4IS6B

Crystal structure of hla-dr4 bound to gp100 peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
188
structure length
188
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structure-Based Design of Altered MHC Class II-Restricted Peptide Ligands with Heterogeneous Immunogenicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4is6B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4is6B01
4OM0H 5JDSB 4F8TA 4N8VA 3GMPA 4AIXA 4JO3L 3OXSA 5I30H 3MRMB 1CT8A 3GKWH 4JFQA 4LLDB 1LNUB 4OCWH 4M6OL 2PXYA 5GRVL 1M05A 3OAUL 3SDYL 1HHHB 3FT3B 3LPGA 1LP9E 4BYHA 2H2PD 3GSNH 1UYWL 3RWEB 4OT1H 4KTEL 4HWEL 1LEKA 3CDCA 5MEPA 2N7BA 3TYFB 1HKFA 4KROB 1NAKL 4NN6B 4LCWA 3PL6B 1J11A 1CE6A 1CTOA 2UUDH 3CH1B 3IDMB 1JZ5A 3SDDA 1XGYH 1CGUA 2MKLC 2ICES 4L3EE 1H3VA 2JJUA 1NCCH 5I74C 5F1KC 5GZOC 1IC5H 3UJTL 4NPYB 3O4LE 5DTFB 4P4RA 1BJMA 4OFKA 2NY0D 1JN6B 2YN3A 4TSCH 4PJCF 1MOEA 3K46A 1J0IA 5T1KB 3DHJA 4CMHB 2FX8H 1LO2H 1CD0A 4L8CB 2V2TA 4HWBL 1KNOA 4Y16B 2HH0L 1QHOA 3QHZL 5I18L 3QUML 3B4NA 3DO3A 4JRYE 3RWJA 3GSQB 1ZE3C 1QKZL 2BRRL 3VD4A 3TN0C 5BW7A 2Z8WC 4LIQH 1I1AB 2CRYA 4QRPE 1CDGA 4PJ9B 3KPLA 4QHUB 4KK8D 1UJ3A 1EH9A 1W72H 4MWFB 2VMFA 3D18B 5SWSE 4LMQI 4XNYH 2R9HC 5L6YL 3VWKD 4J3WA 3T8XA 3K4DA 1L9NA 4JB9H 4YBQD 4YHMH 5I16B 1CGSH 5TQ0L 3F58H 2OX5A 2MQCA 5IBUB 4M7ZC 1KLGA 2R4RL 4XRCB 5FCSH 2HKFH 3NGBC 1BVZA 3ZTJH 4NHCL 3JBG7 1P4LB 2YA2A 3SJVB 2W9DL 4L8SA 4KRNA 4QF1B 5F9OH 3F65A 4HAFA 2XFXA 2JCCB 1JRHI 3HUJB 3U46A 1G9EA 3PGCA 3MXVL 4NQSB 2CLVA 1QNZL 1I85C 1JWMB 3CLEH 1VKXB 4N0UA 4KMLB 4L3ED 2JJSC 5EU5A 3RIAK 2LAAA 3NTCH 3VFWA 1F58L 1I3UA 3KGRA 4ORGA 1ZV5A 1YJDH 1YPZA 3AU1A 1BZQK 4J8RA 3I9GL 3O9WD 4JQVC 3O4LD 3HN3A 1T66D 4S1DD 1D5XB 1KN4L 1ACZA 3U36B 5CD5C 1F4AA 1FDLH 1SJEA 3SKOA 4EBQL 4ODVH 2V5MA 4PJDA 5KVGL 2OZ4L 1OY3B 4APQB 4U1HA 2G5RA 4MCZA 4AT6A 2X1WL 2WQ8A 3SKMB 4P2QA 4GBXC 4JRYD 1U6AH 3L7EA 4Y4HB 4DVRH 3V52L 5JXAH 2BY2A 3REVA 2DLTA 4YHPB 5JXEC 4LGSB 4OCMC 5ALBH 4YQXH 3G04A 4QRPD 2EYSB 3QXTA 3VFOB 5JW4M 2L4OA 4IRSC 5SWSD 2Z31C 3FKUS 5DVLA 4PLKC 5CSBA 2NY7H 4ZNEA 1KIQA 2JE8A 3U4BH 1QO3A 1NBZA 5KSAA 1IKNC 4F57H 5J9PA 1KEMH 4O58L 3E8UL 3D5OF 3WKNA 4OCYL 3MUJA 3S35L 3X14B 5IOPB 3DRQB 3JTTB 5D5MF 3HZVB 1YEKH 2P24A 1IC7L 3VXTB 1QSFB 2C3XA 5DJZB 4JHBA 1OD9A 2XY2A 4JQIH 1MQKH 3ROLA 5EO1B 4MA1B 2OMNA 4XWGL 1WLHA 4FQPA 1BQHG 4R6UA 4JHZA 5TDOA 1YN7A 4TRPH 5I15H 5A16B 1TQBB 1YEEL 4GRWB 4QRTA 2DQEH 4ZXBD 3SO5A 4I0PD 2V7NB 3NIGE 1MY5A 3MGOA 3QRFM 4G3YL 3BGMA 2BVPB 3QNZA 3RVUD 1SMAA 1A4KB 1AQDB 3P0YL 5DZNA 1QFWM 3OJDA 3HPLB 4X7SH 3V6FA 4G8IB 4KZDL 1JPFA 4S1SH 5JNYA 4YHOH 3MLYL 4PR5B 5D1XA 4RGMC 1SQ2N 2CIKB 1DN0A 5ENWA 4PRPE 1S7QB 2VTFA 4ODXB 4X6DE 4NT6A 1RU9L 1MVUA 1U95B 1HHJB 5I19L 5JR1H 1IQDB 5ESQB 1WQVT 5D6DA 4I18C 2YR3A 2XXCB 1C5BL 1MLCB 1OTUC 3OJMB 5GGQH 4Z7VA 1Q9WB 3HNSL 5EC1A 2QQNH 4PB9H 5FEBA 4HIIB 3V5KA 2XN9A 2VISB 2EXYD 3NA9H 2XTJC 2I27N 4DZBA 3PV6B 3RPIA 5I8OL 3M45A 2XXMB 1NEZB 5BRZA 1VERA 3RAJL 5C0DB 5HHQB 3U30B 2ILLA 2G75A 3MRQB 4G6FB 2CUIA 1HE7A 5F7LB 4AMKL 5IVXF 1AQKH 4EI5A 4UZGA 4PYHA 2FO4A 3DJ9A 4N0UE 3N9GH 4YHIA 3LN5B 5TDPB 3RVTD 2A0LC 3T0EA 1KB9K 5JTWA 1JMZA 3L3OA 2F53B 3DUSB 4LSQL 3O2VH 1NBVH 1MCPH 4O02L 4UBDD 4DAGL 2NW2B 5HYSG 3ARDD 3UPAA 3DURB 1KJ3H 5DGQA 3VJ6B 5HVHB 5EUKA 4UT6H 4R3SB 4BZ2H 4PJDE 3OQ3B 4I77L 5AD0A 1HN1A 3W9EB 4UTAH 3OGOE 1I8LC 4PJGE 4NUJA 5I1LB 4P2QE 2D7TL 5DDHB 2BFVH 1J87A 4TNWK 2WINA 2X5PA 2AQ3A 4PBWD 4D0BB 5KN5A 4IMKC 1B6DA 1JI1A 2VLKB 4C56A 5T5NF 3P4OB 4P9MH 4LEOA 2F58L 2YD6A 3EFDL 5K9OB 4DVBA 4YHKL 4DUWA 5DI8B 4ZNEE 5FFLA 1T1ZB 3D69B 1BIIB 1OM3L 1O0VA 2EDXA 1PYWB 3FJTA 5ICXA 5IJVB 3U0WH 1G6RH 4GG8A 5HYQB 1CK0H 2VIRB 2W92A 3FMGL 4JN2B 1RJYB 4LPTA 4U6VH 2A9MH 2HLFD 2ZP0T 1W8OA 5MENE 4XBEL 1EHXA 3TIEB 4N8CH 1EFXA 1MIEH 1LEGA 1TJIL 3H9ZA 4J3XA 5DEFB 3W11C 5CHNB 4ZTOH 3MO1A 1OARH 2NXZB 5E2UL 3RUGF 4Q97A 2B39A 3B2VL 4IRJB 4U05A 2FEEL 3S5LG 2Q20A 1JF5A 1A7RH 3BPOB 2VQ1B 1KIPB 5GIRA 5JQ6L 3VWJB 1KPVA 4Z6AT 5C09B 4HJGA 3NBNA 4NQCA 3ZTNH 1DUZA 1MFEH 4H25A 4NO0B 1N26A 3D85D 5CLWA 1M4KA 4KHXH 4KVCH 4ZQKB 5FECA 2GT9A 1CFVH 1BWWA 5E00A 4Z7WB 5FGBA 5SX4I 1T5WB 1MFNA 2R1YA 2GY7B 3MJ9L 4N1CA 3UPRB 4RWHA 4MJ5B 2J2ZA 3IAQA 1RJZB 2Z4QB 3PG2A 3MRBA 3QXWA 3W0WB 1QLRA 5E70A 1NBYA 5BVJB 4FQQA 3CMOL 4JGJA 4N5UA 2CDGB 2V2WB 3F6IA 4HIXL 2FYYB 2XQYK 1K5NA 5CJQL 1HCFX 3QZWB 4L9LB 4PUBH 2VZOA 4PJHE 4Z7VE 3TBSB 5JPNA 3RFZC 4P2QD 4JR9H 1G7IA 3ESUF 4NZRL 5HGDA 5EWIH 1BD2E 4JFEA 4M48L 1WBZB 2VLRA 1NGZA 4GO6B 3B9DA 5IMOB 5BXFA 2PETA 3K7UA 4KKBC 3V6OA 2XN9E 4GRLC 5DUML 1K9TA 2XWJB 4XNQA 2BXZA 5DJ8B 5IBLC 3IKCB 3MBEB 1INDL 3QIBB 5E99L 12E8L 5BRZE 4Q9RL 5IB1B 2YC1A 5KSAD 1ITBB 4DQOH 5BZDB 1ND0A 3MJ6A 4YXHH 4WIQA 5TE7L 2QQLH 4Y2DA 2GSIA 4YDLB 1UWGH 4F9PA 5MEND 4I0KA 1MHCB 4N0FB 5FYLE 2Z8RA 3VD3A 1A6AB 3T0EE 1OHQA 3LQZB 4FQHB 4IEFB 1MF2L 4U1SB 2ORBH 4NN7B 4Y5YB 1U8OB 4JFPB 3T0VA 4X7TB 3WE6A 2AV7A 2EICA 1Z5LB 2LAGB 4HKXA 3CPLB 3BP7A 2EH8L 2FB4L 4QYOA 3L3DB 5CJBA 5ITBL 3VXPA 4S10A 2BCKA 3FO2A 4I48A 3N0PB 3QEHB 3VFGL 5C0JB 1MCWW 