4ISDA

Crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
187
Chain Sequence
SQKPITLYVGADYVSAFAMSAFVVLKEKGLDFEIRTVDLKSKQQEVSLTRRVPTLQHDRFTLSESSAIAEYLDEVYPAPHYAAVLPADRETRALARQLQAWIRSDFMPLGEAAQLACEKLLSAADRLIDDERYGVFGDWCIADTDFALMLNRLVACGDPVPPKVLRYVERQWARPSVQQWVKQKRDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of GLUTATHIONE TRANSFERASE homolog from BURKHOLDERIA GL BGR1, TARGET EFI-501803, with bound glutathione
rcsb
molecule keywords Glutathione S-transferase
source organism Burkholderia glumae
molecule tags Transferase
total genus 65
structure length 187
sequence length 211
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14834 GST_C_4 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4isdA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4isdA01
3GNJA 3Q18A 1THXA 4NMUA 2LV3A 3LORA 3VFIA 2LUSA 4AF2A 3UMAA 1JLVA 5ECMB 3BCKA 4NWYA 5D93A 3EU4A 5IMZA 5G30A 2VD0A 5ELAA 1DSBA 2CQ9A 2XPEA 1K0DA 3ZZXA 4DSSB 4WETA 4EDZA 1UA5A 2RLIA 1PGTA 5IM9A 2IWTA 3HVSA 3L78A 4CHSA 3GTUB 3GH6A 3IK7A 4JZQA 5FHIA 2VAFA 2WB9A 2BJXA 1ON4A 1YEXA 2HRKB 1H75A 3GFKA 4G10A 2P0GA 2YOIA 2VIMA 4L0UA 5KN1A 3VPQA 2EIQA 1BAYA 2VL2A 2N5FA 4K0GA 5DJLA 1SYXA 3E9JB 3APQA 3QOUA 2WFCA 2B6MA 4N0VA 1I9DA 2NDOA 5JCGA 3FEUA 5HR3A 2CAIA 1UN2A 4KNDA 2PN8A 5C04A 3A2XA 2I9HA 1DBYA 1M99A 4GXZA 2OKAA 5B6MA 1OKTA 2HZFA 4ZIJA 1XCCA 2IMIA 1PSQA 3ZITA 4MZBA 3W8JA 1EV9A 2DJ0A 1HYUA 5ID2B 1Z5YE 4ISDA 2IIYA 1AC1A 7GSSA 5COHA 1PQNA 1AQXA 4MJAA 3F4RA 4MH3A 2FWHA 5DQYA 2JL4A 3GUSA 1SKSB 1G7OA 2O8VB 2H0GA 1MTCA 1JFUA 3R3EA 4HQSA 1JZRA 3C8EA 2CZ3A 4EUYA 2LSTA 5AGYA 5J9CA 4GLTA 5FT3A 2J23A 3GYKA 1XWCA 1HD2A 3IOSA 1OKDA 5EL8A 5DAKB 4V1Ap 3ZYWA 1ERWA 2B3SA 5E59A 2VL3A 4L5OA 5ECSA 2KP2A 4MJEA 4USSA 4EKZA 4Q5NA 1VGLA 2CX3A 4QL9A 4ZILA 4PGTA 3M0FA 1M0UA 1U87A 4IS0A 5IO0A 5H5RA 4TR3A 4ULXA 4BVXA 1OE8A 4ACSA 2KUCA 5D96A 4ZBDA 1GTUA 2MBTA 5IMCA 4K6XA 3GX8A 1GSSA 1SYRA 3FRCA 5D9TA 3W6GA 2BTOT 1OC9A 2MBSA 1WIKA 2GSTA 3GHAA 4MABA 1TTZA 4KE3A 1PN9A 1G6WA 5IMDA 1QFNA 2Z9SA 2FWGA 1FVJA 4TXOA 4PQIA 2XPDA 1XXUA 3VWVA 4GSSA 4TRXA 1TRWA 1U6TA 2DMMA 3TCOA 2H30A 3D4MA 1WRYA 1B9YC 4ZB9A 4MP4A 1T1VA 4WEYA 2OJLA 1Z7PA 4YH2A 5ELGA 1XPVA 4MF5A 1PRXA 4PQHA 4KH7A 1YKAA 4K7NA 5IPGA 3APSA 4MLYA 4BL7A 3CSIA 2H19A 2FWFA 3H8QA 3FZAA 3DRNA 3KIJA 4BWSA 5CRHA 2X8GA 3ERGA 2H71A 2YPMA 2DJ1A 3G7JA 2K18A 3BD2A 2HRFA 1IYIA 1M2DA 4XCSA 3KTLA 4MCUA 1HQOA 3HA9A 1CQGA 3ZTLA 2L57A 4MPGA 3GSTA 3IE3A 1EZKA 1ZL9A 2DLXA 3A3TA 3EC3A 3TKSC 16GSA 2NPBA 5G5FA 1M7TA 4OMVA 4KCAA 2VD1A 5C00A 3P8WA 4GWRA 2E2GA 4V2MA 2JACA 6GSUA 1FW1A 4YQVA 4I97A 5AIXA 3BBYA 3WGDA 1Q98A 2H0HA 4G0LA 4WKWA 1JLWA 4HOJA 1O7UA 2P5RA 5B7CA 1A24A 1ZGNA 1GLPA 4K2DA 5G1KA 4GF0A 14GSA 1YF1A 5DALA 2AAWA 4DEJA 1BX9A 2RUFA 4RI7A 1HNBA 4AGSA 1SKWB 4Q5QA 1AQWA 2NTOA 2JZTA 2L6DA 2QSIA 2MMAA 5J3RA 4PUAA 1FVKA 4I2TA 3GIXA 2R4VA 4WF4A 3QD9A 3DGQA 4KA0A 1XWAA 3ZRDA 3GL3A 3DIEA 1J08A 4IJ3A 2CV4A 2IFQB 4TR0A 4DSQA 3GURA 5EPFA 5DCGA 2CZ2A 3WD6A 4L5LA 1O6JA 4JE1A 1ZZYA 2C3NA 4K7IA 1EOHA 1T7PB 2WGRA 1B4QA 3FZ5A 2H6YA 2VL9A 2C0EA 2XHFA 4JEDA 4ZB8A 1NHYA 4IGJA 5CRDA 3C71A 5JCWA 1ABAA 3FKFA 5ECQB 2V2GA 5ECIB 3UJ1A 3ZMKA 3LXTA 4YQUA 2MZCA 3FW2A 1Z9HA 4K9ZA 4ECBA 2F9SA 2HI7A 2WS2A 2K6VA 1MDKA 4MJBA 4NV5A 1OE7A 1W4VA 4V1Ag 1GSFA 4XRAA 3G7IA 3LSZA 4TXOB 2GQLA 2V41A 4YQMA 3F6FA 1W89A 2V6KA 1TXXA 3DEXA 17GSA 3FZ9A 5GAND 1FB6A 3HD5A 5G31A 4GRFA 3IBHA 3PR8A 5ECPB 4ZL8A 5G1LA 5AIVA 1A0FA 3VLNA 3H1NA 3KH9A 3DMLA 1Q4JA 2B1LA 2HE3A 4KF9A 1S3DA 3VWXA 1EGOA 1GH2A 4BL7B 3ZREA 2VCXA 2R5GA 4FQUA 2VOCA 1U3IA 3LWAA 2FCHA 1GULA 1ERTA 3PGTA 3KD0A 2C1YA 5CAXA 4KX4A 4ML6A 3J7Yb 1A8YA 1USBA 5EVOA 1MD4A 3F63A 4MMMA 2HLSA 5L71A 3KMOA 3F9UA 4NHZA 2HSNB 2HRAA 4EXJA 3HVVA 4MPFA 3TOUA 2CVBA 2F51A 1DE2A 1X0RA 2LNTA 5A4UA 3F3RA 2VUPA 2BMXA 3TKPA 1KBNA 4F9ZA 2FLSA 1GP1A 3QMXA 5DJMA 2RIIA 3FR6A 4KDYA 5ECOB 2D2ZA 4LA1A 1EP7A 2N5AA 1GSUA 5DALB 1V40A 2NVLA 1QMVA 3HJPA 4ZBBA 3V1WA 4F03A 1JZOA 5DAKA 5CNWA 3ZL5A 1TP9A 4OD7A 2YWNA 3F0IA 4GQCA 2VCVA 5INYA 4QQ7A 3TJGA 4HU7A 1ZOFA 3MDKA 3IHQA 2FD3A 5D9XA 3LJRA 4XS1A 4KGIA 2FHEA 3TDGA 2VLUA 3F3QA 1TRUA 1K0MA 4ECJA 3TKRA 4XS4A 3GKKA 4F0BA 3I43A 3CBUA 1GRXA 2XBIA 4EL1A 3QDNA 4WF5A 2AYTA 5CREA 3QR6A 1R5AA 3L0HA 4O7HA 4PX1A 1QQ2A 3TOTA 5J9BA 1ZYEA 1MEKA 2AJQB 1VF4A 4KCEA 6GSYA 3KH7A 1A2JA 4IP1A 3ZLPA 2K8SA 4PNFA 4N11A 5DVBA 3ED3A 1RK4A 2R3XA 1ST9A 1TKDB 3QFBC 3KJYA 4D73A 1T00A 2IN3A 4V2LA 2ON5A 2E7PA 2IJYA 3EURA 4NPBA 4AJ8A 1B48A 1VRSD 1YEPA 1HNCA 1TK0B 18GSA 5D9VA 3TJBA 2CVDA 2R6KA 3LFLA 3UBLA 4JR6A 1R7HA 4PUFC 1EEJA 3H4KA 3DVXA 1LJRA 1K3LA 19GSA 3MWHA 1VF2A 3DVWA 4ZL9A 5B8AA 5D8IA 4HEA2 1EP8A 1V9WA 4NV2A 1TI3A 2KP1A 1YJ6A 2K8VA 2WZ9A 1JZDA 2HZEA 2DJ3A 1GUKA 4LLRA 3FY7A 3MAKA 2H1GA 4HJMA 5HFGA 5KN3A 2M80A 1G0TA 2H72A 2L59A 1WWJA 2VM2A 2ALBA 2C80A 2DBCA 5GZZB 5IQYA 1SL1B 3TKSA 2GSRA 1O81A 1T3BA 4HDEA 3WT2A 3ME7A 3QAVA 1XW5A 1TK8B 3LEFA 3KZQA 5F8BA 4TOPA 2GVPA 2HSHA 9GSSA 3N9JA 3RAZA 1PL1A 2CX4A 3M1GA 3EU3A 2IL3A 2WULA 4DVCA 2GGTA 1TK5B 3RHCA 2B7JA 1SK1A 4O5RA 3O6TA 4POKA 2AV4A 1R4WA 4KDXA 4ECCA 4XS4B 3M8NA 2O89A 4WR4A 3H93A 2IFQA 2QKEA 4ZXGA 4NXIA 2TIRA 2DIZA 2TRCP 2DJJA 2X64A 1V57A 2OE1A 1XZOA 2LJKA 1LU4A 4WBJA 4I6XA 3CTFA 1AW9A 5A4VA 1XWKA 3UARA 3Q19A 4JRRA 3VWUA 4GQFA 1SJ6A 2V32A 4IKHA 4K7OA 2YZUA 5DCHA 4D73B 4TR4A 1SU9A 4RQXA 4HQZA 2H0IA 2PWJA 6GSXA 2VM1A 4E8EA 3MSZA 2VL2C 3QAGA 1S3CA 2YWMA 4MZWA 3I9V2 2IMKA 3HJMA 3IC4A 1QK8A 3ZIJA 3C1SA 1FG4A 3NIVA 2LRNA 2B5YA 3IA1A 4G0KA 1VF3A 1NM3A 3ME8A 4POBA 3ZIVA 1XOBA 3KMNA 4F82A 2LJRA 4POMA 4OWYA 2L5OA 5ECHB 3TJKA 3RPNA 3UVHA 2MYGA 3EE2A 3GMFA 4AJ6A 3TRXA 1SJIA 4F2IA 2HZEB 5DQSA 3A2VA 4K1FA 4J2FA 5CRWA 4BWQA 2YCDA 3U5RE 1THOA 3IC8A 4POLA 3C1RA 4IQAA 3H79A 4WR5A 2H1AA 1OVNA 3ZVJD 5H5QA 5IOWA 2XBQA 5AN1A 4KAEA 2RM6A 4TVEA 2CAQA 1O85A 2QGVA 3TJFA 3ERFA 2DIYA 4O92A 4I5QA 2E2MA 4ID0A 1J9BA 3HCZA 1EGRA 1MDIA 2LTKA 3O3TA 2C0FA 2GDRA 3UVTA 2JSZA 5F06A 2VCTA 4K8MA 4OFNA 4HZ2A 5HR0A 1G6YA 2REMA 4FIWA 4OO5A 2A2SA 5IMAA 5CRGA 4BVYA 2TRXA 1DUGA 1X5DA 3UL3A 1PA3A 1SL0B 3K8NA 3LYPA 2F8FA 1F6MC 4HZ4A 1FB0A 2PPTA 5J5NA 4KW6A 4BA7A 4J56E 4TKYA 3KGKA 3KCMA 4MA9A 5GSTA 2H73A 3CXGA 3LYKA 3EMPA 2EIOA 2KLXA 5KEJA 3IAM2 1AIUA 1UVZA 3G9BA 4MZCA 3ZVJA 1K3OA 2HT9A 3IV4A 1N8JA 1EOGA 3PPUA 1J0FA 3EVIA 1XOAA 1GUHA 3UAPA 4EVMA 4FYCA 2H1BA 1T8EB 4IELA 3NZNA 1YZXA 3GKNA 1GSDA 1WP0A 2YJHA 3D0ZA 3HVXA 5E4WA 12GSA 2GZZA 2YWIA 4YAVA 4OFMA 4IHUA 2OE3A 3O76A 4ECIA 4IP6A 5JWOB 5JCUA 2X8CA 1RW1A 1YKCA 3KXOA 5EY6A 4P3YB 3ZFLA 1TDIA 2K9FA 5D9WA 3C7MA 3CMIA 4EO3A 1ERUA 3E3EA 2YP6A 2JSYA 5D73A 4ML1A 4L8EA 3HXSA 3TRPA 8GSSA 2IMFA 2NBSA 1TI1A 3L9VA 5GAPD 1U88A 3FK8A 1S3AA 4LMVA 2HYXA 4HJ2A 4I8BA 2FWEA 1A2LA 3RHBA 20GSA 2MMNA 5H5SA 3GA4A 1Z6MA 3KEBA 2JADA 3CRTA 4Q5FA 3M3MA 2I81A 3FHKA 4O32A 2I4AA 1LBKA 4FH8A 1R5PA 4Q5RA 3ZFBA 3KM6A 4MF7A 1M9BA 1ZCPA 4XTSA 1XFLA 2UZ8A 3FR3A 2I3YA 4E8HA 3DWVA 1PKZA 4IQ1A 1X5EA 1BJXA 1F9MA 2H8LA 3GX0A 2HRNA 3S9FA 4BVYB 2H75A 3HZ8A 3L9UA 1I5GA 2GTUA 2M72A 2WDUA 4XIHA 1PMTA 1N2AA 2ZNMA 4LL4B 3LGCA 2GZYA 1K0AA 1JZWA 5G2ZA 2H1DA 1XW9A 3SBCA 5HR2A 1B8XA 4KSOA 4MK3A 3WGEA 4FYUA 1FHEA 2GLRA 2H66A 3I69A 2VCWA 4KUNA 3TB2A 4TN8A 5ECRB 3TUEA 5CP1A 2L4CA 3HHVA 2YZHA 5ECNB 5CO3A 1PX6A 3BCIA 3C73A 5B8BA 3BJ5A 1EEMA 1BYEA 2LS5A 3HJOA 1WMJA 2DJ2A 4G2EA 2LEGA 2VCZA 1EV4A 1QXHA 4IN0A 1V2AA 1GTAA 2HQTA 4PURA 3D6IA 2C3QA 1TRSA 1Y25A 2N5BA 3VURA 5ECKB 4HU9A 3TKQA 2G0FA 4ZL7A 1KEBA 1ZYQB 3FZ4A 2GT5A 2AB6A 2MMZA 3W8SA 1BQ7A 1RQMA 3VI7A 3DD3A 3APOA 2DJKA 1NHOA 1GTBA 1A23A 4MH2A 3KP8A 2LQOA 1ML6A 2M46A 2GSSA 3GL5A 3I6AA 2OACA 1X9MB 2V6OA 3TJJA 2R2JA 4WBRD 2GSQA 5IMVA 1ACVA 3IR4A 2YNXA 1GL8A 3PH9A 1AQVA 1V98A 1IYHA 2YV7A 4JBBA 2FA4A 1O8WA 5F07A 2KHPA 4QL7A 2HFDA 3TGZA 2VO4A 2CVKA 5LD0A 1R26A 13GSA 1QUWA 2GQMA 2ZCTA 3D22A 3QAWA 1M9AA 3P2AA 1Y6EA 3VK9A 1Z7RA 3ZMLA 5AISA 4F0CA 3A5WA 2A4VA 3FYGA 4TXVA 1E6BA 2HSMA 2EC4A 2VCQA 4K0NA 3D4TA 4EE0A 1PKWA 2B5EA 3AY8A 1K0NA 1H4OA 4G0IA 5J41A 2H6XA 3US3A 4DSRA 4TR1B 4PQ1A 5HQPA 1GNEA 3QPMA 1C72A 1GTIA 3GH9A 3BOAA 3JCML 4CW9A 3Q74A 1SD8A 4GTUA 1OAZA 3GKXA 2F3MA 2PU9C 1TU7A 4LMWA 4N10A 3HY2A 1U3AA 1OYJA 5LNKe 1B9XC 11GSA 2LKUA 3P90A 3DKSA 4BPYA 5LCZA 2L4QA 4JR4A 3UBKA 1M2BA 3CYNA 2IMEA 5HR1A 3GKMA 1GSEA 4CDOA 5HFIA 3RPPA 4X1UA 4XS6A 1M2AA 3EMXA 4N30A 1HNAA 2ON7A 1G7EA 2CA8A 3HYPA 4LL1B 1ILOA 1X5CA 3D21A 2JZRA 2H01A 2IPAA 4OCFA 2L6CA 2EIRA 5G5EA 4H86A 2YANA 2LNSA 4AJ7A 1TJDA 3CSJA 3GSSA 1ZMAA 2FA8A 3EYTA 2PVQA 3J7Yk 1KTEA 1TRVA 1AXDA 4ILFA 1T4ZA 1TU8A 1A2MA 3CSHA 3R2QA 3F8UA 5BMUA 3FR9A 1WPIA 2B7KA 4HUAA 2FNOA 3DYRA 5A5KA 1PD21 5IIZA 4FO5A 5CYYA 3KP9A 4EF0A 3HZ4A 2WRTA 10GSA 4HI7A 2WJUA 5IPHA 5KN0A 5ABRA 2YV9A 5F0GA 4ZBAA 1PL2A 2DC5A 4IJIA 4HS1A 1GUMA 1F37A 5A4WA 1XWGA 2IMDA 2E0QA 1B4PA 1F3BA 4V2NA 2P5QA 5ECLB 1FAAA 1SD9A 2GT6A 3L9SA 1SK0A 3TRQA 2JZSA 4XRDA 1F2EA 3NOFA 4G9HA 2HSMB 5KN2A 1ERVA 2L5LA 3QFAC 4I2UA 4GSTA 3L4NA 1YDKA 3UOMA 1OC3A 1NW2A 2I1UA 22GSA 1K3YA 4IBPA 3LXZA 3F4TA 1EWXA 3GV1A 3U6VA 2FUG2 3RDWA 2HXKA 3SWLA 2LRTA 3G7YA 2F8AA 4MDCA 1GSQA 1X9SB 3IAS2 4X0XA 1Z6NA 2LRCA 4KB3A 1Z3EA 1T4YA 3IK9A 2FGXA 4L0WA 3RBTA 6GSWA 1SK2A 1QGVA 1YQ1A 2VLTA 3IRAA 2RM5A 3M9KA 2MMOA 4GCIA 2OADA 4PXOA 4BVXB 1GNWA 1SJZA 2OBIA 1JHBA 1VF1A 1MD3A 2OA7A 3CTGA 2GZPA 1A0RP 4MF6A 1KNGA 5IOXA 3UIWA 4EC0A 5HFKA 4EDYA 3HKRA 1SKRB 4N0ZA 2LJAA 4FYBA 3UEMA 2XC2A 4DSSA 3F6DA 5IO2A 1OC9B 1K0BA 4IVFA 2C4JA 2H76A 5GSSA 1AUCA 3KTBA 2B1KA 6GSVA 3LQ7A 4GSNA 1WJKA 2DSAA 3GTUA 1BEDA 4OFTA 2P31A 4X43A 2X99A 2JU5A 2HSYA 3A2WA 3WYWA 4Z7XA 2OBKA 2HRKA 3LG6A 1XBSA 2H74A 3ERWA 2GQKA 1E2YA 2LQQA 5ENUA 3MNGA 1CQHA 2RUEA 1OC8A 1TOFA 1WE0A 4RI6A 1AAZA 3WGXA 2KOKA 2H6ZA 4JU5A 5J4UA 2J9HA 1O8XA 1K0OA 1XWBA 5JWQB 1TW9A 4MJCA 4NAXA 3DXBA 2ES7A 1FOVA 3PINA 4KSMA 2PBJA 1A8LA 1WOUA 2FY6A 3ISOA 3CRUA 4J57E 2YJ7A 1XIYA 5DDLA 1XW6A 1YY7A 2C0DA 3VI5A 1UC7A 3D5JA 3N5OA 1GWCA 5IMFA 1F3AA 3HDCA 1FO5A 4RUVA 3F4SA 3GRXA 1BG5A 2C3TA 6GSSA 4PNGA 4TW5A 2V1MA 6GSTA 1MDJA 2AUVA 4KDUA 5ID2A 2GS3A 4RQRA 2VLVA 1SL2B 3Q6OA 2H70A 3E0UA 2O7KA 3IPZA 1SENA 4YAPA 5F05A 1XVQA 3VPTA 4NHWA 4OCEA 5JWRB 1NSWA 2PUKC 4IW9A 5DBQA 2A2RA 3EWLA 2PMTA 3TKSE 2YN1A 4OO4A 2ZUPA 2C8UA 5FWGA 1O73A 2OE0A 2AHEA 4ZB6A 1YF0A 3EINA 2QC7A 1PX7A 2O85A 2DMLA 1V58A 2R37A 3M9JA 2HNLA 3WT1A 1GLQA 3OR5A 2PERA 4TR1A 2CT6A 2O87A 2G2QA 4G19A 3GN3A 2C0GA 3QCPA 1XVWA 2YWOA 1DE1A 2PGTA 2PVOC 5B6NA 4PTSA 2X8HA 3VWWA 1URMA 3IXRA 2B5XA 1X9WB 4WXTA 3IDVA 3P7XA 1K0CA 1GSYA 4XHMA 2WCIA
