOA 4WVPE 1MAYA 2A31A 2FMJA 8KME2 3KQCA 1BTWA 4NA7A 2VVVA 1TABE 1O3FA 3VB7A 4DGJA 3HATH 1VCPA 2LP6A 3MNSA 4RKJB 1A61H 1W13U 2GV7A 4ZHLU 1WUNH 3RXJA 3IWMA 1NRPH 1RTLA 1ZYOA 2B0FA 4ZKSU 4AB9A 1QJ6B 1FZZA 1V2NT 3FP6E 5K0HA 3MH7A 1GI0A 1ANBA 4SGAE 1CGJE 5L6NH 1SFQB 1Y3WA 2VIQA 3H5CB 5T3HA 3M36A 2QXJA 2XYAA 4I7YH 3DFLA 1SVPA 1O34A 1V2VT 1TB6H 1AUJA 2C4FH 1D9IA 5F6MA 1KYNA 1ZSKA 3DT0H 1UTKA 5C1YA 4X6PA 1O2GH 2VIPA 1B0FA 9LPRA 1GHAF 4Z0KA 1JWTA 2FS9A 1Z1JA 1HCGA 1J8AA 1CBWB 4NIYA 4AFZA 1XUHA 3Q3YA 4Y11E 4AZ2B 2AIQA 4OS7A 1MTUA 1AI8H 1F2SE 1HFDA 1ELEE 1O3HA 1ZPCA 4WF8A 3LH3A 2BZ6H 1H9LB 4Q7ZA 1AB9C 5G4BA 4K1EA 2QAAA 2FPZA 5BPEA 1A0JA 4K1SA 1PQAA 3TH3H 2JH0D 1DSTA 1QZ8A 4QT8C 4INKA 3NK8A 2PFEA 1MU6B 1DWDH 1THPB 4TYDA 3S9CA 4ASHA 1NESE 4ZAEA 2WPIS 3VG8A 1MBQA 1EB2A 2V35A 4I8KA 4F48B 4K3JA 1L1JA 2JKHA 4YXWD 1K28D 1BT7A 4FXGH 2J94A 1RTKA 1BOQA 1LHFH 2R9PA 1V6DA 3V0XA 2G55A 1IQHA 2ZU5A 1ZZZA 2FTLE 1SGNE 1M9UA 1GMDG 3OY6U 1C2EA 1QRWA 3D62A 4ZKRU 1LVBA 1SR5C 2Q6DA 3SU5A 3ENSB 3WWBA 3BIUH 5DGJA 3H7OA 2ZA5A 3LC5A 4X6MA 1EATA 2PKAB 3PROA 2ZHEH 1TOCB 3RC6A 3GY3A 3LDXH 4TWWA 2AMDA 3SUEA 2ZFTA 2Z94A 3BTGE 1P8VC 2TBSA 4A7IB 1C5VA 1ZPBA 1A5GH 4FUDA 4WMDA 1FY3A 3B9FH 3VB6A 2PTNA 1AB9B 3M7UA 3LGTA 2ZQ1A 1PPGE 4MPWA 1C5PA 1ESTA 3BEUA 2G4UA 2R3YA 4X1RU 4X2VA 1TNHA 4BAKB 4FU7A 4OGXA 1YCPM 2A1DB 4NSVA 4Y76A 1IOEA 4DY7B 2SFAA 3L3TA 4Y8YA 8LPRA 2BXUH 2F9NA 2CV3A 3EE7A 1CSOE 2BVXH 3M35A 4TY6A 1GCTB 4AFQA 4NA8A 2B9LA 2ZDMA 1Y59T 4CREA 1XVOA 1NRSH 3EA9A 3PLKA 5EW1H 1TFXA 3E90B 5DKMA 2XC0A 5IYTA 5I46H 3TH4H 4BAHB 5DO4H 1SL3A 3T29A 3RXQA 2J9NA 1THRH 1YWUA 2TGTA 4FETA 1L0ZA 2EQNA 4JZFH 4NIWA 5FPSA 3DFJA 5HKKD 1VCWA 4D76A 1V2MT 5GCHF 4X8VH 3UR6A 2A5AA 5HIYA 4TT3D 1TX7A 1N1LA 2B7DH 2JH5D 4RSPA 1LVOA 2FEQH 1NZQH 1IQJA 3UY9A 2Z9IA 2WHXA 2J4IA 5J4QA 1DXWA 2EC9H 3PB1E 1SLUB 1TONA 1GBLA 2PTCE 1C1TA 4HZHA 2EI6A 3M3TA 1TNKA 2TIOA 3MO3A 2PLXA 2PW8H 1O2UA 1C1UH 2CK3D 2FOEA 2QE7D 1BB0B 2Y7XA 3PV4A 4Y10E 1S84A 5JB8S 1ARBA 2BYAX 4KELA 3RMLH 5JB9S 1O36A 1GVZA 1Y3XA 2IOTA 1HPGA 2F9OA 4CH2B 1K1OA 1GJAB 2P3TB 1FXYA 2XTTB 2XWBI 2FXRA 4MPUA 3EGKH 3B8JA 1O3KA 7GCHG 1C2JA 4I8GA 3RXEA 2Y5HA 3MMGA 2O9QA 1SQTA 1ACBE 2OK5A 2G52A 3E91A 3OY5U 1A0HB 1GBCA 2A2QH 1LVMA 2QY0B 1QY6A 2VINA 2G5VA 1ESBA 1KXBA 4ZUHA 3ZZDA 5DG6A 4FUHA 1VZQH 1BTHH 1ZPZA 3O8BA 3CS7A 1AIXH 1KTSB 1YPKH 1C2IA 4E7NA 4X1NU 2GZ7A 2WYGA 5C2ZA 3SHCH 1RD3B 3E6PH 4LZ1H 4B74A 4NFFA 3TGKE 1C1QA 2OQUA 4IN1A 4TWYA 4AN7A 3BTFE 5EXMA 4IC6A 4UFGH 1E1QD 1C5OH 2OD3B 3ATWA 1WV7H 4AOQA 1FMGA 1XMNB 3TJUA 4DJZB 2QV1A 2BY5X 2XW9A 1NRNH 1HYLA 2F9UA 3TGIE 1LHCH 1KXEA 2TPIZ 1BA8B 4A6LA 3SUFA 1O3BA 3HK3B 1JRSA 2ZECA 1HAZB 2LNCA 2ZHFH 2BY7X 2OC7A 2VB0A 1O31A 5EPYA 4YT7H 1TMBH 3UPEA 3P92A 4XDEA 5EPNA 1GWAA 2H5CA 4ISOA 5FCRA 2BD7A 2G4TA 1Z8IB 1FY1A 3MNBA 4WMFA 1E79D 3PMJA 2AS9A 4IMZA 2A4RA 1GBJA 3LOXA 