4IS5A

Crystal structure of the ligand-free inactive matriptase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
241
structure length
241
Chain Sequence
b'VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDAGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppressor of tumorigenicity 14 protein
publication title Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 58
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4is5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4is5A01
3I77A 3S7KB 3M5MA 4ZROA 3SBKA 1S0QA 1LMWB 1QL8A 3PYHA 1GBDA 4D8NA 1ZPBA 3BEIB 3SU3A 1D4PB 3BSQA 1L2EA 1PQ5A 3KIDU 1QFKH 3KF2A 1AUJA 1V2KT 2EC9H 3SGBE 2C8WB 4LOYH 4A5TS 5AFZH 2Q6FA 1C1RA 1O3BA 1WSSH 2FLRH 3SGQE 2NU2E 3P70B 1O2NA 1O3OA 2RA3A 3GY5A 1DUEA 3GOVB 2FOGA 4BAOB 2XXLA 2ZFSA 4XSKU 2BMGB 3TK9A 1YLDA 1TNIA 2C3SA 3KCGH 3M5OA 3QLPH 2JH0D 4Y7BA 2WINI 4Q7XA 3RM0H 4I8HA 1O38A 3KEEA 2ZGJA 4JZEH 1VCPA 1TA2A 3T29A 1EB2A 3GY6A 1SGRE 4UFFH 1XM1A 1NRNH 1O5GH 7ESTE 4FVDA 1YPKH 4DG4A 1GBCA 4AN7A 1GHAG 1TALA 3TNTA 1QURH 2H9HA 4Y6DA 2BYAX 4E06H 1GHBG 3WY8A 1GGDC 4BANB 2O8WA 2BQ6B 3RXTA 5SGAE 1SSXA 2G4TA 2VIWA 3LDXH 1P2MA 2BLWA 2O8TA 1UTNA 4O3UA 3TPIZ 3SUGA 1GVZA 1QQUA 2B8OH 3FZDA 3FAOA 1HAOH 1C2JA 2OINA 3VB7A 4CHAC 2EA3A 1GJCB 1NRQH 1NRRH 1SGYE 3LKWA 3GISB 3TNSA 1P02A 1AVXA 2H5CA 8ESTE 2BDBA 3V3MA 5EXMA 3V7TA 4DIIH 3MO9A 5JBTA 2A31A 1ELVA 1Z6JH 1BMLA 2P3FH 2STAE 1ZYOA 1JRSA 3S0NA 3D65E 4JCNA 3FZZA 2FOCA 2V3HH 1DPOA 3LC3A 3H7TA 4CR9A 1KIGH 1F7ZA 5IDKA 1V2WT 1LPGB 3QO6A 4HZHA 3EA8A 4IN1A 2BDCA 1GMCF 5FPSA 2QC2A 2P8OB 1CE5A 3ATIA 5FBIA 1LQDB 2Y5GA 4FU8A 1C5RA 1SGQE 3E91A 2H9EH 1EZXC 5EGMA 2PGQB 5DP9A 3NK8A 3CS7A 2HNTE 1SLVB 1UTOA 2PW8H 4FUEA 1SGFA 4J2YB 4MNVA 4X6PA 3FP6E 3E0PB 1YP9A 5F8ZA 5A8YA 5CMXH 2WPMS 1LCYA 3RC5A 3BG4C 3LGYA 3O8DA 2QN5T 3TK6A 1NRPH 1E35B 2XWAA 3E0NB 2A32A 4MPWA 1E0FD 2W26A 2ALVA 2OCVB 2BTCE 2ZPRA 2VH0A 5T6FA 4DW2U 3D49H 2SFAA 1UCYE 1IQHA 3QUMP 4ZKOU 4CRFA 3ZV8A 4NCYA 2FO9A 3RMMH 4ZKSU 3A81A 3GDSA 1A61H 1ZJDA 2ZA5A 1G3DA 1FN8A 1AKSB 2BDGA 2J38A 1C4Y2 1DFPA 2B0FA 2ZFRH 1UK2A 3HK6B 3ZZAA 3BF6H 1JRTA 2CF9H 1ABIH 1CQQA 1AY6H 4K8BA 1ANBA 1K1LA 5EU8A 4TWYA 1AE5A 1ZMNA 1SQAA 5HMAA 5DPAA 3S7HB 3VFEA 2A4RA 2G81E 4AYYB 2ZFQH 1YPGH 4ESTE 2F9PA 3OX7U 3NCLA 1ZSJA 4U30A 2UUYA 3RXQA 5EQQA 3LT3A 1O3LA 3K6YA 3JZ2B 3DFLA 4Y11E 1ABJH 1NRSH 1W7XH 4K8YA 1GPZA 1RTKA 1RS0A 2O8MA 1SLUB 5HGGA 2VIOA 3FFGA 1O5CB 3K6ZA 4X8SH 3PMHB 4KGAA 1P9UA 1KYNA 2GZ8A 1O37A 1DDJA 1O5EH 1C2HA 4D76A 2GZ9A 3N7OA 2H9TH 3BTME 3M35A 1V3XA 4GCHG 1G2LA 3BG8A 5GWZA 3A8DA 3GCHC 1YPJH 2AGEX 1EAUA 6LPRA 2EI6A 1MKXK 4IBLH 1G9IE 1DM4B 1UCYH 1E34B 4XFQA 1OPHB 4DOQA 1HYLA 2VB0A 3VB5A 1O2OA 5JPMH 1WU1A 5F8XA 1G3CA 4AB9A 4XBBA 3LC5A 2NU0E 2BQ7B 3A82A 3ZVCA 1NFWA 1C5OH 1QRXA 4A92A 2Z9GA 2F3CE 4MNYA 2UUJB 2AGGX 2AS9A 4ZHAA 4ASHA 3G01A 1ORFA 1W10U 2VNTA 1V2JT 1OS8A 1AZ8A 1SFIA 4Y10E 4X2VA 1CBWB 1EX3A 2PUXB 4X8TH 4AFZA 1ZTLA 1SFQB 1HJ9A 1CHOF 1MKWH 3QK1A 1YYY1 2VVVA 1K1PA 2G5VA 3C27B 3DA9B 1HIAA 1MUEB 3A7VA 2AIPA 1UVOA 1VITH 1BJVA 1BOQA 1TGSZ 2QA9E 2NU4E 2C8YB 2FS9A 2ZTZA 4NFFA 4YO9A 5AF9H 1TPAE 4JYVH 4ZH8A 1F0SA 1KSNA 1Y3XA 1LHEH 2VINA 2FLBH 1F5LA 1AB9B 3IWMA 2XYAA 2RCEA 3LIWA 2ZGBH 4ABGA 4NA7A 2XCNA 4YM9A 2G51A 1GBTA 1GMHF 2OQ5A 3SI3H 3T2NA 3ZV9A 3F68H 1FZZA 1ZLRA 4FUCA 3NZIA 4H42U 2OBQA 2BDHA 3ZZ5A 1ZSLA 1AVWA 3VXFH 2AFQB 3RMLH 2GZ7A 4ZKNU 3T26A 1DXWA 2ZC9H 1O0DH 1TGCA 4FUBA 1N6XA 1B0FA 2IPHA 4D7GA 1S83A 1MTVA 4LZ1H 1P9SA 1TOMH 3PM3A 4QT8C 3PO1B 1EP6A 1GMDG 5TJXA 4HTCH 2ZP0H 3LPRA 4RKJB 4BTUB 2BXUH 3UNSA 1AGJA 1H4WA 1SGFG 4Y8ZA 2F9BH 3NKKA 1VGCB 3L3TA 4K2YA 2ZTYA 1JXPA 4CRAA 1EAWA 3ATWA 3M3TA 3NPSA 1BTUA 5J4QA 5DP3A 4JYUH 1ELCA 2FX6A 4J1YA 5B6OA 1DLKB 1DICA 2XBWA 5A8XA 1V2VT 1T8OA 2BLVA 3FANA 3SJOA 1MTNC 2CGAA 1XUKA 2UUKB 2PKSC 1W12U 1MTUA 5ESTE 2CF8H 1V2OT 3CS0A 3RU4T 2ZEBA 4VGCC 5L2YH 2PR3A 3A7TA 3NUMA 3M5NA 4IMQA 3UOUA 3SUDA 3ZVGA 1Z6EA 2GDDA 2GCTC 1EZUC 2AMQA 5C1UA 1F5KU 1HBTH 2A2XH 2Y5HA 3QDZB 2Z3CA 1O2JA 2BOHB 4TY7A 2A0QB 1E36B 1SQOA 5FX6A 3M61U 4Y0YE 5C20A 2KAIB 2Q6GA 2R9PA 4WY3A 1GBMA 3BEFB 1MCTA 3OU0A 5EXLA 4WVPE 2O9QA 4GVUA 3RXLA 4CREA 1TMBH 4GHQA 1MKXH 1ZHMA 2GMTC 4XBCA 5DJ7A 4LXBH 1C9TA 1LVMA 2ZCKP 3GY2A 1MD7A 5JBCS 1EXFA 3GCOA 1MBQA 2FTLE 1K1MA 2EI7A 3ZZ9A 1K9OE 5AVDA 1ZR0A 2TPIZ 1HAYB 1UVTH 3ZZDA 4GPGA 1O35A 4PROA 2HPPH 2QV1A 4BAKB 2FOAA 1BRBE 1TYNA 1FLEE 2FOEA 3ZZ3A 1NS3A 1V2LT 4ABFA 3F6UH 1V2UT 1K28D 4GLYA 5DP5A 7GCHF 3RMOH 1AIXH 1PPEE 3Q3KA 3LJOA 1QJ7B 2VH6A 1CT2E 3SGAE 5A0AE 4AB8A 3RXOA 2XCFA 3PTNA 2ZGHA 2CHAB 3UR9A 1P06A 1C1SA 1G32B 2JH6D 3ZVFA 2XBYA 2SNVA 3BTHE 4FUDA 1YM0A 5L6NH 5FHTA 3VXEH 2HALA 1UMAH 3P92A 1V2QT 4BTIB 2R3YA 3BTDE 5EPNA 1BT7A 2ILNA 1CSOE 1UVPA 3RXDA 3O8RA 1AD8H 1BTWA 2BD2A 2D1JA 2G8TA 4DGJA 1L1NA 1CA0B 1HXEH 3RXUA 1BRUP 5K7RA 1GI5A 1TWXB 5A0BA 3A8AA 3SORA 1AO5A 1T32A 1TGTA 1GJ9B 2BD5A 2H5DA 2HNTF 1QGFA 4JK6A 2SGEE 1KXBA 2ZFFH 4FU9A 3SNEA 2FM2A 1JOUB 2C93B 2A7HA 3SJ8A 1GJBB 2FOFA 3GY7A 2BZAA 4UD9H 2FP7B 4B76A 3PV4A 1VCQA 2OC8A 4HGCA 2WPJS 3TH3H 3MU4A 