5C9JB 4JO3H 2ED9A 4DJMA 4HH9B 1FL6A 2JB5H 3LQAH 4OIIL 1GGTA 2NW3A 1NKRA 1OWRM 2HKHL 3NFNB 3OHXB 4M6OH 2DWDA 2BNRE 1FHGA 3HZYB 1SEQL 3QEGL 3OAUH 1BBJA 3SDYH 2W07A 1O7SA 5GRVK 4FN0A 1FFRA 3BKML 4QRQA 2B1AL 3TZVC 4C56E 1N5YL 5FM5M 4QHNA 4Q9QL 4KTEH 4HWEH 1I1RA 1NAKH 2BVQA 2NXYB 1I3GL 3WFHB 2UWEA 5MEOA 3LMJL 4F37K 1JPTL 4HC1A 3TEUA 5IHUL 2Q7NA 1DCLA 1Q9LA 1BD2D 1KJ2A 1L6XA 1RZKH 4FQ1L 3UAJC 3O6KL 4KUZL 1TNNA 3BDYL 1Q94B 4JDZA 5F89A 5CP7A 1CICA 1A1MB 2XN9D 2D4DA 2ADJA 2K9UA 1U0QA 1YNLL 1EMTL 3QG6B 3P4MA 4X8XA 1YY9D 2GITB 3WSQL 4UDUB 5GGRB 4Q6IA 5BRZD 3HPJB 4HWBH 4F7EB 3FT2B 4XP9L 4ESKA 3QHZH 5JDSA 4NM8L 2DD8L 5E2VL 2BRRH 3KPOA 2GJ6B 4P23B 4AEEA 2UY6A 4NQCE 1FE8H 3N06B 3MRMA 5FYLD 5HI5C 1JHTA 2GEEA 5T5NG 4JHWL 4LLDA 1LNUA 3T0ED 4XNZB 4DW2H 4NKDB 3ULUE 5FHAL 4M4PA 2ATKB 2YK1H 1HHHA 4R2GC 1ZLSH 2A1WL 4K71B 3RWEA 4MHHI 2IFFL 3QXAB 1SEBB 2WBJD 3TYFA 5E08H 5L6YH 2DTSA 4PJXA 1XCTB 3ZE0F 5FOBB 5IEHB 3CH1A 4HAGA 4NQXB 4J3SA 5I1DB 5TQ0H 1A8JH 4HUKB 2HP4A 5AG9A 4G43B 3MUHL 1MVFA 4XBGB 2P8LB 4JFEE 4NPYA 3RZWA 2VLRE 5D7KD 5DTFA 5JMOC 4YBHA 4NHCH 5FKAB 1NDGB 3IETA 3V6OE 1JN6A 3MFGB 3CD4A 5T1DL 4C56D 4XNMB 1YNKL 2HG5B 4IMLB 4TUKH 5T1KA 5IMKA 4ZO8A 4HS8L 4LASH 5KSVB 3MXVH 4Y16A 1QNZH 3MA9L 1WC7B 4L1DA 3HCVB 5KANG 1JPSH 1X44A 3QIWB 4M7KL 1F58H 3U9UA 2HTKC 3Q3GB 1I1AA 1RK1A 4U1GC 2EIDA 2ATPB 3I9GH 3HC0A 1FSKB 5JORA 4QHUA 5DHXB 3RZCB 3BI9X 4MWFA 2VKWA 1KN4H 2UVFA 3D18A 4JY6B 4EBQH 3Q0HA 4NJAL 4JRXB 4KKAD 1GCFA 2OZ4H 1B2WL 3SO3B 1CDYA 1T1YA 3VXUA 2PO6B 3V52H 5IF0A 2DMKA 4NZUL 5ICYB 1CDIA 4NQCD 2IC2A 4XRCA 4Y2OA 4GSDL 3T1WA 3QO0A 3ULUD 3VGBA 1MCIA 1MCJA 1QYGL 4ZS7L 1G7LB 4QF1A 3V95A 3WFEH 3E0GA 3LPFA 2E3VA 2JCCA 2DL9A 4LMQE 4JKMA 5FYJE 1GZPB 1H0DB 4NQSA 4DUXA 3LKPA 4O58H 3E8UH 1VKXA 1JWMA 4LF3B 4WI7A 2UWEE 3BN9C 3ELAT 5I71C 1NCDL 1FCGA 4NP4H 3OB0H 4P5KB 2VXVL 2AEPL 5DVMA 1PZ5B 4JFED 2VLRD 4XPHH 1D5XA 5CGMA 2WUBH 5E4EB 1MHEB 4XWGH 3U36A 3O11B 3ARGB 3X11B 4R4BB 3T0XA 2DYPB 4LHQB 2HAZA 3E6FB 3ZYJA 1LO0L 3KHOA 3MRKB 3RL1B 4FQIH 4G3YH 3U7YL 4Y4KB 2LU3A 1UZ8A 3A0OA 3SKMA 3BZ4B 1DEEA 3ME0A 4Y4HA 3O45B 2OYPA 2CH8A 4WW2B 4ELMB 4WUUA 4KZDH 4KDTA 1NSNL 4I2XE 4M1CC 3MLYH 1AHWB 3IXTB 3ZE1F 3THMH 4ZO7A 3L5IA 4PGDB 1C1EH 1ZLVH 3WLWC 2Y07L 3P11H 1RU9H 3BKJL 1ZA6B 4XMLL 5EZLB 5I19H 3UTSB 4MJ6B 1ZLVK 3ALPA 2DLGA 2F9BT 4L3CB 1FNLA 1C5BH 4PJXE 4NQTA 4NKOB 3X14A 4FG6D 1IM9A 5A40E 5IOPA 3MLTB 1OSPL 5IHLB 3JTTA 1YN6B 3HZVA 1H3WM 1OWWA 3HKFA 4GAYB 1FAKT 4LAQL 4XCFL 4GT7A 3MLUL 4HS6A 5F9WC 1QSFA 1KSRA 4OQ1A 5EO1A 1GJIA 3FTGB 1U93B 2NY6C 2VDOH 1P6FA 3NCJH 5ECJE 4JQXA 4LSPL 1KCUL 3QUZC 3E3QC 3RAJH 2KQNA 1S9XB 5FYJD 4EUPH 2V7NA 1B4JH 2ZUQC 3I6GB 2BVPA 4AMKH 4YEFA 1A4KA 1CCZA 1F13A 5AYQA 1P4BH 1A1OA 1FH5L 1CBVL 1KIRB 4Z7QF 5F96L 2Z35B 4KVNL 2NCMA 4G8IA 4DOHB 1TCRA 5DR5L 4P2CG 3GSVB 4LSQH 4B53A 4PR5A 2I60L 3TO4A 4O02H 4V2CB 4DAGH 4ODXA 1IBGL 3TCXA 1HHJA 2JLLA 3F8UB 4Y5VC 4WFHE 5ESQA 5LKNA 3P9LA 1QG3A 4I77H 1MLCA 4U31A 3S7GA 3N50A 1Q9WA 3C08L 2CDFA 1U42A 3VXUE 2D7TH 4FQ2L 4XB8A 3TYGL 4HIIA 2C4FT 3MUZ1 3UYOD 1IEAA 5GZNC 5GPRA 4PY8I 1EHNA 2E7LA 4JFDB 4LEXL 1DBMH 1YEGL 3PV6A 5IKCB 4OM1L 1XGRB 2UZIL 1CI5A 3WFCH 2F58H 3EFDH 3ARRA 1NEZA 4JVPA 4YHKH 1MCKA 5KAQF 1FJ1B 4NWUL 5IQ7L 5C0DA 1UB5B 5HHQA 4LDEB 1OM3H 1FC1A 2V5SA 4XHJC 2BSED 2YD4A 1XT5A 3DGGB 4L8BB 5MERB 5A1AA 3FMGH 3P77B 1PAMA 1Q8MA 5TDPA 4HWNA 4XBEH 1U8HA 5IESL 4F80A 1A7NL 3IFOB 2VAAB 1TJIH 4NQDB 3G6DH 2G5BA 3TO2B 1WBXB 1WBYB 4HCRL 3V5DB 3BIAX 3Q5OA 3KR3H 4NBYB 1MJ8L 1PQZB 1VA9A 5DK2B 3DURA 3JV4A 2X9WA 3VJ6A 1ZHLB 2LQRA 4LL9A 3GK8L 4R3SA 5AEAA 3BIKA 3QULB 5EB9A 5JQ6H 2R1XB 4R26L 5E9DB 3U7AA 4BZ1H 4YFLI 5I1LA 1IKFL 3AREC 1CR9L 5DDHA 1E0OB 4WWID 4M02A 1WZKA 3F12A 4D0BA 1RJLB 4WUUE 1I1AD 3VMPA 1TTUA 2O5YL 2BVOB 2VLKA 3MJ9H 3UXFA 3P4OA 1MWAL 4BFGA 1WFNA 4NNYB 1X5GA 1QR4A 4WFHD 3V4PL 5TJWK 5DI8A 2DJSA 1BQHB 3RHWK 3SGKC 2ICEA 3CMOH 4GAFB 1PYWA 4HIXH 4L4TB 1DFBL 3U79A 4FFYL 5CJQH 1CFSB 3VXUD 1R5IB 4ZODA 1RJYA 4NZRH 1P9MA 5CEZE 1QSEB 5FOJA 1K2DB 4M48H 3TIEA 1Q72H 2R2EA 5DEFA 3DOSA 5L9DL 2AAVA 5DUMH 3D0VB 2XYCA 4XCYB 3IDIB 1FL5B 3VXSB 3DV4A 1LEIB 1INDH 3QA3A 4HKZB 4IRJA 5C0AA 5E99H 12E8H 3SKJH 3DROA 3UTQB 2VWEE 5EIIB 1H5BB 2VQ1A 1IFHL 1CXIA 4OFYA 4P46B 3VWJA 2QLVB 3FZUD 4I4WA 3WDHA 5TE7H 4NO0A 3ALXA 4KTDL 2VO5A 4LSSL 4B41A 2BHYA 3DX8B 4Z7WA 5C07B 4HUVB 4QHMB 5I0DA 3T4YB 1MJUL 3EYUH 3FQXB 1C8PA 1T7YA 3GSXB 1MF2H 1SVCP 3CU1A 1JBJA 1DQQB 2P4AB 4MJ5A 1RJZA 2Z4QA 1DLHB 5GGVL 3W0WA 3H6JA 3A6CL 5D2LA 1AGDA 3BSZL 5DZLA 1Y6KR 2XV6B 3SGDH 5BVJA 1LK2A 2EH8H 2FB4H 3A6BH 5ITBH 1N0XL 2CDGA 2V2WA 2IMNA 3BDXA 4F8QA 3SDXE 4OD1L 3VFGH 4OCSH 4YBLC 4ONFL 3MCLL 4OIIH 1WBZA 2VABB 2HKHH 3C09C 4LP5A 5IMOA 2EDBA 4WUUD 3GSNB 1RUAL 1SEQH 3QNXB 4H8WL 4LSVL 2XICA 4ZAKC 1CFBA 2CSPA 2B1AH 4HGKC 5HVGB 3QIBA 2X89A 1ZMYA 5KG9B 3FO9B 3MCG1 1PKQB 1I3GH 2NY2C 3MC0A 4JHAH 4JG0L 5BZDA 2EO1A 1P2CB 4JO4L 3PWVA 3BVNB 1IM9D 1RUMH 1JPTH 5CP3A 5CEZD 4D9LL 5IHUH 1JL8A 5I76B 3NA4A 4KRLB 4N0FA 4KUZH 4PG2A 4ELKB 5B39G 3BDYH 3WLBA 1A6AA 3VE0A 3VFPA 3LQZA 2DM7A 