4ISDA

Crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
187
Chain Sequence
b'SQKPITLYVGADYVSAFAMSAFVVLKEKGLDFEIRTVDLKSKQQEVSLTRRVPTLQHDRFTLSESSAIAEYLDEVYPAPHYAAVLPADRETRALARQLQAWIRSDFMPLGEAAQLACEKLLSAADRLIDDERYGVFGDWCIADTDFALMLNRLVACGDPVPPKVLRYVERQWARPSVQQWVKQKRDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal structure of GLUTATHIONE TRANSFERASE homolog from BURKHOLDERIA GL BGR1, TARGET EFI-501803, with bound glutathione
rcsb
source organism Burkholderia glumae
molecule tags Transferase
total genus 65
structure length 187
sequence length 211
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14834 GST_C_4 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4isdA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4isdA01
3GKMA 1BX9A 5COHA 2F51A 4FYBA 5EVOA 3FYGA 2LSTA 3UAPA 1Y6EA 3KMNA 4MMMA 2A4VA 5G30A 6GSUA 5D8IA 1WPIA 1TK0B 1NHOA 2VIMA 5DQYA 4D73B 5AGYA 2OACA 4IHUA 5D96A 1EOHA 4MCUA 4N0VA 3IC4A 3VWUA 3EU3A 1DBYA 5ID2A 2B1KA 3KCMA 4QQ7A 5A5KA 2AHEA 1EP7A 1O73A 1NM3A 1FOVA 2H1AA 3TKSE 2OE0A 2DJKA 2IN3A 4LMWA 3W6GA 3FEUA 1E6BA 2YWIA 1DUGA 5JWRB 2HI7A 1QMVA 4G0IA 2RUEA 3H79A 2O7KA 3HVSA 4OCEA 3IA1A 4MF5A 2YANA 4F0CA 3BOAA 5JWOB 1TI3A 4PX1A 3KJYA 1XWAA 5ECIB 14GSA 2EIOA 1ML6A 6GSWA 3QPMA 2YPMA 2KP1A 5B6MA 2H70A 4L8EA 3H93A 16GSA 1SK2A 1GLPA 3FZAA 3LWAA 1GULA 3MDKA 3US3A 1U88A 3UL3A 5KN3A 2DIYA 3EMXA 1FW1A 1E2YA 3A2XA 2GT6A 2PVQA 3D0ZA 4I97A 1Z9HA 1QXHA 2WCIA 3CTGA 4PQ1A 4DVCA 5GAPD 3NIVA 3ERGA 2DJ1A 2H1BA 2WFCA 3ZZXA 1CQHA 5IIZA 1B48A 3IV4A 1GTAA 4K8MA 4OWYA 4G0KA 1ABAA 3E3EA 2FD3A 1TKDB 2DMLA 1LU4A 1R5AA 1LBKA 2H1GA 4NXIA 4K2DA 3TKQA 2N5BA 1J0FA 2C0GA 4IBPA 2VCWA 2XC2A 4LL4B 1DE2A 2H0GA 1SL1B 4EC0A 5GSTA 1GUKA 2P31A 3FR9A 3HJMA 1NW2A 2H01A 3TDGA 3CMIA 5CRGA 2PWJA 2YOIA 4MZCA 4HQSA 3PPUA 2OBKA 5ECSA 3TOUA 2L59A 1YY7A 4BA7A 4O32A 3D6IA 4XRDA 2C0EA 5ABRA 1A2MA 4NPBA 1KNGA 1GNEA 4KDYA 4H86A 1DE1A 2DBCA 2GS3A 1M9BA 1M99A 3HZ4A 5H5RA 4HEA2 5IPGA 5CRHA 5C04A 2XHFA 4MJAA 2TRXA 3GH6A 1AW9A 2NPBA 1U6TA 1G7OA 1BYEA 4NWYA 3UOMA 3ZTLA 3APSA 5ECQB 3WGEA 5D9WA 4KH7A 1ZMAA 1UN2A 2K8VA 4HS1A 5F8BA 1Z5YE 2C3TA 1XBSA 4MDCA 4HOJA 3DGQA 5ID2B 4DSQA 1FG4A 4F03A 1T7PB 3F6FA 4XHMA 1PRXA 3KGKA 3GKNA 3J7Yb 3KP9A 2M46A 2VCTA 5A4VA 5GZZB 1FVKA 2HYXA 2HRKB 4F82A 3F4SA 3GTUB 1RK4A 4V2LA 4KNDA 4JRRA 3D4MA 2P5QA 1VRSD 2AB6A 1YEXA 3L0HA 1O81A 1OAZA 1TK8B 3TJKA 2ZCTA 1PX7A 2QC7A 3A2WA 3RHCA 3QAGA 2LKUA 2O89A 2HE3A 5DJLA 3N5OA 3LXZA 2KUCA 3E0UA 2MBTA 1SD9A 5INYA 4G0LA 2UZ8A 3DRNA 1AQWA 2B7JA 3D22A 3QFBC 1MDKA 3HY2A 2GQMA 3I43A 4N30A 2IIYA 3CRTA 3F63A 3P90A 4KA0A 1PA3A 5G5FA 5ECMB 2H66A 1PSQA 4GLTA 9GSSA 1O6JA 4MJCA 1A0RP 4KW6A 2LEGA 2VO4A 1A2JA 1QK8A 4ECJA 1O85A 1K0AA 4IS0A 3HCZA 3WT2A 1V57A 3KZQA 2JU5A 3IOSA 4MH3A 4ZL8A 3TJGA 4L5OA 5D9XA 2H6XA 2N5AA 3RDWA 3G7IA 4Q5QA 5ECLB 2K9FA 4NHWA 8GSSA 4ACSA 1UVZA 2NBSA 4I6XA 3LGCA 4ZB9A 3H1NA 4KAEA 1EZKA 3MNGA 4IGJA 1X9SB 4ML1A 2FUG2 4PGTA 3SBCA 3F6DA 1XWGA 2LRCA 4JU5A 4FYCA 4LL1B 4CDOA 2WJUA 2FWEA 2I9HA 3C7MA 6GSVA 4KE3A 1F3AA 3OR5A 2FWFA 4ZL7A 3EWLA 4ZB8A 4RQRA 3FRCA 3BCIA 5IOWA 2H6YA 3APOA 2E0QA 1OE8A 1MD4A 2ON7A 2HRFA 1K0DA 1Q4JA 2JZTA 2VLVA 1XW5A 2HNLA 2IMDA 2E2GA 6GSYA 3FW2A 4EDZA 5ECOB 1S3CA 5AISA 1OKTA 1SK1A 2XPDA 4N0ZA 1JZDA 2NTOA 3VLNA 3IAM2 3IXRA 4AJ6A 1Z7PA 3GN3A 4ECBA 4RUVA 1SYXA 3GHAA 2YZHA 3IPZA 4ML6A 5FWGA 2HLSA 1XCCA 1TTZA 2B5YA 1XVWA 2PPTA 10GSA 2IFQA 3TUEA 5F0GA 2GGTA 3EVIA 4MF6A 1V98A 2C4JA 4NHZA 3HYPA 2ON5A 1EV4A 3KD0A 3C1SA 2AUVA 2H19A 4KDUA 4PXOA 1GSDA 1SYRA 4JBBA 3Q6OA 2REMA 5DDLA 4MABA 3TGZA 4HDEA 1WWJA 5IO0A 1YDKA 5AN1A 2DJJA 4HI7A 3DEXA 4PQIA 2P0GA 3O3TA 2FNOA 2WZ9A 3UEMA 2WRTA 2BJXA 3EE2A 3ZVJA 2E2MA 3VWXA 1HYUA 2LJRA 3LSZA 4IQAA 4AJ8A 2H76A 2CA8A 1USBA 1YQ1A 5IMCA 3Q18A 4YAVA 2C3QA 1OVNA 1QGVA 2K18A 4BPYA 1GSEA 3ZIVA 1AQXA 2MMZA 2PERA 3FR6A 4GSNA 4TXVA 1SKRB 4Q5FA 2HZEA 3EINA 5E4WA 2F3MA 5HR3A 3HVXA 2B3SA 1M7TA 5DBQA 3L9VA 3GH9A 3FK8A 5AIXA 2JADA 3GA4A 2QSIA 1B9YC 2HSMA 4XS6A 1TXXA 3KH9A 3M8NA 4EDYA 3HJPA 1SL0B 3R3EA 4HZ4A 4OO5A 1XW6A 1R26A 2K8SA 2LRTA 2BMXA 2DJ0A 1O8XA 1VF4A 1F3BA 1YKCA 4EVMA 4TR0A 1GSSA 4MZWA 3F9UA 3TKPA 1BAYA 4TR1A 1EP8A 4X1UA 4HJ2A 2HRKA 4PURA 5D9TA 3GTUA 4OCFA 1OC9A 3WYWA 2HFDA 3ME7A 3UJ1A 1U3AA 1SKSB 1GSFA 5IQYA 5IM9A 3DVWA 3VFIA 1YF0A 1M2AA 1PL2A 2LNSA 3ZIJA 4I5QA 1G0TA 4KDXA 4GQCA 1X9MB 2CZ2A 1SJZA 3UIWA 2FWHA 4EKZA 2GVPA 1K0BA 4FIWA 1JHBA 1QUWA 1GUHA 4K6XA 2H75A 3W8SA 3M0FA 5B7CA 2L5OA 2M80A 2H0HA 3ZFBA 1PX6A 3ZREA 2C80A 4N10A 2R6KA 2VOCA 4MK3A 2OJLA 2HXKA 3F3RA 3GFKA 7GSSA 4V2NA 2GQLA 3O6TA 1TRVA 4K7OA 5DQSA 2JSYA 2CV4A 2VM1A 4PNFA 1RW1A 4RI7A 1TP9A 3LXTA 2IFQB 4OMVA 4PTSA 4KCEA 2G2QA 4ZB6A 5IMAA 2ALBA 3F4TA 1WE0A 1V2AA 4F0BA 5F06A 3Q74A 4GWRA 1GWCA 1MTCA 3EYTA 1N2AA 4FO5A 2MYGA 3QDNA 1A2LA 3DMLA 2EC4A 2CVKA 4OFNA 2PN8A 3CRUA 3DWVA 5J9CA 1R4WA 1X5DA 2K6VA 2H6ZA 1PQNA 4BVXA 4HU9A 2XPEA 5CREA 3M3MA 2PVOC 5DAKB 3F3QA 3TB2A 3QCPA 2I3YA 2WGRA 5CAXA 4ZIJA 2V6OA 2GSQA 2HRAA 2KLXA 1GTBA 3KTLA 5EL8A 3R2QA 4TKYA 2X99A 2F8AA 2DMMA 1Z7RA 4OFTA 3VI7A 2C0DA 2GLRA 2FA4A 5JCGA 3FKFA 4DSSB 4O7HA 1ILOA 1SENA 4OD7A 2FLSA 2KP2A 2O87A 2X8GA 2HZEB 2B5EA 2PUKC 3PINA 2DSAA 2I4AA 3ZRDA 4MA9A 1GSQA 3UBKA 2H72A 1KEBA 2MMOA 2R3XA 4K0NA 2IL3A 5LCZA 5J3RA 2HSMB 2V41A 4NAXA 2X8CA 1FB0A 3D21A 5KN1A 2RLIA 1O8WA 4ECCA 5G2ZA 1H75A 1GNWA 2GDRA 3UVTA 4PNGA 2B6MA 4WF4A 4XS4B 2XBQA 1WJKA 3QAVA 4RQXA 1F2EA 1KBNA 4YAPA 6GSTA 1WMJA 3QR6A 4HUAA 4PUFC 4TR1B 1G6WA 2J23A 3U6VA 1W4VA 2NVLA 2VL3A 4NV5A 3G7JA 3MAKA 1EEMA 4NMUA 2YV9A 3EU4A 2C3NA 1OC9B 1R5PA 1VF2A 4ULXA 2LUSA 1VF1A 4DSRA 2MBSA 2F8FA 3TOTA 1EWXA 5HQPA 2RM6A 2VD0A 3TKRA 4EUYA 3D5JA 1MDIA 5D9VA 4POLA 4EO3A 4GTUA 2GTUA 