5E2OA 3M3SA 2VIVA 1SOZA 5CHAB 1LKBA 1K22H 3SW2B 4ZKRU 1BQYA 2A4OA 2PLXA 1C1OA 1EASA 1T7CA 1UTJA 1CHOG 2HPQH 3SU5A 4BOHA 1UJ1A 4ISIH 1ETSH 2BHGA 2PSYA 3E8LA 3SZNA 1OWHA 2VIQA 1HAGE 3D23A 3RDZA 4UDWH 2ZIQH 3MMGA 5EW2H 4TPYA 3BTTE 5GCHG 1HJAB 4K3JA 1OYTH 1DVAH 4YOIA 3BV9B 1BCUH 1P3EA 3OYPA 3ZZ7A 1LHDH 4YLQH 3BN9A 1QB6A 1MZDA 3M5LA 1ID5H 1GG6B 1KTTB 4TPIZ 3MHWU 2AGIX 4TY6A 4AG2A 1TLDA 1C5XB 1HDTH 2TRMA 2V35A 2GP9B 1VITF 1MTWA 2AEIH 5LH8A 1UK4A 1GI6A 2V3OH 4KTUA 3A85A 4Y0ZE 1EJNA 1IQLA 3RXJA 5FAHA 1PPFE 2VVUA 1UHBB 4NIVA 3SJKA 1P2QA 3SN8A 5F8TA 3VGCB 1UTKA 2JETB 1L0ZA 1YPMH 1J8AA 2QY0B 1ESBA 1LVOA 3VEQB 3BTWE 2BVSH 1GCDA 1CO7E 1AKSA 3PROA 4ABBA 1ZGVA 4OGXA 1BJUA 1MQ5A 1RIWC 4FU7A 1M9UA 3LH1A 3IG6B 1D6WA 2WPLS 5LPRA 4AG1A 1S85A 4Y8YA 1S6FA 1EATA 3AASA 4UFDH 1GWAA 3MH4A 4K69A 3CENA 3FVFB 3DT0H 4FUIA 1SC8U 1A4WH 1ZHRA 1O2PA 3ZYEA 1DWDH 1T4VH 1YF4A 3PTBA 2ANMH 2ZCLP 1H8DH 1KXEA 4AFUA 1AHTH 2FXRA 4INKA 2HWLB 1RXPA 3SU0A 3DHKH 3ZZ8A 1B0EA 1Q31A 1QL9A 1AFEH 1PQ7A 2I6QA 5HXFA 1O3PB 2Z3EA 3Q3YA 5K0HA 2M5TA 2Z9LA 2RG3A 2ZDMA 2V6NA 2Z7FE 1O30A 1O5AB 3KL6A 3U98H 2ZU3A 1J16A 3ATKA 3GCNA 4DY7B 2DUCA 1VR1H 3M37A 1TMUH 1GVLA 4FUHA 3UREA 3A7XA 3SV8A 1IAUA 3ZYDA 1GCTB 2A5IA 4Q7YA 1QB1A 3LGTA 1S84A 1QBOA 4DVAU 4MNXA 4HFPB 1O3NA 1S6HA 5L2ZH 1OWJA 3RXHA 1LHCH 2RDLA 2ZDNA 3GY3A 2ANWA 2VWOA 3F9EA 1SG8B 3MU1A 3U9AH 1F92A 4I31A 1DOJA 3ZVEA 1P2OA 5GIBA 1DSTA 3MNCA 1C2GA 2A7JA 1EOJA 2FOHA 1C2EA 1CGJE 3VB6A 1O2MA 1S5SA 3MNSA 2Y7ZA 1NESE 3A7ZA 4F4OC 3TVJB 1O2RA 1TABE 3SUEA 3UNRA 4WH8A 4B71A 4TYDA 3A89A 1QR3E 3RXKA 1A1RA 4HI3A 7GCHG 1TRYA 1Y5AT 4JZDH 2WUCA 4IC5A 1P03A 4RSPA 2R0LA 4DIHH 3IITA 1MZAA 1O2LA 1TGBA 1GI8B 5J4SA 4NGAH 2PKAB 4AORA 1MBMA 3TU7H 1BMMH 3U69H 3RXPA 1LVBA 3A80A 3SNBA 5DP7A 2NWNA 4WF8A 1IQKA 3EAJA 3KQEA 1CGHA 2FMJA 2P16A 6GCHF 2IOTA 2GVFA 3SJIA 4ZHMU 3MH5A 1TRNA 3NXPA 1OWIA 4BTTB 1O2SA 1HUTH 1C5PA 1P04A 1TBZH 1FIWA 4WH6A 5ABWA 2CN0H 5FCRA 2UWLA 4A1XA 3BTEE 5E2PA 4H4FA 1Y3VA 3ATLA 1GDUA 2AMDA 3LOXA 2HNTC 1ZTJA 2TBSA 2YNBA 1A2CH 2STBE 1EUFA 2P8OC 3SQHE 1D3PB 3SHAH 3A86A 3HGPA 2WYGA 1LQEA 1O3JA 2QIQA 1O3GA 1XUIA 3U1JB 1BMNH 1RRKA 1Z8RA 4K60A 1Z7KA 3ZVDA 4ISOA 3SU4A 3TGIE 1IQGA 2R3UA 4I7YH 2WV4A 3KGPA 2VWNA 4X0WU 1TE0A 3V12A 2GKVE 1C1WH 1W14U 2SNWA 2QF0A 3KHVA 3ZZ6A 1S82A 1O5DH 2C8ZB 2UWOA 2CXVA 2F9OA 2P59A 2XBXA 1C2MA 1D9IA 2HOBA 1OWEA 2ALPA 1SGEE 4I8GA 1KDQB 1YPHE 1WQVH 3SV7A 4X2XA 1S81A 4XE4A 1DANH 2BZ6H 1BDAA 5TCCA 5E8EH 1ACBE 3F9HA 1GBKA 1ZMJA 1QIXB 1RJXB 3GY4A 1HAXB 2BXTH 3F9GA 1W2KH 5TCAA 1H9LB 3SU2A 1C5QA 1O34A 1KLJH 1GJ4H 2Z6BD 3PLKA 4NSYA 1VITG 4ABEA 2ZHQH 2C8XB 4DURA 2VGCB 2IN2A 1HCGA 2KAIA 1EAIA 1BTPA 1W3CA 2ZCHP 4NIXA 3MU8A 4SGAE 3TLOA 2ZDVH 1S0RA 2H1UA 3E16B 1GI3A 1AWHB 2FWWA 3GCTF 1O2WA 5GDSH 1PJPA 1QRWA 2OP9A 2D8WA 1P09A 2Z9IA 1JBUH 1W13U 2ZDAH 1QY6A 1TGNA 3ODFA 2F91A 5C5NA 2BVXH 1BA8B 3ELAH 3S69A 3QWCH 2Y6TA 1O3HA 2ZU1A 5L30H 1FJSA 4O97A 3PMBB 1MU6B 1C5TA 3S9CA 4THNH 4FUJA 2VIDA 2SGPE 5HM2A 2Q6DA 2F83A 4IC6A 1O2HA 1DE7H 1FAXA 1U6QA 5DP4A 3TIUA 1TONA 2IJOB 4B2AA 1EPTA 3T5FH 2FESH 4X6MA 4B2CA 3SV6A 4AGJA 2FPZA 1N8OB 4JZIA 3W94A 3PWBA 4OS5A 2A7CA 1GI0A 1NO9H 1ELBA 1MAXA 1HAHH 1TX8A 1GJDB 4CBNA 1KLIH 1CVWH 2FOMB 1Z8JB 1C4V2 4OS1A 5ESBA 4BXWA 3UPEA 3RXEA 1KXDA 1CBWC 1V2RT 1XUGA 1BMAA 2P3UB 1HGTH 2ZU4A 1W8BH 1G3EA 1YCPK 5G4BA 1TQ0B 5E0GA 1O2YA 1K1OA 1VJ9U 5E0JA 1E37B 1P10A 1QBNA 1MU8B 2SGAA 1BBRK 3RXBA 1SQTA 4VGCB 3SV9A 3TK5A 2OXSA 1SMFE 4MTBA 1O32A 4A1TA 2Q1JA 5EOKA 2QXJA 1HNEE 1VZQH 1O2GH 1AB9C 1P57B 2AERH 2OBOA 5JB9S 8LPRA 3RLWH 3EGKH 3AW1A 3QN7A 1YKTA 1PQ8A 5GPIB 1G2MA 1LPZB 2OC7A 1Y3WA 4DT7B 1LO6A 3K9XB 2PWXA 1WBGB 4ABHA 3MO6A 1OWKA 3U1IB 1GMCG 4FUGA 3ENSB 2C4FH 1IQNA 1QRZA 2W3IA 4O03A 2QYIA 1DWCH 1C2KA 1D6RA 1GVKB 4YZUA 3M3VA 4UFEH 1BRAA 3MNBA 1O2KA 3KQCA 1THSH 3LGIA 3O8BA 4A7IB 1WYKA 1XKBC 1CU1A 3JZ1B 5GXPA 1Y5BT 2ZKSA 3DD2H 4Z0KA 7KMEH 2ZDLA 3FP8E 1KY9A 1Y5UT 3PO1C 4IMZA 1TIOA 3T28A 1C5ZB 3ZVAA 3RXAA 1XVOA 2PTCE 1P12E 2Y5FA 2XRCA 4Q7ZA 4BAQB 1ARCA 4GSOA 1C1NA 2UUFB 5T6DA 1IQJA 5C1YA 2ZGXH 1PQAA 3SQEE 1GHAF 2BY5X 1QJ1B 4O3TA 3QGJA 1CA8B 2VWMA 4XBDA 3BIUH 1GHWH 1YGCH 1UHBA 1UTLM 5A09A 4YLUA 1SI5H 3F9FA 3D62A 2HRVA 2QAAA 2WPHS 1IQEA 3PB1E 3BEUA 4IN2A 1WAYB 3EE0B 1BTYA 4A1VA 4CRDA 3B9FH 3RXGA 6ESTA 1Z71A 1DT2A 4BAMB 1UVUH 1FUJA 1P05A 4BNRA 3NWUA 2PGBB 5A8ZA 4Z6AH 1PFXC 3E6PH 1EJAA 3SNCA 5DKMA 3A88A 2EI8A 2DE8A 4R8TB 3U8TH 1UK3A 1BZXE 4Y79A 2PSXA 2PHBA 3ESTA 1ANEA 1EKBB 4YESB 1Y3YA 1C5UA 2H6MA 1A3EH 2GT7A 1NU9A 1QJ6B 1ELGA 3T25A 3M7TA 1O3DA 4GUXA 5EODA 3HGNA 3O8CA 1GL0E 3K2UA 3HKJB 4MNWA 2FYRA 3R0FA 4GHTA 3MH7A 3RXSA 1TB6H 4XOJA 1ANCA 1LHFH 1OX1A 1TPOA 4X1QU 5ETXA 2FS8A 3LJJA 1N6YA 2J92A 3GICB 1BTXA 3RU4E 6CHAB 1EP5A 2ZZUH 1O3CA 1GBHA 2O8LA 1EPTC 1BUIA 1GBAA 4U2WA 1WTHD 1C5SA 1FIZA 3GCTG 3P17H 3SHCH 1HAZB 2BVRH 1L4ZA 1F5RA 4TWWA 1W11U 3P8FA 1MAYA 2WPKS 4K5ZA 1XVMA 4MDSA 1TNGA 3PMAB 5LGOA 1C2FA 3URCA 5FPTA 4X1NU 2V0BA 2G00A 4AYVB 3UTUH 3GYMA 1CT0E 4WXIA 4NIWA 3SNAA 1WQSA 1XXDA 1MD8A 3EA7A 2TGAA 1SGDE 3TH4H 1O3EA 1GHXH 1T4UH 1NY22 2B7DH 