2CO7B 2HYMA 2Y4SA 4U1SA 4AM0B 1YNLH 3WXWL 1EMTH 1YUHB 4JFPA 1TVBB 2D0GA 1H3GA 5D7IF 5CGYD 3IDNB 3WSQH 3DMMC 3VI3F 3T3PF 1Z5LA 1DBBL 1Y0LB 3RDTA 3CPLA 4PJEF 2IAMB 3L3DA 1R3LB 1S9WB 1X5KA 2FLBT 4MCYB 4RAUA 3QEHA 2DD8H 5C0JA 5F7DB 5E2VH 2Z92A 4HH9A 2V9QA 4PRBB 4YZFF 3CSBA 1W72B 2XKSA 1TNMA 1QEWB 3G6JB 3NFNA 1JHKH 3D3VE 2VL4A 3HZYA 5C0ND 3P0VL 1J10A 1BVLB 2GI7A 5FHAH 5DJXB 1P7HL 5KAQG 2XT1B 2C1PB 3RWHB 2VUYA 3EGSB 3TO4D 2I9LA 4W4OC 3TH3T 5SV4A 5BMFH 5HYJB 2IFFH 3WDJA 1T2QL 4LRIC 3WHXA 4L4VE 3S3JA 4V1DB 1ZTXL 3ZDYE 3IFPB 5KSBF 3K4ZA 5HHXH 3PWUB 4P4KA 3WFHA 1IARB 5E94A 2VERN 1G0XA 4YDKL 3ULVL 3MLSL 1B9ZA 5L8JB 4P49A 3CX5J 5GGSB 4MNGB 2Q3AA 3W39B 4HK3N 1A7BA 1D5MB 1INQB 1Q94A 3RX8A 3WBDA 1NFDE 3WKML 1OF2B 4S1RH 3WHE1 3LEXB 4GMTL 5EZIL 4Q74A 1NCNA 4RMSA 3I75A 4KGLA 3ZKXB 5K9KB 1EFQA 3QG6A 1YNKH 4NJ9L 4H8WC 3SDAA 1JGDA 3CFEB 4UDUA 5GGRA 3ARQA 2AI0H 1DL7L 3LKNB 3HPJA 4HS8H 5C0AE 1CS6A 3QUYB 3RX5A 4F7EA 3MA9H 1JZ7A 1G84A 2OMBA 4PLJC 1URLA 2PKDA 2RBLA 2OM5A 2AEWA 2CR3A 1BFVH 2J8UF 2IANE 3UO1L 4P23A 4HPOL 4QXGH 3BUYB 2HVJA 1IQWL 4LLYB 3I6LE 5B3NA 1MIML 4XCNB 2FEDD 4Z7WE 2WAHA 5J12B 4OLWL 2BZDA 1UCTA 5E2TH 4X4MA 2VE6B 3CIQA 3QXAA 4NJAH 4YDIL 3S35X 3HG1B 4YK4C 1B2WH 1XCTA 3W0WE 5D2LE 5IEHA 3HE7C 4F7TB 3OKNB 3TLRA 3DVNB 4NZUH 5C3TA 4RRPG 3WIIL 4M1DL 1JZ8A 4GXUN 5HI4C 4XBGA 2P8LA 1MJJB 5L0QB 3D3VD 4GSDH 2DQHL 3FN9A 1JGLH 5FKAA 1HXMA 4ZUWB 5CMAA 1KCSL 1CU4L 1QYGH 4CBPA 4F9LA 1G1YA 2VLKD 4XNMA 3CFCH 5E5UB 5FCUL 3ZDZF 3LPWA 1BEYL 1D6VH 2HG5A 1T0NB 5T1MB 3JSSA 5L8LB 5DS8A 1GXEA 1JGUL 2J88H 4XP1L 2X4SB 4QY8B 3VGAC 1EEYB 3IAPA 5F88B 5DO2C 5C0EB 3HCVA 1DBJH 4ODTL 4U1MB 1RSFA 4FFVD 1K85A 3ULVC 4PJAE 1DANT 2CLRB 2VXVH 3Q3GA 2AEPH 1JZ4A 5DC9B 4ZUVB 4LOUC 3HAEG 1JF1B 2NLJA 4ODSL 5T3ZD 1JNLL 5MP6L 3ZKQD 4WO4C 1T03L 5DURD 3UEZA 1I9RL 2BK8A 2NXZD 1NAMA 4JRXA 1E6JL 3V5HB 3VRIB 4IRJD 1WEJH 5C0AD 4XP6H 4GLRI 1OAUL 3U7YH 1U9KA 3KPTA 4HQQL 1XIWB 3C5ZC 5FDWB 5IW1B 3GIZL 3CU7A 3VWJD 4OFYD 2WP3T 4JFYA 5ICYA 5B38B 1FGNH 4NO0D 5HY9A 3QAZC 1NSNH 1RZ8B 3I6LD 2CLZB 1EDQA 2Y07H 2ENYA 4OZHF 1QPPA 1BJ1J 1KTLB 1FVDB 1G7LA 3BKJH 4XMLH 4M1GL 4LHUG 4QRRB 2H2SC 4JFXB 1FO0A 4NN5B 4HXBH 4LQ1A 1GZPA 3L7FB 5HTSA 3W0WD 1H0DA 3P4LA 4XVTL 4LF3A 1OSPH 2X4PA 2F5AL 1ADQL 5IWLA 3MRGB 3C5SA 2PYEA 1C08B 4ZDHB 3PWNB 4RAHA 4N68A 3TBWB 2YEZB 4XCFH 4OI9A 3IDYB 3MLUH 4P5KA 5I9QC 1PZ5A 3OBAA 3BGAA 1WZLA 3CSGA 4XH2B 5AZEH 5I1CL 3KPSA 3PGDB 4O2FA 2DQCL 4K3EL 1KB5L 3EIFA 1RHHB 2QQQA 4LGRB 2W91A 4R4BA 5E6IB 3X11A 2DYPA 4JM2B 4Y88A 3C2SA 3BIBX 3WNOA 5DHVH 3X12A 2DWEB 5D72H 4GW5B 4XBPB 2W0FA 3MRKA 3RL1A 1MHPH 3HI6L 4NBXB 3OG4B 5J06A 1F4WL 1S7VB 4LU5L 5ITFA 5KVDL 3O45A 5F96H 4HIJB 1M7IB 1DSFL 1MSPA 5DR5H 1RD6A 1AHWA 2JK5B 3IXTA 4BFIA 2I60H 3FOMB 1IAIL 4KI5E 2DBJA 3ILQD 3UTSA 4MJ6A 2X09A 4X4ME 3BKYL 1V05A 4M43H 4RWYL 3BFOA 2Y9RT 3RDTD 4NKOA 2JTDA 3MLTA 1WWCA 2YN5A 4U6XA 4U6HB 3C08H 4LK4A 3KPQA 4GAYA 4FQ2H 3G08B 4AJ0A 4JLRA 3TYGH 3SCMC 5GS2H 1DVFB 2VYRE 2XRAL 4J6RH 4XCEB 1XGPB 5LCVL 3T0WA 4LEXH 1YEGH 3FTGA 1U93A 1D5BA 4OM1H 2KUTA 2DQIL 2K3TA 4HMCA 1VPOH 2AJUL 5DRWB 4YPJA 1S7XB 5E5MB 4PJ8B 4NWUH 5IQ7H 1S9XA 4J7RA 4XMKL 3I6GA 2AJSH 4P4KD 5LXGH 1KIRA 2YZ1A 4GXVL 2PN5A 5FYKH 5BO1L 3CXDL 4XNXL 1JNHA 1ZHNB 5F3BB 1HDMB 5CLTA 1OAYL 5IESH 4GW1B 3GSVA 5DJCB 1OQXA 3WJLC 4HCRH 1HOCA 2CKBL 1RAMA 1MJ8H 4OFPA 5E4IA 3VG0L 3EOYG 4DEPC 4MD4A 1OAZL 3PXJA 3GK8H 3SDAD 2MSPA 5E0QA 4Y7MA 4G6MH 2WLZA 5HI3C 5MEQB 3MV01 1YPZF 4KHTH 4R26H 2D7MA 4K8RD 5CBEA 3ZSSA 1IKFH 1CR9H 5TGBB 2HWZL 1A7PL 1JGVL 1CG9B 3S8WA 4WTXA 2IEPA 1GZQB 4NBZB 4KKCC 5I66A 1TXKA 1YYMH 2K7PA 4JFDA 2NX5B 2O5YH 3N85H 2VL5B 4KI5D 4P5TD 4OD2B 1XGRA 4RA3A 1MWAH 1CGXA 5DVOA 3MLZL 1FJ1A 4ODWB 1A0QH 1OTTC 3JWNC 5I74B 1HKLL 4J4PA 5GSRA 5LGHH 5MI0C 1DFBH 5F70A 3DGGA 4KH2A 4L8BA 3F7VB 5MHSE 4Z7UB 2R15A 2PYEE 5GISL 5D96C 4CAGA 43CAA 3X3FL 4I5BB 2XPGB 4GOSA 2VAAA 3DARA 4POZC 3AM8A 3BESR 4NQDA 15C8H 3KPSE 4IOFD 1WBXA 3FHQA 3V5DA 2CJUH 2I26N 1PQZA 3VI4F 3RU8H 5EU7C 4N0CD 2DIBA 3TN0B 4I3SL 4MSWA 1VENA 4PBXA 2FBOJ 1RUPL 1KXTB 1OTSD 1OAKL 4MXQC 3WFDH 2R1XA 3DETD 3FCTB 3RVVC 4R9HA 3T77B 1KENL 3HI1B 3JXAA 3AY4C 4TSAL 4PB0L 4NCDA 4LP4A 4PY7B 4KTDH 5AZ2H 1MI5B 4MNQE 5KANI 3QCTL 4JZNB 4FMKA 1E4XI 2OR9H 3IU4L 2D03L 4FXKB 1MJUH 4HUMB 1NGYB 2BVOA 2W9EL 2BVUA 4N8VG 4XXDB 4CN4A 3OAZH 4NNYA 4PJIB 5GGVH 1AR1C 3A6CH 1BQHA 5IJKA 3BSZH 3ZKSD 2DI9A 3OAZK 4M7ZB 2R0LH 4DGYL 1N0XH 4L4TA 3PIQB 3NGBB 4OD1H 4N90E 3OKEB 4FZ8L 1R5IA 4JG1H 1A47A 1QSEA 4ZS6D 3V4UH 3MCLH 2OTPA 4YNYB 1FZMA 1K2DA 4OBRA 1ETZB 4GKOA 4G6AC 1DEDA 1HWHB 1GGCL 1RUAH 5IROC 3D0VA 5ILTL 4H8WH 4LSVH 3L3HA 5HHNB 1LEIA 4EN3B 3GJFA 4Z5RB 1KACB 2DDQL 4HKZA 1OW0A 3WN5C 3UTQA 2IG2L 2Q7YB 1H5BA 3TVMC 1LE5B 5CEXB 4P46A 4JO4H 4U1LB 5GGTL 1VEOA 5MHSD 1XR9B 3ZHLA 1EZVY 3NPZB 1KTKE 1ZHKA 2PYED 1I7RB 2FIKB 3NZ8B 3RI5F 1E4KA 1I1FB 1JNNL 3DX8A 1U41A 4QHMA 4HUVA 3T4YA 4GRMB 3FQXA 3KPSD 1AKJB 3GSXA 3KDMB 1DQQA 4GBXB 2NNAB 1DLHA 2DYPD 3QUMB 1DBBH 5HGGS 5C0RH 3MREA 4YDJB 4MAUH 4GKSB 1FVEB 4Z78B 1SBSL 3M1BA 4IRSB 5E1HB 2Z31B 2HJKB 