2JACA 2YWNA 3DD3A 1YJ6A 2X64A 3TRPA 4XCSA 4XIHA 4KCAA 4PQHA 2O8VB 1XW9A 4WXTA 1HNBA 4RI6A 5JCUA 4BWSA 1SKWB 5B8AA 2YJHA 4Q5RA 2R5GA 2H30A 3A3TA 3HXSA 2O85A 2YV7A 4JE1A 3TRXA 3HA9A 1YF1A 4K9ZA 2HSHA 3Q19A 2J9HA 3LORA 3P2AA 3GIXA 3WD6A 3CXGA 4ZL9A 3IDVA 2LQQA 1AC1A 2FA8A 2F9SA 1YKAA 1U87A 1GL8A 4OFMA 3KMOA 3FZ9A 1IYIA 2LTKA 3IAS2 4KB3A 4JR6A 2HZFA 2LNTA 4GSTA 4BVXB 1ACVA 5L71A 2FCHA 3L78A 4TW5A 2LS5A 2TIRA 1PKWA 1MDJA 1KTEA 3RAZA 3KXOA 4MZBA 1WOUA 4MPFA 2OKAA 2VCXA 3LQ7A 2JZSA 1BG5A 3L4NA 2KHPA 3ISOA 3C1RA 5HR1A 1WIKA 1EGRA 3GV1A 3FY7A 1V40A 1AIUA 1OKDA 4ZILA 5H5SA 2YZUA 3DKSA 2AAWA 4V1Ag 4P3YB 1O7UA 2Z9SA 2TRCP 2VCZA 2YP6A 1M2BA 4XRAA 2VLTA 1Z6NA 1YEPA 1W89A 2PU9C 3ZMLA 4IW9A 1HQOA 3TJBA 1THOA 2FGXA 4YH2A 4I8BA 1PD21 3IBHA 3LYKA 1XWKA 2NDOA 2BTOT 3M9JA 3BJ5A 2L4QA 2IJYA 2GQKA 3TCOA 4YQUA 2CVDA 3IC8A 2I81A 1K0OA 1DSBA 2VD1A 1XPVA 4G2EA 1EEJA 2H71A 3VURA 1BQ7A 1A24A 2CZ3A 4K0GA 3I6AA 1Y25A 3H8QA 3HHVA 3BBYA 12GSA 4IQ1A 3O76A 1SL2B 3DVXA 4IN0A 2H74A 2IMFA 3G9BA 3KH7A 4N11A 2L6CA 5J5NA 4ILFA 1ZYQB 5ENUA 5DALB 3J7Yk 1CQGA 3G7YA 1XWCA 5B8BA 4XTSA 5G1KA 2AYTA 1TOFA 1VF3A 2HRNA 1FAAA 3GRXA 2VL2C 1G6YA 4NV2A 1OC8A 3C8EA 1TU7A 2HSYA 4FQUA 2IMEA 1T4YA 1TJDA 4V1Ap 2D2ZA 3C73A 2YWOA 4KSMA 3N9JA 2IMIA 3VWWA 2GSSA 2EIRA 5CNWA 5DAKA 1T00A 2C0FA 2LQOA 1TW9A 5KEJA 2VUPA 18GSA 5EPFA 3HZ8A 3ERFA 5CP1A 5B6NA 5J41A 3LJRA 4BVYB 1MD3A 2B7KA 2OE1A 4QL9A 4AGSA 3GL3A 2V32A 1C72A 5BMUA 5J4UA 2ZNMA 4L0WA 4DSSA 4IP1A 4O92A 3P8WA 2IMKA 2IWTA 5ELGA 4GF0A 2OBIA 4HQZA 1ZGNA 2CT6A 1AXDA 4O5RA 3DYRA 2H0IA 2CAQA 4LA1A 1XWBA 2JL4A 3FHKA 2VL2A 5ECHB 5D93A 1AAZA 4EF0A 2CQ9A 5HR2A 3TKSC 3BCKA 2V2GA 2LV3A 2FWGA 5F05A 1S3DA 2GZZA 5EY6A 1ERUA 5J9BA 1FHEA 3H4KA 4JEDA 3ED3A 5CRDA 3CSHA 4E8HA 4XS4A 3VK9A 4DEJA 1K0CA 4TXOB 2IPAA 4ZBAA 2KOKA 3U5RE 2OA7A 2CX4A 17GSA 3FR3A 5ELAA 2LJAA 4I2UA 3AY8A 3GUSA 2GSTA 2P5RA 4IKHA 3UMAA 4MJEA 1T1VA 4WEYA 5FHIA 1Z6MA 3QAWA 4TOPA 3IE3A 3A5WA 5G31A 4F2IA 2DJ3A 1XFLA 2XBIA 5GSSA 4LMVA 2H8LA 4GXZA 4LLRA 5GAND 5IOXA 4ID0A 2LRNA 4G19A 2JSZA 1ERWA 2X8HA 1J9BA 1S3AA 1AQVA 2GZPA 2VL9A 1SD8A 4GSSA 4EL1A 3TJFA 4MP4A 1PMTA 4POBA 1XOBA 1A8YA 2EIQA 4CW9A 4WBRD 1MEKA 3TKSA 1X0RA 5G5EA 4ZBBA 2QGVA 3LYPA 5ECPB 6GSXA 2C1YA 4AF2A 1K3LA 2MMNA 3RPPA 4KUNA 3QMXA 1LJRA 3IK7A 4MJBA 5IMDA 5A4WA 5HFKA 1ST9A 2YN1A 2VLUA 20GSA 4IVFA 5LD0A 3GYKA 3VPTA 4WETA 1NHYA 4V2MA 3GX0A 1X5EA 3DIEA 5ECNB 4OO4A 2YWMA 4FH8A 3QFAC 1T3BA 1PGTA 4X43A 2VCVA 1BEDA 3S9FA 3PH9A 5HFIA 6GSSA 1T8EB 3DXBA 1GTIA 3I69A 2WS2A 1K3YA 1ZZYA 4EXJA 4KGIA 4WR5A 1X5CA 3K8NA 3RBTA 5CRWA 4TVEA 3GX8A 2RM5A 5DVBA 2L4CA 3M1GA 5H5QA 3I9V2 3MSZA 3F4RA 2GZYA 4XS1A 2M72A 1ZOFA 4MLYA 4GCIA 3LFLA 2CX3A 1TDIA 1HNAA 4HZ2A 3APQA 3WGDA 1UC7A 1OYJA 3PGTA 1T4ZA 4JZQA 1ERTA 1I9DA 2A2RA 1GUMA 4F9ZA 3ZYWA 3ZFLA 1GRXA 4AJ7A 3WGXA 1SJIA 3KP8A 1UA5A 4KSOA 1H4OA 1GTUA 2R4VA 4WR4A 3FZ5A 1GP1A 4G10A 5JCWA 1N8JA 2B5XA 3RHBA 3ZLPA 2I1UA 2C8UA 2E7PA 3VWVA 4X0XA 1XOAA 1FVJA 5F07A 2YNXA 19GSA 5FT3A 3KEBA 5DCGA 3HD5A 4KX4A 1JLWA 3CBUA 5DALA 4E8EA 4TN8A 3GNJA 1TRWA 3EURA 1ON4A 3WT1A 1GLQA 1ZYEA 1K3OA 1RQMA 3W8JA 4GRFA 3M9KA 4Q5NA 3C71A 5CYYA 2ES7A 4IP6A 1X9WB 3KTBA 1K0MA 2H1DA 4BL7A 13GSA 1YZXA 5IMZA 3KIJA 1PN9A 3ZITA 1SJ6A 4IJIA 2VM2A 1XXUA 1OC3A 2FHEA 4MPGA 3F8UA 2WDUA 3LEFA 4WKWA 5KN2A 1J08A 4USSA 2QKEA 4K1FA 1G7EA 22GSA 3CTFA 5LNKe 3GSSA 4BVYA 4GQFA 3JCML 3EC3A 3GSTA 1ZCPA 1A0FA 3GKKA 3VPQA 4IJ3A 5E59A 2H73A 4L5LA 2L5LA 4YQVA 4I2TA 3UVHA 3HKRA 1JFUA 2PGTA 1XZOA 5ECRB 3MWHA 4PUAA 1TRSA 2YCDA 3CSJA 1WP0A 5DCHA 3KM6A 4CHSA 3PR8A 4Z7XA 1FB6A 2HSNB 1PL1A 4KF9A 2B1LA 4ZXGA 3V1WA 1HNCA 3SWLA 1GH2A 2GSRA 4HJMA 1PKZA 2MMAA 4ISDA 3GL5A 1V58A 3ZMKA 4WF5A 1B4QA 2WULA 3L9SA 3E9JB 2L57A 4YQMA 1M2DA 3HJOA 2PBJA 1F9MA 4TXOA 3CYNA 3IHQA 4D73A 2DJ2A 4WBJA 1EGOA 4K7IA 2N5FA 1B4PA 4EE0A 5G1LA 3CSIA 2YJ7A 3IK9A 2V1MA 2WB9A 5HR0A 11GSA 2CVBA 2DLXA 4J2FA 2RIIA 1V9WA 5C00A 5ECKB 1F6MC 1TU8A 3NOFA 1QQ2A 1A8LA 3FZ4A 3P7XA 1HD2A 1TK5B 1WRYA 1JLVA 2V6KA 4POKA 3IR4A 1K0NA 4ZBDA 2HQTA 2DIZA 3TJJA 1U3IA 3IRAA 4TR4A 1B9XC 5JWQB 3ERWA 4BWQA 2A2SA 3NZNA 4MF7A 2OADA 3A2VA 1SU9A 3GMFA 2G0FA 3HVVA 1URMA 3QD9A 1JZOA 3RPNA 5D73A 1XVQA 5IPHA 4ECIA 1A23A 4J57E 5AIVA 4L0UA 1BJXA 4MH2A 4JR4A 2OE3A 1ZL9A 1Z3EA 4POMA 1GSYA 5HFGA 4BL7B 2AJQB 2L6DA 3QOUA 4FYUA 4HU7A 2FY6A 1B8XA 4TR3A 4G9HA 1JZRA 1OE7A 2PMTA 5CO3A 3VI5A 1TI1A 3F0IA 1SK0A 2DC5A 3ZVJD 1IYHA 5DJMA 5IMVA 1TRUA 2JZRA 3ZL5A 3BD2A 3TRQA 1VGLA 2CAIA 2HT9A 4QL7A 3GURA 2LJKA 3D4TA 2RUFA 4J56E 1I5GA 3EMPA 1R7HA 5A4UA 1ERVA 1M9AA 5IO2A 1JZWA 2ZUPA 5KN0A 3UBLA 1Q98A 2AV4A 4TRXA 2MZCA 4IELA 3ME8A 1NSWA 1QFNA 2R37A 5IMFA 2GT5A 1XIYA 3LG6A 1FO5A 1EV9A 1GSUA 1EOGA 1F37A 1THXA 1M0UA 4K7NA 3UARA 2VCQA 3HDCA 2R2JA 1AUCA 2VAFA 3L9UA 3GKXA
chains in the Genus database with same CATH superfamily
3GKMA 1BX9A 5COHA 5J40A 1FOHA 2F51A 4FYBA 2A2PA 5EVOA 3FYGA 2LSTA 3UAPA 1Y6EA 3KMNA 4MMMA 2A4VA 5G30A 6GSUA 5D8IA 1WPIA 1TK0B 1NHOA 2VIMA 5DQYA 4D73B 5AGYA 2OACA 4IHUA 5D96A 1EOHA 4MCUA 4N0VA 3RFRC 3IC4A 3VWUA 3EU3A 1DBYA 5ID2A 2B1KA 3KCMA 4QQ7A 5A5KA 2AHEA 1EP7A 1O73A 1NM3A 1FOVA 2H1AA 3TKSE 2OE0A 1ZYNA 2DJKA 4LMWA 2IN3A 3W6GA 3FEUA 1E6BA 2YWIA 1DUGA 5JWRB 2HI7A 1QMVA 4G0IA 2RUEA 3H79A 2O7KA 3HVSA 4OCEA 3IA1A 4MF5A 2YANA 4F0CA 3BOAA 5JWOB 1TI3A 4PX1A 3KJYA 1XWAA 5ECIB 14GSA 4YKFA 2EIOA 1ML6A 6GSWA 3QPMA 2YPMA 2KP1A 5B6MA 2H70A 4L8EA 1SVOA 4AKIA 3H93A 16GSA 1SK2A 1GLPA 3FZAA 3LWAA 1GULA 3MDKA 3US3A 2A4HA 1U88A 3UL3A 5KN3A 2DIYA 3EMXA 1FW1A 1E2YA 3A2XA 2GT6A 2PVQA 3D0ZA 4I97A 1Z9HA 1QXHA 2WCIA 3CTGA 4PQ1A 4DVCA 5GAPD 3NIVA 3ERGA 2DJ1A 2H1BA 2WFCA 3ZZXA 1CQHA 5IIZA 2EFHA 1B48A 3IV4A 1GTAA 2HSNA 4K8MA 4OWYA 4G0KA 1ABAA 3E3EA 2FD3A 