2VWLA 4UFGH 3BTGE 5A0CA 3MU5A 4JYTA 4ABIA 1TFXA 5DO4H 5FCKA 2ZECA 2GV6A 2FEQH 3A8CA 4INHA 4KP0A 1O2ZA 2P94A 4RKOB 1GDQA 1NPMA 4WMFA 3OY5U 2VJ1A 2B9LA 1OKXA 4RN6A 2ZPQA 1SGIB 5JB8S 4FXGH 5DP6A 1OXGA 2ESTE 2BX3A 1DITH 4B75A 4NFEA 3PLPA 4UEHH 2PKAA 2UWPA 2FDAA 3RC6A 1JIMA 4X8VH 5BPEA 5T3HA 3UQOA 1NT1A 1CGIE 2GX4A 3SV2H 9ESTA 1GMHG 3A7WA 5I25A 3VPKA 1G3BA 2W5EA 4E7NA 2H2ZA 1C5NH 5AHGH 2EEKA 1Z1JA 5CHAC 1D3TB 5JDUB 2XWBI 1D3QB 1JWTA 1ZOMA 1MMJN 3AVZA 1H9IE 5DP8A 4F49A 4GCHF 1AFQC 3RM2H 1DY9A 2BQWB 1IQIA 1QHRB 1TNJA 2CMYA 2WV5A 3MTYA 1HLTH 1IHTH 3VB4A 1LTOA 1O31A 4O9VA 4OS7A 4ISNA 1V2MT 7LPRA 1Z8IB 1H8IH 1O2XA 1O2QA 4WXVA 1J14A 1C1VH 4A6LA 1HJAC 4JZ1A 1K21H 1NFUA 5F03A 1OOKB 3SUFA 3ZZBA 1ANDA 3OSYA 1FQ3A 3SOSA 2FX4A 2QGRA 1SB1H 4NWLA 1P3CA 1EZQA 2PUQH 4JMYA 4X6OA 5EG4A 1GGDB 1GG6C 1GI7B 1TBQH 3M36A 3AW0A 1XUFA 1GJ6A 3RXMA 2WPIS 4D7FA 3RU4D 2J94A 3LGWA 2BD7A 4I8LA 2J95A 4JZFH 1DX5M 1NZQH 1QB9A 1TBRH 2XC4A 4NIYA 3V0XA 1FPHH 4ABJA 5JYIA 2AMPA 1NROH 3P95A 3HKIB 3P6ZB 2C90B 1BIOA 4GAWA 3SJ9A 4CHAB 4CRGA 3VGCC 1HAVB 2JETC 3AAUA 3I78A 1KDQA 5EQSA 3GYLB 3RC4A 3V13A 4ZXYH 5PTPA 1GI1A 2ZU2A 3URDA 3RXRA 1TX6A 1UTQA 4X6NA 2ZG0H 1J15A 1HFDA 1ZJKA 5EPYA 1RTFB 2XW9A 4ZXXH 1TPSA 2PTNA 2TGPZ 1FY4A 1SL3A 1FY3A 1W7GH 4U32A 1YPLH 2AH4X 2YNAA 4XDEA 1NTPA 2ZF0H 1X7AC 3E1XB 1UCYK 5T6GA 4D9QA 1THRH 4BXSA 1K1IA 1P2JA 2ZHEH 3U8OH 1V2PT 3C1KA 4AFQA 1GJ8B 1PYTD 3QX5H 1HAIH 2Y7XA 1AN1E 1DWEH 2A1DB 3RXVA 3ATMA 3RUOA 1EOLA 4OS4A 1GDNA 4I8JA 4Q80A 1AWFH 1PPCE 1BB0B 2DE9A 1P2IA 2K1QA 1MTSA 1GMDF 1ARBA 3GDUA 2J34A 3BG4B 4OS2A 2ZU5A 1SVPA 3DUXH 1EB1H 4OS6A 1D3DB 1C1TA 4CH2B 4K1SA 4FVBA 4JK5A 3Q00A 4MG3A 3RLYH 1C2LA 2A4GA 2HGTH 1MKWK 2Y80A 2A4QA 2FI4E 1O39A 3VB3A 1FMGA 3MFJA 1GBEA 1AUTC 1XX9A 1ZPCA 2ZHFH 1LHGH 9LPRA 1GCTC 1TA6A 2W7UA 1RFNA 2P95A 1OP2A 1BHXB 1AU8A 1DXPA 2A2QH 2OQUA 5FPYA 2FI5E 4AX9H 2J9NA 1A0HB 2ASUB 3R3GB 1W0ZU 2SGFE 1LPKB 2GCHF 3HPTB 5JBBS 1SHHB 1HAPH 1O3KA 2TIOA 3RXCA 5FX5A 1NFYA 4B1TA 5F6MA 1HPGA 1Q3XA 8KME2 1WTGH 1FDPA 1H1BA 4B73A 1O2VA 1SOTA 2RA0A 4AGKA 1TX7A 3UUZA 3QTVH 1FXYA 2F9UA 3KN2A 1QCPA 2J2UA 2ZHWH 2ODPA 1V6DA 2ZDKA 1SHYA 4K1EA 4NG9H 2QF3A 4LZ4B 1PPGE 1N1LA 4CRCA 2XC5A 1OWDA 1BTZA 1O3MA 3UQVA 1NFXA 1SGNE 5LPEA 3GCHB 1AQ7A 3LH3A 1K1NA 3S9AA 1WOFA 3EQ0H 1XMNB 4Y71A 1HRTH 2Z94A 3TH2H 1ZTKA 4B2BA 1LKAA 1FAKH 4NWKA 4CR5A 1G30B 1MCVA 1TMTH 3SO3A 4X2WA 3ZVBA 1C5YB 1G36A 2XBVA 2W3KA 3EDXB 1TRMA 3TJOA 1O5FH 1HXFH 1BTHH 1QQ4A 1KXFA 1XXFA 2AYWA 3Q76A 1A5GH 4WWYA 1O5BB 4ZHLU 3TGJE 3UY9A 4MVNA 2ZPSA 4YT6H 2XNIA 2W7SA 3GY8A 4YOGA 3P8OA 2OLGA 1GJ7B 4CRBA 1O3FA 1C5WB 2GT8A 3MU0A 4OGYA 3M7UA 2LNCA 2ZFTA 1LDTT 3ODDA 4ZMAH 2G55A 4X1SU 2THFB 1GBBA 1NC6A 2FOBA 3A8BA 4UONA 2Z3DA 4IS5A 3AAVA 2J4IA 1Z1IA 3K65B 3P8NA 1B5GH 1GI9B 3KQDA 4KELA 1K1JA 3UWIA 1GBLA 1G37A 2BOKA 3STJA 3SNDA 2R2WU 2R0KA 3H5CB 3RXFA 4X2YA 1YPHC 2NU1E 1SR5C 4X1PU 1DLEA 5LPFA 1A5IA 1L1GA 2OUAA 2ANYA 4WJG2 1ELAA 1WCZA 3UIRA 3LONA 1A46H 2A45B 3PLBA 1HJ8A 2PV9B 1RD3B 2BD8A 2R2MB 1TPPA 1HV7A 1ZGIA 4IW4E 5HM9A 1EQ9A 2B5TB 3TJVA 3UFAA 1GI4A 3E3TA 2VVCA 2VU8E 3SI4H 3Q77A 3QZQA 4I8KA 4LK4A 4K1TA 4CH8B 1QBVH 2G52A 1MQ6A 5DK1A 2SGDE 2AIQA 1VJAU 3T62A 1GBIA 1C1MA 5HYOA 1KXAA 3FP7E 1XKAC 2LPRA 2VGCC 1THPB 4U01A 1TQ7B 1ZHPA 2JH5D 3ZZ4A 2BB4A 2Y81A 1O2UA 2D26C 2BY7X 3MYWA 2CV3A 1FY5A 2FODA 2GDEH 3MO3A 2XC0A 1A5HA 5GCHF 1O3AA 3M7QA 5FBEA 4X1RU 4NA9H 3ZZCA 2WYJA 2BY8X 2QCYA 2ZQ2A 1JMOH 2GTBA 1TAWA 3UOPA 2TGTA 5AFYH 4MPXA 1F0TA 1SGCA 1C1QA 1DUAA 4ZUHA 1C2IA 1W0YH 4KTCA 4DCDA 1C5LH 1MTNB 2ODYB 1C5VA 2BDYA 8GCHF 1YCPM 2PKSB 5DGJA 1NU7B 2F9NA 2WUBA 3U8RH 3HATH 1JIRA 1PPBH 3KQBA 1GJAB 1P01A 1XUJA 1QA7A 4E05H 3E90B 3QTOH 1N8OC 3BTQE 4ZAEA 2GCTB 1Y3UA 3B8JA 1GBJA 5H4IB 1GI2A 1P2NA 1ZPZA 1TNHA 4D9RA 1L4DA 1XUHA 1FN6A 1Y59T 1SBWA 1BITA 1VCWA 2ZI2H 4M7GA 1EAXA 4AZ2B 1C2DA 2HVXA 1E38B 5EQRA 1P2KA 1F0UA 1P8VC 2I6SA 3F1SB 4Q2KA 1Y8TA 1OSSA 3RP2A 1Q2WA 1SPJA 4ABAA 2O8UA 1L1JA 1ESAA 4I33A 4NZLA 1ZSKA 1A7SA 2GMTB 2BD4A 3OTJE 3RXIA 3STIA 2QXHA 4AFSA 2ZTXA 1FY8E 1WUNH 1V2NT 1AZZA 1C1UH 6GCHG 1FV9A 2GV7A 4ISHH 1BRCE 2OD3B 2PFEA 2ZNKH 4UE7H 2P93A 3BIVH 1KLTA 1T8NA 1VGCC 1ZRKA 2BM2A 1YBWA 2GCHG 4YOJA 4CBOA 4NSVA 1GL1A 2FTMA 4INLA 2BD3A 3TJNA 1OYQA 3MOCA 4R0IA 2A5AA 1UTPA 3B23B 1GHBF 5DG6A 1INCA 5EW1H 1A3BH 1J9CH 3BTFE 1ZRBA 1PPHE 4DJZB 1FONA 1GHZA 2ANKH 1SLWB 1DWBH 1ESTA 4Y76A 4X8UH 4FUFA 5C5OA 1QA0A 4Y8XA 1SGPE 1ETRH 2D2DA 2P3TB 1UTMA 2ZHDA 4B74A 1BBRE 1J17T 1IQMA 1P11E 2OC0A 2OC1A 1C1PA 2ODQA 4MPUA 1PPZA 3L33A 1OP0A 2FI3E 3UNQA 3CP7A 2FZZA 2NU3E 3LGUA 1GBFA 2Z9JA 1AI8H 1P0SH 4KKDA 2ULLA 2GGVB 1TNKA 4BAHB 1HIAB 1QNJA 1F0RA 3SU1A 4H6SB 3A84A 3QZRA 1AVGH 2A5KA 1UO6A 1WV7H 3LGVA 1TOCB 5JBAS 4Y7AA 1EPTB 2BD9A 3UWJH 2ZGCA 3TITA 2F9VA 1HAVA 3W95A 1EZSC 1GHVH 1FNIA 1FI8A 1K2I1 1ZZZA 1FY1A 4KTSA 4E7RG 3MWIU 1A0LA 3I29A 2HLCA 5C67A 3KNXA 3MI4A 2QXGA 3QGNB 4YT7H 1UVSH 1ELEE 2BY9X 3MNXA 1O33A 1H9HE 5FXLA 1RTLA 1IOEA 2BY6X 1CHGA 1IHSH 3P8GA 1QTFA 1SLXB 1ELTA 1FPCH 2JKHA 1NM6A 1O2IA 2ZO3H 2G4UA 1YCPH 3OY6U 2TGDA 2BLOA 2Y82A 5BRRE 1GHYH 4ISLA 1V2TT 1C5MD 2CHAC 2ZWLH 3TJUA 1TNLA 1O3IA 3ITIA 1BBRH 1BHXF 3UR6A 1DSUA 1KTSB 3SU6A 1T8MA 1GJ5H 5C1XA 2CJIA 1B7XB 4SGBE 5C3NA 1KXCA 1ETTH 3EYDA 4ABDA 1C9PA 5I46H 4NZQA 5A2MH 1RGQA 3BTKE 1CA0C 3H7OA 5IYTA 1F2SE 3DFJA 1NN6A 4NA8A 1ELFA 3A87A 4YTAA 2BDIA 3GDVA 5EXNA 1AFQB 3LU9B 1O2TA 2YOLA 1SGTA 3PMJA 5C2ZA 2BLQA 1MH0A 1V2ST 2BDAA 1HB0B 3EA9A 2VIPA 3PWCA 6CHAC 2Z9KA 1QL7A 5GJ4B 1ELDE 3HK3B 2ZQ1A 1EJMA 1T31A 2QXIA 1OP8A 1T8LA 4WMDA 1DS2E 2G5NA 1RIWB 2BX4A 2OTVA 4I32A 1DY8A 3A83A 3TGKE 4H6TA 1C4U2 5E0HA 3MH6A 4MQAA 3L6PA 2SGQE 1Z8GA 3Q3XA 4WMEA 1AE8H 4MLFB 4MPVA 1YLCA 4IGDA 1LVYA 3S9BA 2XTTB 3A7YA 1CT4E 5CE1A 2ZFPH 4AOQA 1ZMLA 2GD4B 1A0JA 3T27A 1YPEH 3RMNH 2FIRH 8GCHG 1AMHA 1IQFA 2FYQA 1YC0A 1PYTC 1O36A