4MNQD 2VABA 4OTXL 4Y4FC 3B9KC 2CUHA 4FQXC 4E0RA 3GSNA 4KU1A 4WEUD 3RP1A 5IW6B 1U91B 2HMID 2FECI 3O3DB 3BHBA 1T2QH 5D2NC 5KG9A 3FO9A 4LPWA 1ZTXH 1BM3L 4B0MM 5HYSA 4Y89A 1PKQA 2VXSL 1MCBA 2ENSA 4H5SB 1P2CA 4YDKH 3ULVH 3MLSH 3BVNA 4N90D 1IAKB 5HJ3B 5I76A 1WGOA 1H3TA 25C8H 4GAJL 5EA0L 5C0IB 4TVPD 5GRUH 3S36L 4ELKA 3STLB 3BPLC 5TFSL 4CW1A 1YUHA 1PZUB 1TVBA 4NJ9H 3IDNA 4WHYH 1I8IA 1DL7H 5TE6L 4DKAA 2L7UA 5K59E 3ZT6A 4PGBB 5EDXA 1FIEA 1S9WA 3SGEH 5ETUA 5CSGA 4MCYA 1S7UA 4RGMB 2EDQA 2DJUA 3CFDB 4OZIB 3KPPA 3SKNA 3ZKND 2H2PC 1HH6B 4BSJA 4HPOH 1K4CA 4ZSOE 4NFDA 1IQWH 1QEWA 3G6JA 1OSZA 3K81A 4I18B 3I3DA 1LGVA 4X6CE 1BVLA 4PG9B 3PDDA 5DJXA 5HHPB 4OLWH 1NC4B 3RWHA 3EGSA 4BUGA 3BPNC 3QCVL 5HYJA 1BJ8A 4YDIH 1SYVB 1A6VL 4XB7A 1N59B 3B6SA 1WZ1L 3IFPA 4LVHC 3A6OA 5BVPL 4R7DB 3S5LA 2NY0C 2XTJB 4HGWB 4U6YB 5GGSA 4MNGA 4WFFE 3NCCB 4EKXA 3WIIH 1I4FB 1ONQA 1D5MA 1HYRC 1TMCB 3LQMA 1OF2A 4LCUB 2DQHH 4FQLL 1WAAF 4UT9L 1KCSH 1CU4H 1T80A 2AJXL 1C12A 5FCUH 4EXKA 3TF7C 3CX5K 1BEYH 1BHGA 3CFEA 3EW3B 2VH5L 3LKNA 4FQJH 1JGUH 3QUYA 4G9FE 4LCYB 4XP1H 3MRDA 4MNHB 4KK8C 2CRZA 3EOTL 1U8MB 4ODTH 1T3FB 1ULVA 1AP2B 1EV2E 1AGCB 4ZG1A 1YEHL 1IGJB 3BUYA 3EOBB 3VWKC 5JHDA 1I75A 4LLYA 3CXHJ 4XCNA 2QQKL 4ODSH 1J1XH 1JNLH 4YBQC 1CWVA 2EE9A 1KBGL 1T03H 1I9RH 3GMLB 3MV8B 2VQTA 4PJCE 3K2UL 3HG1A 2DBLL 4X8JB 4OZGB 1L7TH 1E6JH 2BHZA 4NKMB 4KJWD 1KG0A 2KPNA 3GMMA 1RULL 3R8BB 4HQQH 4OF3A 4F7TA 3OJVC 4RDQF 3IRPX 3GIZH 4NQVB 5GS0D 2NMSA 3DVNA 4JVWA 4OKVA 5IVNA 1XF5B 3FQUA 5C0BE 1UM4L 2W65B 1G9ML 3AB0C 4P2OD 5GRJL 2GCYB 5CEYB 5CAYB 2OS7A 1R3JA 1RHFA 1MJJA 2EE6A 3FQRA 1CD8A 4ODHL 3VFVB 1KFAH 3AC0A 2NTFB 1U58B 2IBBA 3BX7C 2VLJE 1AGBB 4M1GH 3DECA 5FO8A 1T0NA 3WIFB 4RAVB 5T1MA 2W0PA 4PGEA 3MV7E 3O9WC 1I7UB 3HRZB 2X4SA 4QY8A 2ZSWB 4XVTH 3RBSA 2X4NB 4QHLB 3NCYS 3WO3B 1T66C 4S1DC 5F88A 4GAGH 2F5AH 4LPCA 1ADQH 1RVFL 4U1MA 3O2DL 5C0EA 1ZT4B 2VDKL 1XF3B 4WFFD 4A6YH 4DZ8B 3C8KA 2VR9A 2CLRA 5IB5B 1QSED 3IDXL 4ODUB 2RFXB 2ZG3A 1PY9A 2UVEA 1JF1A 2VSDA 2VXUL 4K3EH 2HJFB 4DGIL 3I85A 1KB5H 1BQLL 2OTWB 4EUPB 3GM0A 4PP1D 1MUJB 3GMQB 4PRDA 3OWEA 5FO9B 1X7QB 2E8YA 4XI5D 4WI9A 4G9FD 1AXSB 2DQFB 4HBCL 1MEXL 4X6EB 3VXME 3RRQA 1K8DB 1XCQA 3HI6H 5IGXL 1XIWA 5IVXA 5CKAA 5FDWA 4JE4B 5IW1A 1UH3A 4LU5H 1JF6A 4X9GA 3BW9A 4FZEH 5B38A 3QDGB 2IBZX 3MCKB 3TCLB 1J12A 1RZ8A 4TVSa 4KZEL 2CLZA 3OB8A 4JFZH 1IAIH 2H32B 1E4JA 1KTLA 3TA3A 1KF9B 2OXHA 4G6KL 2QR0B 4QRRA 1WZMA 1BZ9B 4JFXA 2OSLA 3BKYH 1D9KA 3O3BB 1EO8L 5M94B 4XGZA 4LHJB 1ZWIB 1IC4H 1G7HB 1EHLL 1BJ1H 4ERSL 1EJ6A 4AEIL 3CVHL 3JWOC 3V0VA 3MRGA 1C08A 1C5DB 4ZDHA 3PWNA 3PWPB 2X4QB 5C0BD 3MNZA 3VG9C 1LE9B 2XRAH 4I0PC 5C7XL 4WV1C 4XH2A 4KV5F 3PGDA 4N9OB 4O51B 1G9MC 2YRPA 2W0LA 3D25B 3G5YB 2J6EA 1U3JA 5E2JA 2DQIH 2P49B 2VLJD 1RHHA 2E9IA 4GKNA 5E6IA 1UH2A 1MCOL 4PPTA 4JM2A 3RL2B 2E6PA 1AD0A 5HPOA 3X13B 4BQ6A 4GW5A 2YKLL 4XBPA 3MV7D 4BKLA 1P7KA 3ES6B 1R0AL 4JFFB 3QXUA 4GXVH 4C58B 5IFHL 5BO1H 4CUCA 4XNXH 5D5ME 2GAZA 5DK3A 5BOPA 5C0CA 3DWTA 1M7IA 4N5ED 4OGXL 1VDGA 2LU7A 1OAYH 3Q48A 1FZKB 2VZUA 1FAIH 1ZEAH 2YXFA 2AXFB 2JK5A 1WFOA 4MQTB 5JHDE 2ESVA 4N0RA 4XZUB 3RUGA 3SEPA 2CKBH 2QSTA 4BQ9A 1OAZH 1MELA 2CDEB 3BWUC 3LN9A 2EXYC 1FORL 3VXMD 4OZFH 1OL0A 3RY4A 2BC4B 4M62L 5BS0E 4U6HA 3L5WA 4UOW0 2HWZH 1A7PH 1JGVH 5GS1C 3G08A 1D5ZB 1K3ZA 3TZVB 1DVFA 2A74B 2AW2A 4WHYG 4XCEA 1TPXC 1XGPA 4LLMA 5T1LA 3S6CA 1JV5B 1N3NB 5DRNA 1MFAL 1E6OH 4EZMA 5E6YA 3LEVL 3V6ZB 5DRWA 3MZGB 1S7XA 3V0WL 1G6RA 1OGAE 3B9AA 1JP5A 1A21A 1HKLH 2PNDA 4HIEB 2A73B 1E28B 4PS4L 1UA6H 4UBDC 5DEZA 3WFZA 2SEBB 3ARDC 4G42B 3TJHD 3PWJB 5KS9B 5GISH 1YMME 5JIHA 1Q0YL 1HDMA 3X3FH 4GW1A 3WUWG 2MQ3A 2JCCF 3FRUB 3HUJF 3KPMB 5IB3B 4LPXA 5DJCA 2B4CL 5FF6B 2DQUL 4S2SB 3QXVA 4LFHG 1FFOB 4Q9BA 2FX7H 4RDQG 3WL9B 1NMBL 5EOTB 2ZWLT 2APBA 1FNGB 2MWCA 2R0KH 1XGQA 3ZYIA 3VD9A 1KENH 5TGBA 1UJ3C 2NY5H 3FO0L 4Z0BL 5IVXE 3PXHA 4GUPB 4M5YL 2P5EB 1J9CT 2VUOA 4MZ2A 4PB0H 3I3EA 4R2GB 4Q0XL 1GZQA 4D0CB 3VXNB 4NQEB 4U7MA 3RNQB 5IQ9A 3GSWA 2Z8SA 3QCTH 3R4DA 5CZKA 3IU4H 2D03H 4UOJA 4HZAA 5JHDD 1XAUA 2VL5A 3MPCA 4OD2A 2W9EH 5I0ZA 2ZUVA 1DQML 3LB6D 3H3PH 1H8OA 2HLFC 4ODWA 4MXWH 1CGWA 5EUOB 1JPGB 5D1QD 4QNPF 4UU9B 3KJ4B 4ZD3L 2DS4A 4DGYH 5F7YC 4TQEL 4PJ5B 3T4AB 1VACB 5BS0D 3F7VA 4Z7UA 2E9WA 5DYOB 1V7NL 2BXYA 3BEWB 1HXYA 4TYUA 4YE4H 5IB4A 5I8KL 3MACL 1JWSB 2A6KB 4I5BA 2XPGA 3F7YB 2ADFL 1RK0B 3ILPB 3RGHA 5ILTH 4GW4B 1H3UA 1JIBA 2O61A 1EVUA 1Z0MA 4M61B 4YIQA 4N9GA 6FABL 2XZAH 4ZUUB 2DDQH 1UXSB 2Y36L 2ICWJ 1QHPA 5CKGA 2GJJA 4X9FA 3VXRB 2IG2H 4U1GB 1QBLL 3EYQD 3BN3B 2FSEA 5GGTH 5T3XH 3MOBH 3T77A 2IH3A 1OPGL 4FQCH 1OD7A 5IFAL 2VDQL 1YMMD 1FG2B 4PY7A 3QQ9D 1MI5A 1JNNH 5C0CE 4GRWF 4NUGL 4JZNA 4B7IA 4HUXB 4FXKA 1LK3L 3LS4L 1UWEH 3KXFE 1T2JA 3GGWB 4F3FB 3IF1B 2ESVE 2B4CC 3RUGE 5IIEB 3OKDB 5IMMB 5J57B 1QR1B 4QWWD 1BIHA 1ZGLB 1MH5B 1FLTX 3PIQA 5J6HB 5EO0A 2BNQB 1UVQB 1XIWD 5DFWH 2HRPH 9CGTA 2ED8A 5CILL 1FGVH 4Y19E 1F6LL 1ETZA 3ZKMD 3OSKA 2X40A 3PJSB 2Q87A 4POYA 4WU7A 1J88A 4X9HA 1L0QA 2I07B 1ZLWH 4N0YL 4OIAA 4Z0XB 3S34L 1I85A 5JOFB 2AGJL 2FJGA 