2BM2A 3P8GA 4BAQB 5DP9A 3GY2A 1S6FA 1SGCA 1T31A 2PHBA 3M5MA 4NIVA 1BBRE 1GDNA 1O2OA 2CF8H 3EE0B 2QYIA 1IAUA 1DS2E 2ZTZA 3PTNA 4AG1A 1HJ8A 4IBLH 3RM2H 1L4DA 2SGPE 4I86A 2C93B 1LPKB 2GZ8A 2KCYA 4UFDH 1CT2E 4RN6A 4UD9H 1O2RA 4NG9H 1GJ9B 1ZGVA 1O5DH 1AKSA 3UNQA 2Z3DA 4MPXA 3LPRA 1P01A 4JYVH 2H1UA 1X7AC 3ZYEA 2BLVA 6LPRA 3SQEE 4XSKU 2WYJA 2Y7ZA 3LT3A 3ZZAA 2CJIA 3ESTA 4D9RA 1P02A 1UVSH 1EJNA 1DWEH 5ESBA 3ZZ3A 3MWIU 3BG8A 5JBTA 1VKYA 4XOJA 1DICA 1DPOA 1GPZA 2HOBA 1FY5A 2O8WA 3KN2A 3GS9A 3TH2H 4GVUA 1YLDA 1JMOH 4YLUA 2BLQA 3FZZA 1DITH 4M9FA 1EP5A 3GCOA 4AC9A 3SN8A 1UHBA 1PFXC 1FONA 4GUXA 3S69A 2FYRA 2XNIA 1NU9A 5EODA 1TALA 2BD5A 3RXDA 4MVNA 3RXIA 2ANWA 1JIRA 4HI3A 3K6ZA 1TYNA 5C1UA 1P2NA 1GI8B 1BMNH 1CT0E 1SGIB 3NZIA 1GI1A 1UVPA 2I6QA 1O3CA 2RFKC 1FIZA 1HAVA 1GI7B 1U6QA 1J16A 1ZGIA 4LOYH 4MNVA 5A0BA 3M5NA 3ZVDA 1WQVH 3ATIA 1AE5A 3A86A 1V2PT 2Z9KA 3SU2A 1VITG 1FUJA 3TU7H 1CE5A 5FL7D 1OWDA 1ZRKA 1SHYA 2ODQA 2WV9A 1C5MD 3BSQA 4AFUA 3UB0A 6GCHF 3RLYH 4ABGA 3S7HB 3A8CA 4GHQA 1ELVA 3E8LA 2BQ7B 1O32A 2BDHA 1AE8H 2LPRA 1O3GA 2NU0E 2R2WU 3O8DA 1G3CA 1COWD 3SJIA 2KZ4A 2P3FH 1J17T 5KGOA 1ZLRA 1O3DA 3ZV8A 3T62A 1OWJA 4E7RG 3QLPH 3SNCA 2UWLA 5BRRE 2FI3E 1GGDC 1UMAH 1V2UT 5K7RA 5A0CA 3WW7A 1YPEH 2G51A 4HFPB 2EI7A 3LC3A 3STJA 5L2YH 5PTPA 1SGDE 1F0SA 1C5NH 2D8WA 2BQ6B 1SI5H 2VH6A 1GHBG 3KQDA 4X6NA 4X1PU 5HXFA 2CN0H 2CMYA 3SOSA 1DSUA 1AZ8A 1V2LT 4SGBE 5F03A 1MD8A 3A89A 3RXBA 1FPHH 1Y3UA 5E0GA 4DIIH 2ZF0H 3LH1A 4ISNA 2CXVA 1P05A 1QR3E 2PUQH 3UWIA 2A4OA 5HGGA 3Q3XA 5C3NA 1O2NA 2ZFRH 1GMCF 1P11E 3KQEA 1MAXA 3RMMH 1B5GH 1RIWC 1OKXA 3M7TA 1LDTT 1PPCE 2OC1A 2TGDA 4J2YB 2M5TA 3RXRA 2ZDAH 7LPRA 3GICB 2AMPA 1AFQC 4OGYA 3SV7A 1SG8B 2PGQB 3D65E 2F9PA 1Z6EA 1P2OA 2SGQE 1L1NA 1GHVH 4I8HA 2FM2A 1GMHG 4JZDH 2VGCC 3FP8E 2QXIA 3RC5A 4AGKA 4THNH 1GI9B 1AKSB 1OPHB 2CGAA 3HGNA 4WWYA 5DSFA 1UVOA 1P06A 1DVAH 4B71A 4Q63A 1GGDB 1G3EA 3GY8A 2WPKS 2C8XB 1AFEH 1GI6A 4RT0A 1BRCE 1TGTA 5EQSA 1MMJN 4YLQH 5FCKA 1GI2A 1P04A 1RJXB 2OINA 1Y5UT 4ZROA 2RDLA 1P2KA 2W3KA 3P8FA 1BTPA 1O2KA 5LGOA 3AAVA 1YPGH 3JZ1B 4AX9H 1C1OA 1PQ8A 4U2WA 3KYGA 1DANH 4ACAA 5DN6D 1GVLA 2R3UA 1MKXK 3ITIA 1NU7B 2ZI2H 1MTVA 1PQ5A 3FP7E 1Z7KA 3MTYA 1UHBB 1WCZA 4FUBA 4ISIH 1RIWB 2ZKSA 2BLOA 2PSXA 2QGRA 1KXAA 4K2YA 3PV2A 5GWZA 3SV9A 1D6RA 2Q6GA 1AFQB 3DSOA 3EYDA 2XCFA 3RXMA 1IQKA 1ELCA 2FI4E 2VNTA 1TBQH 1DUEA 1ZOMA 4YO9A 5HMAA 2VGCB 4ABHA 1AGJA 1MTWA 1NTPA 4MTBA 5LH8A 2ZU2A 1WXRA 4B2BA 2RG3A 4P02A 3U1JB 1HAVB 1CHOF 1QJ1B 4B73A 1V2QT 2HLCA 1AMHA 1L2EA 1OP0A 9ESTA 2R2MB 4H6SB 5HM9A 1MU8B 2M2AA 3S0NA 2GGVB 2RCEA 3RMOH 1N6YA 1BMLA 3DD2H 1KXCA 1KY9A 3PMAB 5EGMA 4JZIA 4KTUA 5HIZA 4LZ4B 2Q1JA 2IPQX 2V3MA 1C2LA 5ETXA 4OM9A 4A92A 3TK9A 1HXFH 2Z7FE 2ODYB 3A7YA 1ETSH 2GZ9A 2ULLA 2DUCA 2XCNA 2H9EH 4JMYA 1W11U 1LO6A 2JJ1D 3QX5H 1HAGE 1ELTA 1Q2WA 1GJBB 3NWUA 1O0DH 3O8CA 1D3QB 1ID5H 