chains in the Genus database with same CATH superfamily
3GNJA 3Q18A 1THXA 4NMUA 2LV3A 3LORA 3VFIA 2LUSA 4AF2A 3UMAA 1JLVA 5ECMB 3BCKA 4NWYA 5D93A 3EU4A 5IMZA 5G30A 2VD0A 5ELAA 1DSBA 2CQ9A 2XPEA 4CY6A 1K0DA 3ZZXA 4DSSB 4WETA 4EDZA 1UA5A 2RLIA 1PGTA 5IM9A 5BRTA 2IWTA 3HVSA 3L78A 4CHSA 3GTUB 3GH6A 3IK7A 4JZQA 5FHIA 2VAFA 2WB9A 2BJXA 1ON4A 1YEXA 2HRKB 1H75A 3GFKA 4G10A 2P0GA 2YOIA 2VIMA 4L0UA 5KN1A 4O5QA 3VPQA 2EIQA 1BAYA 2VL2A 2N5FA 4K0GA 2O5VA 5DJLA 1SYXA 3E9JB 3APQA 3QOUA 2WFCA 2B6MA 4N0VA 1I9DA 2NDOA 3IHGA 5JCGA 3FEUA 2WVYA 5HR3A 2CAIA 4EIPA 1UN2A 3CWGA 4KNDA 2PN8A 5C04A 3A2XA 2WW0A 2A2PA 2I9HA 1DBYA 1M99A 4GXZA 2OKAA 5B6MA 1OKTA 2HZFA 4ZIJA 1XCCA 2IMIA 1PSQA 3ZITA 4MZBA 3W8JA 1EV9A 2DJ0A 1Y1UA 1HYUA 5ID2B 1Z5YE 4ISDA 2IIYA 1AC1A 7GSSA 1XG8A 5COHA 1PQNA 1AQXA 4MJAA 3F4RA 4MH3A 2FWHA 5DQYA 2JL4A 3GUSA 1SKSB 2DKIA 2O8VB 1G7OA 2H0GA 1MTCA 1JFUA 4X4JA 3R3EA 4HQSA 1JZRA 1ZYNA 3C8EA 2CZ3A 2WVZA 4EUYA 2LSTA 5AGYA 5J9CA 4GLTA 5FT3A 2J23A 3HMJG 3GYKA 1XWCA 1HD2A 3IOSA 3FMWA 1OKDA 5EL8A 5DAKB 4V1Ap 4K5RA 3ZYWA 1ERWA 2B3SA 5E59A 2VL3A 1TXUA 4L5OA 2X49A 5ECSA 2KP2A 4Z2UA 4MJEA 4USSA 4EKZA 4Q5NA 1VGLA 2CX3A 4QL9A 4ZILA 4G01A 4PGTA 3M0FA 1M0UA 1U87A 4IS0A 5IO0A 5H5RA 4TR3A 4ULXA 4BVXA 1OE8A 4ACSA 2KUCA 5D96A 4ZBDA 1GTUA 2MBTA 5IMCA 4K6XA 3GX8A 1GSSA 1SYRA 3FRCA 5D9TA 3W6GA 2BTOT 1OC9A 2MBSA 1WIKA 2GSTA 4EIQA 3GHAA 4MABA 3LW9A 1TTZA 4KE3A 1PN9A 1G6WA 5IMDA 1QFNA 2Z9SA 2FWGA 1FVJA 4TXOA 4PQIA 2XPDA 1XXUA 3VWVA 4GSSA 4TRXA 1TRWA 1U6TA 2DMMA 3TCOA 2H30A 3D4MA 1WRYA 1B9YC 4ZB9A 4MP4A 1T1VA 4WEYA 2OJLA 1Z7PA 4YH2A 5ELGA 1XPVA 4MF5A 1PRXA 4PQHA 4KH7A 1YKAA 4K7NA 5IPGA 3APSA 4MLYA 4BL7A 3CSIA 2H19A 2FWFA 3H8QA 3FZAA 3DRNA 3KIJA 4BWSA 4E68A 5CRHA 2X8GA 3ERGA 4A5PA 2H71A 2YPMA 2DJ1A 3G7JA 2K18A 3BD2A 2HRFA 1IYIA 1M2DA 4XCSA 3KTLA 4MCUA 1HQOA 3HA9A 1CQGA 3ZTLA 2L57A 4MPGA 3GSTA 3IE3A 1EZKA 1ZL9A 2DLXA 3A3TA 3EC3A 3TKSC 16GSA 2NPBA 5G5FA 1M7TA 4OMVA 4KCAA 2O3EA 2VD1A 5C00A 3P8WA 4GWRA 2E2GA 4V2MA 2JACA 6GSUA 1FW1A 4YQVA 4I97A 5AIXA 3BBYA 3WGDA 1Q98A 2H0HA 4G0LA 4WKWA 1JLWA 4HOJA 2EFCA 1O7UA 2P5RA 5B7CA 1A24A 1ZGNA 1GLPA 4K2DA 5G1KA 4GF0A 14GSA 1YF1A 5DALA 2AAWA 4DEJA 5J47A 1BX9A 2RUFA 4RI7A 1HNBA 4AGSA 1SKWB 4Q5QA 1AQWA 2NTOA 2JZTA 2L6DA 2QSIA 2MMAA 5J3RA 4PUAA 1FVKA 4I2TA 3GIXA 2R4VA 4WF4A 3QD9A 2R0GA 3DGQA 4KA0A 1XWAA 3ZRDA 3GL3A 3DIEA 1J08A 4IJ3A 2DKHA 2CV4A 4PI2C 2IFQB 4TR0A 4DSQA 3GURA 5EPFA 5DCGA 2CZ2A 3WD6A 4L5LA 1O6JA 4JE1A 1ZZYA 2C3NA 4K7IA 1EOHA 1T7PB 2WGRA 1B4QA 3FZ5A 2H6YA 2VL9A 2C0EA 2XHFA 4JEDA 4PHZC 4ZB8A 1NHYA 4IGJA 5CRDA 3C71A 5JCWA 1ABAA 3FKFA 5ECQB 2V2GA 5ECIB 3UJ1A 3ZMKA 3LXTA 4YQUA 2MZCA 1SVOA 3FW2A 1Z9HA 4K9ZA 4FXYP 4ECBA 2F9SA 2HI7A 2WS2A 2K6VA 1MDKA 4MJBA 4NV5A 1OE7A 1W4VA 4V1Ag 1GSFA 4XRAA 3G7IA 3LSZA 3MYDA 4TXOB 2GQLA 2V41A 4YQMA 3F6FA 1W89A 2V6KA 1TXXA 3DEXA 17GSA 3FZ9A 5GAND 1FB6A 3HD5A 5G31A 4GRFA 3IBHA 1BF5A 3PR8A 5ECPB 4ZL8A 5G1LA 5AIVA 1A0FA 3VLNA 3H1NA 3KH9A 3DMLA 1Q4JA 2B1LA 2HE3A 4KF9A 1S3DA 2X4AA 3VWXA 1EGOA 1GH2A 4BL7B 3ZREA 2VCXA 2R5GA 4FQUA 2VOCA 1U3IA 3LWAA 2FCHA 1GULA 1ERTA 3PGTA 3KD0A 2C1YA 5CAXA 4KX4A 4ML6A 3J7Yb 1A8YA 1USBA 5EVOA 1FOHA 1MD4A 3F63A 4MMMA 2HLSA 5L71A 3KMOA 3F9UA 4NHZA 2HSNB 2HRAA 4EXJA 3HVVA 4MPFA 3TOUA 2CVBA 2F51A 1DE2A 1X0RA 2LNTA 5A4UA 3F3RA 2VUPA 2BMXA 3TKPA 1KBNA 4F9ZA 2FLSA 1GP1A 3QMXA 5DJMA 1YVLA 2RIIA 3FR6A 4KDYA 5ECOB 2D2ZA 4LA1A 1EP7A 2N5AA 1GSUA 5DALB 1V40A 2NVLA 4HSCX 1QMVA 3HJPA 4ZBBA 3V1WA 4F03A 1JZOA 5DAKA 5CNWA 3ZL5A 1TP9A 4OD7A 2YWNA 2QA2A 3F0IA 4GQCA 2VCVA 5INYA 4QQ7A 3TJGA 4HU7A 1ZOFA 3MDKA 1I1IP 3IHQA 2FD3A 5D9XA 3LJRA 4XS1A 4KGIA 2FHEA 3TDGA 2VLUA 3F3QA 1TRUA 1K0MA 4ECJA 3TKRA 4XS4A 3GKKA 4F0BA 3I43A 3CBUA 1GRXA 2XBIA 4EL1A 3QDNA 4WF5A 2AYTA 5CREA 3QR6A 1R5AA 3L0HA 4O7HA 4PX1A 1QQ2A 3TOTA 5J9BA 1ZYEA 1MEKA 2AJQB 1VF4A 5J4YA 4KCEA 6GSYA 3KH7A 1A2JA 4IP1A 3ZLPA 2K8SA 4BIKA 4PNFA 4N11A 5DVBA 3ED3A 1RK4A 2R3XA 1ST9A 1TKDB 3QFBC 3KJYA 4D73A 1T00A 2IN3A 4V2LA 2ON5A 2E7PA 2IJYA 3EURA 4NPBA 4AJ8A 1B48A 1VRSD 1YEPA 1HNCA 1TK0B 18GSA 5D9VA 3TJBA 2CVDA 2R6KA 3LFLA 3UBLA 4JR6A 1R7HA 4PUFC 1EEJA 4ICYA 3H4KA 3DVXA 1LJRA 1K3LA 4CY8A 19GSA 3MWHA 1VF2A 3DVWA 4ZL9A 5B8AA 5D8IA 4HEA2 1EP8A 1V9WA 4NV2A 1TI3A 2EFDA 2KP1A 1YJ6A 2K8VA 4YKFA 2WZ9A 1JZDA 2HZEA 2DJ3A 1GUKA 4LLRA 3FY7A 3MAKA 2H1GA 4HJMA 4Z2TA 5HFGA 5KN3A 2M80A 1G0TA 2H72A 2L59A 1WWJA 2VM2A 2ALBA 2C80A 2DBCA 5GZZB 5IQYA 1SL1B 3TKSA 2GSRA 1O81A 1T3BA 4HDEA 3WT2A 3ME7A 3QAVA 1XW5A 1TK8B 3LEFA 3KZQA 5F8BA 4TOPA 2GVPA 2HSHA 9GSSA 3N9JA 1M3IA 3RAZA 1PL1A 2CX4A 3M1GA 3EU3A 2IL3A 2WULA 4DVCA 2GGTA 1TK5B 3RHCA 2B7JA 1SK1A 4O5RA 3O6TA 4POKA 2AV4A 1R4WA 4KDXA 4ECCA 4XS4B 3M8NA 2O89A 4W66A 4WR4A 3H93A 2IFQA 2QKEA 4ZXGA 4NXIA 2TIRA 2DIZA 2TRCP 2DJJA 2X64A 5A1NA 2R0CA 1V57A 2OE1A 1XZOA 2LJKA 1LU4A 4WBJA 4I6XA 3CTFA 2QA1A 1AW9A 5A4VA 1XWKA 3UARA 3Q19A 4JRRA 3VWUA 4GQFA 1SJ6A 2V32A 4AKGA 4IKHA 4K7OA 2YZUA 5DCHA 4D73B 4TR4A 1SU9A 4RQXA 4HQZA 2H0IA 2PWJA 6GSXA 2VM1A 4E8EA 3MSZA 2VL2C 3QAGA 1S3CA 2YWMA 4MZWA 3I9V2 2IMKA 3HJMA 3IC4A 2VKZG 1QK8A 3ZIJA 3C1SA 1FG4A 3NIVA 2LRNA 2B5YA 3IA1A 4G0KA 1VF3A 1NM3A 3ME8A 4POBA 3ZIVA 1XOBA 3KMNA 4F82A 2LJRA 4POMA 1SVMA 4OWYA 2L5OA 5ECHB 3TJKA 3RPNA 3UVHA 2MYGA 3EE2A 3GMFA 4AJ6A 3TRXA 1SJIA 4F2IA 2HZEB 5DQSA 3A2VA 4K1FA 4J2FA 5CRWA 4BWQA 2YCDA 3U5RE 1THOA 3IC8A 2HSNA 3RGBC 4POLA 3C1RA 4IQAA 3H79A 4WR5A 2H1AA 1OVNA 3ZVJD 5H5QA 5IOWA 2XBQA 5AN1A 4KAEA 2RM6A 4TVEA 2CAQA 1O85A 4K2XA 4AI6A 2QGVA 3TJFA 3ERFA 2DIYA 4O92A 4I5QA 2E2MA 4ID0A 1J9BA 3HCZA 1M3JA 1EGRA 1MDIA 2LTKA 3O3TA 2C0FA 2GDRA 4PI0C 3UVTA 2JSZA 5F06A 2VCTA 4YKGA 4K8MA 4OFNA 4HZ2A 5HR0A 1G6YA 3RFRC 2REMA 4FIWA 4OO5A 2A2SA 2WW2A 2WW1A 5IMAA 2EFEA 4Z2RA 5CRGA 4BVYA 2TRXA 1DUGA 1X5DA 3UL3A 1PA3A 1SL0B 3K8NA 3LYPA 2F8FA 1F6MC 4HZ4A 1FB0A 3CQFA 2PPTA 5J5NA 4KW6A 4BA7A 5A1NB 4J56E 4TKYA 3KGKA 3KCMA 4MA9A 5GSTA 2H73A 4ZB7A 3CXGA 3LYKA 3EMPA 2EIOA 2KLXA 5KEJA 3IAM2 1AIUA 1UVZA 3G9BA 4MZCA 3ZVJA 1K3OA 2HT9A 3IV4A 1YEWC 1N8JA 1EOGA 3PPUA 1J0FA 3EVIA 1XOAA 1GUHA 3UAPA 4EVMA 5J40A 4FYCA 2H1BA 1T8EB 4IELA 3NZNA 1YZXA 2WVXB 3GKNA 5A5HA 1GSDA 1WP0A 2YJHA 3D0ZA 3HVXA 5E4WA 12GSA 2GZZA 2YWIA 4YAVA 4OFMA 4IHUA 2OE3A 1SVLA 5BMUB 3O76A 4ECIA 4IP6A 5JWOB 5JCUA 2X8CA 1RW1A 1YKCA 3KXOA 5EY6A 4P3YB 3ZFLA 1TDIA 2K9FA 5D9WA 3C7MA 3CMIA 4EO3A 4GDFA 1ERUA 3E3EA 2YP6A 2JSYA 5D73A 4ML1A 4L8EA 3HXSA 3TRPA 8GSSA 2IMFA 2NBSA 1TI1A 3L9VA 5GAPD 1U88A 3FK8A 1S3AA 4LMVA 2HYXA 4HJ2A 4I8BA 2FWEA 1A2LA 3RHBA 20GSA 2MMNA 5H5SA 3GA4A 1Z6MA 3KEBA 2JADA 3CRTA 4Q5FA 3TU3B 3M3MA 2I81A 5A34A 3FHKA 4O32A 2I4AA 1LBKA 4FH8A 1R5PA 4Q5RA 3ZFBA 4N3ZA 3KM6A 4MF7A 1M9BA 1ZCPA 4XTSA 1XFLA 2UZ8A 3FR3A 2I3YA 4E8HA 3DWVA 1PKZA 4MNNA 4IQ1A 1X5EA 1BJXA 2UV8G 1F9MA 2H8LA 3GX0A 2HRNA 3S9FA 4BVYB 2H75A 3HZ8A 3L9UA 1I5GA 2GTUA 2M72A 2WDUA 4XIHA 1PMTA 1N2AA 2ZNMA 4LL4B 3LGCA 2GZYA 1K0AA 5KOXA 1JZWA 5G2ZA 2H1DA 1XW9A 3SBCA 2OT3A 5HR2A 1B8XA 4KSOA 4MK3A 3WGEA 4FYUA 1FHEA 2GLRA 2H66A 3I69A 2VCWA 4KUNA 3EPTA 3TB2A 4TN8A 5ECRB 3TUEA 5CP1A 2L4CA 3HHVA 2YZHA 5ECNB 5CO3A 1PX6A 3BCIA 3C73A 1PN0A 5B8BA 3BJ5A 1EEMA 1BYEA 5A5HB 2LS5A 3HJOA 1WMJA 2DJ2A 4G2EA 5J4VA 2LEGA 2VCZA 1EV4A 1QXHA 4IN0A 1V2AA 1GTAA 2HQTA 4PURA 3D6IA 2C3QA 1TRSA 1Y25A 2N5BA 3VURA 5ECKB 4HU9A 3TKQA 2G0FA 4ZL7A 1KEBA 1ZYQB 2WW3A 3FZ4A 2GT5A 2AB6A 2MMZA 1S4BP 3W8SA 1BQ7A 1RQMA 3VI7A 3DD3A 3APOA 2DJKA 1NHOA 1GTBA 1A23A 4MH2A 3KP8A 2LQOA 1ML6A 2M46A 2GSSA 3GL5A 3I6AA 2OACA 1X9MB 2V6OA 3TJJA 2R2JA 4WBRD 2GSQA 5IMVA 1ACVA 3IR4A 2YNXA 1GL8A 3PH9A 3MIXA 1AQVA 1V98A 1IYHA 2YV7A 4JBBA 2FA4A 1O8WA 5F07A 2KHPA 4QL7A 2HFDA 3TGZA 2VO4A 2CVKA 5LD0A 5A34B 1R26A 13GSA 1QUWA 2GQMA 2ZCTA 3D22A 3QAWA 1M9AA 3P2AA 1Y6EA 3VK9A 1Z7RA 3ZMLA 4AKXB 5AISA 4F0CA 3A5WA 2A4VA 3FYGA 4TXVA 1E6BA 2HSMA 2EC4A 2VCQA 4K0NA 3D4TA 4EE0A 1PKWA 2B5EA 3AY8A 1K0NA 4AKHA 1H4OA 4G0IA 5J41A 4AKIA 2H6XA 3US3A 4DSRA 4TR1B 4PQ1A 5HQPA 2O36A 1GNEA 4O5UA 3QPMA 1C72A 1GTIA 3GH9A 3BOAA 3JCML 4CW9A 3Q74A 1SD8A 4GTUA 1OAZA 3GKXA 2F3MA 2PU9C 1TU7A 4K5SA 4LMWA 4N10A 3HY2A 1U3AA 1OYJA 5LNKe 1B9XC 11GSA 2LKUA 3P90A 3DKSA 4BPYA 5LCZA 2L4QA 4JR4A 3UBKA 1BG1A 1M2BA 3CYNA 2IMEA 5HR1A 3GKMA 1GSEA 4CDOA 5HFIA 3RPPA 4X1UA 4XS6A 1M2AA 3EMXA 4N30A 1HNAA 2ON7A 1G7EA 2CA8A 3HYPA 4LL1B 3A5IA 1ILOA 1X5CA 3D21A 2JZRA 2H01A 2IPAA 4OCFA 3CHXC 2L6CA 2EIRA 5G5EA 2WVXA 4H86A 2YANA 2LNSA 4AJ7A 1TJDA 3CSJA 3GSSA 1ZMAA 2FA8A 3EYTA 2PVQA 3J7Yk 1KTEA 2EFHA 1TRVA 1AXDA 4ILFA 1T4ZA 1TU8A 1A2MA 3CSHA 3R2QA 3F8UA 5BMUA 3FR9A 1WPIA 2B7KA 4HUAA 2FNOA 3DYRA 5A5KA 1PD21 5IIZA 4FO5A 2R0PA 5CYYA 3KP9A 4EF0A 3HZ4A 2WRTA 10GSA 4HI7A 2WJUA 5IPHA 5KN0A 5ABRA 2YV9A 5F0GA 4ZBAA 1PL2A 2DC5A 4IJIA 4HS1A 1GUMA 1F37A 5A4WA 1XWGA 2IMDA 2E0QA 1B4PA 1F3BA 4V2NA 2WZSA 1S3RA 2H1LA 2P5QA 