5IVZA 4CVXB 4EN3A 5FYLL 4WWKB 5DRZB 2EKJA 1ITCA 5I71B 4WTZA 3TA3D 2JJSA 4M9PA 3SQOH 4IHOA 3O6FD 1BM3H 3ULSB 1D9KD 2VXSH 1QP1A 2X42A 3H9SB 1LE5A 3TT1L 5CEXA 3U1SL 2X4RA 3R06B 5FV2A 1BBDL 3GMOB 3TGXA 4K3DL 1CYGA 1XR9A 1BF2A 4K07A 1I7RA 2FIKA 3PP4H 4GAJH 5EA0H 1I1FA 3S36H 4BELD 2R1WB 3H9YA 3JWDL 4GRMA 1AKJA 2HFEB 5TFSH 5C2BH 5ANME 3JV5A 3KDMA 4HWBA 1T4KA 2NNAA 3SGDI 3SPVA 3VXOB 2LTQC 3U0PB 1N4XL 5E6ID 3BP4A 4JM2D 3D2UB 5TE6H 5JXEA 3KWWB 1ZS8B 5K9JL 2H1PL 3E2HC 1A9BB 4Z78A 4QOKE 2ZCHL 5C71A 4KMQA 1JZ6A 1Q38A 2Z31A 5J89A 2HJKA 1FPTL 3WV0A 4WENB 1EVTC 2MPAL 2XZQH 5C0CD 3H7BB 5JOPE 3KXFD 2V5RA 3QEQE 4JGMA 1U91A 1AGFB 2DICA 5EOQL 5F9DC 5CCKL 3O3DA 1XGTA 2ESVD 3AXLB 3EHBD 4X5WB 1J8HE 5D9SB 3SE8L 5EO9A 3QCVH 5IBUG 3UYPA 2WWKO 2AV1B 3IDJB 3LY6A 5F9WB 3NFSL 5BVPH 2FGWL 3T04D 4D9QE 1AD9B 1IAKA 2J8HA 3CDFA 3RY5A 2NY6B 5HJ3A 4YHLL 5TF1H 4PV9B 4Y19D 1YY9C 1K4DB 5C0IA 1B0WA 4YHZL 2ZCLL 3QUZB 3DRTB 3STLA 1DVFD 1UEMA 5T1LD 4F58H 2ZUQB 4FQLH 2EDRA 3MFFB 4QXWA 4EDWH 2AJXH 3VXQB 3P73A 1CIUA 4QGYA 3MR9B 3ULUL 1FZJB 4PRIB 3WJJC 3T0EC 4P57A 4PGBA 3O0RL 3EOTH 3K80A 4J3TA 3CFDA 4ISVB 4OZIA 5DT1L 1P7QD 3IJYB 3REWB 4RCAA 5E5RB 2VLLB 1HH6A 3VFUA 1YEHH 2WBJC 4Y5VB 4I18A 5ISZB 1XFPA 3GUTB 2E9BA 5HHPA 3NH7H 3F5WB 3EYVB 3IFLL 1NC4A 1GVIA 2AJ3B 2ADIA 1KBGH 5EOCJ 2OZ4A 4ZFZA 1SYVA 3K2UH 1N59A 2AXJA 4J3OC 2O5XH 4M7LT 3JWOH 1RULH 3O2WL 5BV7C 5JHLL 3DUHA 2DRUA 4R7DA 2CMRH 5DRXB 4JAMB 3D48R 4H0GA 4HGWA 3LD8C 4U6YA 5A2JH 1CQYA 3G5ZB 1UM4H 1G9MH 5GRJH 1I4FA 4W6WB 4ODHH 3DUUA 1TZIA 5JOPD 4HD9A 3QEQD 4HSQA 1HYSC 4X0KB 2YD5A 3WNNA 4KQ3L 5KJRH 1R3IL 4EI6B 3MMEB 1J8HD 1NANI 1N64L 4OB5L 1YMHB 1BP3B 5DJ2B 2EC9T 4XVJL 2YUXA 4LCYA 2VC2L 4MNHA 5AG8A 1AY1L 4XP4L 4JFHE 3ZE0E 2Q8BL 1U8MA 1RVFH 4D9QD 3O2DH 2A2QT 3T1FB 2G60L 2AS5M 1T3FA 1YEFL 5I75B 3RVWD 3JUZA 2WW8A 1AGCA 2EXWD 3FQNB 4KKAC 3GRWL 1A3RL 3EOBA 4RGNE 1IMHC 2EZ0D 3S9DB 2CUMA 3LOWA 5DHVB 4DGIH 1BQLH 3OKMB 3IJSB 3GMLA 3MV8A 3QDJB 3AREB 1W0WA 3EJYD 1I3RB 1A4JB 4OZGA 5CJXC 4NKMA 1QFWH 3DBXB 2Q6WB 4JPVL 4HBCH 1MEXH 5F6IC 5IGXH 5EOCL 2RIKA 3CXHK 3GHBH 3ULUC 4HF5L 4TNVF 4NQVA 3HMXL 1NLDL 2C7UA 5FYJL 5SWZE 1XF5A 1QVOB 2W65A 5CEYA 2GCYA 5K93A 1AR2A 5J6GB 5CBAA 3VFVA 4KZEH 1MI5D 1X5JA 4RNRB 3T2NL 1CXHA 1U58A 3LKSB 4UNVA 5B39A 3LRSB 4HC1L 3IYLW 2PTTA 5C1MB 1AGBA 3DHMA 4G6KH 1KJ2L 1U8JB 3V8CA 3WIFA 2CIIB 4RAVA 1KV3A 4MB5A 1QFPA 3CZFA 1EO8H 1MFDL 4J2XA 3LVEA 1I7UA 3HRZA 1EHLH 2X4NA 4QHLA 4ERSH 1X5IA 3BKCH 4AEIH 3CVHH 3V6OC 3TP4A 3RTQA 3GNML 3R0MA 2RR3A 1ZT4A 4HT1H 3JV6B 1NEZG 1JRHL 4ONHB 5F1NA 1G0DA 4OLVL 5IB5A 4BQBA 5C7XH 3DSFH 2RFXA 1G7MB 5FB8B 5HDLA 4IIQA 1GH7A 2EDEA 3QYCA 3IRZA 2ICCA 1T0MB 2HJFA 4XP5L 4PD4K 3BUTA 4P99A 4OIBA 2IALB 1XH3B 1MCOH 1MUJA 2C4FU 4UV7L 1A3LL 4EN3D 1DZBA 4W4NA 2QSCL 2Q3ZA 1H3PL 2F19L 4F9PC 1TETL 1AXSA 1RZ7H 2DQFA 4X6EA 3IS1X 1K8DA 4JFHD 1R0AH 4LNVA 1IGTB 1NCWL 3DXAB 2DOCA 1MAML 4YO0B 1NUFA 1T6VN 5IFHH 4P3WA 4O2EB 4OGXH 3QDGA 3L9RB 2GTWB 1AGEB 3MCKA 1FFNB 4RGND 1F6AB 4KXZI 1G7JB 4OKDA 4FG6C 1RZGA 3RWIB 2CD0A 1CZ8L 1IAOB 1PG7L 2LABA 3R1GH 1FZOB 2QSQA 2QR0A 4YBLB 1C7SA 4HXAH 2AABL 1BZ9A 4ETQA 1A6WL 2XTLA 1OP5K 1FORH 4LKXB 1G7HA 2WLYA 3SE9H 4BFEA 4HBQA 1UM5L 2HT4D 1A02N 4M62H 3ZO0A 1C5DA 3V2AR 4ZAKB 3PWPA 5SWZD 2X4QA 1RIUH 3W9DB 5DVKA 4JM4L 3RWCB 3MNWB 5HYFA 1LE9A 4FRWA 2Z31D 5ABDE 3GI9H 1MWAB 4O51A 1MFAH 3QNYB 1Q0XH 3G5YA 3RNKA 2NY2B 3PQYB 4HFUH 5F9JB 1FNHA 1QA9B 3ZE1E 3G9VA 3M8OL 2WNGA 1NFIB 1INEL 1UJTA 3V0WH 1RURL 3X13A 1CD9B 3WEXB 1WWBX 1FP5A 3VMOA 3ES6A 4CNIB 4M7LL 4HLZG 4PS4H 4FFWD 2L0DA 2N56A 4AEHL 2GTZB 2L7JA 1LQSR 5AAWA 1FFPB 4M93C 4UIKL 4CU7A 1W0YT 4O9HL 2Y25A 2XQBL 1T1XB 3DMMB 1FZKA 5AYUH 4Q6IC 2AXFA 3QEUB 2B4CH 5E7FA 1R24B 2DQUH 5ESVB 4HDIB 3IT8D 3MLVH 1NC2A 5I8CB 1L7IL 3TJEL 2CDEA 4Z8FL 3B8YA 5DHYA 5DD6A 3FO0H 2W1NA 1T21B 5I1JL 1QUNA 1D5ZA 3TZVA 4Z7QE 4Q0XH 2EKSB 1Q9OB 2A74A 4JN1L 3MJ9A 4AIZB 1JV5A 1N3NA 3QBTB 3U6RB 3VGHA 2IPTH 1OT2A 4NN6C 5D7SL 2YWZA 3QZWG 4X6FA 2UY7A 3HAEA 2E27L 4U1KB 3RX7A 1FN4B 3V6ZA 3DYMA 3ZT7A 1DQMH 1NC4D 3LKQB 4U7SA 1I7TB 2NY3B 5IV2A 5DVNA 3NACL 3LV3B 2A73A 1E28A 4HUWB 4H1LH 4TQEH 3BZEB 4ZOBA 5IHZB 4TPRL 2D9CA 4AL8L 4UIMA 2SEBA 3CSPA 4NNXB 3PWJA 3SE4C 1HHIB 3MV9E 5I8KH 1HILB 1D5IL 3TV3H 2ADFH 2AK1L 5FF6A 1MJ7H 1A3QA 4S2SA 1FFOA 6FABH 1TIUA 4YC2C 3L6FB 5D6CB 1KCKA 2Y36H 2ZCKL 2YPKB 4NHUB 5A2KH 5D7LB 3GBLA 4K3JL 3WL9A 4LHUA 4RFOL 5EOTA 3SE3C 1I1AC 4ZFGL 1FNGA 1W8NA 4U1JB 4OF0A 1MCLA 5C0FA 1VESA 1FRGL 43C9B 5IFAH 3VXNA 3HFML 1TVHB 2BJML 4KAQL 2JIXB 5DD5L 3GJEB 3QDME 4NUGH 3QFJB 1FNEA 3GKZA 4YK4B 1LK3H 4DWHA 5CEZL 1K8IB 3HE7B 1BFSA 3VRLF 1J0JA 4Y5XC 3CGTA 5EN2B 4Q6YA 1FNSL 4OV5A 1S78D 5EUOA 1ZANL 3GI8L 3O41B 4PJEA 2NR6D 4WW2F 4ELMF 4H20H 5ICZB 5ID0A 4PBVC 2NPLX 4M8VA 2IADA 4PJ5A 1JGEB 2BOBB 3SHSA 5GSVB 3S36X 5CILH 5DYOA 3VW3L 4K7PY 3BEWA 4UB0L 3TIDA 4GG6B 4PIRF 5F71A 1RK0A 4N0YH 3ILPA 2P5WB 4GW4A 3VGAB 3BYYA 3FZUC 4OFVA 3S34H 1LO5B 4M61A 2IPKB 5FYLH 4QO1A 1F2XK 5LGKA 4HV8B 5I8EB 4ZUUA 3STBA 3E6HB 5DUBB 1X6NA 4BSWA 4EQ3A 3GBNH 1YY8B 3BQUC 3VXRA 3H3BC 4X7FC 