1TKDB 2DMLA 1LU4A 1R5AA 1LBKA 2H1GA 4NXIA 4K2DA 3TKQA 2N5BA 1J0FA 2C0GA 4IBPA 2VCWA 2XC2A 4LL4B 1DE2A 2H0GA 1SL1B 4EC0A 5GSTA 1GUKA 2P31A 3FR9A 3HJMA 1NW2A 2H01A 3TDGA 3CMIA 5CRGA 2PWJA 2YOIA 4MZCA 4HQSA 3PPUA 2OBKA 5ECSA 3TOUA 2L59A 1YY7A 4BA7A 4O32A 3D6IA 4XRDA 2C0EA 5ABRA 1A2MA 4NPBA 1KNGA 1GNEA 4KDYA 4H86A 1DE1A 2DBCA 2GS3A 1M9BA 1M99A 3HZ4A 5H5RA 4HEA2 5IPGA 5CRHA 5C04A 2XHFA 4MJAA 2TRXA 3GH6A 1AW9A 2NPBA 1U6TA 1G7OA 1BYEA 3A5IA 4NWYA 3UOMA 3ZTLA 3APSA 5ECQB 3WGEA 5D9WA 4KH7A 1ZMAA 1UN2A 2K8VA 4HS1A 5F8BA 1Z5YE 2C3TA 1XBSA 4MDCA 4HOJA 3DGQA 5ID2B 4DSQA 1FG4A 4F03A 1T7PB 3F6FA 4XHMA 1PRXA 3KGKA 3GKNA 3J7Yb 3KP9A 2M46A 2VCTA 5A4VA 5GZZB 1FVKA 2HYXA 2HRKB 4F82A 3F4SA 3GTUB 1RK4A 4V2LA 4KNDA 4JRRA 3D4MA 2P5QA 1VRSD 2AB6A 1YEXA 1YEWC 3L0HA 1O81A 1OAZA 1TK8B 4FXYP 3TJKA 2ZCTA 1PX7A 2QC7A 3A2WA 3RHCA 4EIPA 3QAGA 2LKUA 2O89A 2HE3A 5DJLA 3N5OA 3LXZA 2KUCA 3E0UA 2MBTA 1SD9A 5INYA 4G0LA 2UZ8A 3DRNA 1AQWA 2B7JA 1Y1UA 3D22A 3QFBC 1MDKA 3HY2A 2GQMA 3I43A 4N30A 2IIYA 3CRTA 3F63A 3P90A 4KA0A 3CWGA 1PA3A 5G5FA 5ECMB 2VKZG 2H66A 1PSQA 4GLTA 9GSSA 1O6JA 4MJCA 1A0RP 4KW6A 2LEGA 2VO4A 1A2JA 1QK8A 4ECJA 1O85A 1K0AA 4IS0A 3HCZA 3WT2A 1V57A 3KZQA 2JU5A 3IOSA 4MH3A 4ZL8A 3TJGA 4L5OA 5D9XA 2H6XA 5J4VA 2N5AA 3RDWA 3G7IA 4Q5QA 5ECLB 2K9FA 4NHWA 8GSSA 4ACSA 1UVZA 2NBSA 4Z2UA 4I6XA 3LGCA 4ZB9A 3H1NA 4KAEA 1S4BP 1EZKA 3MNGA 1S3RA 4YKGA 4IGJA 1X9SB 2R0PA 4ML1A 2FUG2 4PGTA 3SBCA 3F6DA 1XWGA 2LRCA 4JU5A 4FYCA 4LL1B 4CDOA 2WJUA 2FWEA 2I9HA 3C7MA 6GSVA 4KE3A 1F3AA 3OR5A 2FWFA 4ZL7A 3EWLA 4ZB8A 4RQRA 3FRCA 3BCIA 5IOWA 2H6YA 3APOA 2E0QA 1OE8A 1MD4A 2ON7A 2O5VA 2HRFA 1K0DA 1Q4JA 2JZTA 2VLVA 1XW5A 2HNLA 2IMDA 2E2GA 6GSYA 3FW2A 4EDZA 5ECOB 1S3CA 5AISA 1OKTA 1SK1A 2XPDA 4N0ZA 1JZDA 2NTOA 3VLNA 3IAM2 3IXRA 4AJ6A 1Z7PA 3GN3A 4ECBA 4RUVA 1SYXA 3GHAA 2YZHA 3IPZA 4ML6A 5FWGA 2HLSA 1XCCA 1TTZA 2B5YA 1XVWA 2PPTA 10GSA 2IFQA 3TUEA 5F0GA 2GGTA 3EVIA 4PI0C 4MF6A 1I1IP 1V98A 2C4JA 4NHZA 3HYPA 2ON5A 1EV4A 3KD0A 3C1SA 2AUVA 2H19A 4KDUA 4PXOA 1GSDA 1SYRA 4JBBA 3Q6OA 2REMA 5DDLA 4MABA 3TGZA 4HDEA 1WWJA 5IO0A 1YDKA 5AN1A 2DJJA 4HI7A 1PFOA 3DEXA 1SVMA 4PQIA 2P0GA 3IHGA 3O3TA 2FNOA 2WZ9A 3UEMA 2WRTA 2BJXA 3EE2A 3ZVJA 2O36A 2E2MA 3VWXA 1HYUA 2LJRA 5J4YA 3LSZA 4IQAA 4AJ8A 2H76A 2CA8A 4K2XA 1USBA 1YQ1A 5IMCA 3Q18A 4YAVA 2C3QA 1OVNA 1QGVA 2K18A 3MYDA 4BPYA 1GSEA 3ZIVA 1AQXA 2MMZA 2PERA 3FR6A 4GSNA 4TXVA 1SKRB 4Q5FA 4AKXB 2HZEA 3EINA 5E4WA 5J47A 2F3MA 5HR3A 3HVXA 2B3SA 1M7TA 5DBQA 3L9VA 3GH9A 3FK8A 5AIXA 2JADA 3GA4A 2QSIA 1B9YC 2HSMA 4XS6A 1TXXA 3KH9A 3M8NA 4EDYA 3HJPA 1SL0B 3R3EA 4HZ4A 4OO5A 1XW6A 1R26A 2K8SA 2LRTA 2BMXA 2DJ0A 1O8XA 1VF4A 1F3BA 1YKCA 4EVMA 1TXUA 4TR0A 1GSSA 4MZWA 3F9UA 3TKPA 1BAYA 4TR1A 1EP8A 4X1UA 4HJ2A 2HRKA 1N25A 4PURA 5D9TA 3GTUA 4OCFA 1OC9A 3WYWA 2HFDA 3ME7A 3UJ1A 1U3AA 1SKSB 1GSFA 5IQYA 5IM9A 4Z2TA 3DVWA 3VFIA 1YF0A 4BIKA 1M2AA 1PL2A 2LNSA 3ZIJA 4I5QA 1G0TA 4KDXA 4GQCA 1X9MB 2CZ2A 1SJZA 3UIWA 2FWHA 4EKZA 2GVPA 1K0BA 4FIWA 1JHBA 1QUWA 1GUHA 4K6XA 2H75A 3W8SA 3M0FA 5B7CA 2L5OA 2M80A 2H0HA 3ZFBA 1PX6A 3ZREA 3CQFA 2C80A 4N10A 2R6KA 4O5QA 2VOCA 4MK3A 2OJLA 2HXKA 3F3RA 3GFKA 7GSSA 4V2NA 5KOWA 2GQLA 3O6TA 2WW1A 1TRVA 4K7OA 5DQSA 2JSYA 2CV4A 3CHXC 2VM1A 4PNFA 1RW1A 4RI7A 1TP9A 3LXTA 2IFQB 4OMVA 4PTSA 4KCEA 2G2QA 4ZB6A 5IMAA 2ALBA 3F4TA 1WE0A 1V2AA 4F0BA 5F06A 3Q74A 4GWRA 1GWCA 1MTCA 3EYTA 1N2AA 4FO5A 2MYGA 3QDNA 1A2LA 3DMLA 2DKHA 2EC4A 2CVKA 4OFNA 2PN8A 3CRUA 3DWVA 5J9CA 1R4WA 1X5DA 2K6VA 2H6ZA 1PQNA 4BVXA 4HU9A 2XPEA 5CREA 3M3MA 2PVOC 5DAKB 3F3QA 3TB2A 3QCPA 2I3YA 1YVLA 2WGRA 5CAXA 4ZIJA 2V6OA 2EFEA 2GSQA 2HRAA 2KLXA 1GTBA 3KTLA 2WW3A 5EL8A 3R2QA 5BRTA 4TKYA 2X99A 2F8AA 2DMMA 1Z7RA 4OFTA 3VI7A 2C0DA 2GLRA 2FA4A 5BMUB 5JCGA 3FKFA 4DSSB 4O7HA 1ILOA 1SENA 4PI2C 4OD7A 2FLSA 2KP2A 2O87A 2X8GA 2HZEB 2B5EA 2PUKC 3PINA 2DSAA 2I4AA 3ZRDA 4MA9A 1GSQA 3UBKA 2H72A 1KEBA 2MMOA 2R3XA 4K0NA 2IL3A 5LCZA 5J3RA 2HSMB 2V41A 4NAXA 2X8CA 2EFCA 1FB0A 3D21A 5KN1A 2RLIA 5A5HB 1O8WA 4ECCA 5G2ZA 1H75A 1GNWA 2GDRA 1BG1A 3UVTA 4PNGA 2B6MA 4WF4A 4XS4B 2XBQA 1WJKA 3QAVA 4RQXA 1F2EA 1KBNA 4YAPA 6GSTA 1WMJA 3QR6A 4HUAA 4PUFC 4TR1B 1G6WA 2X49A 2J23A 3U6VA 1W4VA 2NVLA 2VL3A 4NV5A 3G7JA 3MAKA 1EEMA 4NMUA 2YV9A 3EU4A 1PN0A 2C3NA 1OC9B 2WW0A 1R5PA 1VF2A 4ULXA 2LUSA 1VF1A 4DSRA 3HMJG 3L9UA 2MBSA 2F8FA 3TOTA 1EWXA 5HQPA 2RM6A 2VD0A 3TKRA 4EUYA 3D5JA 1MDIA 5D9VA 4POLA 4EO3A 4GTUA 2GTUA 2JACA 2YWNA 3DD3A 1YJ6A 2X64A 3TRPA 4XCSA 4XIHA 4KCAA 4PQHA 2O8VB 1XW9A 4WXTA 1HNBA 4RI6A 5JCUA 4BWSA 1SKWB 3FMWA 5B8AA 2YJHA 4Q5RA 2R5GA 2H30A 3A3TA 3HXSA 2O85A 2YV7A 4JE1A 3TRXA 3HA9A 1YF1A 4K9ZA 2HSHA 3Q19A 2J9HA 3TU3B 3LORA 3P2AA 3GIXA 3WD6A 3CXGA 4ZL9A 3IDVA 2LQQA 1SVLA 1AC1A 2FA8A 2F9SA 1YKAA 1U87A 1GL8A 4OFMA 3KMOA 3FZ9A 1IYIA 2LTKA 3IAS2 4KB3A 4JR6A 2HZFA 2LNTA 4GSTA 4BVXB 1ACVA 5L71A 2FCHA 3L78A 4TW5A 2LS5A 2TIRA 1PKWA 1MDJA 1KTEA 5A1NB 4GDFA 3RAZA 3KXOA 4MZBA 1WOUA 4MPFA 2QA1A 2OKAA 2VCXA 3LQ7A 2JZSA 1BG5A 3L4NA 2KHPA 3C1RA 3ISOA 5HR1A 1WIKA 1EGRA 3GV1A 3FY7A 1V40A 1AIUA 1OKDA 4ZILA 5H5SA 2YZUA 3DKSA 2AAWA 4V1Ag 4P3YB 1O7UA 2Z9SA 2TRCP 2VCZA 2YP6A 1M2BA 4XRAA 2VLTA 1Z6NA 1YEPA 1W89A 2PU9C 3ZMLA 4IW9A 1HQOA 3TJBA 1THOA 2FGXA 4YH2A 4I8BA 1PD21 3IBHA 3LYKA 1XWKA 2NDOA 2BTOT 3M9JA 3BJ5A 2L4QA 2IJYA 4PHZC 2GQKA 3TCOA 4YQUA 2CVDA 3IC8A 2I81A 1K0OA 1DSBA 3MIXA 2VD1A 1XPVA 2R0GA 4G2EA 1EEJA 2H71A 3VURA 1BQ7A 1A24A 2CZ3A 4K0GA 3I6AA 1Y25A 3H8QA 4G01A 3HHVA 3BBYA 12GSA 4IQ1A 3O76A 5A34B 1SL2B 3DVXA 4IN0A 2H74A 2IMFA 3G9BA 3KH7A 4N11A 2L6CA 5J5NA 4ILFA 1ZYQB 5ENUA 5DALB 3J7Yk 1CQGA 3G7YA 1XWCA 5B8BA 4XTSA 5G1KA 2AYTA 1TOFA 1VF3A 2HRNA 1FAAA 3GRXA 2VL2C 1G6YA 4NV2A 1OC8A 4AKGA 3C8EA 1TU7A 2HSYA 4FQUA 2IMEA 1T4YA 