3EA8A 1E38B 1QURH 4D9QA 1P10A 2OCVB 3LJOA 4WH6A 3ZZ9A 1A0LA 1YPHC 4ZXYH 3GOVB 1T4VH 1O2XA 2YNAA 1AU8A 1MTSA 1WSSH 5A8YA 1KLIH 3Q77A 5JBBS 1UCYH 4BAOB 1TGNA 1SPJA 5FXLA 2H2ZA 2UUKB 2A0QB 1CA8B 1A4WH 5DP5A 1C5LH 2QN5T 1LPZB 2BDCA 2BB4A 3GY7A 5E8EH 1ZRBA 3FKSD 1W3CA 2JIZD 8GCHF 2G00A 1QBVH 1NRRH 4BTIB 1GJ5H 1IHTH 4Z1MD 2BD2A 1WOFA 1HUTH 1IQMA 1TPOA 3FANA 2QIQA 3KQBA 1OWEA 3KGPA 1E34B 1BRUP 1LHEH 1ZMNA 3UNSA 1BHXB 1WDIA 2BY8X 4NFEA 3ZZBA 4ABFA 1WQSA 1C1WH 3SU0A 1FY8E 1C1VH 1S6HA 5AHGH 1OWKA 1PJPA 1GJCB 5A8ZA 3GYLB 1HAYB 1GJDB 4LXBH 2KFWA 2EY4C 2NU1E 2J38A 3U8OH 5AFYH 3UFAA 3W94A 2HGTH 1CA0C 1Z8JB 3PRBA 3BTTE 1SGTA 3A8BA 1CU1A 1SHHB 2FO9A 1YPLH 2FX4A 1A2CH 4YOJA 4DT4A 1HAPH 3BTKE 2IJOB 2P94A 3K2UA 2Y82A 2AMQA 1G37A 4O03A 4A5TS 2STAE 3F2GA 2XBVA 3VXFH 4GCHG 2QXHA 5GXPA 4TSFD 3KL6A 2ZFPH 2AGGX 5CDFE 4K8YA 4Q7XA 1O3EA 4CR5A 1VITH 2F9VA 2AGIX 3UQVA 2UUJB 4INHA 1RGQA 1JBUH 2FP7B 2OTVA 3MH5A 1YPJH 1C2MA 3I29A 1C1RA 1EOJA 3UQOA 3HK6B 2K1QA 4XE4A 1LPGB 3QWCH 1O3LA 1T7CA 3PRDA 1QCPA 2ZU4A 3U9AH 2Q6FA 1G36A 3W95A 1O2YA 1SKYE 1P09A 4GHTA 3LU9B 3SZNA 2FLRH 3ZVEA 2WV5A 3HPTB 2SGAA 1LHDH 1S85A 1CA0B 1BZXE 1BBRH 4INLA 1EAUA 4BNRA 5JYIA 5I25A 3PMHB 2KM0A 3A8DA 2ANYA 3MHWU 3SU4A 1UTMA 3OU0A 1EUFA 1GBIA 1LVYA 1SMFE 1NROH 1KIGH 2KX4A 5E0JA 2P3UB 2J5UA 1NRQH 3BTEE 3T26A 1V2OT 1C2KA 2AYWA 1Q31A 3OAAD 1GHBF 4BANB 1TWXB 3SQHE 3TJOA 2VWMA 4A1XA 3FOAA 1GBEA 3RXAA 3TNTA 2Y80A 1GG6C 2ZP0H 7KMEH 3PTBA 1O3NA 1MABB 3EQ0H 4U32A 4CRGA 1PYTD 3SBKA 1O2PA 3R3GB 2WINI 4O9VA 2ZFFH 3LGWA 2BY9X 4DURA 1AVXA 1ELAA 3SZEA 1C2FA 5T6GA 1UCYE 2R0KA 1N6XA 1TBRH 4B2AA 1UTLM 3QGNB 4UONA 3BEIB 3VGCC 4YZUA 5FAHA 3KCGH 1WAYB 3UOUA 4I32A 1HXEH 1AUTC 3BTDE 1BUIA 3MH6A 1DX5M 3GCNA 3RXPA 1QRZA 2HWLB 1YLCA 2OLGA 1NY22 3SGAE 2Y81A 1NT1A 1MCVA 1MQ5A 2Y5GA 4Z6AH 3DUXH 2A5KA 3RXSA 2STBE 4HG6A 3W1EA 3MU8A 1MQ6A 2F91A 3MO6A 1BDAA 2ALPA 2J2UA 3MNCA 1FAKH 1O2QA 2NU3E 2O8TA 4FUGA 1FNIA 4MDSA 3V3MA 3GCTF 1XM1A 2EI8A 4LK4A 2HNTC 1TNJA 1SQRA 4XRNA 4R0IA 1UTNA 1AD8H 3GDUA 4TPIZ 1GG6B 3SU3A 4X0WU 4UEHH 3SO3A 4JYTA 1SOTA 3QUMP 1QGFA 1K0HA 3E3TA 2V3OH 4K5ZA 3ZYDA 5C0TA 1NM6A 5EJ1A 1PYTC 2ANMH 3N99A 3ZZ5A 2ZIQH 1ZJKA 2H6MA 3U98H 1DM4B 1SLXB 3TJVA 1O39A 3TJNA 1QIXB 2JETC 3VGCB 1IHSH 1SGPE 3VFEA 3PLPA 2NU2E 1XXFA 3QZRA 4BXWA 3RC4A 1MH0A 1VJAU 2GCTC 2ZQ2A 5JBAS 5DP6A 3CNRA 2GCHF 1ELDE 3O8RA 1ZHMA 1P9SA 3N7EA 1BHXF 5GDSH 4BAMB 3K9XB 1UVUH 1BTYA 1DXPA 1SQAA 1ZHPA 3KHVA 1UK3A 1GI3A 3NPSA 1W0ZU 5DP7A 1TA2A 1ZJDA 1C1NA 4X8SH 2O8UA 3TITA 4J1YA 4FVDA 2AFQB 4FOUC 3BTQE 3T25A 1QTFA 3M61U 1TGCA 2EA3A 5C17A 3SUDA 1O38A 3EDXB 1HAIH 1ETTH 3SV6A 3ZZ6A 2FDAA 1MZDA 1Y5AT 3BN9A 3M37A 2XOKD 1AQ7A 1GI5A 1JOUB 3URCA 3NUMA 1P0SH 4NWKA 4I31A 3AASA 1ELGA 4RT1A 1W0YH 1AWFH 3P6ZB 5EJZA 3ZIAD 1O2HA 1YF4A 3FAOA 1O5GH 3TIUA 2VVUA 5IDKA 4H4FA 2JETB 4GLYA 1P2MA 4IC5A 5EJLA 3F2FA 4OS5A 