4NZDA 3TT1H 5DQ9A 3I84A 3U1SH 1RUKH 1BBDH 1F45A 4K3DH 1N6QL 1S7WA 3OF6D 3Q5YA 3ROOB 3DV6B 3RTQD 4WO4B 4MMXC 8CGTA 4N8PA 3MV9D 1FG2A 4PRHE 4WY7L 1QRKA 3VFTB 4IOSD 2DQGL 4HUXA 1H8SA 2EDOA 4CVWA 2UYLB 4K94H 5C08B 1FYTB 3GGWA 3BD4A 3C5ZB 5DC0A 3CFBB 4F3FA 3RIFF 3IF1A 4OSUL 1N4XH 3O3AB 5BV7H 5IIEA 5DMYA 4LVNC 5IMMA 4Y1AE 1CQKA 3VFRB 1QR1A 2V9TA 1NCBH 1ZGLA 1FFQA 3QAZB 5FUCE 1MH5A 4XAKE 5SV3A 3U9PL 4JO2H 2H1PH 3MZTA 4KDTC 1UVQA 4WGWB 3FQWB 2ZCHH 4JFOA 3OR6A 4YGAB 4FP8L 3K8MA 1FPTH 2MPAH 7CGTA 2RCSH 4QTHA 2C26A 4XCCH 5F97E 5EOQH 4Z0XA 5JOFA 5CCKH 1I8KB 2JJTA 2QJDA 4WWKA 5DRZA 3SE8H 3GB7A 3QI9D 1NMAL 3ARBB 1Z9SA 4YX2L 3ULSA 5DWUL 2XWTA 5HDQH 5I9QB 4JCMA 1B0RB 1HIML 5D1ZB 3H9SA 3NFSH 1Y6NR 1RIVL 3KLSA 4LSRH 2F54E 2FGWH 3R06A 5DJ0A 1KUMA 5CGYC 3OPZL 3ZL4L 2GQHA 2R1WA 4EOWL 3FFCB 3V6BR 2ERJC 2VWEC 1CE1L 2V5YA 5L2KE 2V17H 4MJIB 2HFEA 4GMSL 4XVSL 4AEFA 4LBEB 1KC5L 3U0PA 3AS2A 5IVOA 1B90A 3D2UA 5F7NC 1HI6B 1ZS8A 4LSTL 5C0NC 3O0RH 1U3HA 1AO7E 4QTIL 1A9BA 5DT1H 3O8XA 1OP9A 3TO4C 1GC1L 3C6LA 4WHDA 3BO8B 3CC5B 2QADD 4PRHD 1LO4L 1J0KA 3IVKB 3PHQB 2V7HA 5DJAB 4EJ1C 4G80B 4M4RA 2J8OA 1VFUA 5L2JB 4P0DA 1FQ9C 4QKXB 3DX7B 4X5WA 3T2PA 1DANU 5D9SA 3EJJX 5E2WL 3IS0X 4S11A 2AJZA 3I2CL 4WVRA 4Y1AD 1NC2D 5D7IE 3SCMB 3VI3E 3PP3H 3T3PE 5HHMB 4XAKD 1C16A 5DA4A 3QWRA 4PJEE 2E7LC 4DGVL 3PP3K 1AD9A 1K4DA 3QUZA 3TZVD 4YZFE 2AEQL 3U30C 3JVGA 5TQ2L 4KQ3H 1R3IH 3DNKA 3I02A 4QRUB 2D31B 1U8PB 4LPYA 1N64H 4OB5H 5FO7A 4W6YB 1FZJA 1IL1A 3H7LA 2VC2H 4A6YB 3UAJD 5KSBE 1AY1H 3AS1A 1X5YA 2F54D 1FNFA 5IFJA 2FEDC 1G7PB 2G60H 4MA3B 1I8MA 2LVCA 1BVKA 4G7YL 3GRWH 4DEPB 1U8QA 1KB5B 5L2KD 5ISZA 4YLQT 4BH7A 3SDCC 3GUTA 3F5WA 3EYVA 3U0TB 1U8NA 5DF0A 2AJ3A 5EU6B 1IZJA 5ERWB 3CNKA 1WISA 3HMWL 4PFEA 1WVZA 4ENEC 2APTA 1CFQB 3GBML 1F90H 4PTTA 4JEGB 4JPVH 5EOCH 4GKZB 3HNVL 2XNAA 4LHUD 4HF5H 4J3VA 1AO7D 2ZKHL 4UI2A 3HMXH 1NLDH 1UXWB 5FYJH 3WS6A 3G5ZA 2JJWA 2J8UE 3D39E 5HHVL 2CRIA 3PABB 4F7PA 3JV0A 4X0KA 4PGCB 3T2NH 8FABA 3C9NB 5MI0B 1MNUH 2ITDA 2MKWA 4UDTB 3T0BA 4R96B 2E7CA 4EI6A 3MMEA 4JZJB 1EGJL 1YMHA 4QT5B 1P9MC 5DJ2A 2FLRT 2APWA 4KDWA 35C8H 5D96B 1JTTA 5DLML 4F7CB 2RJMA 2CXGA 1NCTA 1JRHH 1M6OB 1D3CA 1EAJA 2ZUTA 3FQNA 4OLVH 4PREB 4IRJC 4NRZB 1RZIB 1BAFH 4PP2B 5DHVA 4XP5H 3CAFA 2X7LB 3OKMA 4EIZC 5J3HD 3IJSA 3FOLB 3QDJA 4UV7H 3AREA 4XPFH 5FGCB 1A4JA 1I3RA 4LRNL 2QSCH 3ZDZE 1H3PH 2F19H 1TETH 3HE6A 1CLZL 1SVZA 1Q1JL 2I5YL 4LARL 4PJBB 5EBWB 4UILL 4RGOH 2P46B 1QVOA 5J6GA 2EDFA 1N8ZA 2CKBB 1KPUB 3SGKA 1LD9A 4PLNC 4RNRA 2ZPKH 3LKSA 3OAYH 5C9KA 3RGVD 4HHAA 5HPMB 1VFAB 1WTLA 4DKEL 3OAYK 3UTTB 3FHAA 4OZFB 2AABH 5KZCB 1KEGH 2CIIA 4XC3L 1XR8B 1A6WH 3NIFF 2WMPA 1GRWA 2MCG1 3TESA 1X4XA 4OLXL 1Z9LA 2WQRA 1UM5H 3MJ7A 3G6JF 2BVEA 5BOZG 4ONHA 2AK4E 2NY4D 4JM4H 1P53A 1T7VA 2YZ8A 3GM8A 3D39D 1G7MA 5FB8A 5F6HI 4K8RL 1X5HA 4PJ7B 5HHOA 3WN5B 1JI2A 4HPYL 3TVMB 4F15C 4NYLB 5GJSL 2IALA 1F11B 2CK0H 1XH3A 3LEYL 4YH6A 4OZHE 1RURH 2ITCB 4WWKD 1U2CA 5TPWL 3TBTA 4U1IB 4YDLC 3UTPD 4EVNB 4LCCC 2HJLB 3MX0A 5JIIA 2D7OA 1EZVX 1IGTA 3H9SD 3DXAA 4YO0A 2UZXB 3ILQC 3BP5A 3MUGB 1KT2B 4P9HL 4UIKH 1MCRA 3S3SA 4O9HH 2XQBH 3L9RA 3G5VA 4J3UA 1PJ9A 5F7UA 3CH8A 4HCRA 2A6DB 3RIAF 1F6AA 4DTGH 4OGAD 2Q8AL 1G7JA 3RDTC 3UBXB 5I6XC 3RWIA 1IAOA 4P59L 4LCWE 1M1SA 5F3HB 3MODL 2NY1D 3S37L 3TJEH 3RKDD 4LKXA 4Y4FB 4Z8FH 4FQXB 3MYJB 1U3HD 1L9MA 3BAEL 2FHBA 1N2RB 1HQ4B 5I1JH 2M1KA 4WHTB 3O8XD 3RWCA 3C6LD 3LS5L 4JN1H 5D2NB 2I9TA 1MWAA 5HVFB 4PY8J 3V7MA 3BH9B 5D7SH 4P4KC 5F9JA 1SY6L 1D7FA 1YEDB 2BY0A 5DMJB 2Y72A 1NFIA 4U33A 1BMGA 1EEUA 2CKNA 4Z76A 5AUMA 3AS3A 1BX2A 3WO4C 5ID1A 1FG9C 1U8KB 3WEXA 3WIHA 2VN4A 2WIIB 5DD1L 3BRDA 3BWAB 3IXAB 3NACH 4NGHL 3S97C 1RZFH 4QRSB 1SHMA 4CNIA 2X1XR 3BPLB 5DQJA 3QWRD 1BOYA 1I1YB 2GTZA 4IS6B 5IM7B 1NGWB 4AL8H 1NAML 2AK4D 2Q86B 3PWLA 2R23A 4K7PL 3HTLX 1U8LA 3X3GL 3SDAC 3DMMA 4MYWB 2AK1H 3QEUA 3S4SB 2CXKA 1KJMB 1R24A 4JKPL 5EC2A 5ESVA 4K8RC 1CD1B 2Y5EA 2GJZA 1QQDB 3HI5L 2FIRT 2ZZUT 1KYOJ 5AWNH 5I8CA 4MD5B 3UJJL 32C2A 3MLXH 4K3JH 4ZFGH 3BGFC 1JJUA 1CIDA 1BWMA 4KI5C 4P5TC 3MRFB 1F4XL 3BZDA 5GJTL 2PXYD 1R3KB 1T21A 3EJZD 5FA4B 3MRIB 1AE6L 1OLZA 2EKSA 1FO0L 2VNCA 1Q9OA 2BJMH 4KAQH 4G8FB 4AIZA 3KLAB 4P9HC 3C60C 1YDPB 3U6RA 3QHTC 4LVHB 1BLNB 4HWZB 4ZUSB 3BXNB 3MRHB 5D71L 4WU5B 2AKRB 1FN4A 4LCWD 2NY0B 3LKQA 1UT9A 1FNSH 1MRFL 3LAFA 5FAAA 3SDDD 3GI8H 3GSRB 1KELH 4P2RB 5CUSL 1F6FB 4HUWA 4KJQC 4R90L 3HZMA 1WJ3A 3BZEA 4D8PB 2VDPL 5IHZA 1YPZE 3EO1B 3VW3H 4L5FL 4N0CC 1YECH 1HHIA 4RX4A 4UB0H 1HILA 5TF0A 1ED3A 4HUUB 1OTSC 4HEPG 3U7WL 3DETC 5HHOE 4ZPTB 2K1MA 3R8QA 3L6FA 1GPOH 3K3QA 5B21A 5LAXB 4J23A 2OQJB 2YPKA 2A77L 4XMPL 3RVXD 3VWKB 3DVFA 3QJHA 4U1JA 4RFEB 2J12B 1N6QH 4NOFA 3DXAE 5EBLB 4HK3J 4WY7H 4PJFF 1GYAA 4JM2F 2DQGH 3QFJA 5E8DL 5TDNB 1K8IA 1DE4A 3SO3C 4MQSB 4TSBH 4FXGA 5EN2A 4TVPL 1KGCE 3VFMB 4R8WH 4ZS6C 1LP9B 3QDJD 4LLWB 4W81A 5SX4H 3VI4E 1AIFB 3AB0B 2P45B 3ARSA 2FR4B 4OV6F 3U9PH 4BJLA 3HE6D 2BOBA 2Z93B 5GSVA 3VD7A 5J56B 4CADB 4L3EB 3EO0B 1NDMB 4C4KO 1VADA 4GG6A 4HK0B 2F15A 3GIVB 4TNWF 1J1OL 3O9WB 2P5WA 