5ECLB 1FAAA 1SD9A 2GT6A 3L9SA 1SK0A 3TRQA 2JZSA 4XRDA 1F2EA 3NOFA 4G9HA 2HSMB 5KN2A 1ERVA 2L5LA 3QFAC 4I2UA 4GSTA 3L4NA 1YDKA 3UOMA 1OC3A 1NW2A 2I1UA 22GSA 1K3YA 4IBPA 3LXZA 3F4TA 1EWXA 3GV1A 3U6VA 2FUG2 3RDWA 2HXKA 3SWLA 2LRTA 3G7YA 2F8AA 4MDCA 1GSQA 1X9SB 3IAS2 4X0XA 1Z6NA 2LRCA 4KB3A 1Z3EA 1T4YA 3IK9A 2FGXA 4L0WA 3RBTA 6GSWA 1SK2A 1QGVA 1YQ1A 2VLTA 3IRAA 2RM5A 3M9KA 2MMOA 4GCIA 2OADA 4PXOA 4BVXB 1GNWA 1SJZA 2OBIA 1JHBA 1VF1A 1MD3A 2OA7A 3CTGA 2GZPA 1A0RP 4MF6A 5KOWA 1KNGA 5IOXA 3UIWA 4QMKA 4EC0A 5HFKA 4EDYA 3HKRA 1SKRB 4N0ZA 2LJAA 4FYBA 3UEMA 2XC2A 4DSSA 3F6DA 5IO2A 1OC9B 1K0BA 3HVNA 4IVFA 2C4JA 2H76A 5GSSA 1AUCA 3KTBA 2B1KA 6GSVA 3LQ7A 4GSNA 1WJKA 2DSAA 3GTUA 1BEDA 4OFTA 2P31A 4X43A 2X99A 2JU5A 2HSYA 3A2WA 3WYWA 4Z7XA 2OBKA 2HRKA 3LG6A 1XBSA 2H74A 3ERWA 2GQKA 1E2YA 2LQQA 5ENUA 3MNGA 1CQHA 2RUEA 1OC8A 1TOFA 1WE0A 4RI6A 1AAZA 3WGXA 2KOKA 2H6ZA 4JU5A 5J4UA 2J9HA 1O8XA 1K0OA 1XWBA 5JWQB 1TW9A 4MJCA 1N25A 4NAXA 3DXBA 2ES7A 1FOVA 3PINA 4KSMA 2PBJA 1A8LA 1WOUA 2FY6A 3ISOA 3CRUA 4J57E 2YJ7A 1XIYA 5DDLA 1XW6A 1YY7A 2C0DA 3VI5A 1UC7A 3D5JA 3N5OA 1GWCA 5IMFA 1F3AA 3HDCA 1FO5A 4RUVA 3F4SA 3GRXA 1BG5A 2C3TA 6GSSA 4PNGA 4TW5A 2V1MA 1PFOA 6GSTA 1MDJA 2AUVA 4KDUA 5ID2A 2GS3A 4RQRA 2VLVA 1SL2B 3Q6OA 2H70A 3E0UA 2O7KA 3IPZA 1SENA 4YAPA 5F05A 1XVQA 3VPTA 4NHWA 4OCEA 5JWRB 1NSWA 2PUKC 4IW9A 5DBQA 2A2RA 3EWLA 2PMTA 3TKSE 2YN1A 4OO4A 2ZUPA 2C8UA 5FWGA 1O73A 2OE0A 2AHEA 4ZB6A 1YF0A 3EINA 2QC7A 1PX7A 2O85A 2DMLA 1V58A 2R37A 3M9JA 2HNLA 3WT1A 1GLQA 3OR5A 2PERA 4TR1A 2CT6A 2O87A 2A4HA 2G2QA 4G19A 3GN3A 2C0GA 3QCPA 1XVWA 2YWOA 1DE1A 2PGTA 2PVOC 5B6NA 4PTSA 2X8HA 3VWWA 1URMA 3IXRA 2B5XA 1X9WB 4WXTA 3IDVA 1ZYPA 3P7XA 1K0CA 1GSYA 4XHMA 2WCIA
chains in the Genus database with same CATH topology
3GNJA 3Q18A 1THXA 4NMUA 2LV3A 3LORA 3VFIA 2LUSA 4AF2A 3UMAA 1JLVA 5ECMB 3BCKA 4NWYA 5D93A 3EU4A 5IMZA 5G30A 2VD0A 5ELAA 1DSBA 2CQ9A 2XPEA 4CY6A 1K0DA 3ZZXA 4DSSB 4WETA 4EDZA 1UA5A 2RLIA 1PGTA 5IM9A 5BRTA 2IWTA 3HVSA 3L78A 4CHSA 3GTUB 3GH6A 3IK7A 4JZQA 5FHIA 2VAFA 2WB9A 2BJXA 1ON4A 1YEXA 2HRKB 1H75A 3GFKA 4G10A 2P0GA 2YOIA 2VIMA 4L0UA 5KN1A 4O5QA 3VPQA 2EIQA 1BAYA 2VL2A 2N5FA 4K0GA 2O5VA 5DJLA 1SYXA 3E9JB 3APQA 3QOUA 2WFCA 2B6MA 4N0VA 1I9DA 2NDOA 3IHGA 5JCGA 3FEUA 5HR3A 2CAIA 4EIPA 1UN2A 3CWGA 4KNDA 2PN8A 5C04A 3A2XA 2A2PA 2I9HA 1DBYA 1M99A 4GXZA 2OKAA 5B6MA 1OKTA 2HZFA 4ZIJA 1XCCA 2IMIA 1PSQA 3ZITA 4MZBA 3W8JA 1EV9A 2DJ0A 1Y1UA 1HYUA 5ID2B 1Z5YE 4ISDA 2IIYA 1AC1A 7GSSA 5COHA 1PQNA 1AQXA 4MJAA 3F4RA 4MH3A 2FWHA 5DQYA 2JL4A 3GUSA 1SKSB 2DKIA 1G7OA 2O8VB 2H0GA 1MTCA 1JFUA 4X4JA 3R3EA 4HQSA 1JZRA 1ZYNA 3C8EA 2CZ3A 4EUYA 2LSTA 5AGYA 5J9CA 4GLTA 5FT3A 2J23A 3HMJG 3GYKA 1XWCA 1HD2A 3IOSA 3FMWA 1OKDA 5EL8A 5DAKB 4V1Ap 4K5RA 3ZYWA 1ERWA 2B3SA 5E59A 2VL3A 1TXUA 4L5OA 2X49A 5ECSA 2KP2A 4Z2UA 4MJEA 4USSA 4EKZA 4Q5NA 1VGLA 2CX3A 4QL9A 4ZILA 4G01A 4PGTA 3M0FA 1M0UA 1U87A 4IS0A 5IO0A 5H5RA 4TR3A 4ULXA 4BVXA 1OE8A 4ACSA 2KUCA 5D96A 4ZBDA 1GTUA 2MBTA 5IMCA 4K6XA 3GX8A 1GSSA 1SYRA 3FRCA 5D9TA 3W6GA 2BTOT 1OC9A 2MBSA 1WIKA 2GSTA 4EIQA 3GHAA 4MABA 3LW9A 1TTZA 4KE3A 1PN9A 1G6WA 5IMDA 1QFNA 2Z9SA 2FWGA 1FVJA 4TXOA 4PQIA 2XPDA 1XXUA 3VWVA 4GSSA 4TRXA 1TRWA 1U6TA 2DMMA 3TCOA 2H30A 3D4MA 1WRYA 1B9YC 4ZB9A 4MP4A 1T1VA 4WEYA 2OJLA 1Z7PA 4YH2A 5ELGA 1XPVA 4MF5A 1PRXA 4PQHA 4KH7A 1YKAA 4K7NA 5IPGA 3APSA 4MLYA 4BL7A 3CSIA 2H19A 2FWFA 3H8QA 3FZAA 3DRNA 3KIJA 4BWSA 4E68A 5CRHA 2X8GA 3ERGA 4A5PA 2H71A 2YPMA 2DJ1A 3G7JA 2K18A 3BD2A 2HRFA 1IYIA 1M2DA 4XCSA 3KTLA 4MCUA 1HQOA 3HA9A 1CQGA 3ZTLA 2L57A 4MPGA 3GSTA 3IE3A 1EZKA 1ZL9A 2DLXA 3A3TA 3EC3A 3TKSC 16GSA 2NPBA 5G5FA 1M7TA 4OMVA 4KCAA 2VD1A 5C00A 3P8WA 4GWRA 2E2GA 4V2MA 2JACA 6GSUA 1FW1A 4YQVA 4I97A 5AIXA 3BBYA 3WGDA 1Q98A 2H0HA 4G0LA 4WKWA 1JLWA 4HOJA 2EFCA 1O7UA 2P5RA 5B7CA 1A24A 1ZGNA 1GLPA 4K2DA 5G1KA 4GF0A 14GSA 1YF1A 5DALA 2AAWA 4DEJA 5J47A 1BX9A 2RUFA 4RI7A 1HNBA 4AGSA 1SKWB 4Q5QA 1AQWA 2NTOA 2JZTA 2L6DA 2QSIA 2MMAA 5J3RA 4PUAA 1FVKA 4I2TA 3GIXA 2R4VA 4WF4A 3QD9A 2R0GA 3DGQA 4KA0A 1XWAA 3ZRDA 3GL3A 3DIEA 1J08A 4IJ3A 2DKHA 2CV4A 2IFQB 4TR0A 4DSQA 3GURA 5EPFA 5DCGA 2CZ2A 3WD6A 4L5LA 1O6JA 4JE1A 1ZZYA 2C3NA 4K7IA 1EOHA 1T7PB 2WGRA 1B4QA 3FZ5A 2H6YA 2VL9A 2C0EA 2XHFA 4JEDA 4ZB8A 1NHYA 4IGJA 5CRDA 3C71A 5JCWA 1ABAA 3FKFA 5ECQB 2V2GA 5ECIB 3UJ1A 3ZMKA 3LXTA 4YQUA 2MZCA 1SVOA 3FW2A 1Z9HA 4K9ZA 4ECBA 2F9SA 2HI7A 2WS2A 2K6VA 1MDKA 4MJBA 4NV5A 1OE7A 1W4VA 4V1Ag 1GSFA 4XRAA 3G7IA 3LSZA 3MYDA 4TXOB 2GQLA 2V41A 4YQMA 3F6FA 1W89A 2V6KA 1TXXA 3DEXA 17GSA 3FZ9A 5GAND 1FB6A 3HD5A 5G31A 4GRFA 3IBHA 1BF5A 3PR8A 5ECPB 4ZL8A 5G1LA 5AIVA 1A0FA 3VLNA 3H1NA 3KH9A 3DMLA 1Q4JA 2B1LA 2HE3A 4KF9A 1S3DA 2X4AA 3VWXA 1EGOA 1GH2A 4BL7B 3ZREA 2VCXA 2R5GA 4FQUA 2VOCA 1U3IA 3LWAA 2FCHA 1GULA 1ERTA 3PGTA 3KD0A 2C1YA 5CAXA 4KX4A 4ML6A 3J7Yb 1A8YA 1USBA 5EVOA 1FOHA 1MD4A 3F63A 4MMMA 2HLSA 5L71A 3KMOA 3F9UA 4NHZA 2HSNB 2HRAA 4EXJA 3HVVA 4MPFA 3TOUA 2CVBA 2F51A 1DE2A 1X0RA 2LNTA 5A4UA 3F3RA 2VUPA 2BMXA 3TKPA 1KBNA 4F9ZA 2FLSA 1GP1A 3QMXA 5DJMA 1YVLA 2RIIA 3FR6A 4KDYA 5ECOB 2D2ZA 4LA1A 1EP7A 2N5AA 1GSUA 5DALB 1V40A 2NVLA 1QMVA 3HJPA 4ZBBA 3V1WA 4F03A 1JZOA 5DAKA 5CNWA 3ZL5A 1TP9A 4OD7A 2YWNA 2QA2A 3F0IA 4GQCA 2VCVA 5INYA 4QQ7A 3TJGA 4HU7A 1ZOFA 3MDKA 3IHQA 2FD3A 5D9XA 3LJRA 4XS1A 4KGIA 2FHEA 3TDGA 2VLUA 3F3QA 1TRUA 1K0MA 4ECJA 3TKRA 4XS4A 3GKKA 4F0BA 3I43A 3CBUA 1GRXA 2XBIA 4EL1A 3QDNA 4WF5A 2AYTA 5CREA 3QR6A 1R5AA 3L0HA 4O7HA 4PX1A 1QQ2A 3TOTA 5J9BA 1ZYEA 1MEKA 2AJQB 1VF4A 5J4YA 4KCEA 6GSYA 3KH7A 1A2JA 4IP1A 3ZLPA 2K8SA 4PNFA 4N11A 5DVBA 3ED3A 1RK4A 2R3XA 1ST9A 1TKDB 3QFBC 3KJYA 4D73A 1T00A 2IN3A 4V2LA 2ON5A 2E7PA 2IJYA 3EURA 4NPBA 4AJ8A 1B48A 1VRSD 1YEPA 1HNCA 1TK0B 18GSA 5D9VA 3TJBA 2CVDA 2R6KA 3LFLA 3UBLA 4JR6A 1R7HA 4PUFC 1EEJA 4ICYA 3H4KA 3DVXA 1LJRA 1K3LA 4CY8A 19GSA 3MWHA 1VF2A 3DVWA 4ZL9A 5B8AA 5D8IA 4HEA2 1EP8A 1V9WA 4NV2A 1TI3A 2EFDA 2KP1A 1YJ6A 2K8VA 4YKFA 2WZ9A 1JZDA 2HZEA 2DJ3A 1GUKA 4LLRA 3FY7A 3MAKA 2H1GA 4HJMA 4Z2TA 5HFGA 5KN3A 2M80A 1G0TA 2H72A 2L59A 1WWJA 2VM2A 2ALBA 2C80A 2DBCA 5GZZB 5IQYA 1SL1B 3TKSA 2GSRA 1O81A 1T3BA 4HDEA 3WT2A 3ME7A 3QAVA 1XW5A 1TK8B 3LEFA 3KZQA 5F8BA 4TOPA 2GVPA 2HSHA 9GSSA 3N9JA 3RAZA 1PL1A 2CX4A 3M1GA 3EU3A 2IL3A 2WULA 4DVCA 2GGTA 1TK5B 3RHCA 2B7JA 1SK1A 4O5RA 3O6TA 4POKA 2AV4A 1R4WA 4KDXA 4ECCA 4XS4B 3M8NA 2O89A 4W66A 4WR4A 3H93A 2IFQA 2QKEA 4ZXGA 4NXIA 2TIRA 2DIZA 2TRCP 2DJJA 2X64A 5A1NA 2R0CA 1V57A 2OE1A 1XZOA 2LJKA 1LU4A 4WBJA 4I6XA 3CTFA 2QA1A 1AW9A 5A4VA 1XWKA 3UARA 3Q19A 4JRRA 3VWUA 4GQFA 1SJ6A 2V32A 4AKGA 4IKHA 4K7OA 2YZUA 5DCHA 4D73B 4TR4A 1SU9A 4RQXA 4HQZA 2H0IA 2PWJA 6GSXA 2VM1A 4E8EA 3MSZA 2VL2C 3QAGA 1S3CA 2YWMA 4MZWA 3I9V2 2IMKA 3HJMA 3IC4A 2VKZG 1QK8A 3ZIJA 3C1SA 1FG4A 3NIVA 2LRNA 2B5YA 3IA1A 4G0KA 1VF3A 1NM3A 3ME8A 4POBA 3ZIVA 1XOBA 3KMNA 4F82A 2LJRA 4POMA 1SVMA 4OWYA 2L5OA 5ECHB 3TJKA 3RPNA 3UVHA 2MYGA 3EE2A 3GMFA 4AJ6A 3TRXA 1SJIA 4F2IA 2HZEB 5DQSA 3A2VA 4K1FA 4J2FA 5CRWA 4BWQA 2YCDA 3U5RE 1THOA 3IC8A 2HSNA 4POLA 3C1RA 4IQAA 3H79A 4WR5A 2H1AA 1OVNA 3ZVJD 5H5QA 5IOWA 2XBQA 5AN1A 4KAEA 2RM6A 4TVEA 2CAQA 1O85A 4K2XA 4AI6A 2QGVA 3TJFA 3ERFA 2DIYA 4O92A 4I5QA 2E2MA 4ID0A 1J9BA 3HCZA 1EGRA 1MDIA 2LTKA 3O3TA 2C0FA 2GDRA 3UVTA 2JSZA 5F06A 2VCTA 4YKGA 4K8MA 4OFNA 4HZ2A 5HR0A 1G6YA 2REMA 4FIWA 4OO5A 2A2SA 5IMAA 2EFEA 4Z2RA 5CRGA 4BVYA 2TRXA 1DUGA 1X5DA 3UL3A 1PA3A 1SL0B 3K8NA 3LYPA 2F8FA 1F6MC 4HZ4A 1FB0A 2PPTA 5J5NA 4KW6A 4BA7A 5A1NB 4J56E 4TKYA 3KGKA 3KCMA 4MA9A 5GSTA 2H73A 4ZB7A 3CXGA 3LYKA 3EMPA 2EIOA 2KLXA 5KEJA 3IAM2 1AIUA 1UVZA 3G9BA 4MZCA 3ZVJA 1K3OA 2HT9A 3IV4A 1N8JA 1EOGA 3PPUA 1J0FA 3EVIA 1XOAA 1GUHA 3UAPA 4EVMA 5J40A 4FYCA 2H1BA 1T8EB 4IELA 3NZNA 1YZXA 3GKNA 5A5HA 1GSDA 1WP0A 2YJHA 3D0ZA 3HVXA 5E4WA 12GSA 2GZZA 2YWIA 4YAVA 4OFMA 4IHUA 2OE3A 1SVLA 5BMUB 3O76A 4ECIA 4IP6A 5JWOB 5JCUA 2X8CA 1RW1A 1YKCA 3KXOA 5EY6A 4P3YB 3ZFLA 1TDIA 2K9FA 5D9WA 3C7MA 3CMIA 4EO3A 4GDFA 1ERUA 3E3EA 2YP6A 2JSYA 5D73A 4ML1A 4L8EA 3HXSA 3TRPA 8GSSA 2IMFA 2NBSA 1TI1A 3L9VA 5GAPD 1U88A 3FK8A 1S3AA 4LMVA 2HYXA 4HJ2A 4I8BA 2FWEA 1A2LA 3RHBA 20GSA 2MMNA 5H5SA 3GA4A 1Z6MA 3KEBA 2JADA 3CRTA 4Q5FA 3TU3B 3M3MA 2I81A 5A34A 3FHKA 4O32A 2I4AA 1LBKA 4FH8A 1R5PA 4Q5RA 3ZFBA 4N3ZA 3KM6A 4MF7A 1M9BA 1ZCPA 4XTSA 1XFLA 2UZ8A 3FR3A 2I3YA 4E8HA 3DWVA 1PKZA 4MNNA 4IQ1A 1X5EA 1BJXA 2UV8G 1F9MA 2H8LA 3GX0A 2HRNA 3S9FA 4BVYB 2H75A 3HZ8A 3L9UA 1I5GA 2GTUA 2M72A 2WDUA 4XIHA 1PMTA 1N2AA 2ZNMA 4LL4B 3LGCA 2GZYA 1K0AA 5KOXA 1JZWA 5G2ZA 2H1DA 1XW9A 3SBCA 2OT3A 5HR2A 1B8XA 4KSOA 4MK3A 3WGEA 4FYUA 1FHEA 2GLRA 2H66A 3I69A 2VCWA 4KUNA 3EPTA 3TB2A 4TN8A 5ECRB 3TUEA 5CP1A 2L4CA 3HHVA 2YZHA 5ECNB 5CO3A 1PX6A 3BCIA 3C73A 1PN0A 5B8BA 3BJ5A 1EEMA 1BYEA 5A5HB 2LS5A 3HJOA 1WMJA 2DJ2A 4G2EA 5J4VA 2LEGA 2VCZA 1EV4A 1QXHA 4IN0A 1V2AA 1GTAA 2HQTA 4PURA 3D6IA 2C3QA 1TRSA 1Y25A 2N5BA 3VURA 5ECKB 4HU9A 3TKQA 2G0FA 4ZL7A 1KEBA 1ZYQB 3FZ4A 2GT5A 2AB6A 2MMZA 3W8SA 1BQ7A 1RQMA 3VI7A 3DD3A 3APOA 2DJKA 1NHOA 1GTBA 1A23A 4MH2A 3KP8A 2LQOA 1ML6A 2M46A 2GSSA 3GL5A 3I6AA 2OACA 1X9MB 2V6OA 3TJJA 2R2JA 4WBRD 2GSQA 5IMVA 1ACVA 3IR4A 2YNXA 1GL8A 3PH9A 3MIXA 1AQVA 1V98A 1IYHA 2YV7A 4JBBA 2FA4A 1O8WA 5F07A 2KHPA 4QL7A 2HFDA 3TGZA 2VO4A 2CVKA 5LD0A 5A34B 1R26A 13GSA 1QUWA 2GQMA 2ZCTA 3D22A 3QAWA 1M9AA 3P2AA 1Y6EA 3VK9A 1Z7RA 3ZMLA 4AKXB 5AISA 4F0CA 3A5WA 2A4VA 3FYGA 4TXVA 1E6BA 2HSMA 2EC4A 2VCQA 4K0NA 3D4TA 4EE0A 1PKWA 2B5EA 3AY8A 1K0NA 4AKHA 1H4OA 4G0IA 5J41A 4AKIA 2H6XA 3US3A 4DSRA 4TR1B 4PQ1A 5HQPA 1GNEA 4O5UA 3QPMA 1C72A 1GTIA 3GH9A 3BOAA 3JCML 4CW9A 3Q74A 1SD8A 4GTUA 1OAZA 3GKXA 2F3MA 2PU9C 1TU7A 4K5SA 4LMWA 4N10A 3HY2A 1U3AA 1OYJA 