chains in the Genus database with same CATH superfamily
3I77A 3S7KB 3M5MA 4ZROA 3SBKA 1S0QA 1LMWB 1QL8A 3PYHA 1GBDA 4D8NA 1ZPBA 3BEIB 3SU3A 1D4PB 3BSQA 1L2EA 1PQ5A 3KIDU 1QFKH 3KF2A 1AUJA 1V2KT 2EC9H 3SGBE 2C8WB 4LOYH 4A5TS 5AFZH 2Q6FA 1C1RA 1O3BA 1WSSH 2FLRH 3SGQE 2NU2E 3P70B 1O2NA 1O3OA 2RA3A 3GY5A 1DUEA 3GOVB 2FOGA 4BAOB 2XXLA 2ZFSA 4XSKU 2BMGB 3TK9A 1YLDA 1TNIA 2C3SA 3KCGH 3M5OA 3QLPH 2JH0D 2HVYB 2EY4C 4Y7BA 2WINI 4Q7XA 3RM0H 4I8HA 1O38A 3KEEA 2ZGJA 4JZEH 1VCPA 1TA2A 3T29A 1EB2A 3GY6A 1SGRE 4UFFH 1SKYE 1XM1A 1NRNH 1O5GH 7ESTE 4FVDA 1YPKH 4DG4A 1GBCA 4AN7A 1GHAG 1TALA 3TNTA 1QURH 4ACAA 2H9HA 4Y6DA 2BYAX 2RDEA 4E06H 1GHBG 3WY8A 1GGDC 4BANB 2O8WA 2BQ6B 3RXTA 5SGAE 1NBMD 1SSXA 2G4TA 2VIWA 3LDXH 1P2MA 2BLWA 2O8TA 1UTNA 4O3UA 3TPIZ 3SUGA 1GVZA 1QQUA 2B8OH 3FZDA 3FAOA 1HAOH 1C2JA 2OINA 3VB7A 4CHAC 2EA3A 1GJCB 1NRQH 1NRRH 1SGYE 3LKWA 3GISB 3TNSA 1P02A 1AVXA 2H5CA 8ESTE 2BDBA 3V3MA 5EXMA 3V7TA 4DIIH 3MO9A 5JBTA 2A31A 1ELVA 1Z6JH 1BMLA 2P3FH 2JIZD 2STAE 1ZYOA 1JRSA 3S0NA 3D65E 4JCNA 3FZZA 2FOCA 2V3HH 1DPOA 3LC3A 3H7TA 4CR9A 1KIGH 1F7ZA 5IDKA 1V2WT 1LPGB 3QO6A 4HZHA 3EA8A 4IN1A 2BDCA 1GMCF 5FPSA 2QC2A 2P8OB 1CE5A 3ATIA 5FBIA 1LQDB 2Y5GA 4FU8A 1C5RA 1SGQE 3E91A 2H9EH 1EZXC 5EGMA 2PGQB 5DP9A 1BMFD 3NK8A 3CS7A 1EFRD 2HNTE 1SLVB 1UTOA 2PW8H 4FUEA 1SGFA 4J2YB 4MNVA 4X6PA 3FP6E 3E0PB 1YP9A 5F8ZA 5A8YA 3FOAA 5CMXH 2WPMS 1LCYA 3RC5A 3BG4C 3LGYA 3O8DA 2QN5T 3TK6A 1NRPH 1E35B 2XWAA 3E0NB 2A32A 4I86A 1E0FD 2W26A 4MPWA 2ALVA 2OCVB 2BTCE 2ZPRA 2VH0A 5T6FA 4DW2U 3D49H 2SFAA 1UCYE 1IQHA 3QUMP 4ZKOU 4CRFA 3ZV8A 4NCYA 2FO9A 3RMMH 4ZKSU 3A81A 3GDSA 1A61H 2JJ2D 1ZJDA 2ZA5A 1G3DA 1FN8A 1AKSB 2BDGA 2J38A 1C4Y2 1DFPA 2B0FA 2ZFRH 1UK2A 3HK6B 3ZZAA 3BF6H 3SZEA 1JRTA 2CF9H 1ABIH 1CQQA 1AY6H 4K8BA 1ANBA 1K1LA 5EU8A 4TWYA 1AE5A 1ZMNA 1SQAA 5HMAA 5DPAA 3S7HB 3VFEA 2A4RA 2G81E 4AYYB 2ZFQH 1YPGH 4ESTE 2F9PA 3OX7U 5JYIA 3NCLA 1ZSJA 3F2HA 4U30A 2UUYA 3RXQA 5EQQA 3LT3A 1O3LA 3K6YA 3JZ2B 3DFLA 4Y11E 1ABJH 1NRSH 1W7XH 1FX0B 4K8YA 1GPZA 1RTKA 1RS0A 3GS9A 3H09A 2O8MA 1SLUB 5HGGA 2VIOA 3FFGA 1O5CB 3K6ZA 4X8SH 3PMHB 4KGAA 1P9UA 1KYNA 2GZ8A 1O37A 1DDJA 1O5EH 1C2HA 4D76A 2GZ9A 3N7OA 2H9TH 3BTME 3M35A 1V3XA 5IK2D 4GCHG 1G2LA 3BG8A 5GWZA 3A8DA 3GCHC 1YPJH 2AGEX 1EAUA 6LPRA 2KCPA 2EI6A 1MKXK 4IBLH 1G9IE 1DM4B 1UCYH 1E34B 4XFQA 1OPHB 4DOQA 1HYLA 2VB0A 3VB5A 1O2OA 5JPMH 1WU1A 5F8XA 1G3CA 4AB9A 4XBBA 3FKSD 3LC5A 2NU0E 2BQ7B 3A82A 4ASUD 3ZVCA 3PV2A 1NFWA 1C5OH 1QRXA 4A92A 2RFKC 2Z9GA 2F3CE 4MNYA 2UUJB 2AGGX 2AS9A 4TT3D 4ZHAA 4ASHA 3G01A 1ORFA 1W10U 2VNTA 1V2JT 1OS8A 1AZ8A 1SFIA 4Y10E 4X2VA 1CBWB 3ZIAD 1EX3A 2PUXB 4X8TH 4AFZA 1ZTLA 1SFQB 1HJ9A 1CHOF 1MKWH 3QK1A 1YYY1 2VVVA 1K1PA 2G5VA 3C27B 3DA9B 1HIAA 1MUEB 3A7VA 2AIPA 1UVOA 1VITH 1K0HA 1BJVA 2JJ1D 3DSOA 1BOQA 1TGSZ 2QA9E 2NU4E 2C8YB 2FS9A 3KQ5A 2ZTZA 4NFFA 4YO9A 5AF9H 1TPAE 4JYVH 4ZH8A 1F0SA 1KSNA 1Y3XA 1LHEH 2VINA 2FLBH 1F5LA 1AB9B 3IWMA 2XYAA 1COWD 3OE7D 2RCEA 3LIWA 2ZGBH 4ABGA 2WPDD 4NA7A 2XCNA 4YM9A 2G51A 1GBTA 1GMHF 2OQ5A 3SI3H 3T2NA 3ZV9A 3F68H 1FZZA 4Q4LA 1ZLRA 4FUCA 3NZIA 2J98B 4H42U 2OBQA 2BDHA 3ZZ5A 1ZSLA 1AVWA 3VXFH 2AFQB 3RMLH 2GZ7A 4ZKNU 3T26A 1DXWA 2ZC9H 1O0DH 1TGCA 4FUBA 1N6XA 1B0FA 2WV9A 2IPHA 4D7GA 1S83A 1MTVA 4LZ1H 1P9SA 1TOMH 3PM3A 4QT8C 3PO1B 1EP6A 1GMDG 5TJXA 4HTCH 2ZP0H 3LPRA 4RKJB 4BTUB 2BXUH 3UNSA 1AGJA 1H4WA 1SGFG 4Y8ZA 2F9BH 3NKKA 1VGCB 3L3TA 4K2YA 2ZTYA 1JXPA 4CRAA 5HKKD 1EAWA 3ATWA 3M3TA 3NPSA 1BTUA 5J4QA 5DP3A 4JYUH 4FETA 1ELCA 2FX6A 4J1YA 5B6OA 1DLKB 4P00A 1DICA 2XBWA 5A8XA 1V2VT 1T8OA 1WDIA 2BLVA 3FANA 3SJOA 1MTNC 2CGAA 1XUKA 2UUKB 2KR7A 2PKSC 5HIYA 1W12U 1MTUA 4B6FA 4Q63A 5ESTE 2CF8H 1V2OT 3CS0A 3RU4T 2ZEBA 4VGCC 5L2YH 2PR3A 3A7TA 3NUMA 3M5NA 4IMQA 3UOUA 3SUDA 3ZVGA 1Z6EA 2GDDA 2GCTC 1EZUC 2AMQA 5C1UA 1F5KU 1HBTH 2A2XH 2Y5HA 3QDZB 2Z3CA 1O2JA 2BOHB 4TY7A 2A0QB 1E36B 1SQOA 5FX6A 3M61U 4Y0YE 5C20A 2KAIB 2Q6GA 2R9PA 4WY3A 1GBMA 3BEFB 1MCTA 3OU0A 5EXLA 4WVPE 2O9QA 5GNDA 4GVUA 3RXLA 4CREA 1TMBH 4GHQA 3UAIC 1MKXH 4AC9A 1ZHMA 2GMTC 4XBCA 5DJ7A 4LXBH 1C9TA 1LVMA 2ZCKP 3GY2A 1MD7A 5JBCS 1EXFA 3GCOA 1MBQA 2FTLE 1K1MA 2EI7A 3ZZ9A 1K9OE 5AVDA 1ZR0A 2TPIZ 1HAYB 1UVTH 3ZZDA 4GPGA 1O35A 4PROA 2HPPH 2QV1A 4BAKB 2FOAA 1BRBE 1TYNA 1FLEE 2FOEA 3ZZ3A 1NS3A 1V2LT 4ABFA 3F6UH 1V2UT 1K28D 4GLYA 5DP5A 3OFND 3RMOH 1AIXH 7GCHF 