4BXSA 2NWNA 3C1KA 3TNSA 1GHAG 1C5XB 2GCTB 1OWIA 1QL7A 1BIOA 1GI4A 1W7XH 1OP8A 1NFXA 3MYWA 1HB0B 1C5ZB 1MUEB 3SHAH 1G2LA 1XKAC 3VB4A 2SNWA 5J4SA 2A7CA 2GVFA 1AVGH 2W3IA 3ZVAA 3ZZCA 1EQ9A 3K6YA 4NZQA 1GL0E 1C4Y2 1O5FH 4ZH8A 2O8MA 2F43B 4IMQA 1XKBC 2PWXA 3A7TA 1QB9A 1XUIA 3MOCA 1VJ9U 1GDQA 4X8UH 3RXFA 2TGAA 1NBMD 4XBCA 4B6EA 2KR7A 1EXFA 5TCAA 1OYQA 4P00A 3GCHC 3G01A 3E1XB 1IQFA 1SGFG 3M5LA 3QDZB 1S0QA 4JK6A 2PV9B 1GMDF 4Y6DA 1UO6A 1HGTH 3CENA 2D2DA 4Y8XA 5F8TA 4FU9A 5GJ4B 3RXVA 1GBMA 2JH6D 1PPEE 1T8MA 4MQAA 3OTJE 4I33A 2GD4B 2WPMS 3PO1C 2IN2A 3M7QA 3BIVH 3V12A 5LPRA 1EJAA 3A83A 2AGEX 2VIDA 2C90B 2DE9A 3QTVH 1TNLA 1WYKA 4UDWH 2FTMA 2GDEH 3GY5A 1ZMLA 1ZSLA 1PQ7A 1Z8GA 1ANDA 1NN6A 1W8BH 3KNXA 1C9PA 5CHAC 2ZCHP 4B1TA 2GT8A 1Y8TA 3RXUA 2XC4A 3MU4A 1FLEE 1F0TA 1H8DH 1CVWH 2R0LA 1UTOA 1GCDA 3MQKC 5E2PA 1HDTH 2BTCE 2ZZUH 1GL1A 1UTJA 4ABIA 2A4QA 2BQWB 4DT7B 1FAXA 1C5WB 1TNIA 1Y3YA 4IGDA 1F0RA 1O2IA 5TJXA 4B76A 4KKDA 3GCHB 1O2ZA 1S0RA 3EAJA 5T6DA 4DG4A 2Z9JA 2FYQA 4ABAA 1V2KT 1F0UA 1BBRK 2ZGCA 2GMTC 1QBOA 3L6PA 1TQ7B 7ESTE 1DLKB 1F5LA 3PO1B 3GY4A 1P03A 3TVJB 1LQDB 1HNEE 2FOCA 5T6FA 1ZSJA 2ZDVH 1K1IA 1GBFA 1YPHE 2KCOA 4YT6H 3AK5A 5T1VA 1PPHE 2W7SA 5EW2H 3GDSA 1GJ4H 2UWOA 1XUJA 4JK5A 2ZHWH 2VJ1A 2OC8A 1E36B 2ZU1A 2TGPZ 5FPTA 1TX6A 3A80A 1ZMJA 5CHAB 1HAOH 2ZDLA 1OYTH 5GCHG 2O8LA 3DHKH 1F5KU 3QZQA 4XBDA 4MPVA 5C67A 1SGYE 1B0EA 1NFUA 1T8NA 1AZZA 5LPFA 3RM0H 1G3BA 3C27B 3NKKA 4Y8ZA 4Y7AA 1UTPA 2VIVA 6ESTA 3Q00A 1ETRH 1MBMA 3PLBA 4GPGA 3RXKA 1W10U 1OOKB 2VU8E 4IW4E 3NRLA 3MFJA 1SLVB 1O2LA 2BDGA 1TGBA 4CBOA 3OFND 1HJAC 2ZC9H 1O3AA 4ESTE 4F55A 1P3EA 4TY7A 2OP9A 3SJ9A 1Q3XA 2OQ5A 2GMTB 4U30A 2OUAA 1BTUA 1Y3VA 7GCHF 1AVWA 1F92A 5EIYA 1ZTJA 1DWCH 2HNTF 2FOAA 4XBBA 3OE7D 1MKWH 5SGAE 4RI0A 5AFZH 3WWFA 2OXSA 3ATLA 3LJJA 3E16B 3U8RH 1OX1A 1EZXC 1NFYA 1KXFA 3CP7A 4X8TH 1A1RA 1WU1A 4A1VA 2V0BA 2XRCA 1JIMA 2Y5FA 4X1SU 1HRTH 3N7OA 1D3PB 1F7ZA 1BCUH 2GJGA 3F2HA 4FUIA 2PKSC 5C94A 3K65B 1Z71A 3UR9A 1XUGA 3BEFB 1AO5A 1HV7A 2ZO3H 2BMGB 3A7ZA 5ESTE 4E06H 2ALVA 2BDYA 3SJKA 4HGCA 3DSGA 3M3VA 3D49H 4ZKOU 4NSYA 1YM0A 5AVDA 1XUKA 3RXHA 1EOLA 4CH8B 5AF9H 1O33A 1TGSZ 2BLWA 4UE7H 2HPPH 2ZDNA 1IQLA 2BOHB 4B75A 4NIXA 3A8AA 2I6SA 1QA7A 3TK5A 2B8OH 1IQGA 1P57B 1H9IE 1PPFE 5E0HA 1YCPH 1GBTA 2WUCA 2Z3CA 3ZZ7A 3T28A 1C1PA 3BG4C 2A2XH 1RXPA 1GJ7B 2F3CE 2HALA 2UUFB 3T2NA 2WPHS 3KEEA 3RXGA 1BTXA 1JXPA 4IN2A 1EPTA 1P9UA 2P93A 2WZQA 5A8XA 5FBEA 3F9EA 2H9TH 2ZGXH 3OEED 1G30B 1QB6A 1OXGA 1O3PB 3I78A 1C4U2 2PKSB 4MNYA 3GYMA 3FZDA 2NU4E 1SGQE 3RP2A 3U1IB 1G32B 3BF6H 4FVBA 1YC0A 2HPQH 5HM2A 5DP3A 1XUFA 2G8TA 3TLOA 3P70B 1L1GA 3SJOA 3SNDA 1CQQA 3SI4H 2BHGA 1C1MA 1YPMH 3F0PA 4ZXXH 2ZFSA 1GHZA 3SJ8A 2SGDE 3URDA 1T8OA 3AW0A 2A5IA 3ELAH 2XXLA 4JYUH 3AW1A 1GVKB 1P2IA 2AIPA 2FESH 3GISB 4F4OC 3PYHA 4ABEA 1TPPA 1J14A 5C5OA 3A7VA 1GJ8B 4CRBA 3RDZA 1C4V2 