5LNKe 1B9XC 11GSA 2LKUA 3P90A 3DKSA 4BPYA 5LCZA 2L4QA 4JR4A 3UBKA 1BG1A 1M2BA 3CYNA 2IMEA 5HR1A 3GKMA 1GSEA 4CDOA 5HFIA 3RPPA 4X1UA 4XS6A 1M2AA 3EMXA 4N30A 1HNAA 2ON7A 1G7EA 2CA8A 3HYPA 4LL1B 3A5IA 1ILOA 1X5CA 3D21A 2JZRA 2H01A 2IPAA 4OCFA 2L6CA 2EIRA 5G5EA 4H86A 2YANA 2LNSA 4AJ7A 1TJDA 3CSJA 3GSSA 1ZMAA 2FA8A 3EYTA 2PVQA 3J7Yk 1KTEA 2EFHA 1TRVA 1AXDA 4ILFA 1T4ZA 1TU8A 1A2MA 3CSHA 3R2QA 3F8UA 5BMUA 3FR9A 1WPIA 2B7KA 4HUAA 2FNOA 3DYRA 5A5KA 1PD21 5IIZA 4FO5A 2R0PA 5CYYA 3KP9A 4EF0A 3HZ4A 2WRTA 10GSA 4HI7A 2WJUA 5IPHA 5KN0A 5ABRA 2YV9A 5F0GA 4ZBAA 1PL2A 2DC5A 4IJIA 4HS1A 1GUMA 1F37A 5A4WA 1XWGA 2IMDA 2E0QA 1B4PA 1F3BA 4V2NA 2H1LA 2P5QA 5ECLB 1FAAA 1SD9A 2GT6A 3L9SA 1SK0A 3TRQA 2JZSA 4XRDA 1F2EA 3NOFA 4G9HA 2HSMB 5KN2A 1ERVA 2L5LA 3QFAC 4I2UA 4GSTA 3L4NA 1YDKA 3UOMA 1OC3A 1NW2A 2I1UA 22GSA 1K3YA 4IBPA 3LXZA 3F4TA 1EWXA 3GV1A 3U6VA 2FUG2 3RDWA 2HXKA 3SWLA 2LRTA 3G7YA 2F8AA 4MDCA 1GSQA 1X9SB 3IAS2 4X0XA 1Z6NA 2LRCA 4KB3A 1Z3EA 1T4YA 3IK9A 2FGXA 4L0WA 3RBTA 6GSWA 1SK2A 1QGVA 1YQ1A 2VLTA 3IRAA 2RM5A 3M9KA 2MMOA 4GCIA 2OADA 4PXOA 4BVXB 1GNWA 1SJZA 2OBIA 1JHBA 1VF1A 1MD3A 2OA7A 3CTGA 2GZPA 1A0RP 4MF6A 5KOWA 1KNGA 5IOXA 3UIWA 4QMKA 4EC0A 5HFKA 4EDYA 3HKRA 1SKRB 4N0ZA 2LJAA 4FYBA 3UEMA 2XC2A 4DSSA 3F6DA 5IO2A 1OC9B 1K0BA 4IVFA 2C4JA 2H76A 5GSSA 1AUCA 3KTBA 2B1KA 6GSVA 3LQ7A 4GSNA 1WJKA 2DSAA 3GTUA 1BEDA 4OFTA 2P31A 4X43A 2X99A 2JU5A 2HSYA 3A2WA 3WYWA 4Z7XA 2OBKA 2HRKA 3LG6A 1XBSA 2H74A 3ERWA 2GQKA 1E2YA 2LQQA 5ENUA 3MNGA 1CQHA 2RUEA 1OC8A 1TOFA 1WE0A 4RI6A 1AAZA 3WGXA 2KOKA 2H6ZA 4JU5A 5J4UA 2J9HA 1O8XA 1K0OA 1XWBA 5JWQB 1TW9A 4MJCA 1N25A 4NAXA 3DXBA 2ES7A 1FOVA 3PINA 4KSMA 2PBJA 1A8LA 1WOUA 2FY6A 3ISOA 3CRUA 4J57E 2YJ7A 1XIYA 5DDLA 1XW6A 1YY7A 2C0DA 3VI5A 1UC7A 3D5JA 3N5OA 1GWCA 5IMFA 1F3AA 3HDCA 1FO5A 4RUVA 3F4SA 3GRXA 1BG5A 2C3TA 6GSSA 4PNGA 4TW5A 2V1MA 6GSTA 1MDJA 2AUVA 4KDUA 5ID2A 2GS3A 4RQRA 2VLVA 1SL2B 3Q6OA 2H70A 3E0UA 2O7KA 3IPZA 1SENA 4YAPA 5F05A 1XVQA 3VPTA 4NHWA 4OCEA 5JWRB 1NSWA 2PUKC 4IW9A 5DBQA 2A2RA 3EWLA 2PMTA 3TKSE 2YN1A 4OO4A 2ZUPA 2C8UA 5FWGA 1O73A 2OE0A 2AHEA 4ZB6A 1YF0A 3EINA 2QC7A 1PX7A 2O85A 2DMLA 1V58A 2R37A 3M9JA 2HNLA 3WT1A 1GLQA 3OR5A 2PERA 4TR1A 2CT6A 2O87A 2A4HA 2G2QA 4G19A 3GN3A 2C0GA 3QCPA 1XVWA 2YWOA 1DE1A 2PGTA 2PVOC 5B6NA 4PTSA 2X8HA 3VWWA 1URMA 3IXRA 2B5XA 1X9WB 4WXTA 3IDVA 1ZYPA 3P7XA 1K0CA 1GSYA 4XHMA 2WCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GNJ A;  3Q18 A;  1THX A;  4NMU A;  2LV3 A;  3LOR A;  3VFI A;  2LUS A;  4AF2 A;  3UMA A;  1JLV A;  5ECM B;  3BCK A;  4NWY A;  5D93 A;  3EU4 A;  5IMZ A;  5G30 A;  2VD0 A;  5ELA A;  1DSB A;  2CQ9 A;  2XPE A;  1K0D A;  3ZZX A;  4DSS B;  4WET A;  4EDZ A;  1UA5 A;  2RLI A;  1PGT A;  5IM9 A;  2IWT A;  3HVS A;  3L78 A;  4CHS A;  3GTU B;  3GH6 A;  3IK7 A;  4JZQ A;  5FHI A;  2VAF A;  2WB9 A;  2BJX A;  1ON4 A;  1YEX A;  2HRK B;  1H75 A;  3GFK A;  4G10 A;  2P0G A;  2YOI A;  2VIM A;  4L0U A;  5KN1 A;  3VPQ A;  2EIQ A;  1BAY A;  2VL2 A;  2N5F A;  4K0G A;  5DJL A;  1SYX A;  3E9J B;  3APQ A;  3QOU A;  2WFC A;  2B6M A;  4N0V A;  1I9D A;  2NDO A;  5JCG A;  3FEU A;  5HR3 A;  2CAI A;  1UN2 A;  4KND A;  2PN8 A;  5C04 A;  3A2X A;  2I9H A;  1DBY A;  1M99 A;  4GXZ A;  2OKA A;  5B6M A;  1OKT A;  2HZF A;  4ZIJ A;  1XCC A;  2IMI A;  1PSQ A;  3ZIT A;  4MZB A;  3W8J A;  1EV9 A;  2DJ0 A;  1HYU A;  5ID2 B;  1Z5Y E;  4ISD A;  2IIY A;  1AC1 A;  7GSS A;  5COH A;  1PQN A;  1AQX A;  4MJA A;  3F4R A;  4MH3 A;  2FWH A;  5DQY A;  2JL4 A;  3GUS A;  1SKS B;  1G7O A;  2O8V B;  2H0G A;  1MTC A;  1JFU A;  3R3E A;  4HQS A;  1JZR A;  3C8E A;  2CZ3 A;  4EUY A;  2LST A;  5AGY A;  5J9C A;  4GLT A;  5FT3 A;  2J23 A;  3GYK A;  1XWC A;  1HD2 A;  3IOS A;  1OKD A;  5EL8 A;  5DAK B;  4V1A p;  3ZYW A;  1ERW A;  2B3S A;  5E59 A;  2VL3 A;  4L5O A;  5ECS A;  2KP2 A;  4MJE A;  4USS A;  4EKZ A;  4Q5N A;  1VGL A;  2CX3 A;  4QL9 A;  4ZIL A;  4PGT A;  3M0F A;  1M0U A;  1U87 A;  4IS0 A;  5IO0 A;  5H5R A;  4TR3 A;  4ULX A;  4BVX A;  1OE8 A;  4ACS A;  2KUC A;  5D96 A;  4ZBD A;  1GTU A;  2MBT A;  5IMC A;  4K6X A;  3GX8 A;  1GSS A;  1SYR A;  3FRC A;  5D9T A;  3W6G A;  2BTO T;  1OC9 A;  2MBS A;  1WIK A;  2GST A;  3GHA A;  4MAB A;  1TTZ A;  4KE3 A;  1PN9 A;  1G6W A;  5IMD A;  1QFN A;  2Z9S A;  2FWG A;  1FVJ A;  4TXO A;  4PQI A;  2XPD A;  1XXU A;  3VWV A;  4GSS A;  4TRX A;  1TRW A;  1U6T A;  2DMM A;  3TCO A;  2H30 A;  3D4M A;  1WRY A;  1B9Y C;  4ZB9 A;  4MP4 A;  1T1V A;  4WEY A;  2OJL A;  1Z7P A;  4YH2 A;  5ELG A;  1XPV A;  4MF5 A;  1PRX A;  4PQH A;  4KH7 A;  1YKA A;  4K7N A;  5IPG A;  3APS A;  4MLY A;  4BL7 A;  3CSI A;  2H19 A;  2FWF A;  3H8Q A;  3FZA A;  3DRN A;  3KIJ A;  4BWS A;  5CRH A;  2X8G A;  3ERG A;  2H71 A;  2YPM A;  2DJ1 A;  3G7J A;  2K18 A;  3BD2 A;  2HRF A;  1IYI A;  1M2D A;  4XCS A;  3KTL A;  4MCU A;  1HQO A;  3HA9 A;  1CQG A;  3ZTL A;  2L57 A;  4MPG A;  3GST A;  3IE3 A;  1EZK A;  1ZL9 A;  2DLX A;  3A3T A;  3EC3 A;  3TKS C;  16GS A;  2NPB A;  5G5F A;  1M7T A;  4OMV A;  4KCA A;  2VD1 A;  5C00 A;  3P8W A;  4GWR A;  2E2G A;  4V2M A;  2JAC A;  6GSU A;  1FW1 A;  4YQV A;  4I97 A;  5AIX A;  3BBY A;  3WGD A;  1Q98 A;  2H0H A;  4G0L A;  4WKW A;  1JLW A;  4HOJ A;  1O7U A;  2P5R A;  5B7C A;  1A24 A;  1ZGN A;  1GLP A;  4K2D A;  5G1K A;  4GF0 A;  14GS A;  1YF1 A;  5DAL A;  2AAW A;  4DEJ A;  1BX9 A;  2RUF A;  4RI7 A;  1HNB A;  4AGS A;  1SKW B;  4Q5Q A;  1AQW A;  2NTO A;  2JZT A;  2L6D A;  2QSI A;  2MMA A;  5J3R A;  4PUA A;  1FVK A;  4I2T A;  3GIX A;  2R4V A;  4WF4 A;  3QD9 A;  3DGQ A;  4KA0 A;  1XWA A;  3ZRD A;  3GL3 A;  3DIE A;  1J08 A;  4IJ3 A;  2CV4 A;  2IFQ B;  4TR0 A;  4DSQ A;  3GUR A;  5EPF A;  5DCG A;  2CZ2 A;  3WD6 A;  4L5L A;  1O6J A;  4JE1 A;  1ZZY A;  2C3N A;  4K7I A;  1EOH A;  1T7P B;  2WGR A;  1B4Q A;  3FZ5 A;  2H6Y A;  2VL9 A;  2C0E A;  2XHF A;  4JED A;  4ZB8 A;  1NHY A;  4IGJ A;  5CRD A;  3C71 A;  5JCW A;  1ABA A;  3FKF A;  5ECQ B;  2V2G A;  5ECI B;  3UJ1 A;  3ZMK A;  3LXT A;  4YQU A;  2MZC A;  3FW2 A;  1Z9H A;  4K9Z A;  4ECB A;  2F9S A;  2HI7 A;  2WS2 A;  2K6V A;  1MDK A;  4MJB A;  4NV5 A;  1OE7 A;  1W4V A;  4V1A g;  1GSF A;  4XRA A;  3G7I A;  3LSZ A;  4TXO B;  2GQL A;  2V41 A;  4YQM A;  3F6F A;  1W89 A;  2V6K A;  1TXX A;  3DEX A;  17GS A;  3FZ9 A;  5GAN D;  1FB6 A;  3HD5 A;  5G31 A;  4GRF A;  3IBH A;  3PR8 A;  5ECP B;  4ZL8 A;  5G1L A;  5AIV A;  1A0F A;  3VLN A;  3H1N A;  3KH9 A;  3DML A;  1Q4J A;  2B1L A;  2HE3 A;  4KF9 A;  1S3D A;  3VWX A;  1EGO A;  1GH2 A;  4BL7 B;  3ZRE A;  2VCX A;  2R5G A;  4FQU A;  2VOC A;  1U3I A;  3LWA A;  2FCH A;  1GUL A;  1ERT A;  3PGT A;  3KD0 A;  2C1Y A;  5CAX A;  4KX4 A;  4ML6 A;  3J7Y b;  1A8Y A;  1USB A;  5EVO A;  1MD4 A;  3F63 A;  4MMM A;  2HLS A;  5L71 A;  3KMO A;  3F9U A;  4NHZ A;  2HSN B;  2HRA A;  4EXJ A;  3HVV A;  4MPF A;  3TOU A;  2CVB A;  2F51 A;  1DE2 A;  1X0R A;  2LNT A;  5A4U A;  3F3R A;  2VUP A;  2BMX A;  3TKP A;  1KBN A;  4F9Z A;  2FLS A;  1GP1 A;  3QMX A;  5DJM A;  2RII A;  3FR6 A;  4KDY A;  5ECO B;  2D2Z A;  4LA1 A;  1EP7 A;  2N5A A;  1GSU A;  5DAL B;  1V40 A;  2NVL A;  1QMV A;  3HJP A;  4ZBB A;  3V1W A;  4F03 A;  1JZO A;  5DAK A;  5CNW A;  3ZL5 A;  1TP9 A;  4OD7 A;  2YWN A;  3F0I A;  4GQC A;  2VCV A;  5INY A;  4QQ7 A;  3TJG A;  4HU7 A;  1ZOF A;  3MDK A;  3IHQ A;  2FD3 A;  5D9X A;  3LJR A;  4XS1 A;  4KGI A;  2FHE A;  3TDG A;  2VLU A;  3F3Q A;  1TRU A;  1K0M A;  4ECJ A;  3TKR A;  4XS4 A;  3GKK A;  4F0B A;  3I43 A;  3CBU A;  1GRX A;  2XBI A;  4EL1 A;  3QDN A;  4WF5 A;  2AYT A;  5CRE A;  3QR6 A;  1R5A A;  3L0H A;  4O7H A;  4PX1 A;  1QQ2 A;  3TOT A;  5J9B A;  1ZYE A;  1MEK A;  2AJQ B;  1VF4 A;  4KCE A;  6GSY A;  3KH7 A;  1A2J A;  4IP1 A;  3ZLP A;  2K8S A;  4PNF A;  4N11 A;  5DVB A;  3ED3 A;  1RK4 A;  2R3X A;  1ST9 A;  1TKD B;  3QFB C;  3KJY A;  4D73 A;  1T00 A;  2IN3 A;  4V2L A;  2ON5 A;  2E7P A;  2IJY A;  3EUR A;  4NPB A;  4AJ8 A;  1B48 A;  1VRS D;  1YEP A;  1HNC A;  1TK0 B;  18GS A;  5D9V A;  3TJB A;  2CVD A;  2R6K A;  3LFL A;  3UBL A;  4JR6 A;  1R7H A;  4PUF C;  1EEJ A;  3H4K A;  3DVX A;  1LJR A;  1K3L A;  19GS A;  3MWH A;  1VF2 A;  3DVW A;  4ZL9 A;  5B8A A;  5D8I A;  4HEA 2;  1EP8 A;  1V9W A;  4NV2 A;  1TI3 A;  2KP1 A;  1YJ6 A;  2K8V A;  2WZ9 A;  1JZD A;  2HZE A;  2DJ3 A;  1GUK A;  4LLR A;  3FY7 A;  3MAK A;  2H1G A;  4HJM A;  5HFG A;  5KN3 A;  2M80 A;  1G0T A;  2H72 A;  2L59 A;  1WWJ A;  2VM2 A;  2ALB A;  2C80 A;  2DBC A;  5GZZ B;  5IQY A;  1SL1 B;  3TKS A;  2GSR A;  1O81 A;  1T3B A;  4HDE A;  3WT2 A;  3ME7 A;  3QAV A;  1XW5 A;  1TK8 B;  3LEF A;  3KZQ A;  5F8B A;  4TOP A;  2GVP A;  2HSH A;  9GSS A;  3N9J A;  3RAZ A;  1PL1 A;  2CX4 A;  3M1G A;  3EU3 A;  2IL3 A;  2WUL A;  4DVC A;  2GGT A;  1TK5 B;  3RHC A;  2B7J A;  1SK1 A;  4O5R A;  3O6T A;  4POK A;  2AV4 A;  1R4W A;  4KDX A;  4ECC A;  4XS4 B;  3M8N A;  2O89 A;  4WR4 A;  3H93 A;  2IFQ A;  2QKE A;  4ZXG A;  4NXI A;  2TIR A;  2DIZ A;  2TRC P;  2DJJ A;  2X64 A;  1V57 A;  2OE1 A;  1XZO A;  2LJK A;  1LU4 A;  4WBJ A;  4I6X A;  3CTF A;  1AW9 A;  5A4V A;  1XWK A;  3UAR A;  3Q19 A;  4JRR A;  3VWU A;  4GQF A;  1SJ6 A;  2V32 A;  4IKH A;  4K7O A;  2YZU A;  5DCH A;  4D73 B;  4TR4 A;  1SU9 A;  4RQX A;  4HQZ A;  2H0I A;  2PWJ A;  6GSX A;  2VM1 A;  4E8E A;  3MSZ A;  2VL2 C;  3QAG A;  1S3C A;  2YWM A;  4MZW A;  3I9V 2;  2IMK A;  3HJM A;  3IC4 A;  1QK8 A;  3ZIJ A;  3C1S A;  1FG4 A;  3NIV A;  2LRN A;  2B5Y A;  3IA1 A;  4G0K A;  1VF3 A;  1NM3 A;  3ME8 A;  4POB A;  3ZIV A;  1XOB A;  3KMN A;  4F82 A;  2LJR A;  4POM A;  4OWY A;  2L5O A;  5ECH B;  3TJK A;  