1TJDA 4V1Ap 2D2ZA 3C73A 2YWOA 4KSMA 3N9JA 2IMIA 3VWWA 2GSSA 2EIRA 5CNWA 5DAKA 1T00A 2C0FA 2LQOA 4O5UA 1TW9A 5KEJA 2VUPA 18GSA 5EPFA 3HZ8A 3ERFA 5CP1A 5B6NA 5J41A 3LJRA 2WZSA 4BVYB 1MD3A 2B7KA 2OE1A 4QL9A 4AGSA 3GL3A 1C72A 5BMUA 5J4UA 2ZNMA 4L0WA 4DSSA 4IP1A 4O92A 3P8WA 2IMKA 2IWTA 1BF5A 5ELGA 4GF0A 2OBIA 4HQZA 1ZGNA 2CT6A 1AXDA 4O5RA 3DYRA 2OT3A 2H0IA 2CAQA 4LA1A 1XWBA 2JL4A 3FHKA 2VL2A 5ECHB 5D93A 1AAZA 4EF0A 2CQ9A 5HR2A 3TKSC 3BCKA 2V2GA 2LV3A 2FWGA 5F05A 1S3DA 2GZZA 5EY6A 1ERUA 5J9BA 5A5HA 1FHEA 3H4KA 4JEDA 3ED3A 5CRDA 3CSHA 4E8HA 4XS4A 3VK9A 4DEJA 1K0CA 4TXOB 2IPAA 4ZBAA 2KOKA 3U5RE 2OA7A 2CX4A 17GSA 3FR3A 5ELAA 2LJAA 4I2UA 4AKHA 3AY8A 3GUSA 2GSTA 2P5RA 4IKHA 3UMAA 4MJEA 1T1VA 4WEYA 5FHIA 1Z6MA 3QAWA 4TOPA 3IE3A 3A5WA 5G31A 4F2IA 2DJ3A 2WVZA 1XFLA 2XBIA 5GSSA 4LMVA 2H8LA 4GXZA 4LLRA 5GAND 5IOXA 4ID0A 4ZB7A 2LRNA 4G19A 2JSZA 1ERWA 2X8HA 1J9BA 1S3AA 1AQVA 2GZPA 2VL9A 1SD8A 4GSSA 4EL1A 3TJFA 4MP4A 1PMTA 4POBA 1XOBA 1A8YA 2H1LA 2EIQA 4CW9A 4WBRD 1MEKA 3TKSA 1X0RA 5G5EA 4ZBBA 2QGVA 3LYPA 5ECPB 6GSXA 2C1YA 4AF2A 1K3LA 2MMNA 3RPPA 4KUNA 3QMXA 4X4JA 1LJRA 3IK7A 4MJBA 5IMDA 5A4WA 5HFKA 1ST9A 2YN1A 2VLUA 20GSA 4IVFA 5LD0A 3GYKA 3VPTA 1M3IA 4WETA 1NHYA 4V2MA 3GX0A 1X5EA 3DIEA 5ECNB 4OO4A 1XG8A 2YWMA 4FH8A 5A1NA 3QFAC 1T3BA 3HVNA 1PGTA 4X43A 2VCVA 1BEDA 3S9FA 3PH9A 5HFIA 6GSSA 1T8EB 3DXBA 1GTIA 3I69A 2WS2A 1K3YA 1ZZYA 4EXJA 2WVXA 4KGIA 4WR5A 1X5CA 3K8NA 3RBTA 5CRWA 4TVEA 3GX8A 2RM5A 5DVBA 2L4CA 3M1GA 5H5QA 3I9V2 3MSZA 3F4RA 2GZYA 4XS1A 2M72A 2R0CA 1ZOFA 4MLYA 4GCIA 3LFLA 2CX3A 2X4AA 1TDIA 1HNAA 4HZ2A 3APQA 3WGDA 1UC7A 1OYJA 3PGTA 1T4ZA 4JZQA 1ERTA 1I9DA 2A2RA 1GUMA 4F9ZA 3ZYWA 3ZFLA 1GRXA 4AJ7A 3WGXA 1SJIA 3KP8A 1UA5A 4KSOA 1H4OA 1GTUA 2R4VA 4WR4A 3FZ5A 4Z2RA 1GP1A 4G10A 5JCWA 3EPTA 1N8JA 5A34A 2B5XA 3RHBA 3ZLPA 4CY6A 2I1UA 2C8UA 2E7PA 3VWVA 4X0XA 1XOAA 1FVJA 5F07A 2YNXA 19GSA 5FT3A 3KEBA 5DCGA 3HD5A 4KX4A 1JLWA 3CBUA 5DALA 4E8EA 4TN8A 4CY8A 3GNJA 1TRWA 3EURA 1ON4A 3WT1A 1GLQA 1ZYEA 4MNNA 1K3OA 1RQMA 2DKIA 3W8JA 4GRFA 3M9KA 4Q5NA 3C71A 5CYYA 2ES7A 2QA2A 4W66A 4IP6A 1X9WB 3KTBA 1K0MA 2H1DA 4BL7A 4ICYA 13GSA 1YZXA 5IMZA 3KIJA 1PN9A 3ZITA 1SJ6A 4IJIA 2VM2A 1XXUA 1OC3A 4HSCX 2FHEA 4A5PA 4MPGA 3F8UA 2WDUA 3LEFA 4WKWA 5KN2A 1J08A 4USSA 4E68A 2QKEA 4K1FA 1G7EA 22GSA 3CTFA 5LNKe 3GSSA 4BVYA 4GQFA 3JCML 3EC3A 3GSTA 1ZCPA 1A0FA 3GKKA 4K5SA 3VPQA 4IJ3A 5E59A 4EIQA 2H73A 4L5LA 2L5LA 4YQVA 4I2TA 3UVHA 3HKRA 1JFUA 2PGTA 1XZOA 5ECRB 3MWHA 4PUAA 1TRSA 2YCDA 3CSJA 1WP0A 1M3JA 5DCHA 3KM6A 4CHSA 3PR8A 4Z7XA 1FB6A 2HSNB 1PL1A 4KF9A 2B1LA 4ZXGA 3V1WA 4AI6A 1HNCA 3SWLA 1GH2A 2GSRA 4HJMA 4K5RA 1PKZA 2MMAA 4ISDA 3GL5A 1V58A 3ZMKA 4WF5A 1B4QA 2WULA 3L9SA 3E9JB 2L57A 4YQMA 1M2DA 3HJOA 2WVXB 2PBJA 1F9MA 4TXOA 3CYNA 3IHQA 4D73A 2DJ2A 4WBJA 1EGOA 4K7IA 2N5FA 1B4PA 4EE0A 5G1LA 3CSIA 2YJ7A 3IK9A 2V1MA 2WB9A 5HR0A 11GSA 2CVBA 2DLXA 4J2FA 2RIIA 1V9WA 5C00A 5ECKB 1F6MC 1TU8A 3NOFA 1QQ2A 1A8LA 3FZ4A 3P7XA 1HD2A 1TK5B 1WRYA 1JLVA 3LW9A 2V6KA 4POKA 3IR4A 1K0NA 4ZBDA 2HQTA 2DIZA 3TJJA 1U3IA 3IRAA 4TR4A 1B9XC 5JWQB 2UV8G 3ERWA 4BWQA 2A2SA 3NZNA 4MF7A 2OADA 3A2VA 1SU9A 3GMFA 2G0FA 3HVVA 1URMA 4QMKA 3QD9A 5KOXA 1JZOA 3RPNA 5D73A 1XVQA 5IPHA 4ECIA 1A23A 4J57E 5AIVA 4L0UA 1BJXA 4MH2A 4N3ZA 4JR4A 2OE3A 1ZL9A 1ZYPA 1Z3EA 4POMA 1GSYA 5HFGA 4BL7B 2AJQB 2L6DA 3QOUA 4FYUA 4HU7A 2FY6A 2WVYA 1B8XA 4TR3A 4G9HA 1JZRA 1OE7A 2PMTA 5CO3A 3VI5A 1TI1A 3F0IA 1SK0A 2DC5A 3ZVJD 1IYHA 5DJMA 5IMVA 1TRUA 2JZRA 3ZL5A 3BD2A 3TRQA 1VGLA 2CAIA 2HT9A 4QL7A 3GURA 2LJKA 3RGBC 2O3EA 3D4TA 2RUFA 4J56E 1I5GA 3EMPA 1R7HA 5A4UA 1ERVA 1M9AA 5IO2A 1JZWA 2ZUPA 5KN0A 3UBLA 1Q98A 2AV4A 4TRXA 2MZCA 4IELA 3ME8A 1NSWA 1QFNA 2R37A 2WW2A 5IMFA 2GT5A 1XIYA 3LG6A 1FO5A 1EV9A 1GSUA 1EOGA 1F37A 1THXA 1M0UA 4K7NA 3UARA 2VCQA 3HDCA 2R2JA 1AUCA 2EFDA 2VAFA 2V32A 3GKXA
chains in the Genus database with same CATH topology
3GKMA 1BX9A 5COHA 5J40A 1FOHA 2F51A 4FYBA 2A2PA 5EVOA 3FYGA 2LSTA 3UAPA 1Y6EA 3KMNA 4MMMA 2A4VA 5G30A 6GSUA 5D8IA 1WPIA 1TK0B 1NHOA 2VIMA 5DQYA 4D73B 5AGYA 2OACA 4IHUA 5D96A 1EOHA 4MCUA 4N0VA 3IC4A 3VWUA 3EU3A 1DBYA 5ID2A 2B1KA 3KCMA 4QQ7A 5A5KA 2AHEA 1EP7A 1O73A 1NM3A 1FOVA 2H1AA 3TKSE 2OE0A 1ZYNA 2DJKA 4LMWA 2IN3A 3W6GA 3FEUA 1E6BA 2YWIA 1DUGA 5JWRB 2HI7A 1QMVA 4G0IA 2RUEA 3H79A 2O7KA 3HVSA 4OCEA 3IA1A 4MF5A 2YANA 4F0CA 3BOAA 5JWOB 1TI3A 4PX1A 3KJYA 1XWAA 5ECIB 14GSA 4YKFA 2EIOA 1ML6A 6GSWA 3QPMA 2YPMA 2KP1A 5B6MA 2H70A 4L8EA 1SVOA 4AKIA 3H93A 16GSA 1SK2A 1GLPA 3FZAA 3LWAA 1GULA 3MDKA 3US3A 2A4HA 1U88A 3UL3A 5KN3A 2DIYA 3EMXA 1FW1A 1E2YA 3A2XA 2GT6A 2PVQA 3D0ZA 4I97A 1Z9HA 1QXHA 2WCIA 3CTGA 4PQ1A 4DVCA 5GAPD 3NIVA 3ERGA 2DJ1A 2H1BA 2WFCA 3ZZXA 1CQHA 5IIZA 2EFHA 1B48A 3IV4A 1GTAA 2HSNA 4K8MA 4OWYA 4G0KA 1ABAA 3E3EA 2FD3A 1TKDB 2DMLA 1LU4A 1R5AA 1LBKA 2H1GA 4NXIA 4K2DA 3TKQA 2N5BA 1J0FA 2C0GA 4IBPA 2VCWA 2XC2A 4LL4B 1DE2A 2H0GA 1SL1B 4EC0A 5GSTA 1GUKA 2P31A 3FR9A 3HJMA 1NW2A 2H01A 3TDGA 3CMIA 5CRGA 2PWJA 2YOIA 4MZCA 4HQSA 3PPUA 2OBKA 5ECSA 3TOUA 2L59A 1YY7A 4BA7A 4O32A 3D6IA 4XRDA 2C0EA 5ABRA 1A2MA 4NPBA 1KNGA 1GNEA 4KDYA 4H86A 1DE1A 2DBCA 2GS3A 1M9BA 1M99A 3HZ4A 5H5RA 4HEA2 5IPGA 5CRHA 5C04A 2XHFA 4MJAA 2TRXA 3GH6A 1AW9A 2NPBA 1U6TA 1G7OA 1BYEA 3A5IA 4NWYA 3UOMA 3ZTLA 3APSA 5ECQB 3WGEA 5D9WA 4KH7A 1ZMAA 1UN2A 2K8VA 4HS1A 5F8BA 1Z5YE 2C3TA 1XBSA 4MDCA 4HOJA 3DGQA 5ID2B 4DSQA 1FG4A 4F03A 1T7PB 3F6FA 4XHMA 1PRXA 3KGKA 3GKNA 3J7Yb 3KP9A 2M46A 2VCTA 5A4VA 5GZZB 1FVKA 2HYXA 2HRKB 4F82A 3F4SA 3GTUB 1RK4A 4V2LA 4KNDA 4JRRA 3D4MA 2P5QA 1VRSD 2AB6A 1YEXA 3L0HA 1O81A 1OAZA 1TK8B 3TJKA 2ZCTA 1PX7A 2QC7A 3A2WA 3RHCA 4EIPA 3QAGA 2LKUA 2O89A 2HE3A 5DJLA 3N5OA 3LXZA 2KUCA 3E0UA 2MBTA 1SD9A 5INYA 4G0LA 2UZ8A 