3O4LB 5C6PB 4NM4L 1U3YA 3FB7B 3EO9L 1LO5A 1HINL 4XTRC 3ZTJG 4IJ3C 3E6HA 1S7RA 5DUBA 4DKFL 1A14L 1YY8A 5DWUH 5L8KB 2DQJL 4FA8A 4E41A 1FL3B 4NNPL 4MLIA 5J7CC 5GS2D 1N6UA 2IBZY 5E4EC 3ROOA 3UC0L 4JRYB 4WO4A 3L3GB 3OPZH 4X98A 3ZL4H 1JZ2A 2V2XB 4EOWH 2MHAB 1S7TA 2AERT 3PNWB 2UYLA 1WAAA 4I9WD 5C08A 1O5DT 5HHOD 3NCFB 4GMSH 4XVSH 3CFBA 3C8DA 1KC5H 1TZGL 3GSUB 5SWSB 5DFVD 3QPQD 3VFRA 4LSTH 3VFSA 4OF6A 4QHKI 5FYKD 1AHWC 4QTIH 2HMIC 3VCLA 3ECBA 1NUDA 3DXAD 2YUWA 3WXVH 1LO4H 2GK0B 4U1NB 5F7FA 2C9AA 2DMCA 2YD2A 3MOAL 3RWFB 4Z7NF 4CL7A 3WUWA 2ZOKB 3AGVA 1I8KA 1KGCD 3KVQA 5CIPH 3HLAB 3ARBA 3VG9B 1SBBA 1B0RA 4I0PB 4IM8A 4WV1B 5D1ZA 2EIEA 2EO9A 4DGVH 5DD0L 4NKQB 1NUGA 1ZA3A 4YWGL 5K33A 4O5LH 1CL7H 2OJZL 3ARYA 2Q1EA 1V3KA 2F5BL 3DYPA 3FFCA 4G5ZH 2FJFB 1YA5A 5GS0L 1AC6A 1V3JA 4DFIA 4G8GA 1ZVSB 2X4OB 2NY2D 1UB6A 2LFGA 3ZKNC 4K23L 2P42B 3TFKD 4Z7UF 5LWYL 3PGFL 2OBGA 5FGSA 2AQ1A 3KAAA 5C92A 5EORL 2H26A 2XA8L 3QUXA 4WDIB 4HFWB 5D7KE 3PHSA 5D1XD 3CC5A 4G7YH 1BFOA 2MCPL 1UYWH 1OVZA 3SY0B 3DMMD 4LCIL 3I6KB 5L2JA 1QSVA 2MMXA 3DX7A 4X6BB 5B38G 5GS1B 3CUPB 2FD6L 3GBMH 1WCQA 1NMCB 4JJ5B 4WTWA 1TPXB 1LEKB 3UJTH 4NRXB 1XF2B 4PJIF 5GGVY 2P44B 2YOCA 3IDUA 3OG6B 5F1IB 3O6ML 1DQDL 2HH0H 2X9XA 3U83A 4P4RB 2D31A 5I18H 2IJ0C 3QUMH 1EGJH 3ARDB 1QKZH 3CVHB 4GQ9L 1KJVB 1ADQA 4EI5D 4C54A 2NY3D 5DLMH 4A6YA 2AXHA 5E7BA 4TNVK 2V2TB 4E41E 2Z91B 5B22A 3MLWL 3LKRB 4IOIB 5T33L 4JO1L 3FT3A 4F37F 1K3IA 3MRPB 1SMOA 4MZ3A 1QRNB 1KB5A 3RWJB 4B50A 4LLUB 4KJWC 2FWOB 4RX4D 5CSZB 1PG7X 1YNTB 5I30L 3PL6A 3GKWL 4OCWL 5EU6A 1SYSB 3IDMA 5ERWA 1WAAE 4PRPB 5GS0C 4RMRA 4X6DB 1UJ3B 3EYSL 4KJYB 2AJVL 4P2OC 1KCLA 3QWQB 4LRNH 3VDAA 1CFQA 4FS0A 2DB8A 2BNUB 1CLZH 4OT1L 4GKZA 2R4RH 1Q1JH 2I5YH 4LARH 3UZQA 1QOKA 3LHPL 4UILH 1MCEA 1UXWA 2GW5A 1QFUL 1XGYL 5BQ7B 2W9DH 1X5ZA 4CN6A 3PABA 1GIGL 1NPUA 3BD5A 1NLBL 1M7DB 4L8CA 3C9NA 3FT4B 2OI9C 4UDTA 4R96A 3UTOA 1PX3A 4JZJA 4QXUL 2FBJL 4DKEH 2H8PB 1OOAA 1OAQL 3GSQA 4QT5A 2RHEA 2W38A 3G6AB 5B8CC 4TSCL 4XC3H 3B9EA 2XFXB 3ARFB 3EDEA 4PJ9A 3IDGB 4R0LB 1EFXD 4PP1C 1M6OA 1UH4A 4N0UB 2IBGA 3D85B 4PLOB 4NRZA 1TFHA 4K8RH 4QCIB 1RZIA 5KVGH 4D94A 3OGCB 4PP2A 2QTEA 2BMKB 3AU1B 4URTB 3DI2B 2X7LA 5GJSH 2YRZA 3LEYH 1QFWI 2V6HA 2IPUK 4G8GE 4HJ0D 3X17A 5I16A 1OT1A 5TPWH 5CJ5A 3NZHL 1SJEB 1E4KC 4K3GA 4PJDB 4XNYL 2UZYB 2VB5A 4E41D 1TCMA 3U4AA 4MCZB 4PJGB 4P9HH 1P4LA 1S3KL 3SJVA 4P2QB 2CKBA 1WFUA 3HUJA 1EEZB 2DM4A 2Q8AH 1UFUA 2FCBA 5HPMA 1VFAA 4P59H 4OCYH 3S35H 2HKFL 3WDIA 4KFZC 3UTTA 3B43A 2LVEA 4OZFA 4OZIF 3S37H 5EBGA 1IC7H 1TITA 1DDHB 1KIQB 3VMNA 1QO3B 2J5LB 3QSKB 3BAEH 5CD3B 1JK8B 5E56A 3CLEL 4BSVB 3LS5H 5MENB 2JELL 1YEEH 1ZT1B 1A6PA 3NTCL 2H2SD 3WN5A 4X4ZA 3GHEL 1YJDL 5A2FA 3TVMA 4N1EA 1SY6H 3L3IB 4APQA 4NYLA 2OXGA 4FTVB 3H3KA 5HD8C 1HZHL 3ROLB 2OTUB 3P0YH 4H1LB 1KPRB 3SOBL 2WUCL 3ARBD 3K8KA 4YHPA 4LFHD 2WWMD 5IG7B 2HJLA 1G0YR 4Y2DD 3K1KC 5D1ZD 2EYSA 5JW4N 3MGOB 1SJHB 4KMTL 3VFOA 1NAMH 3BGMB 3MUGA 4JDVB 3QNZB 2R8SL 4K7PH 3X3GH 2LTQB 1U6AL 3LDBC 4JJHA 3F7QA 5JXAL 2A6DA 3OJDB 5HBBA 4W6XB 4KV5E 3UBXA 3AS0A 4JKPH 4W68A 3E2HB 1HNGA 4G8GD 3DRQA 5F3HA 4BK5A 1CDBA 3HNSH 1WWAX 3UJJH 2W0KA 4NT6B 4ZFOL 2NY7L 3VXTA 4Y4FA 5DJZA 5LJYH 3NAAL 4FQXA 5F44A 1F4XH 3TBVB 4Z7VB 4PJHB 2BY3A 3QUXD 1HQ4A 4WHTA 1AE6H 1RUQL 4NIKB 5I8OH 3QH3B 5A16A 1BD2B 5D2NA 1ZK9A 3LZFL 4OZGF 3BH9A 4PYGA 5IHBA 2XN9B 1YEDA 4OBSA 5D71H 4B7LA 3N1GC 4DZBB 4IRZL 1AQDA 3TJHC 1IC1A 3KYKL 5I15L 3BWAA 3HPLA 3IXAA 5BRZB 1AI1L 3QPXL 4QRSA 5CUSH 5KVFL 1D6EB 2G75B 2VDPH 5IM7A 1I1YA 1NGWA 5I1AB 1UM6L 1ZXQA 4OUUB 2CIKA 1P5VA 1CICD 4WTZG 1S7QA 2Q86A 3ZSTA 2VDNL 1BREA 1U95A 3HR6A 4AY0A 3RWDB 1AXIB 1IQDA 2FO4B 5J1TC 4YHIB 2CQVA 2H32H 3T0EB 1KJMA 4S1SL 3L3OB 1CXFA 4OLZL 1CD1A 4YHOL 4AENB 3CDYA 1YJDC 5JDJA 2IQAB 1LDSA 3P4NB 5GGTA 2BOCB 4M6ML 2XG4A 2WBJB 1UGNA 2A77H 2ICWB 3B3IB 5JR1L 5EUKB 2VISA 3UMTA 3MRFA 5AD0B 3KYNB 4UOW1 3LB6C 5FA4A 1R3KA 1KYOK 4AYFA 5D1QC 1PLGL 2BHUA 2ZUWA 3VU2A 3SJVE 1YDPA 2JJVA 5FYJU 2JB6B 3TNNB 1BLNA 4HWZA 3MRQA 2BNRB 3BXNA 3MRHA 5BV7B 3HUJE 2JCCE 5LBSL 4WU5A 4KROD 4U3CA 5KN5B 1ERNA 3PL6D 3LD8B 4NSKB 4C56B 3GSRA 4H0HB 3LKOB 3LN5A 4P2RA 1S5HB 2J6EL 5L7XL 2F53A 3DUSA 3ESVF 5ICXB 3EO1A 4R4FL 5E2UH 1AQKL 5H8DA 2NW2A 4F7MB 3B2VH 4D0DB 3N9GL 4BUHA 5EH1A 4HUUA 1J1OH 2CK2A 3EYQC 1UQSB 4NM4H 5T1KD 3W9EA 5EIQA 5IEKB 1WT5A 4ZPTA 1HINH 3KHQA 3FO1B 4Y16D 5LAXA 4DKFH 2OQJA 1UKQA 3QQ9C 3WNLA 1ZKAA 1NEUA 4QNPE 1CXEA 1T89A 3VWKA 4NNPH 3RY6A 1UADC 4PJ9D 1T5XB 5GIRB 4UTAL 2WM0A 5K9OA 2EDKA 5JO5B 4NQCB 4QWWC 1LVEA 4XAWL 2WK2A 1T1ZA 3D69A 1BIIA 5TDNA 2B2XL 5F6IB 5FECB 2GT9B 4D2NA 1VB9A 1XIWC 2W59A 5IJVA 2ZJSL 3MROB 3GFUA 4ZOEA 3VFMA 5HYQA 1TZGH 1LP9A 2VIRA 1E4XL 4JN2A 4P9ML 3ZKMC 1AIFA 4UTBL 1TJHL 2FR4A 1RI8A 2NZ9D 1QLRB 1F2QA 1NBYB 3INUL 1QSFE 2Z93A 2EYRB 1ACYL 3BOVA 5I2IB 4CVUA 5CHNA 1G6RL 4CADA 1MRCL 3D6GA 1K5NB 4JCLA 4RA0C 3TA3C 5D7JC 3EO0A 1NDMA 3EDFA 3O6FC 3SJVD 4U6VL 1G7IB 4HK0A 5I17B 1D9KC 3GIVA 4JFEB 3MOAH 4GRWE 4Q9RH 2VLRB 4N8CL 3FB7A 1MIEL 1KIPA 1IT9L 4YEEA 5C09A 1UWXH 3PF2A 4P3DB 4ZTOL 1T20B 4L3AA 