3RPN A;  3UVH A;  2MYG A;  3EE2 A;  3GMF A;  4AJ6 A;  3TRX A;  1SJI A;  4F2I A;  2HZE B;  5DQS A;  3A2V A;  4K1F A;  4J2F A;  5CRW A;  4BWQ A;  2YCD A;  3U5R E;  1THO A;  3IC8 A;  4POL A;  3C1R A;  4IQA A;  3H79 A;  4WR5 A;  2H1A A;  1OVN A;  3ZVJ D;  5H5Q A;  5IOW A;  2XBQ A;  5AN1 A;  4KAE A;  2RM6 A;  4TVE A;  2CAQ A;  1O85 A;  2QGV A;  3TJF A;  3ERF A;  2DIY A;  4O92 A;  4I5Q A;  2E2M A;  4ID0 A;  1J9B A;  3HCZ A;  1EGR A;  1MDI A;  2LTK A;  3O3T A;  2C0F A;  2GDR A;  3UVT A;  2JSZ A;  5F06 A;  2VCT A;  4K8M A;  4OFN A;  4HZ2 A;  5HR0 A;  1G6Y A;  2REM A;  4FIW A;  4OO5 A;  2A2S A;  5IMA A;  5CRG A;  4BVY A;  2TRX A;  1DUG A;  1X5D A;  3UL3 A;  1PA3 A;  1SL0 B;  3K8N A;  3LYP A;  2F8F A;  1F6M C;  4HZ4 A;  1FB0 A;  2PPT A;  5J5N A;  4KW6 A;  4BA7 A;  4J56 E;  4TKY A;  3KGK A;  3KCM A;  4MA9 A;  5GST A;  2H73 A;  3CXG A;  3LYK A;  3EMP A;  2EIO A;  2KLX A;  5KEJ A;  3IAM 2;  1AIU A;  1UVZ A;  3G9B A;  4MZC A;  3ZVJ A;  1K3O A;  2HT9 A;  3IV4 A;  1N8J A;  1EOG A;  3PPU A;  1J0F A;  3EVI A;  1XOA A;  1GUH A;  3UAP A;  4EVM A;  4FYC A;  2H1B A;  1T8E B;  4IEL A;  3NZN A;  1YZX A;  3GKN A;  1GSD A;  1WP0 A;  2YJH A;  3D0Z A;  3HVX A;  5E4W A;  12GS A;  2GZZ A;  2YWI A;  4YAV A;  4OFM A;  4IHU A;  2OE3 A;  3O76 A;  4ECI A;  4IP6 A;  5JWO B;  5JCU A;  2X8C A;  1RW1 A;  1YKC A;  3KXO A;  5EY6 A;  4P3Y B;  3ZFL A;  1TDI A;  2K9F A;  5D9W A;  3C7M A;  3CMI A;  4EO3 A;  1ERU A;  3E3E A;  2YP6 A;  2JSY A;  5D73 A;  4ML1 A;  4L8E A;  3HXS A;  3TRP A;  8GSS A;  2IMF A;  2NBS A;  1TI1 A;  3L9V A;  5GAP D;  1U88 A;  3FK8 A;  1S3A A;  4LMV A;  2HYX A;  4HJ2 A;  4I8B A;  2FWE A;  1A2L A;  3RHB A;  20GS A;  2MMN A;  5H5S A;  3GA4 A;  1Z6M A;  3KEB A;  2JAD A;  3CRT A;  4Q5F A;  3M3M A;  2I81 A;  3FHK A;  4O32 A;  2I4A A;  1LBK A;  4FH8 A;  1R5P A;  4Q5R A;  3ZFB A;  3KM6 A;  4MF7 A;  1M9B A;  1ZCP A;  4XTS A;  1XFL A;  2UZ8 A;  3FR3 A;  2I3Y A;  4E8H A;  3DWV A;  1PKZ A;  4IQ1 A;  1X5E A;  1BJX A;  1F9M A;  2H8L A;  3GX0 A;  2HRN A;  3S9F A;  4BVY B;  2H75 A;  3HZ8 A;  3L9U A;  1I5G A;  2GTU A;  2M72 A;  2WDU A;  4XIH A;  1PMT A;  1N2A A;  2ZNM A;  4LL4 B;  3LGC A;  2GZY A;  1K0A A;  1JZW A;  5G2Z A;  2H1D A;  1XW9 A;  3SBC A;  5HR2 A;  1B8X A;  4KSO A;  4MK3 A;  3WGE A;  4FYU A;  1FHE A;  2GLR A;  2H66 A;  3I69 A;  2VCW A;  4KUN A;  3TB2 A;  4TN8 A;  5ECR B;  3TUE A;  5CP1 A;  2L4C A;  3HHV A;  2YZH A;  5ECN B;  5CO3 A;  1PX6 A;  3BCI A;  3C73 A;  5B8B A;  3BJ5 A;  1EEM A;  1BYE A;  2LS5 A;  3HJO A;  1WMJ A;  2DJ2 A;  4G2E A;  2LEG A;  2VCZ A;  1EV4 A;  1QXH A;  4IN0 A;  1V2A A;  1GTA A;  2HQT A;  4PUR A;  3D6I A;  2C3Q A;  1TRS A;  1Y25 A;  2N5B A;  3VUR A;  5ECK B;  4HU9 A;  3TKQ A;  2G0F A;  4ZL7 A;  1KEB A;  1ZYQ B;  3FZ4 A;  2GT5 A;  2AB6 A;  2MMZ A;  3W8S A;  1BQ7 A;  1RQM A;  3VI7 A;  3DD3 A;  3APO A;  2DJK A;  1NHO A;  1GTB A;  1A23 A;  4MH2 A;  3KP8 A;  2LQO A;  1ML6 A;  2M46 A;  2GSS A;  3GL5 A;  3I6A A;  2OAC A;  1X9M B;  2V6O A;  3TJJ A;  2R2J A;  4WBR D;  2GSQ A;  5IMV A;  1ACV A;  3IR4 A;  2YNX A;  1GL8 A;  3PH9 A;  1AQV A;  1V98 A;  1IYH A;  2YV7 A;  4JBB A;  2FA4 A;  1O8W A;  5F07 A;  2KHP A;  4QL7 A;  2HFD A;  3TGZ A;  2VO4 A;  2CVK A;  5LD0 A;  1R26 A;  13GS A;  1QUW A;  2GQM A;  2ZCT A;  3D22 A;  3QAW A;  1M9A A;  3P2A A;  1Y6E A;  3VK9 A;  1Z7R A;  3ZML A;  5AIS A;  4F0C A;  3A5W A;  2A4V A;  3FYG A;  4TXV A;  1E6B A;  2HSM A;  2EC4 A;  2VCQ A;  4K0N A;  3D4T A;  4EE0 A;  1PKW A;  2B5E A;  3AY8 A;  1K0N A;  1H4O A;  4G0I A;  5J41 A;  2H6X A;  3US3 A;  4DSR A;  4TR1 B;  4PQ1 A;  5HQP A;  1GNE A;  3QPM A;  1C72 A;  1GTI A;  3GH9 A;  3BOA A;  3JCM L;  4CW9 A;  3Q74 A;  1SD8 A;  4GTU A;  1OAZ A;  3GKX A;  2F3M A;  2PU9 C;  1TU7 A;  4LMW A;  4N10 A;  3HY2 A;  1U3A A;  1OYJ A;  5LNK e;  1B9X C;  11GS A;  2LKU A;  3P90 A;  3DKS A;  4BPY A;  5LCZ A;  2L4Q A;  4JR4 A;  3UBK A;  1M2B A;  3CYN A;  2IME A;  5HR1 A;  3GKM A;  1GSE A;  4CDO A;  5HFI A;  3RPP A;  4X1U A;  4XS6 A;  1M2A A;  3EMX A;  4N30 A;  1HNA A;  2ON7 A;  1G7E A;  2CA8 A;  3HYP A;  4LL1 B;  1ILO A;  1X5C A;  3D21 A;  2JZR A;  2H01 A;  2IPA A;  4OCF A;  2L6C A;  2EIR A;  5G5E A;  4H86 A;  2YAN A;  2LNS A;  4AJ7 A;  1TJD A;  3CSJ A;  3GSS A;  1ZMA A;  2FA8 A;  3EYT A;  2PVQ A;  3J7Y k;  1KTE A;  1TRV A;  1AXD A;  4ILF A;  1T4Z A;  1TU8 A;  1A2M A;  3CSH A;  3R2Q A;  3F8U A;  5BMU A;  3FR9 A;  1WPI A;  2B7K A;  4HUA A;  2FNO A;  3DYR A;  5A5K A;  1PD2 1;  5IIZ A;  4FO5 A;  5CYY A;  3KP9 A;  4EF0 A;  3HZ4 A;  2WRT A;  10GS A;  4HI7 A;  2WJU A;  5IPH A;  5KN0 A;  5ABR A;  2YV9 A;  5F0G A;  4ZBA A;  1PL2 A;  2DC5 A;  4IJI A;  4HS1 A;  1GUM A;  1F37 A;  5A4W A;  1XWG A;  2IMD A;  2E0Q A;  1B4P A;  1F3B A;  4V2N A;  2P5Q A;  5ECL B;  1FAA A;  1SD9 A;  2GT6 A;  3L9S A;  1SK0 A;  3TRQ A;  2JZS A;  4XRD A;  1F2E A;  3NOF A;  4G9H A;  2HSM B;  5KN2 A;  1ERV A;  2L5L A;  3QFA C;  4I2U A;  4GST A;  3L4N A;  1YDK A;  3UOM A;  1OC3 A;  1NW2 A;  2I1U A;  22GS A;  1K3Y A;  4IBP A;  3LXZ A;  3F4T A;  1EWX A;  3GV1 A;  3U6V A;  2FUG 2;  3RDW A;  2HXK A;  3SWL A;  2LRT A;  3G7Y A;  2F8A A;  4MDC A;  1GSQ A;  1X9S B;  3IAS 2;  4X0X A;  1Z6N A;  2LRC A;  4KB3 A;  1Z3E A;  1T4Y A;  3IK9 A;  2FGX A;  4L0W A;  3RBT A;  6GSW A;  1SK2 A;  1QGV A;  1YQ1 A;  2VLT A;  3IRA A;  2RM5 A;  3M9K A;  2MMO A;  4GCI A;  2OAD A;  4PXO A;  4BVX B;  1GNW A;  1SJZ A;  2OBI A;  1JHB A;  1VF1 A;  1MD3 A;  2OA7 A;  3CTG A;  2GZP A;  1A0R P;  4MF6 A;  1KNG A;  5IOX A;  3UIW A;  4EC0 A;  5HFK A;  4EDY A;  3HKR A;  1SKR B;  4N0Z A;  2LJA A;  4FYB A;  3UEM A;  2XC2 A;  4DSS A;  3F6D A;  5IO2 A;  1OC9 B;  1K0B A;  4IVF A;  2C4J A;  2H76 A;  5GSS A;  1AUC A;  3KTB A;  2B1K A;  6GSV A;  3LQ7 A;  4GSN A;  1WJK A;  2DSA A;  3GTU A;  1BED A;  4OFT A;  2P31 A;  4X43 A;  2X99 A;  2JU5 A;  2HSY A;  3A2W A;  3WYW A;  4Z7X A;  2OBK A;  2HRK A;  3LG6 A;  1XBS A;  2H74 A;  3ERW A;  2GQK A;  1E2Y A;  2LQQ A;  5ENU A;  3MNG A;  1CQH A;  2RUE A;  1OC8 A;  1TOF A;  1WE0 A;  4RI6 A;  1AAZ A;  3WGX A;  2KOK A;  2H6Z A;  4JU5 A;  5J4U A;  2J9H A;  1O8X A;  1K0O A;  1XWB A;  5JWQ B;  1TW9 A;  4MJC A;  4NAX A;  3DXB A;  2ES7 A;  1FOV A;  3PIN A;  4KSM A;  2PBJ A;  1A8L A;  1WOU A;  2FY6 A;  3ISO A;  3CRU A;  4J57 E;  2YJ7 A;  1XIY A;  5DDL A;  1XW6 A;  1YY7 A;  2C0D A;  3VI5 A;  1UC7 A;  3D5J A;  3N5O A;  1GWC A;  5IMF A;  1F3A A;  3HDC A;  1FO5 A;  4RUV A;  3F4S A;  3GRX A;  1BG5 A;  2C3T A;  6GSS A;  4PNG A;  4TW5 A;  2V1M A;  6GST A;  1MDJ A;  2AUV A;  4KDU A;  5ID2 A;  2GS3 A;  4RQR A;  2VLV A;  1SL2 B;  3Q6O A;  2H70 A;  3E0U A;  2O7K A;  3IPZ A;  1SEN A;  4YAP A;  5F05 A;  1XVQ A;  3VPT A;  4NHW A;  4OCE A;  5JWR B;  1NSW A;  2PUK C;  4IW9 A;  5DBQ A;  2A2R A;  3EWL A;  2PMT A;  3TKS E;  2YN1 A;  4OO4 A;  2ZUP A;  2C8U A;  5FWG A;  1O73 A;  2OE0 A;  2AHE A;  4ZB6 A;  1YF0 A;  3EIN A;  2QC7 A;  1PX7 A;  2O85 A;  2DML A;  1V58 A;  2R37 A;  3M9J A;  2HNL A;  3WT1 A;  1GLQ A;  3OR5 A;  2PER A;  4TR1 A;  2CT6 A;  2O87 A;  2G2Q A;  4G19 A;  3GN3 A;  2C0G A;  3QCP A;  1XVW A;  2YWO A;  1DE1 A;  2PGT A;  2PVO C;  5B6N A;  4PTS A;  2X8H A;  3VWW A;  1URM A;  3IXR A;  2B5X A;  1X9W B;  4WXT A;  3IDV A;  3P7X A;  1K0C A;  1GSY A;  4XHM A;  2WCI A; 
#chains in the Genus database with same CATH topology
 3GNJ A;  3Q18 A;  1THX A;  4NMU A;  2LV3 A;  3LOR A;  3VFI A;  2LUS A;  4AF2 A;  3UMA A;  1JLV A;  5ECM B;  3BCK A;  4NWY A;  5D93 A;  3EU4 A;  5IMZ A;  5G30 A;  2VD0 A;  5ELA A;  1DSB A;  2CQ9 A;  2XPE A;  4CY6 A;  1K0D A;  3ZZX A;  4DSS B;  4WET A;  4EDZ A;  1UA5 A;  2RLI A;  1PGT A;  5IM9 A;  5BRT A;  2IWT A;  3HVS A;  3L78 A;  4CHS A;  3GTU B;  3GH6 A;  3IK7 A;  4JZQ A;  5FHI A;  2VAF A;  2WB9 A;  2BJX A;  1ON4 A;  1YEX A;  2HRK B;  1H75 A;  3GFK A;  4G10 A;  2P0G A;  2YOI A;  2VIM A;  4L0U A;  5KN1 A;  4O5Q A;  3VPQ A;  2EIQ A;  1BAY A;  2VL2 A;  2N5F A;  4K0G A;  2O5V A;  5DJL A;  1SYX A;  3E9J B;  3APQ A;  3QOU A;  2WFC A;  2B6M A;  4N0V A;  1I9D A;  2NDO A;  3IHG A;  5JCG A;  3FEU A;  2WVY A;  5HR3 A;  2CAI A;  4EIP A;  1UN2 A;  3CWG A;  4KND A;  2PN8 A;  5C04 A;  3A2X A;  2WW0 A;  2A2P A;  2I9H A;  1DBY A;  1M99 A;  4GXZ A;  2OKA A;  5B6M A;  1OKT A;  2HZF A;  4ZIJ A;  1XCC A;  2IMI A;  1PSQ A;  3ZIT A;  4MZB A;  3W8J A;  1EV9 A;  2DJ0 A;  1Y1U A;  1HYU A;  5ID2 B;  1Z5Y E;  4ISD A;  2IIY A;  1AC1 A;  7GSS A;  1XG8 A;  5COH A;  1PQN A;  1AQX A;  4MJA A;  3F4R A;  4MH3 A;  2FWH A;  5DQY A;  2JL4 A;  3GUS A;  1SKS B;  2DKI A;  2O8V B;  1G7O A;  2H0G A;  1MTC A;  1JFU A;  4X4J A;  3R3E A;  4HQS A;  1JZR A;  1ZYN A;  3C8E A;  2CZ3 A;  2WVZ A;  4EUY A;  2LST A;  5AGY A;  5J9C A;  4GLT A;  5FT3 A;  2J23 A;  3HMJ G;  3GYK A;  1XWC A;  1HD2 A;  3IOS A;  3FMW A;  1OKD A;  5EL8 A;  5DAK B;  4V1A p;  4K5R A;  3ZYW A;  1ERW A;  2B3S A;  5E59 A;  2VL3 A;  1TXU A;  4L5O A;  2X49 A;  5ECS A;  2KP2 A;  4Z2U A;  4MJE A;  4USS A;  4EKZ A;  4Q5N A;  1VGL A;  2CX3 A;  4QL9 A;  4ZIL A;  4G01 A;  4PGT A;  3M0F A;  1M0U A;  1U87 A;  4IS0 A;  5IO0 A;  5H5R A;  4TR3 A;  4ULX A;  4BVX A;  1OE8 A;  4ACS A;  2KUC A;  5D96 A;  4ZBD A;  1GTU A;  2MBT A;  5IMC A;  4K6X A;  3GX8 A;  1GSS A;  1SYR A;  3FRC A;  5D9T A;  3W6G A;  2BTO T;  1OC9 A;  2MBS A;  1WIK A;  2GST A;  4EIQ A;  3GHA A;  4MAB A;  3LW9 A;  1TTZ A;  4KE3 A;  1PN9 A;  1G6W A;  5IMD A;  1QFN A;  2Z9S A;  2FWG A;  1FVJ A;  4TXO A;  4PQI A;  2XPD A;  1XXU A;  3VWV A;  4GSS A;  4TRX A;  1TRW A;  1U6T A;  2DMM A;  3TCO A;  2H30 A;  3D4M