1PPEE 3Q3KA 3LJOA 1QJ7B 2VH6A 1CT2E 3SGAE 5FL7D 5A0AE 4AB8A 3RXOA 2XCFA 3PTNA 2ZGHA 2CHAB 3UR9A 1P06A 1C1SA 1G32B 2JH6D 3ZVFA 2XBYA 2SNVA 3BTHE 4FUDA 1YM0A 5L6NH 5FHTA 3VXEH 2HALA 1UMAH 3P92A 1V2QT 4BTIB 2R3YA 3BTDE 5EPNA 1BT7A 2ILNA 1CSOE 1UVPA 3RXDA 3O8RA 1AD8H 1BTWA 2BD2A 2D1JA 2G8TA 5B6LA 4DGJA 1L1NA 1CA0B 1HXEH 3RXUA 1BRUP 5K7RA 1GI5A 1TWXB 5A0BA 3A8AA 3SORA 1AO5A 1T32A 1TGTA 1GJ9B 4P02A 3PRBA 2BD5A 4XD7D 2H5DA 2HNTF 1QGFA 4XRNA 4JK6A 2SGEE 1KXBA 2ZFFH 4FU9A 3SNEA 2FM2A 1JOUB 2C93B 2A7HA 4F55A 3SJ8A 1GJBB 2FOFA 3GY7A 2BZAA 4UD9H 2FP7B 3N99A 4B76A 3PV4A 1VCQA 2OC8A 4HGCA 2WPJS 3TH3H 3MU4A 5E2OA 3M3SA 2VIVA 1SOZA 5CHAB 1LKBA 3PRDA 1K22H 3SW2B 4ZKRU 1BQYA 2A4OA 2PLXA 1C1OA 1EASA 1T7CA 1UTJA 1CHOG 2HPQH 3SU5A 4BOHA 1UJ1A 4ISIH 1ETSH 2BHGA 2PSYA 3E8LA 3SZNA 1OWHA 2VIQA 1HAGE 3D23A 3RDZA 4UDWH 2ZIQH 3MMGA 5EW2H 4TPYA 3BTTE 5EJ1A 5GCHG 1HJAB 4K3JA 1OYTH 1DVAH 4YOIA 3BV9B 1BCUH 1P3EA 3OYPA 3ZZ7A 1LHDH 4YLQH 2J97A 3BN9A 1QB6A 1MZDA 3M5LA 1ID5H 1GG6B 1KTTB 3F0OA 4TPIZ 3MHWU 2AGIX 4TY6A 4AG2A 1TLDA 1C5XB 5HIZA 1HDTH 2TRMA 2V35A 3U28C 2GP9B 1VITF 1MTWA 2AEIH 5LH8A 1UK4A 1GI6A 2V3OH 4KTUA 3A85A 4Y0ZE 1W0KD 1EJNA 1IQLA 3RXJA 5FAHA 1PPFE 2VVUA 1UHBB 4NIVA 2HLDD 3SJKA 1P2QA 3SN8A 5F8TA 3VGCB 1UTKA 2JETB 1L0ZA 1YPMH 1J8AA 2QY0B 2F43B 1ESBA 1LVOA 2V7QD 3EE7A 3VEQB 3BTWE 2BVSH 1GCDA 1CO7E 1AKSA 3PROA 4ABBA 1ZGVA 4OGXA 1BJUA 1MQ5A 1RIWC 4FU7A 1M9UA 3LH1A 3IG6B 1D6WA 2WPLS 5LPRA 4AG1A 1S85A 4Y8YA 1S6FA 1EATA 2LP6A 3AASA 4UFDH 1GWAA 3MH4A 4K69A 3CENA 3FVFB 3DT0H 4FUIA 1SC8U 1A4WH 1ZHRA 3OEHD 1O2PA 3ZYEA 1DWDH 4B6EA 1T4VH 1YF4A 3PTBA 2ANMH 2ZCLP 1H8DH 1KXEA 4AFUA 1AHTH 2FXRA 4INKA 2HWLB 2W6ID 1RXPA 3SU0A 3DHKH 3ZZ8A 1B0EA 1Q31A 1QL9A 1AFEH 1PQ7A 2I6QA 5HXFA 1O3PB 2Z3EA 3Q3YA 5K0HA 2M5TA 2Z9LA 2RG3A 2ZDMA 2V6NA 2Z7FE 1O30A 1O5AB 3KL6A 3U98H 2ZU3A 1J16A 3ATKA 3GCNA 4DY7B 2DUCA 1VR1H 3M37A 1TMUH 1GVLA 4FUHA 3UREA 3A7XA 3FN8A 3SV8A 1IAUA 3ZYDA 1GCTB 1E1RD 2A5IA 4Q7YA 1QB1A 3LGTA 1S84A 1QBOA 4DVAU 4MNXA 4HFPB 1O3NA 1S6HA 5L2ZH 1OWJA 3RXHA 1LHCH 2RDLA 2ZDNA 3GY3A 2ANWA 2VWOA 3F9EA 1SG8B 3MU1A 3U9AH 1F92A 4I31A 1DOJA 3ZVEA 1P2OA 5GIBA 1DSTA 3MNCA 1C2GA 2A7JA 1EOJA 2FOHA 1C2EA 1CGJE 3VB6A 1O2MA 1S5SA 3MNSA 2Y7ZA 1NESE 3A7ZA 4F4OC 3TVJB 1O2RA 1TABE 3SUEA 3UNRA 4WH8A 4B71A 4TYDA 3A89A 1QR3E 5KECA 3RXKA 1A1RA 4HI3A 7GCHG 1TRYA 1Y5AT 4JZDH 2WUCA 3NRLA 1P03A 4IC5A 4RSPA 2R0LA 4DIHH 3IITA 1MZAA 1O2LA 1TGBA 1GI8B 5J4SA 4NGAH 2PKAB 4AORA 1MBMA 3TU7H 1BMMH 3U69H 3RXPA 1LVBA 3A80A 3SNBA 5DP7A 2NWNA 4WF8A 1IQKA 3EAJA 3KQEA 1CGHA 2FMJA 2P16A 6GCHF 2IPQX 2IOTA 2GVFA 3SJIA 4ZHMU 3MH5A 1TRNA 3NXPA 1OWIA 4BTTB 2YMSB 1O2SA 1HUTH 1C5PA 1P04A 1TBZH 1FIWA 2J98A 4WH6A 2CN0H 5ABWA 5FCRA 2UWLA 4A1XA 3BTEE 5E2PA 4H4FA 1Y3VA 3ATLA 1GDUA 2AMDA 2K0QA 2K8IA 3LOXA 2HNTC 1ZTJA 2TBSA 2YNBA 1A2CH 2STBE 1EUFA 2P8OC 3SQHE 1D3PB 3SHAH 3A86A 3HGPA 2WYGA 1LQEA 1O3JA 2QIQA 1O3GA 1XUIA 3PV5A 1BMNH 1RRKA 1Z8RA 4K60A 3U1JB 1Z7KA 3ZVDA 4ISOA 5DSFA 3SU4A 3TGIE 1S6LA 1IQGA 2R3UA 4I7YH 2WV4A 3KGPA 2VWNA 4X0WU 4OM9A 1TE0A 3V12A 2GKVE 3VG8A 1C1WH 1W14U 2SNWA 2QF0A 3WWBA 3F0PA 3KHVA 1YY3A 3FO8D 3ZZ6A 1S82A 1O5DH 2C8ZB 2UWOA 2CXVA 2F9OA 5C17A 2P59A 2XBXA 1C2MA 1D9IA 2HOBA 1OWEA 2QF4A 2ALPA 1SGEE 4I8GA 1KDQB 1YPHE 1WQVH 3SV7A 4X2XA 1S81A 4XE4A 1DANH 2BZ6H 1BDAA 5TCCA 5E8EH 1ACBE 3F9HA 1GBKA 1ZMJA 1QIXB 1RJXB 3GY4A 1HAXB 2BXTH 3F9GA 1W2KH 5TCAA 1H9LB 3SU2A 1C5QA 1O34A 1KLJH 1GJ4H 2Z6BD 3PLKA 5KGOA 4NSYA 1VITG 4ABEA 2ZHQH 2C8XB 4DURA 2VGCB 2IN2A 1HCGA 2KAIA 1EAIA 1BTPA 1W3CA 2ZCHP 4NIXA 3MU8A 4SGAE 3TLOA 2ZDVH 1S0RA 2H1UA 3E16B 1GI3A 1AWHB 2FWWA 3GCTF 1O2WA 5GDSH 1PJPA 1QRWA 2OP9A 2D8WA 1P09A 2Z9IA 1JBUH 1W13U 2ZDAH 1QY6A 1TGNA 3ODFA 2F91A 5C5NA 2BVXH 1BA8B 3ELAH 3S69A 3QWCH 2Y6TA 1O3HA 2ZU1A 5L30H 1FJSA 4O97A 3PMBB 1VKYA 1MU6B 1C5TA 3S9CA 4THNH 4FUJA 2VIDA 2SGPE 5HM2A 2Q6DA 2F83A 4IC6A 1O2HA 2YMSD 1DE7H 1FAXA 1U6QA 5DP4A 3TIUA 1TONA 2IJOB 4B2AA 1EPTA 3OEED 3T5FH 5CDFE 2FESH 4X6MA 4B2CA 3SV6A 4AGJA 2FPZA 3N7EA 4DT4A 1N8OB 4JZIA 3W94A 3PWBA 4OS5A 5EJLA 2A7CA 1GI0A 1NO9H 1ELBA 1MAXA 1HAHH 1TX8A 1GJDB 4CBNA 1KLIH 1CVWH 2FOMB 1Z8JB 2M2AA 1C4V2 4OS1A 5ESBA 4BXWA 3UPEA 3RXEA 1KXDA 1CBWC 1V2RT 1XUGA 1BMAA 2P3UB 1HGTH 2ZU4A 1W8BH 1G3EA 1YCPK 5G4BA 1TQ0B 5E0GA 2OK5A 1O2YA 1H8ED 1K1OA 1VJ9U 5E0JA 1E37B 1P10A 1QBNA 1MU8B 2SGAA 1BBRK 1QZ8A 3RXBA 4ACBA 1SQTA 4VGCB 3SV9A 3TK5A 2OXSA 1SMFE 4MTBA 1O32A 4A1TA 2Q1JA 5EOKA 2QXJA 1HNEE 1VZQH 1O2GH 1AB9C 1P57B 2AERH 2OBOA 5JB9S 8LPRA 3RLWH 3EGKH 3F3BA 3AW1A 3QN7A 1YKTA 1PQ8A 5GPIB 1G2MA 1LPZB 2OC7A 1Y3WA 4DT7B 1LO6A 3K9XB 2PWXA 1WBGB 4ABHA 3MO6A 1OWKA 3OAAD 3U1IB 1GMCG 4FUGA 3ENSB 2C4FH 3CNRA 1IQNA 1QRZA 2W3IA 4O03A 2QYIA 1DWCH 1C2KA 1D6RA 1GVKB 4YZUA 3M3VA 4UFEH 1BRAA 3N7DA 3MNBA 1O2KA 3KQCA 1THSH 3LGIA 3O8BA 4A7IB 1WYKA 1XKBC 1CU1A 3JZ1B 5GXPA 1Y5BT 2ZKSA 3DD2H 4Z0KA 7KMEH 2ZDLA 2KZ4A 3KYGA 3FP8E 1KY9A 1Y5UT 3PO1C 4IMZA 1TIOA 3T28A 1C5ZB 3ZVAA 3RXAA 1XVOA 2PTCE 1P12E 2Y5FA 2XRCA 4Q7ZA 4BAQB 1ARCA 4GSOA 1C1NA 2UUFB 5T6DA 1IQJA 5C1YA 2ZGXH 1PQAA 3SQEE 3F2GA 1GHAF 2BY5X 1QJ1B 