3DRNA 1AQWA 2B7JA 1Y1UA 3D22A 3QFBC 1MDKA 3HY2A 2GQMA 3I43A 4N30A 2IIYA 3CRTA 3F63A 3P90A 4KA0A 3CWGA 1PA3A 5G5FA 5ECMB 2VKZG 2H66A 1PSQA 4GLTA 9GSSA 1O6JA 4MJCA 1A0RP 4KW6A 2LEGA 2VO4A 1A2JA 1QK8A 4ECJA 1O85A 1K0AA 4IS0A 3HCZA 3WT2A 1V57A 3KZQA 2JU5A 3IOSA 4MH3A 4ZL8A 3TJGA 4L5OA 5D9XA 2H6XA 5J4VA 2N5AA 3RDWA 3G7IA 4Q5QA 5ECLB 2K9FA 4NHWA 8GSSA 4ACSA 1UVZA 2NBSA 4Z2UA 4I6XA 3LGCA 4ZB9A 3H1NA 4KAEA 1EZKA 3MNGA 4YKGA 4IGJA 1X9SB 2R0PA 4ML1A 2FUG2 4PGTA 3SBCA 3F6DA 1XWGA 2LRCA 4JU5A 4FYCA 4LL1B 4CDOA 2WJUA 2FWEA 2I9HA 3C7MA 6GSVA 4KE3A 1F3AA 3OR5A 2FWFA 4ZL7A 3EWLA 4ZB8A 4RQRA 3FRCA 3BCIA 5IOWA 2H6YA 3APOA 2E0QA 1OE8A 1MD4A 2ON7A 2O5VA 2HRFA 1K0DA 1Q4JA 2JZTA 2VLVA 1XW5A 2HNLA 2IMDA 2E2GA 6GSYA 3FW2A 4EDZA 5ECOB 1S3CA 5AISA 1OKTA 1SK1A 2XPDA 4N0ZA 1JZDA 2NTOA 3VLNA 3IAM2 3IXRA 4AJ6A 1Z7PA 3GN3A 4ECBA 4RUVA 1SYXA 3GHAA 2YZHA 3IPZA 4ML6A 5FWGA 2HLSA 1XCCA 1TTZA 2B5YA 1XVWA 2PPTA 10GSA 2IFQA 3TUEA 5F0GA 2GGTA 3EVIA 4MF6A 1V98A 2C4JA 4NHZA 3HYPA 2ON5A 1EV4A 3KD0A 3C1SA 2AUVA 2H19A 4KDUA 4PXOA 1GSDA 1SYRA 4JBBA 3Q6OA 2REMA 5DDLA 4MABA 3TGZA 4HDEA 1WWJA 5IO0A 1YDKA 5AN1A 2DJJA 4HI7A 3DEXA 1SVMA 4PQIA 2P0GA 3IHGA 3O3TA 2FNOA 2WZ9A 3UEMA 2WRTA 2BJXA 3EE2A 3ZVJA 2E2MA 3VWXA 1HYUA 2LJRA 5J4YA 3LSZA 4IQAA 4AJ8A 2H76A 2CA8A 4K2XA 1USBA 1YQ1A 5IMCA 3Q18A 4YAVA 2C3QA 1OVNA 1QGVA 2K18A 3MYDA 4BPYA 1GSEA 3ZIVA 1AQXA 2MMZA 2PERA 3FR6A 4GSNA 4TXVA 1SKRB 4Q5FA 4AKXB 2HZEA 3EINA 5E4WA 5J47A 2F3MA 5HR3A 3HVXA 2B3SA 1M7TA 5DBQA 3L9VA 3GH9A 3FK8A 5AIXA 2JADA 3GA4A 2QSIA 1B9YC 2HSMA 4XS6A 1TXXA 3KH9A 3M8NA 4EDYA 3HJPA 1SL0B 3R3EA 4HZ4A 4OO5A 1XW6A 1R26A 2K8SA 2LRTA 2BMXA 2DJ0A 1O8XA 1VF4A 1F3BA 1YKCA 4EVMA 1TXUA 4TR0A 1GSSA 4MZWA 3F9UA 3TKPA 1BAYA 4TR1A 1EP8A 4X1UA 4HJ2A 2HRKA 1N25A 4PURA 5D9TA 3GTUA 4OCFA 1OC9A 3WYWA 2HFDA 3ME7A 3UJ1A 1U3AA 1SKSB 1GSFA 5IQYA 5IM9A 4Z2TA 3DVWA 3VFIA 1YF0A 1M2AA 1PL2A 2LNSA 3ZIJA 4I5QA 1G0TA 4KDXA 4GQCA 1X9MB 2CZ2A 1SJZA 3UIWA 2FWHA 4EKZA 2GVPA 1K0BA 4FIWA 1JHBA 1QUWA 1GUHA 4K6XA 2H75A 3W8SA 3M0FA 5B7CA 2L5OA 2M80A 2H0HA 3ZFBA 1PX6A 3ZREA 2C80A 4N10A 2R6KA 4O5QA 2VOCA 4MK3A 2OJLA 2HXKA 3F3RA 3GFKA 7GSSA 4V2NA 5KOWA 2GQLA 3O6TA 1TRVA 4K7OA 5DQSA 2JSYA 2CV4A 2VM1A 4PNFA 1RW1A 4RI7A 1TP9A 3LXTA 2IFQB 4OMVA 4PTSA 4KCEA 2G2QA 4ZB6A 5IMAA 2ALBA 3F4TA 1WE0A 1V2AA 4F0BA 5F06A 3Q74A 4GWRA 1GWCA 1MTCA 3EYTA 1N2AA 4FO5A 2MYGA 3QDNA 1A2LA 3DMLA 2DKHA 2EC4A 2CVKA 4OFNA 2PN8A 3CRUA 3DWVA 5J9CA 1R4WA 1X5DA 2K6VA 2H6ZA 1PQNA 4BVXA 4HU9A 2XPEA 5CREA 3M3MA 2PVOC 5DAKB 3F3QA 3TB2A 3QCPA 2I3YA 1YVLA 2WGRA 5CAXA 4ZIJA 2V6OA 2EFEA 2GSQA 2HRAA 2KLXA 1GTBA 3KTLA 5EL8A 3R2QA 5BRTA 4TKYA 2X99A 2F8AA 2DMMA 1Z7RA 4OFTA 3VI7A 2C0DA 2GLRA 2FA4A 5BMUB 5JCGA 3FKFA 4DSSB 4O7HA 1ILOA 1SENA 4OD7A 2FLSA 2KP2A 2O87A 2X8GA 2HZEB 2B5EA 2PUKC 3PINA 2DSAA 2I4AA 3ZRDA 4MA9A 1GSQA 3UBKA 2H72A 1KEBA 2MMOA 2R3XA 4K0NA 2IL3A 5LCZA 5J3RA 2HSMB 2V41A 4NAXA 2X8CA 2EFCA 1FB0A 3D21A 5KN1A 2RLIA 5A5HB 1O8WA 4ECCA 5G2ZA 1H75A 1GNWA 2GDRA 1BG1A 3UVTA 4PNGA 2B6MA 4WF4A 4XS4B 2XBQA 1WJKA 3QAVA 4RQXA 1F2EA 1KBNA 4YAPA 6GSTA 1WMJA 3QR6A 4HUAA 4PUFC 4TR1B 1G6WA 2X49A 2J23A 3U6VA 1W4VA 2NVLA 2VL3A 4NV5A 3G7JA 3MAKA 1EEMA 4NMUA 2YV9A 3EU4A 1PN0A 2C3NA 1OC9B 1R5PA 1VF2A 4ULXA 2LUSA 1VF1A 4DSRA 3HMJG 2MBSA 2F8FA 3TOTA 1EWXA 5HQPA 2RM6A 2VD0A 3TKRA 4EUYA 3D5JA 1MDIA 5D9VA 4POLA 4EO3A 4GTUA 2GTUA 2JACA 2YWNA 3DD3A 1YJ6A 2X64A 3TRPA 4XCSA 4XIHA 4KCAA 4PQHA 2O8VB 1XW9A 4WXTA 1HNBA 4RI6A 5JCUA 4BWSA 1SKWB 3FMWA 5B8AA 2YJHA 4Q5RA 2R5GA 2H30A 3A3TA 3HXSA 2O85A 2YV7A 4JE1A 3TRXA 3HA9A 1YF1A 4K9ZA 2HSHA 3Q19A 2J9HA 3TU3B 3LORA 3P2AA 3GIXA 3WD6A 3CXGA 4ZL9A 3IDVA 2LQQA 1SVLA 1AC1A 2FA8A 2F9SA 1YKAA 1U87A 1GL8A 4OFMA 3KMOA 3FZ9A 1IYIA 2LTKA 3IAS2 4KB3A 4JR6A 2HZFA 2LNTA 4GSTA 4BVXB 1ACVA 5L71A 2FCHA 3L78A 4TW5A 2LS5A 2TIRA 1PKWA 1MDJA 1KTEA 5A1NB 4GDFA 3RAZA 3KXOA 4MZBA 1WOUA 4MPFA 2QA1A 2OKAA 2VCXA 3LQ7A 2JZSA 1BG5A 3L4NA 2KHPA 3C1RA 3ISOA 5HR1A 1WIKA 1EGRA 3GV1A 3FY7A 1V40A 1AIUA 1OKDA 4ZILA 5H5SA 2YZUA 3DKSA 2AAWA 4V1Ag 4P3YB 1O7UA 2Z9SA 2TRCP 2VCZA 2YP6A 1M2BA 4XRAA 2VLTA 1Z6NA 1YEPA 1W89A 2PU9C 3ZMLA 4IW9A 1HQOA 3TJBA 1THOA 2FGXA 4YH2A 4I8BA 1PD21 3IBHA 3LYKA 1XWKA 2NDOA 2BTOT 3M9JA 3BJ5A 2L4QA 2IJYA 2GQKA 3TCOA 4YQUA 2CVDA 3IC8A 2I81A 1K0OA 1DSBA 3MIXA 2VD1A 1XPVA 2R0GA 4G2EA 1EEJA 2H71A 3VURA 1BQ7A 1A24A 2CZ3A 4K0GA 3I6AA 1Y25A 3H8QA 4G01A 3HHVA 3BBYA 12GSA 4IQ1A 3O76A 5A34B 1SL2B 3DVXA 4IN0A 2H74A 2IMFA 3G9BA 3KH7A 4N11A 2L6CA 5J5NA 4ILFA 1ZYQB 5ENUA 5DALB 3J7Yk 1CQGA 3G7YA 1XWCA 5B8BA 4XTSA 5G1KA 2AYTA 1TOFA 1VF3A 2HRNA 1FAAA 3GRXA 2VL2C 1G6YA 4NV2A 1OC8A 4AKGA 3C8EA 1TU7A 2HSYA 4FQUA 2IMEA 1T4YA 1TJDA 4V1Ap 2D2ZA 3C73A 2YWOA 4KSMA 3N9JA 2IMIA 3VWWA 2GSSA 2EIRA 5CNWA 5DAKA 1T00A 2C0FA 2LQOA 4O5UA 1TW9A 5KEJA 2VUPA 18GSA 5EPFA 3HZ8A 3ERFA 5CP1A 5B6NA 5J41A 3LJRA 4BVYB 1MD3A 2B7KA 2OE1A 4QL9A 4AGSA 3GL3A 2V32A 1C72A 5BMUA 5J4UA 2ZNMA 4L0WA 4DSSA 4IP1A 4O92A 3P8WA 2IMKA 2IWTA 1BF5A 5ELGA 4GF0A 2OBIA 4HQZA 1ZGNA 2CT6A 1AXDA 4O5RA 3DYRA 2OT3A 2H0IA 2CAQA 4LA1A 1XWBA 2JL4A 3FHKA 2VL2A 5ECHB 5D93A 1AAZA 4EF0A 2CQ9A 5HR2A 3TKSC 3BCKA 2V2GA 2LV3A 2FWGA 5F05A 1S3DA 2GZZA 5EY6A 1ERUA 5J9BA 5A5HA 1FHEA 3H4KA 4JEDA 3ED3A 5CRDA 3CSHA 4E8HA 4XS4A 3VK9A 4DEJA 1K0CA 4TXOB 2IPAA 4ZBAA 2KOKA 3U5RE 2OA7A 2CX4A 17GSA 3FR3A 5ELAA 2LJAA 4I2UA 4AKHA 3AY8A 3GUSA 2GSTA 2P5RA 4IKHA 3UMAA 4MJEA 1T1VA 4WEYA 5FHIA 1Z6MA 3QAWA 4TOPA 3IE3A 3A5WA 5G31A 4F2IA 2DJ3A 1XFLA 2XBIA 5GSSA 4LMVA 2H8LA 4GXZA 4LLRA 5GAND 5IOXA 4ID0A 4ZB7A 2LRNA 4G19A 2JSZA 1ERWA 2X8HA 1J9BA 1S3AA 1AQVA 2GZPA 2VL9A 1SD8A 4GSSA 4EL1A 3TJFA 4MP4A 1PMTA 4POBA 1XOBA 1A8YA 2H1LA 2EIQA 4CW9A 4WBRD 1MEKA 3TKSA 1X0RA 5G5EA 4ZBBA 2QGVA 