A;  1WRY A;  1B9Y C;  4ZB9 A;  4MP4 A;  1T1V A;  4WEY A;  2OJL A;  1Z7P A;  4YH2 A;  5ELG A;  1XPV A;  4MF5 A;  1PRX A;  4PQH A;  4KH7 A;  1YKA A;  4K7N A;  5IPG A;  3APS A;  4MLY A;  4BL7 A;  3CSI A;  2H19 A;  2FWF A;  3H8Q A;  3FZA A;  3DRN A;  3KIJ A;  4BWS A;  4E68 A;  5CRH A;  2X8G A;  3ERG A;  4A5P A;  2H71 A;  2YPM A;  2DJ1 A;  3G7J A;  2K18 A;  3BD2 A;  2HRF A;  1IYI A;  1M2D A;  4XCS A;  3KTL A;  4MCU A;  1HQO A;  3HA9 A;  1CQG A;  3ZTL A;  2L57 A;  4MPG A;  3GST A;  3IE3 A;  1EZK A;  1ZL9 A;  2DLX A;  3A3T A;  3EC3 A;  3TKS C;  16GS A;  2NPB A;  5G5F A;  1M7T A;  4OMV A;  4KCA A;  2O3E A;  2VD1 A;  5C00 A;  3P8W A;  4GWR A;  2E2G A;  4V2M A;  2JAC A;  6GSU A;  1FW1 A;  4YQV A;  4I97 A;  5AIX A;  3BBY A;  3WGD A;  1Q98 A;  2H0H A;  4G0L A;  4WKW A;  1JLW A;  4HOJ A;  2EFC A;  1O7U A;  2P5R A;  5B7C A;  1A24 A;  1ZGN A;  1GLP A;  4K2D A;  5G1K A;  4GF0 A;  14GS A;  1YF1 A;  5DAL A;  2AAW A;  4DEJ A;  5J47 A;  1BX9 A;  2RUF A;  4RI7 A;  1HNB A;  4AGS A;  1SKW B;  4Q5Q A;  1AQW A;  2NTO A;  2JZT A;  2L6D A;  2QSI A;  2MMA A;  5J3R A;  4PUA A;  1FVK A;  4I2T A;  3GIX A;  2R4V A;  4WF4 A;  3QD9 A;  2R0G A;  3DGQ A;  4KA0 A;  1XWA A;  3ZRD A;  3GL3 A;  3DIE A;  1J08 A;  4IJ3 A;  2DKH A;  2CV4 A;  4PI2 C;  2IFQ B;  4TR0 A;  4DSQ A;  3GUR A;  5EPF A;  5DCG A;  2CZ2 A;  3WD6 A;  4L5L A;  1O6J A;  4JE1 A;  1ZZY A;  2C3N A;  4K7I A;  1EOH A;  1T7P B;  2WGR A;  1B4Q A;  3FZ5 A;  2H6Y A;  2VL9 A;  2C0E A;  2XHF A;  4JED A;  4PHZ C;  4ZB8 A;  1NHY A;  4IGJ A;  5CRD A;  3C71 A;  5JCW A;  1ABA A;  3FKF A;  5ECQ B;  2V2G A;  5ECI B;  3UJ1 A;  3ZMK A;  3LXT A;  4YQU A;  2MZC A;  1SVO A;  3FW2 A;  1Z9H A;  4K9Z A;  4FXY P;  4ECB A;  2F9S A;  2HI7 A;  2WS2 A;  2K6V A;  1MDK A;  4MJB A;  4NV5 A;  1OE7 A;  1W4V A;  4V1A g;  1GSF A;  4XRA A;  3G7I A;  3LSZ A;  3MYD A;  4TXO B;  2GQL A;  2V41 A;  4YQM A;  3F6F A;  1W89 A;  2V6K A;  1TXX A;  3DEX A;  17GS A;  3FZ9 A;  5GAN D;  1FB6 A;  3HD5 A;  5G31 A;  4GRF A;  3IBH A;  1BF5 A;  3PR8 A;  5ECP B;  4ZL8 A;  5G1L A;  5AIV A;  1A0F A;  3VLN A;  3H1N A;  3KH9 A;  3DML A;  1Q4J A;  2B1L A;  2HE3 A;  4KF9 A;  1S3D A;  2X4A A;  3VWX A;  1EGO A;  1GH2 A;  4BL7 B;  3ZRE A;  2VCX A;  2R5G A;  4FQU A;  2VOC A;  1U3I A;  3LWA A;  2FCH A;  1GUL A;  1ERT A;  3PGT A;  3KD0 A;  2C1Y A;  5CAX A;  4KX4 A;  4ML6 A;  3J7Y b;  1A8Y A;  1USB A;  5EVO A;  1FOH A;  1MD4 A;  3F63 A;  4MMM A;  2HLS A;  5L71 A;  3KMO A;  3F9U A;  4NHZ A;  2HSN B;  2HRA A;  4EXJ A;  3HVV A;  4MPF A;  3TOU A;  2CVB A;  2F51 A;  1DE2 A;  1X0R A;  2LNT A;  5A4U A;  3F3R A;  2VUP A;  2BMX A;  3TKP A;  1KBN A;  4F9Z A;  2FLS A;  1GP1 A;  3QMX A;  5DJM A;  1YVL A;  2RII A;  3FR6 A;  4KDY A;  5ECO B;  2D2Z A;  4LA1 A;  1EP7 A;  2N5A A;  1GSU A;  5DAL B;  1V40 A;  2NVL A;  4HSC X;  1QMV A;  3HJP A;  4ZBB A;  3V1W A;  4F03 A;  1JZO A;  5DAK A;  5CNW A;  3ZL5 A;  1TP9 A;  4OD7 A;  2YWN A;  2QA2 A;  3F0I A;  4GQC A;  2VCV A;  5INY A;  4QQ7 A;  3TJG A;  4HU7 A;  1ZOF A;  3MDK A;  1I1I P;  3IHQ A;  2FD3 A;  5D9X A;  3LJR A;  4XS1 A;  4KGI A;  2FHE A;  3TDG A;  2VLU A;  3F3Q A;  1TRU A;  1K0M A;  4ECJ A;  3TKR A;  4XS4 A;  3GKK A;  4F0B A;  3I43 A;  3CBU A;  1GRX A;  2XBI A;  4EL1 A;  3QDN A;  4WF5 A;  2AYT A;  5CRE A;  3QR6 A;  1R5A A;  3L0H A;  4O7H A;  4PX1 A;  1QQ2 A;  3TOT A;  5J9B A;  1ZYE A;  1MEK A;  2AJQ B;  1VF4 A;  5J4Y A;  4KCE A;  6GSY A;  3KH7 A;  1A2J A;  4IP1 A;  3ZLP A;  2K8S A;  4BIK A;  4PNF A;  4N11 A;  5DVB A;  3ED3 A;  1RK4 A;  2R3X A;  1ST9 A;  1TKD B;  3QFB C;  3KJY A;  4D73 A;  1T00 A;  2IN3 A;  4V2L A;  2ON5 A;  2E7P A;  2IJY A;  3EUR A;  4NPB A;  4AJ8 A;  1B48 A;  1VRS D;  1YEP A;  1HNC A;  1TK0 B;  18GS A;  5D9V A;  3TJB A;  2CVD A;  2R6K A;  3LFL A;  3UBL A;  4JR6 A;  1R7H A;  4PUF C;  1EEJ A;  4ICY A;  3H4K A;  3DVX A;  1LJR A;  1K3L A;  4CY8 A;  19GS A;  3MWH A;  1VF2 A;  3DVW A;  4ZL9 A;  5B8A A;  5D8I A;  4HEA 2;  1EP8 A;  1V9W A;  4NV2 A;  1TI3 A;  2EFD A;  2KP1 A;  1YJ6 A;  2K8V A;  4YKF A;  2WZ9 A;  1JZD A;  2HZE A;  2DJ3 A;  1GUK A;  4LLR A;  3FY7 A;  3MAK A;  2H1G A;  4HJM A;  4Z2T A;  5HFG A;  5KN3 A;  2M80 A;  1G0T A;  2H72 A;  2L59 A;  1WWJ A;  2VM2 A;  2ALB A;  2C80 A;  2DBC A;  5GZZ B;  5IQY A;  1SL1 B;  3TKS A;  2GSR A;  1O81 A;  1T3B A;  4HDE A;  3WT2 A;  3ME7 A;  3QAV A;  1XW5 A;  1TK8 B;  3LEF A;  3KZQ A;  5F8B A;  4TOP A;  2GVP A;  2HSH A;  9GSS A;  3N9J A;  1M3I A;  3RAZ A;  1PL1 A;  2CX4 A;  3M1G A;  3EU3 A;  2IL3 A;  2WUL A;  4DVC A;  2GGT A;  1TK5 B;  3RHC A;  2B7J A;  1SK1 A;  4O5R A;  3O6T A;  4POK A;  2AV4 A;  1R4W A;  4KDX A;  4ECC A;  4XS4 B;  3M8N A;  2O89 A;  4W66 A;  4WR4 A;  3H93 A;  2IFQ A;  2QKE A;  4ZXG A;  4NXI A;  2TIR A;  2DIZ A;  2TRC P;  2DJJ A;  2X64 A;  5A1N A;  2R0C A;  1V57 A;  2OE1 A;  1XZO A;  2LJK A;  1LU4 A;  4WBJ A;  4I6X A;  3CTF A;  2QA1 A;  1AW9 A;  5A4V A;  1XWK A;  3UAR A;  3Q19 A;  4JRR A;  3VWU A;  4GQF A;  1SJ6 A;  2V32 A;  4AKG A;  4IKH A;  4K7O A;  2YZU A;  5DCH A;  4D73 B;  4TR4 A;  1SU9 A;  4RQX A;  4HQZ A;  2H0I A;  2PWJ A;  6GSX A;  2VM1 A;  4E8E A;  3MSZ A;  2VL2 C;  3QAG A;  1S3C A;  2YWM A;  4MZW A;  3I9V 2;  2IMK A;  3HJM A;  3IC4 A;  2VKZ G;  1QK8 A;  3ZIJ A;  3C1S A;  1FG4 A;  3NIV A;  2LRN A;  2B5Y A;  3IA1 A;  4G0K A;  1VF3 A;  1NM3 A;  3ME8 A;  4POB A;  3ZIV A;  1XOB A;  3KMN A;  4F82 A;  2LJR A;  4POM A;  1SVM A;  4OWY A;  2L5O A;  5ECH B;  3TJK A;  3RPN A;  3UVH A;  2MYG A;  3EE2 A;  3GMF A;  4AJ6 A;  3TRX A;  1SJI A;  4F2I A;  2HZE B;  5DQS A;  3A2V A;  4K1F A;  4J2F A;  5CRW A;  4BWQ A;  2YCD A;  3U5R E;  1THO A;  3IC8 A;  2HSN A;  3RGB C;  4POL A;  3C1R A;  4IQA A;  3H79 A;  4WR5 A;  2H1A A;  1OVN A;  3ZVJ D;  5H5Q A;  5IOW A;  2XBQ A;  5AN1 A;  4KAE A;  2RM6 A;  4TVE A;  2CAQ A;  1O85 A;  4K2X A;  4AI6 A;  2QGV A;  3TJF A;  3ERF A;  2DIY A;  4O92 A;  4I5Q A;  2E2M A;  4ID0 A;  1J9B A;  3HCZ A;  1M3J A;  1EGR A;  1MDI A;  2LTK A;  3O3T A;  2C0F A;  2GDR A;  4PI0 C;  3UVT A;  2JSZ A;  5F06 A;  2VCT A;  4YKG A;  4K8M A;  4OFN A;  4HZ2 A;  5HR0 A;  1G6Y A;  3RFR C;  2REM A;  4FIW A;  4OO5 A;  2A2S A;  2WW2 A;  2WW1 A;  5IMA A;  2EFE A;  4Z2R A;  5CRG A;  4BVY A;  2TRX A;  1DUG A;  1X5D A;  3UL3 A;  1PA3 A;  1SL0 B;  3K8N A;  3LYP A;  2F8F A;  1F6M C;  4HZ4 A;  1FB0 A;  3CQF A;  2PPT A;  5J5N A;  4KW6 A;  4BA7 A;  5A1N B;  4J56 E;  4TKY A;  3KGK A;  3KCM A;  4MA9 A;  5GST A;  2H73 A;  4ZB7 A;  3CXG A;  3LYK A;  3EMP A;  2EIO A;  2KLX A;  5KEJ A;  3IAM 2;  1AIU A;  1UVZ A;  3G9B A;  4MZC A;  3ZVJ A;  1K3O A;  2HT9 A;  3IV4 A;  1YEW C;  1N8J A;  1EOG A;  3PPU A;  1J0F A;  3EVI A;  1XOA A;  1GUH A;  3UAP A;  4EVM A;  5J40 A;  4FYC A;  2H1B A;  1T8E B;  4IEL A;  3NZN A;  1YZX A;  2WVX B;  3GKN A;  5A5H A;  1GSD A;  1WP0 A;  2YJH A;  3D0Z A;  3HVX A;  5E4W A;  12GS A;  2GZZ A;  2YWI A;  4YAV A;  4OFM A;  4IHU A;  2OE3 A;  1SVL A;  5BMU B;  3O76 A;  4ECI A;  4IP6 A;  5JWO B;  5JCU A;  2X8C A;  1RW1 A;  1YKC A;  3KXO A;  5EY6 A;  4P3Y B;  3ZFL A;  1TDI A;  2K9F A;  5D9W A;  3C7M A;  3CMI A;  4EO3 A;  4GDF A;  1ERU A;  3E3E A;  2YP6 A;  2JSY A;  5D73 A;  4ML1 A;  4L8E A;  3HXS A;  3TRP A;  8GSS A;  2IMF A;  2NBS A;  1TI1 A;  3L9V A;  5GAP D;  1U88 A;  3FK8 A;  1S3A A;  4LMV A;  2HYX A;  4HJ2 A;  4I8B A;  2FWE A;  1A2L A;  3RHB A;  20GS A;  2MMN A;  5H5S A;  3GA4 A;  1Z6M A;  3KEB A;  2JAD A;  3CRT A;  4Q5F A;  3TU3 B;  3M3M A;  2I81 A;  5A34 A;  3FHK A;  4O32 A;  2I4A A;  1LBK A;  4FH8 A;  1R5P A;  4Q5R A;  3ZFB A;  4N3Z A;  3KM6 A;  4MF7 A;  1M9B A;  1ZCP A;  4XTS A;  1XFL A;  2UZ8 A;  3FR3 A;  2I3Y A;  4E8H A;  3DWV A;  1PKZ A;  4MNN A;  4IQ1 A;  1X5E A;  1BJX A;  2UV8 G;  1F9M A;  2H8L A;  3GX0 A;  2HRN A;  3S9F A;  4BVY B;  2H75 A;  3HZ8 A;  3L9U A;  1I5G A;  2GTU A;  2M72 A;  2WDU A;  4XIH A;  1PMT A;  1N2A A;  2ZNM A;  4LL4 B;  3LGC A;  2GZY A;  1K0A A;  5KOX A;  1JZW A;  5G2Z A;  2H1D A;  1XW9 A;  3SBC A;  2OT3 A;  5HR2 A;  1B8X A;  4KSO A;  4MK3 A;  3WGE A;  4FYU A;  1FHE A;  2GLR A;  2H66 A;  3I69 A;  2VCW A;  4KUN A;  3EPT A;  3TB2 A;  4TN8 A;  5ECR B;  3TUE A;  5CP1 A;  2L4C A;  3HHV A;  2YZH A;  5ECN B;  5CO3 A;  1PX6 A;  3BCI A;  3C73 A;  1PN0 A;  5B8B A;  3BJ5 A;  1EEM A;  1BYE A;  5A5H B;  2LS5 A;  3HJO A;  1WMJ A;  2DJ2 A;  4G2E A;  5J4V A;  2LEG A;  2VCZ A;  1EV4 A;  1QXH A;  4IN0 A;  1V2A A;  1GTA A;  2HQT A;  4PUR A;  3D6I A;  2C3Q A;  1TRS A;  1Y25 A;  2N5B A;  3VUR A;  5ECK B;  4HU9 A;  3TKQ A;  2G0F A;  4ZL7 A;  1KEB A;  1ZYQ B;  2WW3 A;  3FZ4 A;  2GT5 A;  2AB6 A;  2MMZ A;  1S4B P;  3W8S A;  1BQ7 A;  1RQM A;  3VI7 A;  3DD3 A;  3APO A;  2DJK A;  1NHO A;  1GTB A;  1A23 A;  4MH2 A;  3KP8 A;  2LQO A;  1ML6 A;  2M46 A;  2GSS A;  3GL5 A;  3I6A A;  2OAC A;  1X9M B;  2V6O A;  3TJJ A;  2R2J A;  4WBR D;  2GSQ A;  5IMV A;  1ACV A;  3IR4 A;  2YNX A;  1GL8 A;  3PH9 A;  3MIX A;  1AQV A;  1V98 A;  1IYH A;  2YV7 A;  4JBB A;  2FA4 A;  1O8W A;  5F07 A;  2KHP A;  4QL7 A;  2HFD A;  3TGZ A;  2VO4 A;  2CVK A;  5LD0 A;  5A34 B;  1R26 A;  13GS A;  1QUW A;  2GQM A;  2ZCT A;  3D22 A;  3QAW A;  1M9A A;  3P2A A;  1Y6E A;  3VK9 A;  1Z7R A;  3ZML A;  4AKX B;  5AIS A;  4F0C A;  3A5W A;  2A4V A;  3FYG A;  4TXV A;  1E6B A;  2HSM A;  2EC4 A;  2VCQ A;  4K0N A;  3D4T A;  4EE0 A;  1PKW A;  2B5E A;  3AY8 A;  1K0N A;  4AKH A;  1H4O A;  4G0I A;  5J41 A;  4AKI A;  2H6X A;  3US3 A;  4DSR A;  4TR1 B;  4PQ1 A;  5HQP A;  2O36 A;  1GNE A;  4O5U A;  3QPM A;  1C72 A;  1GTI A;  3GH9 A;  3BOA A;  3JCM L;  4CW9 A;  