4O3TA 3QGJA 1CA8B 2VWMA 4HG6A 4XBDA 3BIUH 1GHWH 1YGCH 1UHBA 1UTLM 5A09A 4YLUA 1SI5H 3F9FA 3D62A 2HRVA 2QAAA 2WPHS 1IQEA 3PB1E 3BEUA 4IN2A 5EIYA 1WAYB 3EE0B 1BTYA 4A1VA 4CRDA 3B9FH 3RXGA 6ESTA 1Z71A 1DT2A 4BAMB 1UVUH 1FUJA 1P05A 4BNRA 3NWUA 2PGBB 5A8ZA 4Z6AH 1PFXC 3E6PH 1EJAA 3SNCA 5DKMA 3A88A 2EI8A 2DE8A 4R8TB 3U8TH 1UK3A 1BZXE 4Y79A 2PSXA 2PHBA 3ESTA 1ANEA 1EKBB 4YESB 1Y3YA 1C5UA 2H6MA 1A3EH 2KX4A 2GT7A 1NU9A 1QJ6B 1ELGA 3T25A 3M7TA 1O3DA 4GUXA 5EODA 3HGNA 3O8CA 3MQKC 1GL0E 3K2UA 3HKJB 4MNWA 2FYRA 3R0FA 4GHTA 3MH7A 2JDID 3RXSA 1TB6H 4XOJA 1ANCA 1LHFH 1OX1A 1TPOA 4X1QU 5ETXA 2FS8A 3LJJA 1N6YA 2J92A 3GICB 1BTXA 3RU4E 6CHAB 1EP5A 2XOKD 2ZZUH 1O3CA 1GBHA 2O8LA 1EPTC 1BUIA 1GBAA 4U2WA 1WTHD 4TSFD 1C5SA 1FIZA 5C0TA 3GCTG 3P17H 3SHCH 1HAZB 2BVRH 1L4ZA 1F5RA 4TWWA 1W11U 3P8FA 2KCOA 1MAYA 2WPKS 4K5ZA 1XVMA 4MDSA 1TNGA 3PMAB 5LGOA 1C2FA 3URCA 5FPTA 4X1NU 2V0BA 2G00A 4AYVB 3UTUH 3GYMA 1CT0E 4WXIA 4NIWA 3SNAA 1WQSA 1XXDA 1MD8A 3EA7A 2TGAA 1SGDE 3TH4H 2QF5A 1O3EA 1GHXH 1T4UH 1NY22 2B7DH 2VWLA 4UFGH 3BTGE 5A0CA 3MU5A 4JYTA 4ABIA 1TFXA 5DO4H 5FCKA 2ZECA 2GV6A 2FEQH 3A8CA 4INHA 4KP0A 1O2ZA 2P94A 4RKOB 1GDQA 1NPMA 4WMFA 3OY5U 2VJ1A 2B9LA 1OKXA 4RN6A 2ZPQA 1SGIB 5JB8S 4FXGH 5DP6A 1OXGA 5DN6D 2ESTE 2BX3A 1DITH 1OHHD 4NFEA 4B75A 3PLPA 4UEHH 2PKAA 2UWPA 2FDAA 3RC6A 1JIMA 4X8VH 1KMHB 5BPEA 5T3HA 3UQOA 2WZQA 1NT1A 1CGIE 2GX4A 3SV2H 9ESTA 1GMHG 3A7WA 5I25A 3VPKA 1G3BA 2W5EA 4E7NA 2H2ZA 1C5NH 5AHGH 2EEKA 1Z1JA 5CHAC 2XNDD 1D3TB 5JDUB 2XWBI 2KCAA 1D3QB 1JWTA 1ZOMA 1MMJN 3AVZA 1H9IE 5DP8A 4F49A 4GCHF 1AFQC 3RM2H 1DY9A 2BQWB 1IQIA 1QHRB 1TNJA 2CMYA 2WV5A 3MTYA 1HLTH 1IHTH 3VB4A 1LTOA 1O31A 4O9VA 4OS7A 4ISNA 1V2MT 5T1VA 1Z8IB 7LPRA 1H8IH 1O2XA 1O2QA 4WXVA 4Z1MD 3F2FA 1J14A 1C1VH 4A6LA 1HJAC 4JZ1A 1K21H 1NFUA 5F03A 3WW7A 3W1EA 1OOKB 3SUFA 3ZZBA 5C94A 1ANDA 3OSYA 1FQ3A 3SOSA 2FX4A 2QGRA 1SB1H 4NWLA 1P3CA 1EZQA 2PUQH 4JMYA 4X6OA 5EG4A 1GGDB 1GG6C 1GI7B 1TBQH 3M36A 3AW0A 1XUFA 1GJ6A 3RXMA 2WPIS 4D7FA 3RU4D 2J94A 3LGWA 2BD7A 4I8LA 2J95A 4JZFH 1DX5M 1NZQH 1QB9A 1TBRH 2XC4A 4NIYA 3V0XA 1FPHH 4ABJA 5C0UA 2AMPA 1NROH 3P95A 3HKIB 3P6ZB 2C90B 1BIOA 4GAWA 3SJ9A 4CHAB 4CRGA 3VGCC 1HAVB 2JETC 3AAUA 3I78A 1KDQA 5EQSA 3GYLB 3RC4A 3V13A 4ZXYH 5PTPA 1GI1A 2ZU2A 3URDA 3RXRA 1TX6A 1UTQA 4X6NA 2ZG0H 1J15A 1HFDA 1ZJKA 2CK3D 2LELA 5EPYA 2VBCA 1RTFB 3AK5A 2XW9A 4ZXXH 1TPSA 2PTNA 2TGPZ 1FY4A 2J5UA 1SL3A 1FY3A 1W7GH 4U32A 1YPLH 2AH4X 2YNAA 4XDEA 1NTPA 2ZF0H 1X7AC 3E1XB 1UCYK 5T6GA 4D9QA 1THRH 4BXSA 1K1IA 1P2JA 2ZHEH 3U8OH 1V2PT 3C1KA 4AFQA 1GJ8B 1PYTD 3QX5H 1HAIH 2Y7XA 1AN1E 1DWEH 2A1DB 3RXVA 3ATMA 3RUOA 1EOLA 4OS4A 1GDNA 4I8JA 4Q80A 1AWFH 1PPCE 1BB0B 2DE9A 1P2IA 2K1QA 1MTSA 1GMDF 1ARBA 3GDUA 2J34A 3BG4B 4OS2A 2ZU5A 1SVPA 3DUXH 1EB1H 4OS6A 1D3DB 1C1TA 4CH2B 4K1SA 4FVBA 4JK5A 3Q00A 4MG3A 3RLYH 1C2LA 2A4GA 2HGTH 1MKWK 2Y80A 2A4QA 4M9FA 2FI4E 1O39A 3VB3A 1FMGA 3MFJA 2L74A 1GBEA 1AUTC 1XX9A 1ZPCA 2ZHFH 1LHGH 1YLNA 2QE7D 1GCTC 1TA6A 9LPRA 2W7UA 1RFNA 2F4LA 2P95A 1OP2A 1BHXB 4RT1A 1AU8A 1DXPA 2A2QH 2OQUA 5FPYA 2FI5E 4AX9H 2J9NA 1A0HB 2ASUB 3R3GB 3WWFA 1W0ZU 2SGFE 1LPKB 2GCHF 3HPTB 5JBBS 1SHHB 1HAPH 1O3KA 2TIOA 3RXCA 5FX5A 1NFYA 4B1TA 5F6MA 1HPGA 1E79D 2WHXA 1Q3XA 8KME2 1WTGH 1FDPA 1H1BA 1W0JD 4B73A 1O2VA 1SOTA 2RA0A 4AGKA 1TX7A 3UUZA 3QTVH 1FXYA 4F48B 2F9UA 3KN2A 1QCPA 2J2UA 2ZHWH 2ODPA 1V6DA 2ZDKA 1SHYA 4K1EA 4NG9H 4FOUC 2QF3A 4LZ4B 1PPGE 1N1LA 4CRCA 2XC5A 1OWDA 1BTZA 5F53A 1O3MA 3UQVA 1NFXA 1SGNE 5LPEA 3GCHB 1AQ7A 3LH3A 1K1NA 3S9AA 1WOFA 3EQ0H 1XMNB 4Y71A 1HRTH 2Z94A 3TH2H 1ZTKA 4B2BA 1LKAA 1FAKH 4NWKA 4CR5A 2YMSC 1G30B 1MCVA 1TMTH 3SO3A 4X2WA 3ZVBA 1C5YB 1G36A 2XBVA 3DSPA 2KM0A 2W3KA 3EDXB 1TRMA 3TJOA 1O5FH 1HXFH 1BTHH 1QQ4A 1KXFA 1XXFA 2AYWA 3Q76A 1A5GH 4WWYA 1O5BB 4ZHLU 3TGJE 3UY9A 4MVNA 2ZPSA 4YT6H 2XNIA 2W7SA 3GY8A 4YOGA 3P8OA 2OLGA 1GJ7B 4CRBA 1MABB 1C5WB 1O3FA 2GT8A 3MU0A 3M7UA 4OGYA 2LNCA 2ZFTA 1LDTT 3ODDA 4ZMAH 2G55A 4X1SU 2THFB 1GBBA 1NC6A 2FOBA 1SQRA 3A8BA 4UONA 2Z3DA 4IS5A 3AAVA 2J4IA 1Z1IA 3K65B 3P8NA 1B5GH 1GI9B 2W6JD 3KQDA 4KELA 1K1JA 3UWIA 1GBLA 1G37A 2BOKA 3STJA 3SNDA 2R2WU 2R0KA 3H5CB 3RXFA 4X2YA 1YPHC 2NU1E 1SR5C 3KYFA 4X1PU 1DLEA 5LPFA 1A5IA 1L1GA 2OUAA 2ANYA 4WJG2 1ELAA 1WCZA 3UIRA 3LONA 1A46H 2A45B 3PLBA 1HJ8A 2PV9B 1RD3B 2BD8A 2R2MB 1TPPA 1HV7A 1ZGIA 4IW4E 5HM9A 1EQ9A 2B5TB 3TJVA 3UFAA 1GI4A 3E3TA 2VVCA 2VU8E 3SI4H 3Q77A 3QZQA 4I8KA 4LK4A 4K1TA 4CH8B 1QBVH 2G52A 1MQ6A 5DK1A 2SGDE 2AIQA 1VJAU 3T62A 1GBIA 1C1MA 5HYOA 1KXAA 2EQNA 2KFWA 3FP7E 1XKAC 2LPRA 2VGCC 1THPB 4U01A 1TQ7B 1ZHPA 2JH5D 3ZZ4A 4RT0A 2BB4A 2Y81A 1O2UA 2D26C 2BY7X 3MYWA 2CV3A 1FY5A 2FODA 2GDEH 3MO3A 2XC0A 1A5HA 5GCHF 1O3AA 3M7QA 5FBEA 4X1RU 4NA9H 3ZZCA 2WYJA 2BY8X 2QCYA 2ZQ2A 1JMOH 2GTBA 1TAWA 3OTPA 3UOPA 2TGTA 5AFYH 4MPXA 1F0TA 1SGCA 1C1QA 1DUAA 4ZUHA 4RI0A 1C2IA 1W0YH 4KTCA 4DCDA 1C5LH 1MTNB 2ODYB 1C5VA 2BDYA 8GCHF 1YCPM 2PKSB 5DGJA 1NU7B 2F9NA 2WUBA 3U8RH 3HATH 1JIRA 1PPBH 3KQBA 1GJAB 1P01A 1XUJA 1QA7A 4E05H 3E90B 3QTOH 1N8OC 3BTQE 4ZAEA 2GCTB 1Y3UA 3B8JA 1GBJA 5H4IB 1GI2A 1P2NA 1ZPZA 1TNHA 