4ZHMU 2FI5E 3BG4B 5IK2D 1K1LA 4Y79A 2H9HA 3AAUA 1KTTB 6CHAC 1MD7A 1HJ9A 2THFB 3UREA 4ZCNA 3IG6B 1C5RA 5F53A 2HNTE 3RU4D 3F9FA 1HAXB 1FIWA 2HLDD 1S6LA 5B6LA 1L4ZA 1BRBE 1KLJH 3N7DA 1BJVA 1AHTH 1SGEE 4WXVA 3MO9A 1G2MA 2J92A 2RA3A 3SV8A 1W14U 3LKWA 4ZKNU 1G3DA 3F1SB 1W7GH 2GDDA 1TQ0B 2W5EA 2ZPQA 2XC5A 4K8BA 1GCTC 4Q80A 1AN1E 1CGHA 3ZZ4A 1Y5BT 4X2XA 1OSSA 2FOBA 2A7HA 2UUYA 5C0UA 1WBGB 2L74A 4ACBA 2CHAC 1EPTC 2PR3A 3T27A 3MH4A 2GV6A 5EXNA 3F68H 2KCPA 1O37A 5EU8A 3TGJE 1BJUA 3A84A 5JDUB 1S5SA 2ESTE 3A7WA 2Z9LA 3JZ2B 2QF0A 3RMNH 2AERH 3BV9B 4ISLA 2P95A 4Q7YA 5DJ7A 1C5YB 1FN6A 4M7GA 1VITF 6CHAB 2ZHQH 4NGAH 2J34A 2ZWLH 3RXCA 2QF4A 2BDIA 1ARCA 1BTZA 4O3TA 1BMFD 1PPZA 1G9IE 1H4WA 3GDVA 1LKAA 2W6JD 2ZCKP 1OP2A 3I77A 3LGYA 3UOPA 1MCTA 2ZTYA 1E0FD 1W0KD 2A4GA 4Y0YE 6GCHG 3R0FA 1QL9A 4I8JA 1SLWB 2BX3A 4CRDA 1V2RT 2FS8A 1HAHH 1TOMH 3UIRA 3Q76A 1EKBB 1EAXA 1EFRD 1W2KH 1TAWA 1ZHRA 1ZTLA 1HIAA 1SSXA 4D8NA 5A0AE 4UFEH 2CHAB 1C5QA 5KEDA 1EPTB 4X2WA 2BD9A 1TA6A 1TE0A 3ZZ8A 2ILNA 3BTHE 1A3BH 1QL8A 1A46H 1P3CA 1MZAA 4ABDA 2F4LA 2ZPSA 3RU4T 2ZG0H 5FX6A 2VIWA 1ELBA 3M5OA 1ANEA 5EXLA 2J98A 2HVYB 1DE7H 2VWOA 1BITA 4KTSA 2H5DA 3FN8A 3QGJA 1TBZH 2GT7A 4HTCH 4X2YA 1FJSA 1GMCG 3ZVGA 1GMHF 3A82A 1DWBH 2IPHA 3ZV9A 4GSOA 3UTUH 3IITA 1EZUC 1UW7A 1WTGH 1LHGH 2KCAA 2BD4A 3VEQB 1TIOA 3GY6A 1UVTH 4K1TA 1FPCH 3E0NB 4IS5A 3SNEA 3RXOA 3F9GA 4OS6A 4DW2U 3S9AA 4WXIA 5A09A 1TLDA 1MKWK 4GAWA 2C8ZB 2FX6A 2FODA 2WPJS 5DP8A 4WJG2 2ZFQH 1O2TA 4K69A 2PGBB 3NCLA 1THSH 4RKOB 2XWAA 3KF2A 1O2WA 1K9OE 1K2I1 2OC0A 3SUGA 1DDJA 4Q2KA 1C5TA 3SV2H 4ABJA 1GBBA 4KP0A 2ZEBA 3PWCA 1K1NA 1DT2A 3ZVFA 4WY3A 3QO6A 1QFKH 1K1JA 2WUBA 1ELFA 3NXPA 1GDUA 1SBWA 1YLNA 3QTOH 1MKXH 5L30H 4UFFH 1QBNA 2Z6BD 1GBHA 1Z1IA 3SYJA 4AB8A 4Y7BA 4U01A 1UK4A 1ABIH 2QF3A 1PPBH 2VBCA 4B2CA 2EEKA 2GP9B 4H42U 2XBXA 2ZTXA 2B5TB 1O3IA 1NPMA 1HBTH 1NBME 1O3JA 2BX4A 1KXDA 1SGRE 2V7QD 2Z9GA 4WMEA 2WPDD 1TMUH 3F0OA 3U69H 4E05H 1XXDA 1GHXH 1D4PB 1LQEA 1UJ1A 2ZPRA 3OTPA 4X1QU 3A87A 1P2JA 1V3XA 1YCPK 3PV5A 2QF5A 1QJ7B 5F8XA 1K21H 1TNGA 2ZU3A 4BOHA 1CHOG 2ZDKA 1SGFA 2QCYA 2F83A 4FUFA 4OS2A 3FO8D 1J15A 2KAIA 4NWLA 2FOHA 4AFSA 2ANKH 1N8OC 3LONA 3B23B 5EOKA 1KLTA 2L6OA 2QC2A 2WPLS 3OSYA 1S82A 5CHBA 4Y0ZE 2IJD1 1YYY1 4H6TA 1H8ED 5DK1A 4AG2A 3P17H 1DLEA 3SGBE 3U28C 1LTOA 1O5AB 1VGCC 1FQ3A 2C8WB 4NA9H 5EG4A 2CF9H 2SGEE 1RRKA 4FUCA 3HKIB 5JBCS 3VPKA 4JZ1A 1HIAB 2GTBA 1D3TB 4OS4A 5HYOA 2QA9E 1E37B 3MNXA 2YNBA 1QB1A 2P8OC 1UCYK 3MU5A 3P95A 4K60A 2WV4A 3HKJB 2PUXB 3ZVBA 1GBAA 4OS1A 2A7JA 2AHME 1RFNA 2HVXA 1C9TA 1QRXA 1GHYH 3KYFA 4MLFB 2J98B 1CT4E 1A5HA 2BXTH 3SW2B 2TRMA 2BDAA 3KIDU 3DA9B 4X6OA 4CR9A 1BMMH 1AY6H 1BQYA 1Z8RA 2BD3A 4AGJA 1GHWH 1GBDA 4XD7D 1O5CB 2D26C 3LGIA 3ZVCA 1MTNC 1SQOA 4MNWA 2VH0A 2P59A 4KTCA 4ISHH 3MU0A 1O2SA 2BOKA 1N8OB 3SI3H 1FN8A 8GCHG 2A45B 3CS0A 5GNDA 1OS8A 3RLWH 5FX5A 