3Q74 A;  1SD8 A;  4GTU A;  1OAZ A;  3GKX A;  2F3M A;  2PU9 C;  1TU7 A;  4K5S A;  4LMW A;  4N10 A;  3HY2 A;  1U3A A;  1OYJ A;  5LNK e;  1B9X C;  11GS A;  2LKU A;  3P90 A;  3DKS A;  4BPY A;  5LCZ A;  2L4Q A;  4JR4 A;  3UBK A;  1BG1 A;  1M2B A;  3CYN A;  2IME A;  5HR1 A;  3GKM A;  1GSE A;  4CDO A;  5HFI A;  3RPP A;  4X1U A;  4XS6 A;  1M2A A;  3EMX A;  4N30 A;  1HNA A;  2ON7 A;  1G7E A;  2CA8 A;  3HYP A;  4LL1 B;  3A5I A;  1ILO A;  1X5C A;  3D21 A;  2JZR A;  2H01 A;  2IPA A;  4OCF A;  3CHX C;  2L6C A;  2EIR A;  5G5E A;  2WVX A;  4H86 A;  2YAN A;  2LNS A;  4AJ7 A;  1TJD A;  3CSJ A;  3GSS A;  1ZMA A;  2FA8 A;  3EYT A;  2PVQ A;  3J7Y k;  1KTE A;  2EFH A;  1TRV A;  1AXD A;  4ILF A;  1T4Z A;  1TU8 A;  1A2M A;  3CSH A;  3R2Q A;  3F8U A;  5BMU A;  3FR9 A;  1WPI A;  2B7K A;  4HUA A;  2FNO A;  3DYR A;  5A5K A;  1PD2 1;  5IIZ A;  4FO5 A;  2R0P A;  5CYY A;  3KP9 A;  4EF0 A;  3HZ4 A;  2WRT A;  10GS A;  4HI7 A;  2WJU A;  5IPH A;  5KN0 A;  5ABR A;  2YV9 A;  5F0G A;  4ZBA A;  1PL2 A;  2DC5 A;  4IJI A;  4HS1 A;  1GUM A;  1F37 A;  5A4W A;  1XWG A;  2IMD A;  2E0Q A;  1B4P A;  1F3B A;  4V2N A;  2WZS A;  1S3R A;  2H1L A;  2P5Q A;  5ECL B;  1FAA A;  1SD9 A;  2GT6 A;  3L9S A;  1SK0 A;  3TRQ A;  2JZS A;  4XRD A;  1F2E A;  3NOF A;  4G9H A;  2HSM B;  5KN2 A;  1ERV A;  2L5L A;  3QFA C;  4I2U A;  4GST A;  3L4N A;  1YDK A;  3UOM A;  1OC3 A;  1NW2 A;  2I1U A;  22GS A;  1K3Y A;  4IBP A;  3LXZ A;  3F4T A;  1EWX A;  3GV1 A;  3U6V A;  2FUG 2;  3RDW A;  2HXK A;  3SWL A;  2LRT A;  3G7Y A;  2F8A A;  4MDC A;  1GSQ A;  1X9S B;  3IAS 2;  4X0X A;  1Z6N A;  2LRC A;  4KB3 A;  1Z3E A;  1T4Y A;  3IK9 A;  2FGX A;  4L0W A;  3RBT A;  6GSW A;  1SK2 A;  1QGV A;  1YQ1 A;  2VLT A;  3IRA A;  2RM5 A;  3M9K A;  2MMO A;  4GCI A;  2OAD A;  4PXO A;  4BVX B;  1GNW A;  1SJZ A;  2OBI A;  1JHB A;  1VF1 A;  1MD3 A;  2OA7 A;  3CTG A;  2GZP A;  1A0R P;  4MF6 A;  5KOW A;  1KNG A;  5IOX A;  3UIW A;  4QMK A;  4EC0 A;  5HFK A;  4EDY A;  3HKR A;  1SKR B;  4N0Z A;  2LJA A;  4FYB A;  3UEM A;  2XC2 A;  4DSS A;  3F6D A;  5IO2 A;  1OC9 B;  1K0B A;  3HVN A;  4IVF A;  2C4J A;  2H76 A;  5GSS A;  1AUC A;  3KTB A;  2B1K A;  6GSV A;  3LQ7 A;  4GSN A;  1WJK A;  2DSA A;  3GTU A;  1BED A;  4OFT A;  2P31 A;  4X43 A;  2X99 A;  2JU5 A;  2HSY A;  3A2W A;  3WYW A;  4Z7X A;  2OBK A;  2HRK A;  3LG6 A;  1XBS A;  2H74 A;  3ERW A;  2GQK A;  1E2Y A;  2LQQ A;  5ENU A;  3MNG A;  1CQH A;  2RUE A;  1OC8 A;  1TOF A;  1WE0 A;  4RI6 A;  1AAZ A;  3WGX A;  2KOK A;  2H6Z A;  4JU5 A;  5J4U A;  2J9H A;  1O8X A;  1K0O A;  1XWB A;  5JWQ B;  1TW9 A;  4MJC A;  1N25 A;  4NAX A;  3DXB A;  2ES7 A;  1FOV A;  3PIN A;  4KSM A;  2PBJ A;  1A8L A;  1WOU A;  2FY6 A;  3ISO A;  3CRU A;  4J57 E;  2YJ7 A;  1XIY A;  5DDL A;  1XW6 A;  1YY7 A;  2C0D A;  3VI5 A;  1UC7 A;  3D5J A;  3N5O A;  1GWC A;  5IMF A;  1F3A A;  3HDC A;  1FO5 A;  4RUV A;  3F4S A;  3GRX A;  1BG5 A;  2C3T A;  6GSS A;  4PNG A;  4TW5 A;  2V1M A;  1PFO A;  6GST A;  1MDJ A;  2AUV A;  4KDU A;  5ID2 A;  2GS3 A;  4RQR A;  2VLV A;  1SL2 B;  3Q6O A;  2H70 A;  3E0U A;  2O7K A;  3IPZ A;  1SEN A;  4YAP A;  5F05 A;  1XVQ A;  3VPT A;  4NHW A;  4OCE A;  5JWR B;  1NSW A;  2PUK C;  4IW9 A;  5DBQ A;  2A2R A;  3EWL A;  2PMT A;  3TKS E;  2YN1 A;  4OO4 A;  2ZUP A;  2C8U A;  5FWG A;  1O73 A;  2OE0 A;  2AHE A;  4ZB6 A;  1YF0 A;  3EIN A;  2QC7 A;  1PX7 A;  2O85 A;  2DML A;  1V58 A;  2R37 A;  3M9J A;  2HNL A;  3WT1 A;  1GLQ A;  3OR5 A;  2PER A;  4TR1 A;  2CT6 A;  2O87 A;  2A4H A;  2G2Q A;  4G19 A;  3GN3 A;  2C0G A;  3QCP A;  1XVW A;  2YWO A;  1DE1 A;  2PGT A;  2PVO C;  5B6N A;  4PTS A;  2X8H A;  3VWW A;  1URM A;  3IXR A;  2B5X A;  1X9W B;  4WXT A;  3IDV A;  1ZYP A;  3P7X A;  1K0C A;  1GSY A;  4XHM A;  2WCI A; 
#chains in the Genus database with same CATH homology
 3GNJ A;  3Q18 A;  1THX A;  4NMU A;  2LV3 A;  3LOR A;  3VFI A;  2LUS A;  4AF2 A;  3UMA A;  1JLV A;  5ECM B;  3BCK A;  4NWY A;  5D93 A;  3EU4 A;  5IMZ A;  5G30 A;  2VD0 A;  5ELA A;  1DSB A;  2CQ9 A;  2XPE A;  4CY6 A;  1K0D A;  3ZZX A;  4DSS B;  4WET A;  4EDZ A;  1UA5 A;  2RLI A;  1PGT A;  5IM9 A;  5BRT A;  2IWT A;  3HVS A;  3L78 A;  4CHS A;  3GTU B;  3GH6 A;  3IK7 A;  4JZQ A;  5FHI A;  2VAF A;  2WB9 A;  2BJX A;  1ON4 A;  1YEX A;  2HRK B;  1H75 A;  3GFK A;  4G10 A;  2P0G A;  2YOI A;  2VIM A;  4L0U A;  5KN1 A;  4O5Q A;  3VPQ A;  2EIQ A;  1BAY A;  2VL2 A;  2N5F A;  4K0G A;  2O5V A;  5DJL A;  1SYX A;  3E9J B;  3APQ A;  3QOU A;  2WFC A;  2B6M A;  4N0V A;  1I9D A;  2NDO A;  3IHG A;  5JCG A;  3FEU A;  5HR3 A;  2CAI A;  4EIP A;  1UN2 A;  3CWG A;  4KND A;  2PN8 A;  5C04 A;  3A2X A;  2A2P A;  2I9H A;  1DBY A;  1M99 A;  4GXZ A;  2OKA A;  5B6M A;  1OKT A;  2HZF A;  4ZIJ A;  1XCC A;  2IMI A;  1PSQ A;  3ZIT A;  4MZB A;  3W8J A;  1EV9 A;  2DJ0 A;  1Y1U A;  1HYU A;  5ID2 B;  1Z5Y E;  4ISD A;  2IIY A;  1AC1 A;  7GSS A;  5COH A;  1PQN A;  1AQX A;  4MJA A;  3F4R A;  4MH3 A;  2FWH A;  5DQY A;  2JL4 A;  3GUS A;  1SKS B;  2DKI A;  1G7O A;  2O8V B;  2H0G A;  1MTC A;  1JFU A;  4X4J A;  3R3E A;  4HQS A;  1JZR A;  1ZYN A;  3C8E A;  2CZ3 A;  4EUY A;  2LST A;  5AGY A;  5J9C A;  4GLT A;  5FT3 A;  2J23 A;  3HMJ G;  3GYK A;  1XWC A;  1HD2 A;  3IOS A;  3FMW A;  1OKD A;  5EL8 A;  5DAK B;  4V1A p;  4K5R A;  3ZYW A;  1ERW A;  2B3S A;  5E59 A;  2VL3 A;  1TXU A;  4L5O A;  2X49 A;  5ECS A;  2KP2 A;  4Z2U A;  4MJE A;  4USS A;  4EKZ A;  4Q5N A;  1VGL A;  2CX3 A;  4QL9 A;  4ZIL A;  4G01 A;  4PGT A;  3M0F A;  1M0U A;  1U87 A;  4IS0 A;  5IO0 A;  5H5R A;  4TR3 A;  4ULX A;  4BVX A;  1OE8 A;  4ACS A;  2KUC A;  5D96 A;  4ZBD A;  1GTU A;  2MBT A;  5IMC A;  4K6X A;  3GX8 A;  1GSS A;  1SYR A;  3FRC A;  5D9T A;  3W6G A;  2BTO T;  1OC9 A;  2MBS A;  1WIK A;  2GST A;  4EIQ A;  3GHA A;  4MAB A;  3LW9 A;  1TTZ A;  4KE3 A;  1PN9 A;  1G6W A;  5IMD A;  1QFN A;  2Z9S A;  2FWG A;  1FVJ A;  4TXO A;  4PQI A;  2XPD A;  1XXU A;  3VWV A;  4GSS A;  4TRX A;  1TRW A;  1U6T A;  2DMM A;  3TCO A;  2H30 A;  3D4M A;  1WRY A;  1B9Y C;  4ZB9 A;  4MP4 A;  1T1V A;  4WEY A;  2OJL A;  1Z7P A;  4YH2 A;  5ELG A;  1XPV A;  4MF5 A;  1PRX A;  4PQH A;  4KH7 A;  1YKA A;  4K7N A;  5IPG A;  3APS A;  4MLY A;  4BL7 A;  3CSI A;  2H19 A;  2FWF A;  3H8Q A;  3FZA A;  3DRN A;  3KIJ A;  4BWS A;  4E68 A;  5CRH A;  2X8G A;  3ERG A;  4A5P A;  2H71 A;  2YPM A;  2DJ1 A;  3G7J A;  2K18 A;  3BD2 A;  2HRF A;  1IYI A;  1M2D A;  4XCS A;  3KTL A;  4MCU A;  1HQO A;  3HA9 A;  1CQG A;  3ZTL A;  2L57 A;  4MPG A;  3GST A;  3IE3 A;  1EZK A;  1ZL9 A;  2DLX A;  3A3T A;  3EC3 A;  3TKS C;  16GS A;  2NPB A;  5G5F A;  1M7T A;  4OMV A;  4KCA A;  2VD1 A;  5C00 A;  3P8W A;  4GWR A;  2E2G A;  4V2M A;  2JAC A;  6GSU A;  1FW1 A;  4YQV A;  4I97 A;  5AIX A;  3BBY A;  3WGD A;  1Q98 A;  2H0H A;  4G0L A;  4WKW A;  1JLW A;  4HOJ A;  2EFC A;  1O7U A;  2P5R A;  5B7C A;  1A24 A;  1ZGN A;  1GLP A;  4K2D A;  5G1K A;  4GF0 A;  14GS A;  1YF1 A;  5DAL A;  2AAW A;  4DEJ A;  5J47 A;  1BX9 A;  2RUF A;  4RI7 A;  1HNB A;  4AGS A;  1SKW B;  4Q5Q A;  1AQW A;  2NTO A;  2JZT A;  2L6D A;  2QSI A;  2MMA A;  5J3R A;  4PUA A;  1FVK A;  4I2T A;  3GIX A;  2R4V A;  4WF4 A;  3QD9 A;  2R0G A;  3DGQ A;  4KA0 A;  1XWA A;  3ZRD A;  3GL3 A;  3DIE A;  1J08 A;  4IJ3 A;  2DKH A;  2CV4 A;  2IFQ B;  4TR0 A;  4DSQ A;  3GUR A;  5EPF A;  5DCG A;  2CZ2 A;  3WD6 A;  4L5L A;  1O6J A;  4JE1 A;  1ZZY A;  2C3N A;  4K7I A;  1EOH A;  1T7P B;  2WGR A;  1B4Q A;  3FZ5 A;  2H6Y A;  2VL9 A;  2C0E A;  2XHF A;  4JED A;  4ZB8 A;  1NHY A;  4IGJ A;  5CRD A;  3C71 A;  5JCW A;  1ABA A;  3FKF A;  5ECQ B;  2V2G A;  5ECI B;  3UJ1 A;  3ZMK A;  3LXT A;  4YQU A;  2MZC A;  1SVO A;  3FW2 A;  1Z9H A;  4K9Z A;  4ECB A;  2F9S A;  2HI7 A;  2WS2 A;  2K6V A;  1MDK A;  4MJB A;  4NV5 A;  1OE7 A;  1W4V A;  4V1A g;  1GSF A;  4XRA A;  3G7I A;  3LSZ A;  3MYD A;  4TXO B;  2GQL A;  2V41 A;  4YQM A;  3F6F A;  1W89 A;  2V6K A;  1TXX A;  3DEX A;  17GS A;  3FZ9 A;  5GAN D;  1FB6 A;  3HD5 A;  5G31 A;  4GRF A;  3IBH A;  1BF5 A;  3PR8 A;  5ECP B;  4ZL8 A;  5G1L A;  5AIV A;  1A0F A;  3VLN A;  3H1N A;  3KH9 A;  3DML A;  1Q4J A;  2B1L A;  2HE3 A;  4KF9 A;  1S3D A;  2X4A A;  3VWX A;  1EGO A;  1GH2 A;  4BL7 B;  3ZRE A;  2VCX A;  2R5G A;  4FQU A;  2VOC A;  1U3I A;  3LWA A;  2FCH A;  1GUL A;  1ERT A;  3PGT A;  3KD0 A;  2C1Y A;  5CAX A;  4KX4 A;  4ML6 A;  3J7Y b;  1A8Y A;  1USB A;  5EVO A;  1FOH A;  1MD4 A;  3F63 A;  4MMM A;  2HLS A;  5L71 A;  3KMO A;  3F9U A;  4NHZ A;  2HSN B;  2HRA A;  4EXJ A;  3HVV A;  4MPF A;  3TOU A;  2CVB A;  2F51 A;  1DE2 A;  1X0R A;  2LNT A;  5A4U A;  3F3R A;  2VUP A;  2BMX A;  3TKP A;  1KBN A;  4F9Z A;  2FLS A;  1GP1 A;  3QMX A;  5DJM A;  1YVL A;  2RII A;  3FR6 A;  4KDY A;  5ECO B;  2D2Z A;  4LA1 A;  1EP7 A;  2N5A A;  1GSU A;  5DAL B;  1V40 A;  2NVL A;  1QMV A;  3HJP A;  4ZBB A;  3V1W A;  4F03 A;  1JZO A;  5DAK A;  5CNW A;  3ZL5 A;  1TP9 A;  4OD7 A;  2YWN A;  2QA2 A;  3F0I A;  4GQC A;  2VCV A;  5INY A;  4QQ7 A;  3TJG A;  4HU7 A;  1ZOF A;  3MDK A;  3IHQ A;  2FD3 A;  5D9X A;  3LJR A;  4XS1 A;  4KGI A;  2FHE A;  3TDG A;  2VLU A;  3F3Q A;  1TRU A;  1K0M A;  4ECJ A;  3TKR A;  4XS4 A;  3GKK A;  4F0B A;  3I43 A;  3CBU A;  1GRX A;  2XBI A;  4EL1 A;  3QDN A;  4WF5 A;  2AYT A;  5CRE A;  3QR6 A;  1R5A A;  3L0H A;  4O7H A;  4PX1 A;  1QQ2 A;  3TOT A;  5J9B A;  1ZYE A;  1MEK A;  2AJQ B;  1VF4 A;  5J4Y A;  4KCE A;  6GSY A;  3KH7 A;  1A2J A;  4IP1 A;  3ZLP A;  2K8S A;  4PNF A;  4N11 A;  5DVB A;  3ED3 A;  1RK4 A;  2R3X A;  1ST9 A;  1TKD B;  3QFB C;  3KJY A;  4D73 A;  1T00 A;  2IN3 A;  4V2L A;  