4D9RA 1L4DA 1XUHA 1FN6A 1Y59T 4ZCNA 1SBWA 1BITA 1VCWA 2ZI2H 4M7GA 1EAXA 4AZ2B 1C2DA 2HVXA 1E38B 5EQRA 1P2KA 1F0UA 1P8VC 1H8HD 2I6SA 3F1SB 4Q2KA 1Y8TA 1OSSA 1E1QD 3RP2A 1Q2WA 1SPJA 5CHBA 4ABAA 2O8UA 1L1JA 1ESAA 4I33A 4NZLA 1ZSKA 1A7SA 2GMTB 2BD4A 3OTJE 3RXIA 3STIA 2QXHA 4AFSA 2ZTXA 1FY8E 1WUNH 1V2NT 1AZZA 1C1UH 6GCHG 1FV9A 2GV7A 4ISHH 1BRCE 2OD3B 2PFEA 2ZNKH 4UE7H 2P93A 3BIVH 1KLTA 1T8NA 1VGCC 1ZRKA 1YWUA 2BM2A 1YBWA 1WXRA 2GCHG 4YOJA 4CBOA 4NSVA 1GL1A 2FTMA 4INLA 2BD3A 3TJNA 1OYQA 3MOCA 4R0IA 2A5AA 1UTPA 3B23B 3DSGA 1GHBF 3UB0A 5DG6A 1INCA 5EW1H 1A3BH 1J9CH 3BTFE 1ZRBA 1PPHE 4DJZB 1FONA 1GHZA 2ANKH 1SLWB 1DWBH 1ESTA 4Y76A 4X8UH 4FUFA 5C5OA 1QA0A 4Y8XA 1SGPE 1ETRH 2PP6A 2D2DA 2P3TB 1UTMA 2ZHDA 4B74A 1BBRE 3DCLA 1J17T 1IQMA 2L6OA 1P11E 2OC0A 2OC1A 1C1PA 2ODQA 4MPUA 1PPZA 3L33A 2AHME 1OP0A 2FI3E 3UNQA 3CP7A 2FZZA 2NU3E 3LGUA 1GBFA 2Z9JA 1AI8H 1P0SH 4KKDA 2ULLA 2GGVB 1TNKA 4BAHB 1HIAB 1QNJA 1F0RA 3SU1A 4H6SB 3A84A 3QZRA 1AVGH 2A5KA 1UO6A 1WV7H 3LGVA 2WSSD 4YXWD 1TOCB 5JBAS 4Y7AA 1EPTB 2BD9A 3UWJH 2ZGCA 3TITA 2F9VA 1HAVA 3W95A 1EZSC 1GHVH 1FNIA 1FI8A 1K2I1 1ZZZA 1FY1A 4KTSA 4E7RG 3MWIU 5EJZA 1A0LA 3I29A 2HLCA 5C67A 3KNXA 3SYJA 3MI4A 2QXGA 3QGNB 4YT7H 1UVSH 1ELEE 2BY9X 3MNXA 2KCYA 1O33A 1H9HE 5FXLA 1RTLA 1IOEA 2BY6X 1CHGA 1IHSH 3P8GA 1QTFA 1SLXB 1ELTA 1FPCH 2JKHA 1NM6A 1O2IA 2ZO3H 2G4UA 1YCPH 3OY6U 2TGDA 2BLOA 2Y82A 5BRRE 1GHYH 4ISLA 1V2TT 1C5MD 2CHAC 2ZWLH 3TJUA 1TNLA 1O3IA 3ITIA 1BBRH 1BHXF 1UW7A 3UR6A 1DSUA 1KTSB 3SU6A 1T8MA 1GJ5H 5C1XA 2CJIA 1B7XB 4SGBE 5C3NA 1KXCA 1ETTH 3EYDA 4ABDA 1C9PA 5I46H 4NZQA 5A2MH 1RGQA 2IJD1 3BTKE 1CA0C 3H7OA 5IYTA 1F2SE 3DFJA 1NN6A 4NA8A 1ELFA 3A87A 4YTAA 2BDIA 3GDVA 5EXNA 1AFQB 3LU9B 1O2TA 2YOLA 1SGTA 3PMJA 5C2ZA 2BLQA 1MH0A 1V2ST 1NBME 2BDAA 1HB0B 3EA9A 2VIPA 3PWCA 6CHAC 2Z9KA 1QL7A 5GJ4B 1ELDE 3HK3B 2ZQ1A 1EJMA 1T31A 2QXIA 1OP8A 1T8LA 4WMDA 1DS2E 2G5NA 1RIWB 2BX4A 2OTVA 4I32A 1DY8A 2V3MA 3A83A 3TGKE 4H6TA 1C4U2 5E0HA 3MH6A 4MQAA 3L6PA 2SGQE 1Z8GA 3Q3XA 5KEDA 4WMEA 1AE8H 4MLFB 4MPVA 1YLCA 4IGDA 1LVYA 3S9BA 2XTTB 3A7YA 1CT4E 5CE1A 2ZFPH 2GJGA 4AOQA 1ZMLA 2GD4B 1A0JA 3T27A 1YPEH 3RMNH 2FIRH 8GCHG 1AMHA 1IQFA 2FYQA 1YC0A 1PYTC 1O36A
chains in the Genus database with same CATH topology
3I77A 3S7KB 3M5MA 4ZROA 3SBKA 1S0QA 1LMWB 1QL8A 3PYHA 1GBDA 4D8NA 1ZPBA 3BEIB 3SU3A 1D4PB 3BSQA 1L2EA 1PQ5A 3KIDU 1QFKH 3KF2A 1AUJA 1V2KT 2EC9H 3SGBE 2C8WB 4LOYH 4A5TS 5AFZH 2Q6FA 1C1RA 1O3BA 1WSSH 2FLRH 3SGQE 2NU2E 3P70B 1O2NA 1O3OA 2RA3A 3GY5A 1DUEA 3GOVB 2FOGA 4BAOB 2XXLA 2ZFSA 4XSKU 2BMGB 3TK9A 1YLDA 1TNIA 2C3SA 3KCGH 3M5OA 3QLPH 2JH0D 4Y7BA 2WINI 4Q7XA 3RM0H 4I8HA 1O38A 3KEEA 2ZGJA 4JZEH 1VCPA 1TA2A 3T29A 1EB2A 3GY6A 1SGRE 4UFFH 1XM1A 1NRNH 1O5GH 7ESTE 4FVDA 1YPKH 4DG4A 1GBCA 4AN7A 1GHAG 1TALA 3TNTA 1QURH 2H9HA 4Y6DA 2BYAX 4E06H 1GHBG 3WY8A 1GGDC 4BANB 2O8WA 2BQ6B 3RXTA 5SGAE 1SSXA 2G4TA 2VIWA 3LDXH 1P2MA 2BLWA 2O8TA 1UTNA 4O3UA 3TPIZ 3SUGA 1GVZA 1QQUA 2B8OH 3FZDA 3FAOA 1HAOH 1C2JA 2OINA 3VB7A 4CHAC 2EA3A 1GJCB 1NRQH 1NRRH 1SGYE 3LKWA 3GISB 3TNSA 1P02A 1AVXA 2H5CA 8ESTE 2BDBA 3V3MA 5EXMA 3V7TA 4DIIH 3MO9A 5JBTA 2A31A 1ELVA 1Z6JH 1BMLA 2P3FH 2STAE 1ZYOA 1JRSA 3S0NA 3D65E 4JCNA 3FZZA 2FOCA 2V3HH 1DPOA 3LC3A 3H7TA 4CR9A 1KIGH 1F7ZA 5IDKA 1V2WT 1LPGB 3QO6A 4HZHA 3EA8A 4IN1A 2BDCA 1GMCF 5FPSA 2QC2A 2P8OB 1CE5A 3ATIA 5FBIA 1LQDB 2Y5GA 4FU8A 1C5RA 1SGQE 3E91A 2H9EH 1EZXC 5EGMA 2PGQB 5DP9A 3NK8A 3CS7A 2HNTE 1SLVB 1UTOA 2PW8H 4FUEA 1SGFA 4J2YB 4MNVA 4X6PA 3FP6E 3E0PB 1YP9A 5F8ZA 5A8YA 5CMXH 2WPMS 1LCYA 3RC5A 3BG4C 3LGYA 3O8DA 2QN5T 3TK6A 1NRPH 1E35B 2XWAA 3E0NB 2A32A 4MPWA 1E0FD 2W26A 2ALVA 2OCVB 2BTCE 2ZPRA 2VH0A 5T6FA 4DW2U 3D49H 2SFAA 1UCYE 1IQHA 3QUMP 4ZKOU 4CRFA 3ZV8A 4NCYA 2FO9A 3RMMH 4ZKSU 3A81A 3GDSA 1A61H 1ZJDA 2ZA5A 1G3DA 1FN8A 1AKSB 2BDGA 2J38A 1C4Y2 1DFPA 2B0FA 2ZFRH 1UK2A 3HK6B 3ZZAA 3BF6H 1JRTA 2CF9H 1ABIH 1CQQA 1AY6H 4K8BA 1ANBA 1K1LA 5EU8A 4TWYA 1AE5A 1ZMNA 1SQAA 5HMAA 5DPAA 3S7HB 3VFEA 2A4RA 2G81E 4AYYB 2ZFQH 1YPGH 4ESTE 2F9PA 3OX7U 3NCLA 1ZSJA 4U30A 2UUYA 3RXQA 5EQQA 3LT3A 1O3LA 3K6YA 3JZ2B 3DFLA 4Y11E 1ABJH 1NRSH 1W7XH 4K8YA 1GPZA 1RTKA 1RS0A 2O8MA 1SLUB 5HGGA 2VIOA 3FFGA 1O5CB 3K6ZA 4X8SH 3PMHB 4KGAA 1P9UA 1KYNA 2GZ8A 1O37A 1DDJA 1O5EH 1C2HA 4D76A 2GZ9A 3N7OA 2H9TH 3BTME 3M35A 1V3XA 4GCHG 1G2LA 3BG8A 5GWZA 3A8DA 3GCHC 1YPJH 2AGEX 1EAUA 6LPRA 2EI6A 1MKXK 4IBLH 1G9IE 1DM4B 1UCYH 1E34B 4XFQA 1OPHB 4DOQA 1HYLA 2VB0A 3VB5A 1O2OA 5JPMH 1WU1A 5F8XA 1G3CA 4AB9A 4XBBA 3LC5A 2NU0E 2BQ7B 3A82A 3ZVCA 1NFWA 1C5OH 1QRXA 4A92A 2Z9GA 2F3CE 4MNYA 2UUJB 2AGGX 2AS9A 4ZHAA 4ASHA 3G01A 1ORFA 1W10U 2VNTA 1V2JT 1OS8A 1AZ8A 1SFIA 4Y10E 4X2VA 1CBWB 1EX3A 2PUXB 4X8TH 4AFZA 1ZTLA 1SFQB 1HJ9A 1CHOF 1MKWH 3QK1A 1YYY1 2VVVA 1K1PA 2G5VA 3C27B 3DA9B 1HIAA 1MUEB 3A7VA 2AIPA 1UVOA 1VITH 1BJVA 1BOQA 1TGSZ 2QA9E 2NU4E 2C8YB 2FS9A 2ZTZA 4NFFA 4YO9A 5AF9H 1TPAE 4JYVH 4ZH8A 1F0SA 1KSNA 1Y3XA 1LHEH 2VINA 2FLBH 1F5LA 1AB9B 3IWMA 2XYAA 2RCEA 3LIWA 2ZGBH 4ABGA 4NA7A 2XCNA 4YM9A 2G51A 1GBTA 1GMHF 2OQ5A 3SI3H 3T2NA 3ZV9A 3F68H 1FZZA 1ZLRA 4FUCA 3NZIA 