1QA0A 1SFIA 1D3DB 2K0QA 1NS3A 2ZHDA 1ORFA 5B6OA 1T32A 2FOMB 5FBIA 3V13A 3RXLA 1NC6A 1O2VA 5ABWA 5L2ZH 1SC8U 2HRVA 1EASA 1K1PA 2VIOA 5TCCA 3F3BA 1VGCB 2AEIH 2OBQA 4MG3A 1Z6JH 4YOGA 3P8NA 1LMWB 2BZAA 2Y6TA 1K1MA 3Q3KA 3ATKA 3STIA 2BY6X 3A7XA 2FZZA 4FU8A 2FIRH 1EAWA 1BMAA 2ASUB 1P12E 4WH8A 1TRYA 1V2JT 3BTME 2P8OB 1ZTKA 3P8OA 1INCA 4FUEA 1KDQA 3MU1A 4CRFA 1DFPA 3SORA 3MI4A 2DE8A 3OX7U 3PWBA 3S9BA 1SB1H 4TPYA 5GIBA 1TPAE 2VWNA 3M3SA 4B6FA 2ZCLP 4DVAU 1O2JA 2YMSD 3OEHD 1EZQA 1OWHA 4YM9A 4GCHF 1H1BA 2AH4X 3SNBA 3H7TA 4AYVB 4YOIA 1T4UH 5CMXH 4Y71A 1HLTH 2V3HH 1ANCA 2FLBH 1MTNB 2W26A 5JPMH 1VR1H 4D7FA 1A7SA 3QN7A 3KQ5A 5F8ZA 1FX0B 3ATMA 1NO9H
chains in the Genus database with same CATH topology
8ESTE 1TPSA 4NZLA 4O3UA 4JZEH 3FVFB 1C1SA 2P16A 1F5RA 2VVCA 3ODFA 5C20A 5DP4A 1A5IA 1KSNA 4CRCA 1IQNA 1H8IH 3RXTA 1C2HA 3PM3A 1LKBA 3T5FH 3FFGA 2ZNKH 4JCNA 1O2MA 2GX4A 2OBOA 2FWWA 3UUZA 3WY8A 3LGUA 4VGCC 3QK1A 4YTAA 1C5UA 3BTWE 2V6NA 1YBWA 3A85A 4YESB 4CBNA 4ZMAH 2YOLA 4BTUB 1V2WT 1RS0A 2KAIB 3VXEH 1DY9A 1EJMA 4R8TB 3OYPA 1E35B 1EZSC 1QQ4A 3AVZA 1QNJA 1JRTA 1QHRB 1O30A 3UNRA 1C2GA 3V7TA 3SGQE 3F9HA 1O5BB 4XFQA 1H9HE 3VB3A 1A3EH 2XBWA 2GKVE 2ZGHA 2SNVA 5EQQA 3HGPA 4DOQA 4CRAA 1NFWA 4PROA 4BTTB 3SU6A 2QXGA 1LCYA 1XX9A 1CO7E 3TK6A 5LPEA 3SU1A 3ODDA 2F9BH 4D7GA 1YGCH 1VCQA 4CHAC 3LIWA 3A88A 2FOFA 1T8LA 2UWPA 1AWHB 1FDPA 2J95A 1DUAA 1IQEA 3U8TH 1TX8A 4FUJA 3UWJH 1J9CH 2G81E 2RA0A 1FI8A 2C3SA 4ZHAA 1TMTH 2SGFE 5C5NA 2W7UA 4F49A 1FY4A 1YP9A 4A1TA 2BDBA 1IQIA 4VGCB 1P2QA 3E0PB 2BVRH 1ABJH 5CE1A 1TRNA 1V2ST 3TPIZ 3A81A 4O97A 4DIHH 1W12U 4I8LA 4ABBA 5E2OA 1B7XB 5DPAA 2G5NA 5H4IB 2BVSH 1UTQA 1O3MA 1UK2A 2BD8A 1EX3A 1ESAA 4NCYA 2ZGJA 2ODPA 2A32A 1GJ6A 1EB1H 1C5SA 1O5EH 2VWLA 1QQUA 3PMBB 2PKAA 1CHGA 3SNAA 1WTHD 4KGAA 1O3OA 1ZR0A 1RTFB 5FHTA 5EQRA 1C2DA 3GCTG 2PSYA 3VB5A 1EP6A 1S83A 2C8YB 2XBYA 1DY8A 1V2TT 1SOZA 5GPIB 4CHAB 2D1JA 1KDQB 1TRMA 1DOJA 1YKTA 4AORA 1FV9A 1D6WA 1HJAB 1S81A 3S7KB 2ZGBH 1XVMA 3D23A 4MNXA 2Z3EA 3RU4E 2FOGA 3F6UH 5C1XA 3LGVA 1GBKA 4DCDA 1CBWC 1EAIA 1CGIE 1K22H 1O35A 3L33A 5A2MH 4AYYB 5FPYA 3EA7A 1BRAA 2GCHG 3RUOA 4WVPE 1MAYA 2A31A 2FMJA 8KME2 3KQCA 1BTWA 4NA7A 2VVVA 1TABE 1O3FA 3VB7A 4DGJA 3HATH 1VCPA 3MNSA 4RKJB 1A61H 1W13U 2GV7A 4ZHLU 1WUNH 3RXJA 3IWMA 1NRPH 1RTLA 1ZYOA 2B0FA 4ZKSU 4AB9A 1QJ6B 1FZZA 1V2NT 3FP6E 5K0HA 3MH7A 1GI0A 1ANBA 4SGAE 1CGJE 5L6NH 1SFQB 1Y3WA 2VIQA 3H5CB 5T3HA 3M36A 2QXJA 2XYAA 4I7YH 3DFLA 1SVPA 1O34A 1V2VT 1TB6H 1AUJA 2C4FH 1D9IA 5F6MA 1KYNA 1ZSKA 3DT0H 1UTKA 5C1YA 4X6PA 1O2GH 2VIPA 1B0FA 9LPRA 1GHAF 4Z0KA 1JWTA 2FS9A 1Z1JA 1HCGA 1J8AA 1CBWB 4NIYA 4AFZA 1XUHA 3Q3YA 4Y11E 4AZ2B 2AIQA 4OS7A 1MTUA 1AI8H 1F2SE 1HFDA 1ELEE 1O3HA 1ZPCA 4WF8A 3LH3A 2BZ6H 1H9LB 4Q7ZA 1AB9C 5G4BA 4K1EA 2QAAA 2FPZA 5BPEA 1A0JA 4K1SA 1PQAA 3TH3H 2JH0D 1DSTA 4QT8C 4INKA 3NK8A 2PFEA 1MU6B 1DWDH 