3LYPA 5ECPB 6GSXA 2C1YA 4AF2A 1K3LA 2MMNA 3RPPA 4KUNA 3QMXA 4X4JA 1LJRA 3IK7A 4MJBA 5IMDA 5A4WA 5HFKA 1ST9A 2YN1A 2VLUA 20GSA 4IVFA 5LD0A 3GYKA 3VPTA 4WETA 1NHYA 4V2MA 3GX0A 1X5EA 3DIEA 5ECNB 4OO4A 2YWMA 4FH8A 5A1NA 3QFAC 1T3BA 1PGTA 4X43A 2VCVA 1BEDA 3S9FA 3PH9A 5HFIA 6GSSA 1T8EB 3DXBA 1GTIA 3I69A 2WS2A 1K3YA 1ZZYA 4EXJA 4KGIA 4WR5A 1X5CA 3K8NA 3RBTA 5CRWA 4TVEA 3GX8A 2RM5A 5DVBA 2L4CA 3M1GA 5H5QA 3I9V2 3MSZA 3F4RA 2GZYA 4XS1A 2M72A 2R0CA 1ZOFA 4MLYA 4GCIA 3LFLA 2CX3A 2X4AA 1TDIA 1HNAA 4HZ2A 3APQA 3WGDA 1UC7A 1OYJA 3PGTA 1T4ZA 4JZQA 1ERTA 1I9DA 2A2RA 1GUMA 4F9ZA 3ZYWA 3ZFLA 1GRXA 4AJ7A 3WGXA 1SJIA 3KP8A 1UA5A 4KSOA 1H4OA 1GTUA 2R4VA 4WR4A 3FZ5A 4Z2RA 1GP1A 4G10A 5JCWA 3EPTA 1N8JA 5A34A 2B5XA 3RHBA 3ZLPA 4CY6A 2I1UA 2C8UA 2E7PA 3VWVA 4X0XA 1XOAA 1FVJA 5F07A 2YNXA 19GSA 5FT3A 3KEBA 5DCGA 3HD5A 4KX4A 1JLWA 3CBUA 5DALA 4E8EA 4TN8A 4CY8A 3GNJA 1TRWA 3EURA 1ON4A 3WT1A 1GLQA 1ZYEA 4MNNA 1K3OA 1RQMA 2DKIA 3W8JA 4GRFA 3M9KA 4Q5NA 3C71A 5CYYA 2ES7A 2QA2A 4W66A 4IP6A 1X9WB 3KTBA 1K0MA 2H1DA 4BL7A 4ICYA 13GSA 1YZXA 5IMZA 3KIJA 1PN9A 3ZITA 1SJ6A 4IJIA 2VM2A 1XXUA 1OC3A 2FHEA 4A5PA 4MPGA 3F8UA 2WDUA 3LEFA 4WKWA 5KN2A 1J08A 4USSA 4E68A 2QKEA 4K1FA 1G7EA 22GSA 3CTFA 5LNKe 3GSSA 4BVYA 4GQFA 3JCML 3EC3A 3GSTA 1ZCPA 1A0FA 3GKKA 4K5SA 3VPQA 4IJ3A 5E59A 4EIQA 2H73A 4L5LA 2L5LA 4YQVA 4I2TA 3UVHA 3HKRA 1JFUA 2PGTA 1XZOA 5ECRB 3MWHA 4PUAA 1TRSA 2YCDA 3CSJA 1WP0A 5DCHA 3KM6A 4CHSA 3PR8A 4Z7XA 1FB6A 2HSNB 1PL1A 4KF9A 2B1LA 4ZXGA 3V1WA 4AI6A 1HNCA 3SWLA 1GH2A 2GSRA 4HJMA 4K5RA 1PKZA 2MMAA 4ISDA 3GL5A 1V58A 3ZMKA 4WF5A 1B4QA 2WULA 3L9SA 3E9JB 2L57A 4YQMA 1M2DA 3HJOA 2PBJA 1F9MA 4TXOA 3CYNA 3IHQA 4D73A 2DJ2A 4WBJA 1EGOA 4K7IA 2N5FA 1B4PA 4EE0A 5G1LA 3CSIA 2YJ7A 3IK9A 2V1MA 2WB9A 5HR0A 11GSA 2CVBA 2DLXA 4J2FA 2RIIA 1V9WA 5C00A 5ECKB 1F6MC 1TU8A 3NOFA 1QQ2A 1A8LA 3FZ4A 3P7XA 1HD2A 1TK5B 1WRYA 1JLVA 3LW9A 2V6KA 4POKA 3IR4A 1K0NA 4ZBDA 2HQTA 2DIZA 3TJJA 1U3IA 3IRAA 4TR4A 1B9XC 5JWQB 2UV8G 3ERWA 4BWQA 2A2SA 3NZNA 4MF7A 2OADA 3A2VA 1SU9A 3GMFA 2G0FA 3HVVA 1URMA 4QMKA 3QD9A 5KOXA 1JZOA 3RPNA 5D73A 1XVQA 5IPHA 4ECIA 1A23A 4J57E 5AIVA 4L0UA 1BJXA 4MH2A 4N3ZA 4JR4A 2OE3A 1ZL9A 1ZYPA 1Z3EA 4POMA 1GSYA 5HFGA 4BL7B 2AJQB 2L6DA 3QOUA 4FYUA 4HU7A 2FY6A 1B8XA 4TR3A 4G9HA 1JZRA 1OE7A 2PMTA 5CO3A 3VI5A 1TI1A 3F0IA 1SK0A 2DC5A 3ZVJD 1IYHA 5DJMA 5IMVA 1TRUA 2JZRA 3ZL5A 3BD2A 3TRQA 1VGLA 2CAIA 2HT9A 4QL7A 3GURA 2LJKA 3D4TA 2RUFA 4J56E 1I5GA 3EMPA 1R7HA 5A4UA 1ERVA 1M9AA 5IO2A 1JZWA 2ZUPA 5KN0A 3UBLA 1Q98A 2AV4A 4TRXA 2MZCA 4IELA 3ME8A 1NSWA 1QFNA 2R37A 5IMFA 2GT5A 1XIYA 3LG6A 1FO5A 1EV9A 1GSUA 1EOGA 1F37A 1THXA 1M0UA 4K7NA 3UARA 2VCQA 3HDCA 2R2JA 1AUCA 2EFDA 2VAFA 3L9UA 3GKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKM A;  1BX9 A;  5COH A;  2F51 A;  4FYB A;  5EVO A;  3FYG A;  2LST A;  3UAP A;  1Y6E A;  3KMN A;  4MMM A;  2A4V A;  5G30 A;  6GSU A;  5D8I A;  1WPI A;  1TK0 B;  1NHO A;  2VIM A;  5DQY A;  4D73 B;  5AGY A;  2OAC A;  4IHU A;  5D96 A;  1EOH A;  4MCU A;  4N0V A;  3IC4 A;  3VWU A;  3EU3 A;  1DBY A;  5ID2 A;  2B1K A;  3KCM A;  4QQ7 A;  5A5K A;  2AHE A;  1EP7 A;  1O73 A;  1NM3 A;  1FOV A;  2H1A A;  3TKS E;  2OE0 A;  2DJK A;  2IN3 A;  4LMW A;  3W6G A;  3FEU A;  1E6B A;  2YWI A;  1DUG A;  5JWR B;  2HI7 A;  1QMV A;  4G0I A;  2RUE A;  3H79 A;  2O7K A;  3HVS A;  4OCE A;  3IA1 A;  4MF5 A;  2YAN A;  4F0C A;  3BOA A;  5JWO B;  1TI3 A;  4PX1 A;  3KJY A;  1XWA A;  5ECI B;  14GS A;  2EIO A;  1ML6 A;  6GSW A;  3QPM A;  2YPM A;  2KP1 A;  5B6M A;  2H70 A;  4L8E A;  3H93 A;  16GS A;  1SK2 A;  1GLP A;  3FZA A;  3LWA A;  1GUL A;  3MDK A;  3US3 A;  1U88 A;  3UL3 A;  5KN3 A;  2DIY A;  3EMX A;  1FW1 A;  1E2Y A;  3A2X A;  2GT6 A;  2PVQ A;  3D0Z A;  4I97 A;  1Z9H A;  1QXH A;  2WCI A;  3CTG A;  4PQ1 A;  4DVC A;  5GAP D;  3NIV A;  3ERG A;  2DJ1 A;  2H1B A;  2WFC A;  3ZZX A;  1CQH A;  5IIZ A;  1B48 A;  3IV4 A;  1GTA A;  4K8M A;  4OWY A;  4G0K A;  1ABA A;  3E3E A;  2FD3 A;  1TKD B;  2DML A;  1LU4 A;  1R5A A;  1LBK A;  2H1G A;  4NXI A;  4K2D A;  3TKQ A;  2N5B A;  1J0F A;  2C0G A;  4IBP A;  2VCW A;  2XC2 A;  4LL4 B;  1DE2 A;  2H0G A;  1SL1 B;  4EC0 A;  5GST A;  1GUK A;  2P31 A;  3FR9 A;  3HJM A;  1NW2 A;  2H01 A;  3TDG A;  3CMI A;  5CRG A;  2PWJ A;  2YOI A;  4MZC A;  4HQS A;  3PPU A;  2OBK A;  5ECS A;  3TOU A;  2L59 A;  1YY7 A;  4BA7 A;  4O32 A;  3D6I A;  4XRD A;  2C0E A;  5ABR A;  1A2M A;  4NPB A;  1KNG A;  1GNE A;  4KDY A;  4H86 A;  1DE1 A;  2DBC A;  2GS3 A;  1M9B A;  1M99 A;  3HZ4 A;  5H5R A;  4HEA 2;  5IPG A;  5CRH A;  5C04 A;  2XHF A;  4MJA A;  2TRX A;  3GH6 A;  1AW9 A;  2NPB A;  1U6T A;  1G7O A;  1BYE A;  4NWY A;  3UOM A;  3ZTL A;  3APS A;  5ECQ B;  3WGE A;  5D9W A;  4KH7 A;  1ZMA A;  1UN2 A;  2K8V A;  4HS1 A;  5F8B A;  1Z5Y E;  2C3T A;  1XBS A;  4MDC A;  4HOJ A;  3DGQ A;  5ID2 B;  4DSQ A;  1FG4 A;  4F03 A;  1T7P B;  3F6F A;  4XHM A;  1PRX A;  3KGK A;  3GKN A;  3J7Y b;  3KP9 A;  2M46 A;  2VCT A;  5A4V A;  5GZZ B;  1FVK A;  2HYX A;  2HRK B;  4F82 A;  3F4S A;  3GTU B;  1RK4 A;  4V2L A;  4KND A;  4JRR A;  3D4M A;  2P5Q A;  1VRS D;  2AB6 A;  1YEX A;  3L0H A;  1O81 A;  1OAZ A;  1TK8 B;  3TJK A;  2ZCT A;  1PX7 A;  2QC7 A;  3A2W A;  3RHC A;  3QAG A;  2LKU A;  2O89 A;  2HE3 A;  5DJL A;  3N5O A;  3LXZ A;  2KUC A;  3E0U A;  2MBT A;  1SD9 A;  5INY A;  4G0L A;  2UZ8 A;  3DRN A;  1AQW A;  2B7J A;  3D22 A;  3QFB C;  1MDK A;  3HY2 A;  2GQM A;  3I43 A;  4N30 A;  2IIY A;  3CRT A;  3F63 A;  3P90 A;  4KA0 A;  1PA3 A;  5G5F A;  5ECM B;  2H66 A;  1PSQ A;  4GLT A;  9GSS A;  1O6J A;  4MJC A;  1A0R P;  4KW6 A;  2LEG A;  2VO4 A;  1A2J A;  1QK8 A;  4ECJ A;  1O85 A;  1K0A A;  4IS0 A;  3HCZ A;  