4H42U 2OBQA 2BDHA 3ZZ5A 1ZSLA 1AVWA 3VXFH 2AFQB 3RMLH 2GZ7A 4ZKNU 3T26A 1DXWA 2ZC9H 1O0DH 1TGCA 4FUBA 1N6XA 1B0FA 2IPHA 4D7GA 1S83A 1MTVA 4LZ1H 1P9SA 1TOMH 3PM3A 4QT8C 3PO1B 1EP6A 1GMDG 5TJXA 4HTCH 2ZP0H 3LPRA 4RKJB 4BTUB 2BXUH 3UNSA 1AGJA 1H4WA 1SGFG 4Y8ZA 2F9BH 3NKKA 1VGCB 3L3TA 4K2YA 2ZTYA 1JXPA 4CRAA 1EAWA 3ATWA 3M3TA 3NPSA 1BTUA 5J4QA 5DP3A 4JYUH 1ELCA 2FX6A 4J1YA 5B6OA 1DLKB 1DICA 2XBWA 5A8XA 1V2VT 1T8OA 2BLVA 3FANA 3SJOA 1MTNC 2CGAA 1XUKA 2UUKB 2PKSC 1W12U 1MTUA 5ESTE 2CF8H 1V2OT 3CS0A 3RU4T 2ZEBA 4VGCC 5L2YH 2PR3A 3A7TA 3NUMA 3M5NA 4IMQA 3UOUA 3SUDA 3ZVGA 1Z6EA 2GDDA 2GCTC 1EZUC 2AMQA 5C1UA 1F5KU 1HBTH 2A2XH 2Y5HA 3QDZB 2Z3CA 1O2JA 2BOHB 4TY7A 2A0QB 1E36B 1SQOA 5FX6A 3M61U 4Y0YE 5C20A 2KAIB 2Q6GA 2R9PA 4WY3A 1GBMA 3BEFB 1MCTA 3OU0A 5EXLA 4WVPE 2O9QA 4GVUA 3RXLA 4CREA 1TMBH 4GHQA 1MKXH 1ZHMA 2GMTC 4XBCA 5DJ7A 4LXBH 1C9TA 1LVMA 2ZCKP 3GY2A 1MD7A 5JBCS 1EXFA 3GCOA 1MBQA 2FTLE 1K1MA 2EI7A 3ZZ9A 1K9OE 5AVDA 1ZR0A 2TPIZ 1HAYB 1UVTH 3ZZDA 4GPGA 1O35A 4PROA 2HPPH 2QV1A 4BAKB 2FOAA 1BRBE 1TYNA 1FLEE 2FOEA 3ZZ3A 1NS3A 1V2LT 4ABFA 3F6UH 1V2UT 1K28D 4GLYA 5DP5A 7GCHF 3RMOH 1AIXH 1PPEE 3Q3KA 3LJOA 1QJ7B 2VH6A 1CT2E 3SGAE 5A0AE 4AB8A 3RXOA 2XCFA 3PTNA 2ZGHA 2CHAB 3UR9A 1P06A 1C1SA 1G32B 2JH6D 3ZVFA 2XBYA 2SNVA 3BTHE 4FUDA 1YM0A 5L6NH 5FHTA 3VXEH 2HALA 1UMAH 3P92A 1V2QT 4BTIB 2R3YA 3BTDE 5EPNA 1BT7A 2ILNA 1CSOE 1UVPA 3RXDA 3O8RA 1AD8H 1BTWA 2BD2A 2D1JA 2G8TA 4DGJA 1L1NA 1CA0B 1HXEH 3RXUA 1BRUP 5K7RA 1GI5A 1TWXB 5A0BA 3A8AA 3SORA 1AO5A 1T32A 1TGTA 1GJ9B 2BD5A 2H5DA 2HNTF 1QGFA 4JK6A 2SGEE 1KXBA 2ZFFH 4FU9A 3SNEA 2FM2A 1JOUB 2C93B 2A7HA 3SJ8A 1GJBB 2FOFA 3GY7A 2BZAA 4UD9H 2FP7B 4B76A 3PV4A 1VCQA 2OC8A 4HGCA 2WPJS 3TH3H 3MU4A 5E2OA 3M3SA 2VIVA 1SOZA 5CHAB 1LKBA 1K22H 3SW2B 4ZKRU 1BQYA 2A4OA 2PLXA 1C1OA 1EASA 1T7CA 1UTJA 1CHOG 2HPQH 3SU5A 4BOHA 1UJ1A 4ISIH 1ETSH 2BHGA 2PSYA 3E8LA 3SZNA 1OWHA 2VIQA 1HAGE 3D23A 3RDZA 4UDWH 2ZIQH 3MMGA 5EW2H 4TPYA 3BTTE 5GCHG 1HJAB 4K3JA 1OYTH 1DVAH 4YOIA 3BV9B 1BCUH 1P3EA 3OYPA 3ZZ7A 1LHDH 4YLQH 3BN9A 1QB6A 1MZDA 3M5LA 1ID5H 1GG6B 1KTTB 4TPIZ 3MHWU 2AGIX 4TY6A 4AG2A 1TLDA 1C5XB 1HDTH 2TRMA 2V35A 2GP9B 1VITF 1MTWA 2AEIH 5LH8A 1UK4A 1GI6A 2V3OH 4KTUA 3A85A 4Y0ZE 1EJNA 1IQLA 3RXJA 5FAHA 1PPFE 2VVUA 1UHBB 4NIVA 3SJKA 1P2QA 3SN8A 5F8TA 3VGCB 1UTKA 2JETB 1L0ZA 1YPMH 1J8AA 2QY0B 1ESBA 1LVOA 3VEQB 3BTWE 2BVSH 1GCDA 1CO7E 1AKSA 3PROA 4ABBA 1ZGVA 4OGXA 1BJUA 1MQ5A 1RIWC 4FU7A 1M9UA 3LH1A 3IG6B 1D6WA 2WPLS 5LPRA 4AG1A 1S85A 4Y8YA 1S6FA 1EATA 3AASA 4UFDH 1GWAA 3MH4A 4K69A 3CENA 3FVFB 3DT0H 4FUIA 1SC8U 1A4WH 1ZHRA 1O2PA 3ZYEA 1DWDH 1T4VH 1YF4A 3PTBA 2ANMH 2ZCLP 1H8DH 1KXEA 4AFUA 1AHTH 2FXRA 4INKA 2HWLB 1RXPA 3SU0A 3DHKH 3ZZ8A 1B0EA 1Q31A 1QL9A 1AFEH 1PQ7A 2I6QA 5HXFA 1O3PB 2Z3EA 3Q3YA 5K0HA 2M5TA 2Z9LA 2RG3A 2ZDMA 2V6NA 2Z7FE 1O30A 1O5AB 3KL6A 3U98H 2ZU3A 1J16A 3ATKA 3GCNA 4DY7B 2DUCA 1VR1H 3M37A 1TMUH 1GVLA 4FUHA 3UREA 3A7XA 3SV8A 1IAUA 3ZYDA 1GCTB 2A5IA 4Q7YA 1QB1A 3LGTA 1S84A 1QBOA 4DVAU 4MNXA 4HFPB 1O3NA 1S6HA 5L2ZH 1OWJA 3RXHA 1LHCH 2RDLA 2ZDNA 3GY3A 2ANWA 2VWOA 3F9EA 1SG8B 3MU1A 3U9AH 1F92A 4I31A 1DOJA 3ZVEA 1P2OA 5GIBA 1DSTA 3MNCA 1C2GA 2A7JA 1EOJA 2FOHA 1C2EA 1CGJE 3VB6A 1O2MA 1S5SA 3MNSA 2Y7ZA 1NESE 3A7ZA 4F4OC 3TVJB 1O2RA 1TABE 3SUEA 3UNRA 4WH8A 4B71A 4TYDA 3A89A 1QR3E 3RXKA 1A1RA 4HI3A 7GCHG 1TRYA 1Y5AT 4JZDH 2WUCA 4IC5A 1P03A 4RSPA 2R0LA 4DIHH 3IITA 1MZAA 1O2LA 1TGBA 1GI8B 5J4SA 4NGAH 2PKAB 4AORA 1MBMA 3TU7H 1BMMH 3U69H 3RXPA 1LVBA 3A80A 3SNBA 5DP7A 2NWNA 4WF8A 1IQKA 3EAJA 3KQEA 1CGHA 2FMJA 2P16A 6GCHF 2IOTA 2GVFA 3SJIA 4ZHMU 3MH5A 1TRNA 3NXPA 1OWIA 4BTTB 1O2SA 1HUTH 1C5PA 1P04A 1TBZH 1FIWA 4WH6A 5ABWA 2CN0H 5FCRA 2UWLA 4A1XA 3BTEE 5E2PA 4H4FA 1Y3VA 3ATLA 1GDUA 2AMDA 3LOXA 2HNTC 1ZTJA 2TBSA 2YNBA 1A2CH 2STBE 1EUFA 2P8OC 3SQHE 1D3PB 3SHAH 3A86A 3HGPA 2WYGA 1LQEA 1O3JA 2QIQA 1O3GA 1XUIA 3U1JB 1BMNH 1RRKA 1Z8RA 4K60A 1Z7KA 3ZVDA 4ISOA 3SU4A 3TGIE 1IQGA 2R3UA 4I7YH 2WV4A 3KGPA 2VWNA 4X0WU 1TE0A 3V12A 2GKVE 1C1WH 1W14U 2SNWA 2QF0A 3KHVA 3ZZ6A 1S82A 1O5DH 2C8ZB 2UWOA 2CXVA 2F9OA 2P59A 2XBXA 1C2MA 1D9IA 2HOBA 1OWEA 2ALPA 1SGEE 4I8GA 1KDQB 1YPHE 1WQVH 3SV7A 4X2XA 1S81A 4XE4A 1DANH 2BZ6H 1BDAA 5TCCA 5E8EH 1ACBE 3F9HA 1GBKA 1ZMJA 1QIXB 1RJXB 3GY4A 1HAXB 2BXTH 3F9GA 1W2KH 5TCAA 1H9LB 3SU2A 1C5QA 1O34A 1KLJH 1GJ4H 2Z6BD 3PLKA 4NSYA 1VITG 4ABEA 2ZHQH 2C8XB 4DURA 2VGCB 2IN2A 1HCGA 2KAIA 1EAIA 1BTPA 1W3CA 2ZCHP 4NIXA 3MU8A 4SGAE 3TLOA 2ZDVH 1S0RA 2H1UA 3E16B 1GI3A 1AWHB 2FWWA 3GCTF 1O2WA 5GDSH 1PJPA 1QRWA 2OP9A 2D8WA 1P09A 2Z9IA 1JBUH 1W13U 2ZDAH 1QY6A 1TGNA 3ODFA 2F91A 5C5NA 2BVXH 1BA8B 3ELAH 3S69A 3QWCH 2Y6TA 1O3HA 2ZU1A 5L30H 1FJSA 4O97A 3PMBB 1MU6B 1C5TA 3S9CA 4THNH 4FUJA 2VIDA 2SGPE 5HM2A 2Q6DA 2F83A 4IC6A 1O2HA 1DE7H 1FAXA 1U6QA 5DP4A 3TIUA 1TONA 2IJOB 4B2AA 1EPTA 3T5FH 2FESH 4X6MA 4B2CA 3SV6A 4AGJA 2FPZA 1N8OB 4JZIA 3W94A 3PWBA 4OS5A 2A7CA 1GI0A 1NO9H 1ELBA 1MAXA 1HAHH 1TX8A 1GJDB 4CBNA 1KLIH 1CVWH 2FOMB 1Z8JB 1C4V2 4OS1A 5ESBA 4BXWA 3UPEA 3RXEA 1KXDA 1CBWC 1V2RT 1XUGA 1BMAA 2P3UB 1HGTH 2ZU4A 1W8BH 1G3EA 1YCPK 5G4BA