2ON5 A;  2E7P A;  2IJY A;  3EUR A;  4NPB A;  4AJ8 A;  1B48 A;  1VRS D;  1YEP A;  1HNC A;  1TK0 B;  18GS A;  5D9V A;  3TJB A;  2CVD A;  2R6K A;  3LFL A;  3UBL A;  4JR6 A;  1R7H A;  4PUF C;  1EEJ A;  4ICY A;  3H4K A;  3DVX A;  1LJR A;  1K3L A;  4CY8 A;  19GS A;  3MWH A;  1VF2 A;  3DVW A;  4ZL9 A;  5B8A A;  5D8I A;  4HEA 2;  1EP8 A;  1V9W A;  4NV2 A;  1TI3 A;  2EFD A;  2KP1 A;  1YJ6 A;  2K8V A;  4YKF A;  2WZ9 A;  1JZD A;  2HZE A;  2DJ3 A;  1GUK A;  4LLR A;  3FY7 A;  3MAK A;  2H1G A;  4HJM A;  4Z2T A;  5HFG A;  5KN3 A;  2M80 A;  1G0T A;  2H72 A;  2L59 A;  1WWJ A;  2VM2 A;  2ALB A;  2C80 A;  2DBC A;  5GZZ B;  5IQY A;  1SL1 B;  3TKS A;  2GSR A;  1O81 A;  1T3B A;  4HDE A;  3WT2 A;  3ME7 A;  3QAV A;  1XW5 A;  1TK8 B;  3LEF A;  3KZQ A;  5F8B A;  4TOP A;  2GVP A;  2HSH A;  9GSS A;  3N9J A;  3RAZ A;  1PL1 A;  2CX4 A;  3M1G A;  3EU3 A;  2IL3 A;  2WUL A;  4DVC A;  2GGT A;  1TK5 B;  3RHC A;  2B7J A;  1SK1 A;  4O5R A;  3O6T A;  4POK A;  2AV4 A;  1R4W A;  4KDX A;  4ECC A;  4XS4 B;  3M8N A;  2O89 A;  4W66 A;  4WR4 A;  3H93 A;  2IFQ A;  2QKE A;  4ZXG A;  4NXI A;  2TIR A;  2DIZ A;  2TRC P;  2DJJ A;  2X64 A;  5A1N A;  2R0C A;  1V57 A;  2OE1 A;  1XZO A;  2LJK A;  1LU4 A;  4WBJ A;  4I6X A;  3CTF A;  2QA1 A;  1AW9 A;  5A4V A;  1XWK A;  3UAR A;  3Q19 A;  4JRR A;  3VWU A;  4GQF A;  1SJ6 A;  2V32 A;  4AKG A;  4IKH A;  4K7O A;  2YZU A;  5DCH A;  4D73 B;  4TR4 A;  1SU9 A;  4RQX A;  4HQZ A;  2H0I A;  2PWJ A;  6GSX A;  2VM1 A;  4E8E A;  3MSZ A;  2VL2 C;  3QAG A;  1S3C A;  2YWM A;  4MZW A;  3I9V 2;  2IMK A;  3HJM A;  3IC4 A;  2VKZ G;  1QK8 A;  3ZIJ A;  3C1S A;  1FG4 A;  3NIV A;  2LRN A;  2B5Y A;  3IA1 A;  4G0K A;  1VF3 A;  1NM3 A;  3ME8 A;  4POB A;  3ZIV A;  1XOB A;  3KMN A;  4F82 A;  2LJR A;  4POM A;  1SVM A;  4OWY A;  2L5O A;  5ECH B;  3TJK A;  3RPN A;  3UVH A;  2MYG A;  3EE2 A;  3GMF A;  4AJ6 A;  3TRX A;  1SJI A;  4F2I A;  2HZE B;  5DQS A;  3A2V A;  4K1F A;  4J2F A;  5CRW A;  4BWQ A;  2YCD A;  3U5R E;  1THO A;  3IC8 A;  2HSN A;  4POL A;  3C1R A;  4IQA A;  3H79 A;  4WR5 A;  2H1A A;  1OVN A;  3ZVJ D;  5H5Q A;  5IOW A;  2XBQ A;  5AN1 A;  4KAE A;  2RM6 A;  4TVE A;  2CAQ A;  1O85 A;  4K2X A;  4AI6 A;  2QGV A;  3TJF A;  3ERF A;  2DIY A;  4O92 A;  4I5Q A;  2E2M A;  4ID0 A;  1J9B A;  3HCZ A;  1EGR A;  1MDI A;  2LTK A;  3O3T A;  2C0F A;  2GDR A;  3UVT A;  2JSZ A;  5F06 A;  2VCT A;  4YKG A;  4K8M A;  4OFN A;  4HZ2 A;  5HR0 A;  1G6Y A;  2REM A;  4FIW A;  4OO5 A;  2A2S A;  5IMA A;  2EFE A;  4Z2R A;  5CRG A;  4BVY A;  2TRX A;  1DUG A;  1X5D A;  3UL3 A;  1PA3 A;  1SL0 B;  3K8N A;  3LYP A;  2F8F A;  1F6M C;  4HZ4 A;  1FB0 A;  2PPT A;  5J5N A;  4KW6 A;  4BA7 A;  5A1N B;  4J56 E;  4TKY A;  3KGK A;  3KCM A;  4MA9 A;  5GST A;  2H73 A;  4ZB7 A;  3CXG A;  3LYK A;  3EMP A;  2EIO A;  2KLX A;  5KEJ A;  3IAM 2;  1AIU A;  1UVZ A;  3G9B A;  4MZC A;  3ZVJ A;  1K3O A;  2HT9 A;  3IV4 A;  1N8J A;  1EOG A;  3PPU A;  1J0F A;  3EVI A;  1XOA A;  1GUH A;  3UAP A;  4EVM A;  5J40 A;  4FYC A;  2H1B A;  1T8E B;  4IEL A;  3NZN A;  1YZX A;  3GKN A;  5A5H A;  1GSD A;  1WP0 A;  2YJH A;  3D0Z A;  3HVX A;  5E4W A;  12GS A;  2GZZ A;  2YWI A;  4YAV A;  4OFM A;  4IHU A;  2OE3 A;  1SVL A;  5BMU B;  3O76 A;  4ECI A;  4IP6 A;  5JWO B;  5JCU A;  2X8C A;  1RW1 A;  1YKC A;  3KXO A;  5EY6 A;  4P3Y B;  3ZFL A;  1TDI A;  2K9F A;  5D9W A;  3C7M A;  3CMI A;  4EO3 A;  4GDF A;  1ERU A;  3E3E A;  2YP6 A;  2JSY A;  5D73 A;  4ML1 A;  4L8E A;  3HXS A;  3TRP A;  8GSS A;  2IMF A;  2NBS A;  1TI1 A;  3L9V A;  5GAP D;  1U88 A;  3FK8 A;  1S3A A;  4LMV A;  2HYX A;  4HJ2 A;  4I8B A;  2FWE A;  1A2L A;  3RHB A;  20GS A;  2MMN A;  5H5S A;  3GA4 A;  1Z6M A;  3KEB A;  2JAD A;  3CRT A;  4Q5F A;  3TU3 B;  3M3M A;  2I81 A;  5A34 A;  3FHK A;  4O32 A;  2I4A A;  1LBK A;  4FH8 A;  1R5P A;  4Q5R A;  3ZFB A;  4N3Z A;  3KM6 A;  4MF7 A;  1M9B A;  1ZCP A;  4XTS A;  1XFL A;  2UZ8 A;  3FR3 A;  2I3Y A;  4E8H A;  3DWV A;  1PKZ A;  4MNN A;  4IQ1 A;  1X5E A;  1BJX A;  2UV8 G;  1F9M A;  2H8L A;  3GX0 A;  2HRN A;  3S9F A;  4BVY B;  2H75 A;  3HZ8 A;  3L9U A;  1I5G A;  2GTU A;  2M72 A;  2WDU A;  4XIH A;  1PMT A;  1N2A A;  2ZNM A;  4LL4 B;  3LGC A;  2GZY A;  1K0A A;  5KOX A;  1JZW A;  5G2Z A;  2H1D A;  1XW9 A;  3SBC A;  2OT3 A;  5HR2 A;  1B8X A;  4KSO A;  4MK3 A;  3WGE A;  4FYU A;  1FHE A;  2GLR A;  2H66 A;  3I69 A;  2VCW A;  4KUN A;  3EPT A;  3TB2 A;  4TN8 A;  5ECR B;  3TUE A;  5CP1 A;  2L4C A;  3HHV A;  2YZH A;  5ECN B;  5CO3 A;  1PX6 A;  3BCI A;  3C73 A;  1PN0 A;  5B8B A;  3BJ5 A;  1EEM A;  1BYE A;  5A5H B;  2LS5 A;  3HJO A;  1WMJ A;  2DJ2 A;  4G2E A;  5J4V A;  2LEG A;  2VCZ A;  1EV4 A;  1QXH A;  4IN0 A;  1V2A A;  1GTA A;  2HQT A;  4PUR A;  3D6I A;  2C3Q A;  1TRS A;  1Y25 A;  2N5B A;  3VUR A;  5ECK B;  4HU9 A;  3TKQ A;  2G0F A;  4ZL7 A;  1KEB A;  1ZYQ B;  3FZ4 A;  2GT5 A;  2AB6 A;  2MMZ A;  3W8S A;  1BQ7 A;  1RQM A;  3VI7 A;  3DD3 A;  3APO A;  2DJK A;  1NHO A;  1GTB A;  1A23 A;  4MH2 A;  3KP8 A;  2LQO A;  1ML6 A;  2M46 A;  2GSS A;  3GL5 A;  3I6A A;  2OAC A;  1X9M B;  2V6O A;  3TJJ A;  2R2J A;  4WBR D;  2GSQ A;  5IMV A;  1ACV A;  3IR4 A;  2YNX A;  1GL8 A;  3PH9 A;  3MIX A;  1AQV A;  1V98 A;  1IYH A;  2YV7 A;  4JBB A;  2FA4 A;  1O8W A;  5F07 A;  2KHP A;  4QL7 A;  2HFD A;  3TGZ A;  2VO4 A;  2CVK A;  5LD0 A;  5A34 B;  1R26 A;  13GS A;  1QUW A;  2GQM A;  2ZCT A;  3D22 A;  3QAW A;  1M9A A;  3P2A A;  1Y6E A;  3VK9 A;  1Z7R A;  3ZML A;  4AKX B;  5AIS A;  4F0C A;  3A5W A;  2A4V A;  3FYG A;  4TXV A;  1E6B A;  2HSM A;  2EC4 A;  2VCQ A;  4K0N A;  3D4T A;  4EE0 A;  1PKW A;  2B5E A;  3AY8 A;  1K0N A;  4AKH A;  1H4O A;  4G0I A;  5J41 A;  4AKI A;  2H6X A;  3US3 A;  4DSR A;  4TR1 B;  4PQ1 A;  5HQP A;  1GNE A;  4O5U A;  3QPM A;  1C72 A;  1GTI A;  3GH9 A;  3BOA A;  3JCM L;  4CW9 A;  3Q74 A;  1SD8 A;  4GTU A;  1OAZ A;  3GKX A;  2F3M A;  2PU9 C;  1TU7 A;  4K5S A;  4LMW A;  4N10 A;  3HY2 A;  1U3A A;  1OYJ A;  5LNK e;  1B9X C;  11GS A;  2LKU A;  3P90 A;  3DKS A;  4BPY A;  5LCZ A;  2L4Q A;  4JR4 A;  3UBK A;  1BG1 A;  1M2B A;  3CYN A;  2IME A;  5HR1 A;  3GKM A;  1GSE A;  4CDO A;  5HFI A;  3RPP A;  4X1U A;  4XS6 A;  1M2A A;  3EMX A;  4N30 A;  1HNA A;  2ON7 A;  1G7E A;  2CA8 A;  3HYP A;  4LL1 B;  3A5I A;  1ILO A;  1X5C A;  3D21 A;  2JZR A;  2H01 A;  2IPA A;  4OCF A;  2L6C A;  2EIR A;  5G5E A;  4H86 A;  2YAN A;  2LNS A;  4AJ7 A;  1TJD A;  3CSJ A;  3GSS A;  1ZMA A;  2FA8 A;  3EYT A;  2PVQ A;  3J7Y k;  1KTE A;  2EFH A;  1TRV A;  1AXD A;  4ILF A;  1T4Z A;  1TU8 A;  1A2M A;  3CSH A;  3R2Q A;  3F8U A;  5BMU A;  3FR9 A;  1WPI A;  2B7K A;  4HUA A;  2FNO A;  3DYR A;  5A5K A;  1PD2 1;  5IIZ A;  4FO5 A;  2R0P A;  5CYY A;  3KP9 A;  4EF0 A;  3HZ4 A;  2WRT A;  10GS A;  4HI7 A;  2WJU A;  5IPH A;  5KN0 A;  5ABR A;  2YV9 A;  5F0G A;  4ZBA A;  1PL2 A;  2DC5 A;  4IJI A;  4HS1 A;  1GUM A;  1F37 A;  5A4W A;  1XWG A;  2IMD A;  2E0Q A;  1B4P A;  1F3B A;  4V2N A;  2H1L A;  2P5Q A;  5ECL B;  1FAA A;  1SD9 A;  2GT6 A;  3L9S A;  1SK0 A;  3TRQ A;  2JZS A;  4XRD A;  1F2E A;  3NOF A;  4G9H A;  2HSM B;  5KN2 A;  1ERV A;  2L5L A;  3QFA C;  4I2U A;  4GST A;  3L4N A;  1YDK A;  3UOM A;  1OC3 A;  1NW2 A;  2I1U A;  22GS A;  1K3Y A;  4IBP A;  3LXZ A;  3F4T A;  1EWX A;  3GV1 A;  3U6V A;  2FUG 2;  3RDW A;  2HXK A;  3SWL A;  2LRT A;  3G7Y A;  2F8A A;  4MDC A;  1GSQ A;  1X9S B;  3IAS 2;  4X0X A;  1Z6N A;  2LRC A;  4KB3 A;  1Z3E A;  1T4Y A;  3IK9 A;  2FGX A;  4L0W A;  3RBT A;  6GSW A;  1SK2 A;  1QGV A;  1YQ1 A;  2VLT A;  3IRA A;  2RM5 A;  3M9K A;  2MMO A;  4GCI A;  2OAD A;  4PXO A;  4BVX B;  1GNW A;  1SJZ A;  2OBI A;  1JHB A;  1VF1 A;  1MD3 A;  2OA7 A;  3CTG A;  2GZP A;  1A0R P;  4MF6 A;  5KOW A;  1KNG A;  5IOX A;  3UIW A;  4QMK A;  4EC0 A;  5HFK A;  4EDY A;  3HKR A;  1SKR B;  4N0Z A;  2LJA A;  4FYB A;  3UEM A;  2XC2 A;  4DSS A;  3F6D A;  5IO2 A;  1OC9 B;  1K0B A;  4IVF A;  2C4J A;  2H76 A;  5GSS A;  1AUC A;  3KTB A;  2B1K A;  6GSV A;  3LQ7 A;  4GSN A;  1WJK A;  2DSA A;  3GTU A;  1BED A;  4OFT A;  2P31 A;  4X43 A;  2X99 A;  2JU5 A;  2HSY A;  3A2W A;  3WYW A;  4Z7X A;  2OBK A;  2HRK A;  3LG6 A;  1XBS A;  2H74 A;  3ERW A;  2GQK A;  1E2Y A;  2LQQ A;  5ENU A;  3MNG A;  1CQH A;  2RUE A;  1OC8 A;  1TOF A;  1WE0 A;  4RI6 A;  1AAZ A;  3WGX A;  2KOK A;  2H6Z A;  4JU5 A;  5J4U A;  2J9H A;  1O8X A;  1K0O A;  1XWB A;  5JWQ B;  1TW9 A;  4MJC A;  1N25 A;  4NAX A;  3DXB A;  2ES7 A;  1FOV A;  3PIN A;  4KSM A;  2PBJ A;  1A8L A;  1WOU A;  2FY6 A;  3ISO A;  3CRU A;  4J57 E;  2YJ7 A;  1XIY A;  5DDL A;  1XW6 A;  1YY7 A;  2C0D A;  3VI5 A;  1UC7 A;  3D5J A;  3N5O A;  1GWC A;  5IMF A;  1F3A A;  3HDC A;  1FO5 A;  4RUV A;  3F4S A;  3GRX A;  1BG5 A;  2C3T A;  6GSS A;  4PNG A;  4TW5 A;  2V1M A;  6GST A;  1MDJ A;  2AUV A;  4KDU A;  5ID2 A;  2GS3 A;  4RQR A;  2VLV A;  1SL2 B;  3Q6O A;  2H70 A;  3E0U A;  2O7K A;  3IPZ A;  1SEN A;  4YAP A;  5F05 A;  1XVQ A;  3VPT A;  4NHW A;  4OCE A;  5JWR B;  1NSW A;  2PUK C;  4IW9 A;  5DBQ A;  2A2R A;  3EWL A;  2PMT A;  3TKS E;  2YN1 A;  4OO4 A;  2ZUP A;  2C8U A;  5FWG A;  1O73 A;  2OE0 A;  2AHE A;  4ZB6 A;  1YF0 A;  3EIN A;  2QC7 A;  1PX7 A;  2O85 A;  2DML A;  1V58 A;  2R37 A;  3M9J A;  2HNL A;  3WT1 A;  1GLQ A;  3OR5 A;  2PER A;  4TR1 A;  2CT6 A;  2O87 A;  2A4H A;  2G2Q A;  4G19 A;  3GN3 A;  2C0G A;  3QCP A;  1XVW A;  2YWO A;  1DE1 A;  2PGT A;  2PVO C;  5B6N A;  4PTS A;  2X8H A;  3VWW A;  1URM A;  3IXR A;  2B5X A;  1X9W B;  4WXT A;  3IDV A;  1ZYP A;  3P7X A;  1K0C A;  1GSY A;  4XHM A;  2WCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...