3WT2 A;  1V57 A;  3KZQ A;  2JU5 A;  3IOS A;  4MH3 A;  4ZL8 A;  3TJG A;  4L5O A;  5D9X A;  2H6X A;  2N5A A;  3RDW A;  3G7I A;  4Q5Q A;  5ECL B;  2K9F A;  4NHW A;  8GSS A;  4ACS A;  1UVZ A;  2NBS A;  4I6X A;  3LGC A;  4ZB9 A;  3H1N A;  4KAE A;  1EZK A;  3MNG A;  4IGJ A;  1X9S B;  4ML1 A;  2FUG 2;  4PGT A;  3SBC A;  3F6D A;  1XWG A;  2LRC A;  4JU5 A;  4FYC A;  4LL1 B;  4CDO A;  2WJU A;  2FWE A;  2I9H A;  3C7M A;  6GSV A;  4KE3 A;  1F3A A;  3OR5 A;  2FWF A;  4ZL7 A;  3EWL A;  4ZB8 A;  4RQR A;  3FRC A;  3BCI A;  5IOW A;  2H6Y A;  3APO A;  2E0Q A;  1OE8 A;  1MD4 A;  2ON7 A;  2HRF A;  1K0D A;  1Q4J A;  2JZT A;  2VLV A;  1XW5 A;  2HNL A;  2IMD A;  2E2G A;  6GSY A;  3FW2 A;  4EDZ A;  5ECO B;  1S3C A;  5AIS A;  1OKT A;  1SK1 A;  2XPD A;  4N0Z A;  1JZD A;  2NTO A;  3VLN A;  3IAM 2;  3IXR A;  4AJ6 A;  1Z7P A;  3GN3 A;  4ECB A;  4RUV A;  1SYX A;  3GHA A;  2YZH A;  3IPZ A;  4ML6 A;  5FWG A;  2HLS A;  1XCC A;  1TTZ A;  2B5Y A;  1XVW A;  2PPT A;  10GS A;  2IFQ A;  3TUE A;  5F0G A;  2GGT A;  3EVI A;  4MF6 A;  1V98 A;  2C4J A;  4NHZ A;  3HYP A;  2ON5 A;  1EV4 A;  3KD0 A;  3C1S A;  2AUV A;  2H19 A;  4KDU A;  4PXO A;  1GSD A;  1SYR A;  4JBB A;  3Q6O A;  2REM A;  5DDL A;  4MAB A;  3TGZ A;  4HDE A;  1WWJ A;  5IO0 A;  1YDK A;  5AN1 A;  2DJJ A;  4HI7 A;  3DEX A;  4PQI A;  2P0G A;  3O3T A;  2FNO A;  2WZ9 A;  3UEM A;  2WRT A;  2BJX A;  3EE2 A;  3ZVJ A;  2E2M A;  3VWX A;  1HYU A;  2LJR A;  3LSZ A;  4IQA A;  4AJ8 A;  2H76 A;  2CA8 A;  1USB A;  1YQ1 A;  5IMC A;  3Q18 A;  4YAV A;  2C3Q A;  1OVN A;  1QGV A;  2K18 A;  4BPY A;  1GSE A;  3ZIV A;  1AQX A;  2MMZ A;  2PER A;  3FR6 A;  4GSN A;  4TXV A;  1SKR B;  4Q5F A;  2HZE A;  3EIN A;  5E4W A;  2F3M A;  5HR3 A;  3HVX A;  2B3S A;  1M7T A;  5DBQ A;  3L9V A;  3GH9 A;  3FK8 A;  5AIX A;  2JAD A;  3GA4 A;  2QSI A;  1B9Y C;  2HSM A;  4XS6 A;  1TXX A;  3KH9 A;  3M8N A;  4EDY A;  3HJP A;  1SL0 B;  3R3E A;  4HZ4 A;  4OO5 A;  1XW6 A;  1R26 A;  2K8S A;  2LRT A;  2BMX A;  2DJ0 A;  1O8X A;  1VF4 A;  1F3B A;  1YKC A;  4EVM A;  4TR0 A;  1GSS A;  4MZW A;  3F9U A;  3TKP A;  1BAY A;  4TR1 A;  1EP8 A;  4X1U A;  4HJ2 A;  2HRK A;  4PUR A;  5D9T A;  3GTU A;  4OCF A;  1OC9 A;  3WYW A;  2HFD A;  3ME7 A;  3UJ1 A;  1U3A A;  1SKS B;  1GSF A;  5IQY A;  5IM9 A;  3DVW A;  3VFI A;  1YF0 A;  1M2A A;  1PL2 A;  2LNS A;  3ZIJ A;  4I5Q A;  1G0T A;  4KDX A;  4GQC A;  1X9M B;  2CZ2 A;  1SJZ A;  3UIW A;  2FWH A;  4EKZ A;  2GVP A;  1K0B A;  4FIW A;  1JHB A;  1QUW A;  1GUH A;  4K6X A;  2H75 A;  3W8S A;  3M0F A;  5B7C A;  2L5O A;  2M80 A;  2H0H A;  3ZFB A;  1PX6 A;  3ZRE A;  2C80 A;  4N10 A;  2R6K A;  2VOC A;  4MK3 A;  2OJL A;  2HXK A;  3F3R A;  3GFK A;  7GSS A;  4V2N A;  2GQL A;  3O6T A;  1TRV A;  4K7O A;  5DQS A;  2JSY A;  2CV4 A;  2VM1 A;  4PNF A;  1RW1 A;  4RI7 A;  1TP9 A;  3LXT A;  2IFQ B;  4OMV A;  4PTS A;  4KCE A;  2G2Q A;  4ZB6 A;  5IMA A;  2ALB A;  3F4T A;  1WE0 A;  1V2A A;  4F0B A;  5F06 A;  3Q74 A;  4GWR A;  1GWC A;  1MTC A;  3EYT A;  1N2A A;  4FO5 A;  2MYG A;  3QDN A;  1A2L A;  3DML A;  2EC4 A;  2CVK A;  4OFN A;  2PN8 A;  3CRU A;  3DWV A;  5J9C A;  1R4W A;  1X5D A;  2K6V A;  2H6Z A;  1PQN A;  4BVX A;  4HU9 A;  2XPE A;  5CRE A;  3M3M A;  2PVO C;  5DAK B;  3F3Q A;  3TB2 A;  3QCP A;  2I3Y A;  2WGR A;  5CAX A;  4ZIJ A;  2V6O A;  2GSQ A;  2HRA A;  2KLX A;  1GTB A;  3KTL A;  5EL8 A;  3R2Q A;  4TKY A;  2X99 A;  2F8A A;  2DMM A;  1Z7R A;  4OFT A;  3VI7 A;  2C0D A;  2GLR A;  2FA4 A;  5JCG A;  3FKF A;  4DSS B;  4O7H A;  1ILO A;  1SEN A;  4OD7 A;  2FLS A;  2KP2 A;  2O87 A;  2X8G A;  2HZE B;  2B5E A;  2PUK C;  3PIN A;  2DSA A;  2I4A A;  3ZRD A;  4MA9 A;  1GSQ A;  3UBK A;  2H72 A;  1KEB A;  2MMO A;  2R3X A;  4K0N A;  2IL3 A;  5LCZ A;  5J3R A;  2HSM B;  2V41 A;  4NAX A;  2X8C A;  1FB0 A;  3D21 A;  5KN1 A;  2RLI A;  1O8W A;  4ECC A;  5G2Z A;  1H75 A;  1GNW A;  2GDR A;  3UVT A;  4PNG A;  2B6M A;  4WF4 A;  4XS4 B;  2XBQ A;  1WJK A;  3QAV A;  4RQX A;  1F2E A;  1KBN A;  4YAP A;  6GST A;  1WMJ A;  3QR6 A;  4HUA A;  4PUF C;  4TR1 B;  1G6W A;  2J23 A;  3U6V A;  1W4V A;  2NVL A;  2VL3 A;  4NV5 A;  3G7J A;  3MAK A;  1EEM A;  4NMU A;  2YV9 A;  3EU4 A;  2C3N A;  1OC9 B;  1R5P A;  1VF2 A;  4ULX A;  2LUS A;  1VF1 A;  4DSR A;  2MBS A;  2F8F A;  3TOT A;  1EWX A;  5HQP A;  2RM6 A;  2VD0 A;  3TKR A;  4EUY A;  3D5J A;  1MDI A;  5D9V A;  4POL A;  4EO3 A;  4GTU A;  2GTU A;  2JAC A;  2YWN A;  3DD3 A;  1YJ6 A;  2X64 A;  3TRP A;  4XCS A;  4XIH A;  4KCA A;  4PQH A;  2O8V B;  1XW9 A;  4WXT A;  1HNB A;  4RI6 A;  5JCU A;  4BWS A;  1SKW B;  5B8A A;  2YJH A;  4Q5R A;  2R5G A;  2H30 A;  3A3T A;  3HXS A;  2O85 A;  2YV7 A;  4JE1 A;  3TRX A;  3HA9 A;  1YF1 A;  4K9Z A;  2HSH A;  3Q19 A;  2J9H A;  3LOR A;  3P2A A;  3GIX A;  3WD6 A;  3CXG A;  4ZL9 A;  3IDV A;  2LQQ A;  1AC1 A;  2FA8 A;  2F9S A;  1YKA A;  1U87 A;  1GL8 A;  4OFM A;  3KMO A;  3FZ9 A;  1IYI A;  2LTK A;  3IAS 2;  4KB3 A;  4JR6 A;  2HZF A;  2LNT A;  4GST A;  4BVX B;  1ACV A;  5L71 A;  2FCH A;  3L78 A;  4TW5 A;  2LS5 A;  2TIR A;  1PKW A;  1MDJ A;  1KTE A;  3RAZ A;  3KXO A;  4MZB A;  1WOU A;  4MPF A;  2OKA A;  2VCX A;  3LQ7 A;  2JZS A;  1BG5 A;  3L4N A;  2KHP A;  3ISO A;  3C1R A;  5HR1 A;  1WIK A;  1EGR A;  3GV1 A;  3FY7 A;  1V40 A;  1AIU A;  1OKD A;  4ZIL A;  5H5S A;  2YZU A;  3DKS A;  2AAW A;  4V1A g;  4P3Y B;  1O7U A;  2Z9S A;  2TRC P;  2VCZ A;  2YP6 A;  1M2B A;  4XRA A;  2VLT A;  1Z6N A;  1YEP A;  1W89 A;  2PU9 C;  3ZML A;  4IW9 A;  1HQO A;  3TJB A;  1THO A;  2FGX A;  4YH2 A;  4I8B A;  1PD2 1;  3IBH A;  3LYK A;  1XWK A;  2NDO A;  2BTO T;  3M9J A;  3BJ5 A;  2L4Q A;  2IJY A;  2GQK A;  3TCO A;  4YQU A;  2CVD A;  