1THPB 4TYDA 3S9CA 4ASHA 1NESE 4ZAEA 2WPIS 1MBQA 1EB2A 2V35A 4I8KA 4K3JA 1L1JA 2JKHA 1K28D 1BT7A 4FXGH 2J94A 1RTKA 1BOQA 1LHFH 2R9PA 1V6DA 3V0XA 2G55A 1IQHA 2ZU5A 1ZZZA 2FTLE 1SGNE 1M9UA 1GMDG 3OY6U 1C2EA 1QRWA 3D62A 4ZKRU 1LVBA 1SR5C 2Q6DA 3SU5A 3ENSB 3BIUH 5DGJA 3H7OA 2ZA5A 3LC5A 4X6MA 1EATA 2PKAB 3PROA 2ZHEH 1TOCB 3RC6A 3GY3A 3LDXH 4TWWA 2AMDA 3SUEA 2ZFTA 2Z94A 3BTGE 1P8VC 2TBSA 4A7IB 1C5VA 1ZPBA 1A5GH 4FUDA 4WMDA 1FY3A 3B9FH 3VB6A 2PTNA 1AB9B 3M7UA 3LGTA 2ZQ1A 1PPGE 4MPWA 1C5PA 1ESTA 3BEUA 2G4UA 2R3YA 4X1RU 4X2VA 1TNHA 4BAKB 4FU7A 4OGXA 1YCPM 2A1DB 4NSVA 4Y76A 1IOEA 4DY7B 2SFAA 3L3TA 4Y8YA 8LPRA 2BXUH 2F9NA 2CV3A 1CSOE 2BVXH 3M35A 4TY6A 1GCTB 4AFQA 4NA8A 2B9LA 2ZDMA 1Y59T 4CREA 1XVOA 1NRSH 3EA9A 3PLKA 5EW1H 1TFXA 3E90B 5DKMA 2XC0A 5IYTA 5I46H 3TH4H 4BAHB 5DO4H 1SL3A 3T29A 3RXQA 2J9NA 1THRH 2TGTA 1L0ZA 4NIWA 4JZFH 5FPSA 3DFJA 1VCWA 4D76A 1V2MT 5GCHF 4X8VH 3UR6A 2A5AA 1TX7A 1N1LA 2B7DH 2JH5D 4RSPA 1LVOA 2FEQH 1NZQH 1IQJA 3UY9A 2Z9IA 2J4IA 5J4QA 1DXWA 2EC9H 3PB1E 1SLUB 1TONA 1GBLA 2PTCE 1C1TA 4HZHA 2EI6A 3M3TA 1TNKA 2TIOA 3MO3A 2PLXA 2PW8H 1O2UA 1C1UH 2FOEA 2Y7XA 1BB0B 3PV4A 4Y10E 1S84A 5JB8S 1ARBA 2BYAX 4KELA 3RMLH 5JB9S 1O36A 1GVZA 1Y3XA 2IOTA 1HPGA 2F9OA 4CH2B 1K1OA 2P3TB 1GJAB 1FXYA 2XTTB 2XWBI 2FXRA 4MPUA 3EGKH 3B8JA 1O3KA 7GCHG 1C2JA 4I8GA 3RXEA 2Y5HA 3MMGA 2O9QA 1SQTA 1ACBE 2G52A 3E91A 3OY5U 1A0HB 1GBCA 2A2QH 1LVMA 2QY0B 1QY6A 2VINA 2G5VA 1ESBA 1KXBA 4ZUHA 3ZZDA 5DG6A 4FUHA 1VZQH 1BTHH 1ZPZA 3O8BA 3CS7A 1AIXH 1KTSB 1YPKH 1C2IA 4E7NA 4X1NU 2GZ7A 2WYGA 5C2ZA 3SHCH 1RD3B 3E6PH 4LZ1H 4B74A 4NFFA 3TGKE 1C1QA 2OQUA 4IN1A 4TWYA 4AN7A 3BTFE 5EXMA 4IC6A 4UFGH 2OD3B 1C5OH 3ATWA 1WV7H 4AOQA 1FMGA 1XMNB 3TJUA 4DJZB 2QV1A 2BY5X 2XW9A 1NRNH 1HYLA 2F9UA 3TGIE 1LHCH 1KXEA 2TPIZ 1BA8B 4A6LA 3SUFA 1O3BA 3HK3B 1JRSA 2ZECA 1HAZB 2LNCA 2ZHFH 2BY7X 2OC7A 2VB0A 1O31A 5EPYA 4YT7H 1TMBH 3UPEA 3P92A 4XDEA 5EPNA 1GWAA 2H5CA 4ISOA 5FCRA 2BD7A 2G4TA 1Z8IB 1FY1A 3MNBA 4WMFA 3PMJA 2AS9A 4IMZA 2A4RA 1GBJA 3LOXA 2BM2A 3P8GA 4BAQB 5DP9A 3GY2A 1S6FA 1SGCA 1T31A 2PHBA 3M5MA 4NIVA 1BBRE 1GDNA 1O2OA 2CF8H 3EE0B 2QYIA 1IAUA 1DS2E 2ZTZA 3PTNA 4AG1A 1HJ8A 4IBLH 3RM2H 1L4DA 2SGPE 2C93B 1LPKB 2GZ8A 4UFDH 1CT2E 4RN6A 4UD9H 1O2RA 4NG9H 1GJ9B 1ZGVA 1O5DH 1AKSA 3UNQA 2Z3DA 4MPXA 3LPRA 1P01A 4JYVH 2H1UA 1X7AC 3ZYEA 2BLVA 6LPRA 3SQEE 4XSKU 2WYJA 2Y7ZA 3LT3A 3ZZAA 2CJIA 3ESTA 4D9RA 1P02A 1UVSH 1EJNA 1DWEH 5ESBA 3ZZ3A 3MWIU 3BG8A 5JBTA 4XOJA 1DICA 1DPOA 1GPZA 2HOBA 1FY5A 2O8WA 3KN2A 3TH2H 4GVUA 1YLDA 1JMOH 4YLUA 2BLQA 3FZZA 1DITH 1EP5A 3GCOA 3SN8A 1UHBA 1PFXC 1FONA 4GUXA 3S69A 2FYRA 2XNIA 1NU9A 5EODA 1TALA 2BD5A 3RXDA 4MVNA 3RXIA 2ANWA 1JIRA 4HI3A 3K6ZA 1TYNA 5C1UA 1P2NA 1GI8B 1BMNH 1CT0E 1SGIB 3NZIA 1GI1A 1UVPA 2I6QA 1O3CA 1FIZA 1HAVA 1GI7B 1U6QA 1J16A 1ZGIA 4LOYH 4MNVA 5A0BA 3M5NA 3ZVDA 1WQVH 3ATIA 1AE5A 3A86A 1V2PT 