3KLDA 3G5XB 1S5IL 1UWXK 4ZQKA 1FL3A 3RHWF 5DD0H 1T5WA 1P6AB 2VXQL 4JRYA 2APFA 2OJZH 2YUZA 3L3GA 5DQDL 3UPRA 5E6IC 2Z9TA 4AH2B 4JM2C 3ZTNL 2V2XA 2MHAA 4I8DA 3AAZB 3PNWA 4KVCL 2XKNB 4WUKL 2F8OA 3TVMD 2MJWA 2FYYA 3DVGB 4APQD 3BPCB 3QZWA 3GSUA 4L9LA 5SWSA 3TBSA 2PTUA 4AG4L 4GS7B 3EDJA 3PGFH 4Y4HD 5KS9F 3VGGA 3NVQA 4HGMA 5T3XE 5EORH 4ZNCD 2XA8H 3BP7B 4QYOB 3QEGH 1JPST 3VXPB 3EHBC 3FO2B 2XWJA 1S9YB 4L9DA 4MAYB 4PUBL 5DJ8A 3BKMH 2GKIA 2GK0A 5I1IL 3SBWA 1S7SB 3IKCA 2MCPH 3MBEA 4XX1G 3KJ6L 4U1NA 1N5YH 4Q9QH 3RWFA 5IB1A 2VKXA 1DQJB 2ZOKA 3LMJH 1M7XA 1BBJB 3HLAA 2FD6H 4QRQB 1J18A 2FH6A 4I0PA 2ARJB 4FQ1H 4WV1A 1MHCA 4KUCD 3O6KH 5E6ZA 2FECL 4P2RE 1QSFD 2BVQB 1KULA 2UWEB 3MTRA 2F53E 3GJFH 4FQHA 5FUOL 5MEOB 4LQFL 1S9KC 4Y5YA 3WFBL 3DPBA 1U8OA 4YXHL 5JZ7D 3GJFK 2QQLL 2FJFA 4X7TA 5EUOF 3H42L 1KJ2B 3DSNA 3O6MH 1NCAL 3MLPA 1ZVSA 1DQDH 2GHWB 2X4OA 4XP9H 3W81A 4V2BA 4NM8H 5C9JA 4M93B 4GQ9H 3O2DA 1I7ZB 4Q6IB 4JHWH 4OF8A 4EUPG 3OHXA 4HFWA 4OLUL 1U92B 3MLWH 5JW4Q 1CLCA 1H8NA 5T33H 4JO1H 1TDQA 4UUJB 5EU4B 2VLKE 3KPOB 2A1WH 5H2BB 4XWOD 1N0LA 2JB5L 3SY0A 3LQAL 2R0WL 2VZTA 4I2XB 4XXCC 3I6KA 1JHTB 1B4RA 4H0IA 2ED7A 3EYSH 4X6BA 2AJVH 5GS1A 3CUPA 4Z7OF 2OL3L 4JJ5A 1E27B 3KYAA 5T3XD 2B20A 1XF2A 4NRXA 4PJXB 1A1MA 3LHPH 3HRPA 4WHCA 3V7AG 5T3ZE 5EG6C 1QFUH 2UUDK 5T1DH 5E8EB 2GITA 3ABZA 5F1IA 1RZKL 5HSFA 1GIGH 1NLBH 4WI8A 4L4JA 5HVWA 3FT2A 4LPVA 3TH4T 4G6FD 3FRPA 3L5HA 1FLRL 4QXUH 3RVWC 2FBJH 2FATL 1YYLL 3IETB 3ARDA 1OAQH 2EXWC 3CVHA 1JTOA 1KJVA 5C09E 3CSYB 1CN4A 2GJ6A 4M7KH 2Z8VC 3QQ3B 2EZ0C 1LHZA 4P2RD 5IMKB 3ARXA 1MRDL 2Z91A 3CFKB 2F53D 4NKDA 3BEVB 3LKRA 4F33B 5F8RC 4IOIA 2ATKA 3QCUL 3EJYC 4YC2B 3MRPA 4OI8A 1KLUB 1QRNA 3HR5B 4LLUA 1N7ML 5CSZA 2FWOA 1SEBA 1YNTA 1UZ6F 1FE8L 3U9UB 1ZT7B 1RK1B 5FOBA 4DKDC 2D9QB 1SYSA 4NQXA 3S37X 4DW2L 3HC0B 4PRPA 5JORB 2QV2A 2Y06L 2K7QA 4X6DA 5F72S 4C59B 5I1DA 4KJYA 5C8JB 2YK1L 5DEGB 2C3WA 3NZHH 3OX8B 1ZLSL 4G43A 2BNUA 1QZ1A 4NRYB 5E08L 2BSTB 2NYYD 2VR5A 1NDGA 5H94B 4UQ2B 1T1YB 4Y5XB 1S3KH 1TENA 4ZS7H 3VXUB 5BQ7A 1BOGB 1HWGB 4GLRH 2PYFB 3TNMB 3MGTB 5IF0B 3OR7B 4IMLA 2DJ4A 1M7DA 5KSVA 3FT4A 4JY5L 1HSAB 3LQAC 1WC7A 1N6VA 3QO0B 1P5UA 2H8PA 1NCDH 3G6AA 3QIWA 2P1YA 2WBWB 3ARFA 4TUKL 5ACMA 4K7PX 2ATPA 3QB7C 4LASL 1BPVA 4PTUB 3IDGA 3IKKA 4R0LA 3LKPB 3RZCA 2D7QA 4EN3C 4JY6A 3D85A 1JPSL 2DL2A 2JELH 4QCIA 2DLHA 3BQUB 4OGYL 1AH1A 2X05A 1LO0H 3GHEH 3OGCA 1CDCA 5A2LH 2BMKA 5JIKA 2FRGP 4JPWL 1RZKC 1HZHH 1TJGL 3MRNB 5JUEL 4E5XB 5FDYA 2PO6A 4C55A 5DGRA 4PGZA 4Y0GA 5C09D 3SOBH 5F93C 2WUCH 5JW3L 4LAJH 4RGNC 2AEIT 3T3MF 1GGYA 2H9GB 4KMTH 4PJGA 1UZ8B 2R8SH 1DEEB 4OD3L 1KIUA 4LVNB 1L6ZA 1EEZA 2IH1B 4WUUB 2XKUA 2HT4C 4DN4L 3DYOA 3VGEA 2DAVA 3RPKA 4LAQH 3QDAA 3WFEL 1DDHA 3NAAH 2GIYA 4TTDD 5EBMB 5CD3A 1KN2L 1JK8A 1MHEA 3EOAB 1IM9B 3JUYA 1T7ZA 5EU3B 1RUQH 3GO1L 4BSVA 3O11A 1RFDL 3Q5TA 1ZLUH 3ARGA 4MA8L 4LSPH 4PJFB 1YEJL 5MENA 4NP4L 1KCUH 1ZT1A 3E6FA 2P48B 3LZFH 3MBED 3MJGX 4HS6B 1ZLUK 3QIBD 2X89D 3MA7B 3L3IA 5E95B 3T2QA 4FFWC 4FTVA 4Y4KA 1PGRB 4XPHL 3BZ4A 1WCBB 2OTUA 4IRZH 2WUBL 3EZJB 4MXVF 4H1LA 1FH5H 1CBVH 3KYKH 3SKUD 2VZSA 1KPRA 1OLLA 4KVNH 1OCWL 1AI1H 4WW2A 3QPXH 4ELMA 5IG7A 5KVFH 2ERJB 4N1HB 2GJ6E 5E8PB 4FQIL 1SJHA 1UM6H 3SGJA 3UROR 4PGDA 4JDVA 1F3DJ 2VDNH 1IBGH 1A1OB 2BSSB 1ZA6A 3ZMRA 5EZLA 1VHPA 1QRNE 4L3CA 3QIUC 1TCRB 1DTUA 4HH8A 4OLZH 1T2XA 2B1HL 3THML 5JLZB 1YN6A 3TO4B 2VDLL 1C1EL 1I9EA 3P11L 4M6MH 4TN9A 1I1CA 1IE5A 1IGYB 3HA0A 2MQ0A 3P9LB 3FQTB 3TBVA 3SDXB 4LPUA 4PJHA 1A6TB 1JMXA 3TPKA 4KRPC 2HN7B 2UZIH 2HT3C 1PLGH 3QH3A 2CDFB 1BD2A 4RFNC 5FM8A 4NCC2 1IEAB 1X3DA 5LBSH 3L5JA 3CLFL 2NXYD 2H3NB 3UP1A 4S0TD 4XVUD 2VDOL 3NCJL 2Z35A 4RMVA 1RY7B 3ORJA 2J6EH 5L7XH 2E9JA 4K7FB 1A7NH 1B4JL 1D6EA 4K2UL 5I1AA 4OUUA 4R4FH 3A67L 1P4BL 3LH2L 3RWDA 2R4SL 3CZJA 3J7HA 3EYOB 3VD5A 3WJJA 4KKNA 1VFMA 1U8HB 3CMGA 4JRXE 1IJ9A 4AENA 1O7VA 3DI3B 5SX5H 2G5BB 1MAJA 4M00A 4OFDA 4U2YA 2IQAA 3D1MC 1HSBB 3P4NA 2P8PB 2BOCA 5SX5K 4WI2A 2WBJA 2ICWA 3B3IA 3JV4B 4TULL 2VDRL 2GJ6D 4P23D 1REIA 1EERB 4WRLA 3SDCB 1XMWA 5M95B 4X7CC 3BIKB 5IKCA 3KYNA 4BQ8A 5J13C 1S78C 2J1KA 1J0YA 5F21B 3V4PH 2NR6C 4XAWH 1QRND 2JB6A 2C4XA 1UB5A 2X4UB 3TNNA 2B2XH 5I1GL 3D3VB 3F12B 5KOVC 2M2DA 1CVRA 2BNRA 5KVEL 2ZJSH 4JDTL 4FFYH 1DBML 4NSKA 4I0CC 5MERA 4PRPD 1E4XH 5K9QG 3P77A 3WFCL 4UTBH 1TJHH 3LKOA 2XI9A 4L4VB 3MV11 1F5WA 1S5HA 1ZAGA 1J1PL 3INUH 3IFOA 1ACYH 1A64A 2ICEB 5L9DH 4S0SD 2ZNWA 3TO2A 1MRCH 2EDNA 1WBYA 4F7MA 5DK2A 2HTLD 4D0DA 1ZHLA 2P8MB 5CIPB 1NFDB 3C87A 1UQSA 5JW5B 2G9HB 5IEKA 2R2EB 1CXKA 3QULA 2QKIB 1IFHH 3VRLE 3RTQC 1IT9H 3FO1A 3G6DL 3QUKB 5E9DA 4FTVE 5IP4A 1HHGB 5DURB 3BRFA 3DV4B 4MVBD 3KR3L 1S5IH 3KLHC 3QA3B 3QIWD 5C0AB 3MRLB 4LSSH 5J11C 4MJ2A 2D3VA 4IIQC 1RJLA 4ELME 3DROB 2VZ1A 3ARFD 2VXQH 3DGCR 3V9FA 1T5XA 5DQDH 1EUUA 4BZ1L 4XPAL 4I4WB 2IANB 3RZCD 5JO5A 4CDHA 2YD9A 5CJXA 4BA8A 3ZE2F 3UTSE 1C7TA 4JRXD 2X1PA 1E4WL 4WUKH 3MROA 4UT7L 3CK0L 2EDHA 2B5IC 1CFSA 4AG4H 2PO6D 4ONFH 4FABL 4EQ2A 4JVUA 4TVPE 2BSRB 2C1OB 3UX9B 5D2LB 1AGDB 1MCQA 2EYRA 1LK2B 5I2IA 2XIDA 4XCYA 2QHRL