2Z9KA 3SU2A 1VITG 1FUJA 3TU7H 1CE5A 1OWDA 1ZRKA 1SHYA 2ODQA 1C5MD 3BSQA 4AFUA 6GCHF 3RLYH 4ABGA 3S7HB 3A8CA 4GHQA 1ELVA 3E8LA 2BQ7B 1O32A 2BDHA 1AE8H 2LPRA 1O3GA 2NU0E 2R2WU 3O8DA 1G3CA 3SJIA 2P3FH 1J17T 1ZLRA 1O3DA 3ZV8A 3T62A 1OWJA 4E7RG 3QLPH 3SNCA 2UWLA 5BRRE 2FI3E 1GGDC 1UMAH 1V2UT 5K7RA 5A0CA 1YPEH 2G51A 4HFPB 2EI7A 3LC3A 3STJA 5L2YH 5PTPA 1SGDE 1F0SA 1C5NH 2D8WA 2BQ6B 1SI5H 2VH6A 1GHBG 3KQDA 4X6NA 4X1PU 5HXFA 2CN0H 2CMYA 3SOSA 1DSUA 1AZ8A 1V2LT 4SGBE 5F03A 1MD8A 3A89A 3RXBA 1FPHH 1Y3UA 5E0GA 4DIIH 2ZF0H 3LH1A 4ISNA 2CXVA 1P05A 1QR3E 2PUQH 3UWIA 2A4OA 5HGGA 3Q3XA 5C3NA 1O2NA 2ZFRH 1GMCF 1P11E 3KQEA 1MAXA 3RMMH 1B5GH 1RIWC 1OKXA 3M7TA 1LDTT 1PPCE 2OC1A 2TGDA 4J2YB 2M5TA 3RXRA 2ZDAH 7LPRA 3GICB 2AMPA 1AFQC 4OGYA 3SV7A 2PGQB 1SG8B 3D65E 2F9PA 1Z6EA 1P2OA 2SGQE 1L1NA 1GHVH 4I8HA 2FM2A 1GMHG 4JZDH 2VGCC 3FP8E 2QXIA 3RC5A 4AGKA 4THNH 1GI9B 1AKSB 1OPHB 2CGAA 3HGNA 4WWYA 1UVOA 1P06A 1DVAH 4B71A 1GGDB 1G3EA 3GY8A 2WPKS 2C8XB 1AFEH 1GI6A 1BRCE 1TGTA 5EQSA 1MMJN 4YLQH 5FCKA 1GI2A 1P04A 1RJXB 2OINA 1Y5UT 4ZROA 2RDLA 1P2KA 2W3KA 3P8FA 1BTPA 1O2KA 5LGOA 3AAVA 1YPGH 3JZ1B 4AX9H 1C1OA 1PQ8A 4U2WA 1DANH 1GVLA 2R3UA 1MKXK 3ITIA 1NU7B 2ZI2H 1MTVA 1PQ5A 3FP7E 1Z7KA 3MTYA 1UHBB 1WCZA 4FUBA 4ISIH 1RIWB 2ZKSA 2BLOA 2PSXA 2QGRA 1KXAA 4K2YA 5GWZA 3SV9A 1D6RA 2Q6GA 1AFQB 3EYDA 2XCFA 3RXMA 1IQKA 1ELCA 2FI4E 2VNTA 1TBQH 1DUEA 1ZOMA 4YO9A 5HMAA 2VGCB 4ABHA 1AGJA 1MTWA 1NTPA 4MTBA 5LH8A 2ZU2A 4B2BA 2RG3A 3U1JB 1HAVB 1CHOF 1QJ1B 4B73A 1V2QT 2HLCA 1AMHA 1L2EA 1OP0A 9ESTA 2R2MB 4H6SB 5HM9A 1MU8B 3S0NA 2GGVB 2RCEA 3RMOH 1N6YA 1BMLA 3DD2H 1KXCA 1KY9A 3PMAB 5EGMA 4JZIA 4KTUA 4LZ4B 2Q1JA 1C2LA 5ETXA 4A92A 3TK9A 1HXFH 2Z7FE 2ODYB 3A7YA 1ETSH 2GZ9A 2ULLA 2DUCA 2XCNA 2H9EH 4JMYA 1W11U 1LO6A 3QX5H 1HAGE 1ELTA 1Q2WA 1GJBB 3NWUA 1O0DH 3O8CA 1D3QB 1ID5H 3EA8A 1E38B 1QURH 4D9QA 1P10A 2OCVB 3LJOA 4WH6A 3ZZ9A 1A0LA 1YPHC 4ZXYH 3GOVB 1T4VH 1O2XA 2YNAA 1AU8A 1MTSA 1WSSH 5A8YA 1KLIH 3Q77A 5JBBS 1UCYH 4BAOB 1TGNA 1SPJA 5FXLA 2H2ZA 2UUKB 2A0QB 1CA8B 1A4WH 5DP5A 1C5LH 2QN5T 1LPZB 2BDCA 2BB4A 3GY7A 5E8EH 1ZRBA 1W3CA 8GCHF 2G00A 1QBVH 1NRRH 4BTIB 1GJ5H 1IHTH 2BD2A 1WOFA 1HUTH 1IQMA 1TPOA 3FANA 2QIQA 3KQBA 1OWEA 3KGPA 1E34B 1BRUP 1LHEH 1ZMNA 3UNSA 1BHXB 2BY8X 4NFEA 3ZZBA 4ABFA 1WQSA 1C1WH 3SU0A 1FY8E 1C1VH 1S6HA 5AHGH 1OWKA 1PJPA 1GJCB 5A8ZA 3GYLB 1HAYB 1GJDB 4LXBH 2NU1E 2J38A 3U8OH 5AFYH 3UFAA 3W94A 2HGTH 1CA0C 1Z8JB 3BTTE 1SGTA 3A8BA 1CU1A 1SHHB 2FO9A 1YPLH 2FX4A 1A2CH 4YOJA 1HAPH 3BTKE 2IJOB 2P94A 3K2UA 2Y82A 2AMQA 1G37A 4O03A 4A5TS 2STAE 2XBVA 3VXFH 4GCHG 2QXHA 5GXPA 3KL6A 2ZFPH 2AGGX 4K8YA 4Q7XA 1O3EA 4CR5A 1VITH 2F9VA 2AGIX 3UQVA 2UUJB 4INHA 1RGQA 1JBUH 2FP7B 2OTVA 3MH5A 1YPJH 1C2MA 3I29A 1C1RA 1EOJA 3UQOA 3HK6B 2K1QA 4XE4A 1LPGB 3QWCH 1O3LA 1T7CA 1QCPA 2ZU4A 3U9AH 2Q6FA 1G36A 3W95A 1O2YA 1P09A 4GHTA 3LU9B 3SZNA 2FLRH 3ZVEA