3IC8 A;  2I81 A;  1K0O A;  1DSB A;  2VD1 A;  1XPV A;  4G2E A;  1EEJ A;  2H71 A;  3VUR A;  1BQ7 A;  1A24 A;  2CZ3 A;  4K0G A;  3I6A A;  1Y25 A;  3H8Q A;  3HHV A;  3BBY A;  12GS A;  4IQ1 A;  3O76 A;  1SL2 B;  3DVX A;  4IN0 A;  2H74 A;  2IMF A;  3G9B A;  3KH7 A;  4N11 A;  2L6C A;  5J5N A;  4ILF A;  1ZYQ B;  5ENU A;  5DAL B;  3J7Y k;  1CQG A;  3G7Y A;  1XWC A;  5B8B A;  4XTS A;  5G1K A;  2AYT A;  1TOF A;  1VF3 A;  2HRN A;  1FAA A;  3GRX A;  2VL2 C;  1G6Y A;  4NV2 A;  1OC8 A;  3C8E A;  1TU7 A;  2HSY A;  4FQU A;  2IME A;  1T4Y A;  1TJD A;  4V1A p;  2D2Z A;  3C73 A;  2YWO A;  4KSM A;  3N9J A;  2IMI A;  3VWW A;  2GSS A;  2EIR A;  5CNW A;  5DAK A;  1T00 A;  2C0F A;  2LQO A;  1TW9 A;  5KEJ A;  2VUP A;  18GS A;  5EPF A;  3HZ8 A;  3ERF A;  5CP1 A;  5B6N A;  5J41 A;  3LJR A;  4BVY B;  1MD3 A;  2B7K A;  2OE1 A;  4QL9 A;  4AGS A;  3GL3 A;  2V32 A;  1C72 A;  5BMU A;  5J4U A;  2ZNM A;  4L0W A;  4DSS A;  4IP1 A;  4O92 A;  3P8W A;  2IMK A;  2IWT A;  5ELG A;  4GF0 A;  2OBI A;  4HQZ A;  1ZGN A;  2CT6 A;  1AXD A;  4O5R A;  3DYR A;  2H0I A;  2CAQ A;  4LA1 A;  1XWB A;  2JL4 A;  3FHK A;  2VL2 A;  5ECH B;  5D93 A;  1AAZ A;  4EF0 A;  2CQ9 A;  5HR2 A;  3TKS C;  3BCK A;  2V2G A;  2LV3 A;  2FWG A;  5F05 A;  1S3D A;  2GZZ A;  5EY6 A;  1ERU A;  5J9B A;  1FHE A;  3H4K A;  4JED A;  3ED3 A;  5CRD A;  3CSH A;  4E8H A;  4XS4 A;  3VK9 A;  4DEJ A;  1K0C A;  4TXO B;  2IPA A;  4ZBA A;  2KOK A;  3U5R E;  2OA7 A;  2CX4 A;  17GS A;  3FR3 A;  5ELA A;  2LJA A;  4I2U A;  3AY8 A;  3GUS A;  2GST A;  2P5R A;  4IKH A;  3UMA A;  4MJE A;  1T1V A;  4WEY A;  5FHI A;  1Z6M A;  3QAW A;  4TOP A;  3IE3 A;  3A5W A;  5G31 A;  4F2I A;  2DJ3 A;  1XFL A;  2XBI A;  5GSS A;  4LMV A;  2H8L A;  4GXZ A;  4LLR A;  5GAN D;  5IOX A;  4ID0 A;  2LRN A;  4G19 A;  2JSZ A;  1ERW A;  2X8H A;  1J9B A;  1S3A A;  1AQV A;  2GZP A;  2VL9 A;  1SD8 A;  4GSS A;  4EL1 A;  3TJF A;  4MP4 A;  1PMT A;  4POB A;  1XOB A;  1A8Y A;  2EIQ A;  4CW9 A;  4WBR D;  1MEK A;  3TKS A;  1X0R A;  5G5E A;  4ZBB A;  2QGV A;  3LYP A;  5ECP B;  6GSX A;  2C1Y A;  4AF2 A;  1K3L A;  2MMN A;  3RPP A;  4KUN A;  3QMX A;  1LJR A;  3IK7 A;  4MJB A;  5IMD A;  5A4W A;  5HFK A;  1ST9 A;  2YN1 A;  2VLU A;  20GS A;  4IVF A;  5LD0 A;  3GYK A;  3VPT A;  4WET A;  1NHY A;  4V2M A;  3GX0 A;  1X5E A;  3DIE A;  5ECN B;  4OO4 A;  2YWM A;  4FH8 A;  3QFA C;  1T3B A;  1PGT A;  4X43 A;  2VCV A;  1BED A;  3S9F A;  3PH9 A;  5HFI A;  6GSS A;  1T8E B;  3DXB A;  1GTI A;  3I69 A;  2WS2 A;  1K3Y A;  1ZZY A;  4EXJ A;  4KGI A;  4WR5 A;  1X5C A;  3K8N A;  3RBT A;  5CRW A;  4TVE A;  3GX8 A;  2RM5 A;  5DVB A;  2L4C A;  3M1G A;  5H5Q A;  3I9V 2;  3MSZ A;  3F4R A;  2GZY A;  4XS1 A;  2M72 A;  1ZOF A;  4MLY A;  4GCI A;  3LFL A;  2CX3 A;  1TDI A;  1HNA A;  4HZ2 A;  3APQ A;  3WGD A;  1UC7 A;  1OYJ A;  3PGT A;  1T4Z A;  4JZQ A;  1ERT A;  1I9D A;  2A2R A;  1GUM A;  4F9Z A;  3ZYW A;  3ZFL A;  1GRX A;  4AJ7 A;  3WGX A;  1SJI A;  3KP8 A;  1UA5 A;  4KSO A;  1H4O A;  1GTU A;  2R4V A;  4WR4 A;  3FZ5 A;  1GP1 A;  4G10 A;  5JCW A;  1N8J A;  2B5X A;  3RHB A;  3ZLP A;  2I1U A;  2C8U A;  2E7P A;  3VWV A;  4X0X A;  1XOA A;  1FVJ A;  5F07 A;  2YNX A;  19GS A;  5FT3 A;  3KEB A;  5DCG A;  3HD5 A;  4KX4 A;  1JLW A;  3CBU A;  5DAL A;  4E8E A;  4TN8 A;  3GNJ A;  1TRW A;  3EUR A;  1ON4 A;  3WT1 A;  1GLQ A;  1ZYE A;  1K3O A;  1RQM A;  3W8J A;  4GRF A;  3M9K A;  4Q5N A;  3C71 A;  5CYY A;  2ES7 A;  4IP6 A;  1X9W B;  3KTB A;  1K0M A;  2H1D A;  4BL7 A;  13GS A;  1YZX A;  5IMZ A;  3KIJ A;  1PN9 A;  3ZIT A;  1SJ6 A;  4IJI A;  2VM2 A;  1XXU A;  1OC3 A;  2FHE A;  4MPG A;  3F8U A;  2WDU A;  3LEF A;  4WKW A;  5KN2 A;  1J08 A;  4USS A;  2QKE A;  4K1F A;  1G7E A;  22GS A;  3CTF A;  5LNK e;  3GSS A;  4BVY A;  4GQF A;  3JCM L;  3EC3 A;  3GST A;  1ZCP A;  1A0F A;  3GKK A;  3VPQ A;  4IJ3 A;  5E59 A;  2H73 A;  4L5L A;  2L5L A;  4YQV A;  4I2T A;  3UVH A;  3HKR A;  1JFU A;  2PGT A;  1XZO A;  5ECR B;  3MWH A;  4PUA A;  1TRS A;  2YCD A;  3CSJ A;  1WP0 A;  5DCH A;  3KM6 A;  4CHS A;  3PR8 A;  4Z7X A;  1FB6 A;  2HSN B;  1PL1 A;  4KF9 A;  2B1L A;  4ZXG A;  3V1W A;  1HNC A;  3SWL A;  1GH2 A;  2GSR A;  4HJM A;  1PKZ A;  2MMA A;  4ISD A;  3GL5 A;  1V58 A;  3ZMK A;  4WF5 A;  1B4Q A;  2WUL A;  3L9S A;  3E9J B;  2L57 A;  4YQM A;  1M2D A;  3HJO A;  2PBJ A;  1F9M A;  4TXO A;  3CYN A;  3IHQ A;  4D73 A;  2DJ2 A;  4WBJ A;  1EGO A;  4K7I A;  2N5F A;  1B4P A;  4EE0 A;  5G1L A;  3CSI A;  2YJ7 A;  3IK9 A;  2V1M A;  2WB9 A;  5HR0 A;  11GS A;  2CVB A;  2DLX A;  4J2F A;  2RII A;  1V9W A;  5C00 A;  5ECK B;  1F6M C;  1TU8 A;  3NOF A;  1QQ2 A;  1A8L A;  3FZ4 A;  3P7X A;  1HD2 A;  1TK5 B;  1WRY A;  1JLV A;  2V6K A;  4POK A;  3IR4 A;  1K0N A;  4ZBD A;  2HQT A;  2DIZ A;  3TJJ A;  1U3I A;  3IRA A;  4TR4 A;  1B9X C;  5JWQ B;  3ERW A;  4BWQ A;  2A2S A;  3NZN A;  4MF7 A;  2OAD A;  3A2V A;  1SU9 A;  3GMF A;  2G0F A;  3HVV A;  1URM A;  3QD9 A;  1JZO A;  3RPN A;  5D73 A;  1XVQ A;  5IPH A;  4ECI A;  1A23 A;  4J57 E;  5AIV A;  4L0U A;  1BJX A;  4MH2 A;  4JR4 A;  2OE3 A;  1ZL9 A;  1Z3E A;  4POM A;  1GSY A;  5HFG A;  4BL7 B;  2AJQ B;  2L6D A;  3QOU A;  4FYU A;  4HU7 A;  2FY6 A;  1B8X A;  4TR3 A;  4G9H A;  1JZR A;  1OE7 A;  2PMT A;  5CO3 A;  3VI5 A;  1TI1 A;  3F0I A;  1SK0 A;  2DC5 A;  3ZVJ D;  1IYH A;  5DJM A;  5IMV A;  1TRU A;  2JZR A;  3ZL5 A;  3BD2 A;  3TRQ A;  1VGL A;  2CAI A;  2HT9 A;  4QL7 A;  3GUR A;  2LJK A;  3D4T A;  2RUF A;  4J56 E;  1I5G A;  3EMP A;  1R7H A;  5A4U A;  1ERV A;  1M9A A;  5IO2 A;  1JZW A;  2ZUP A;  5KN0 A;  3UBL A;  1Q98 A;  2AV4 A;  4TRX A;  2MZC A;  4IEL A;  3ME8 A;  1NSW A;  1QFN A;  2R37 A;  5IMF A;  2GT5 A;  1XIY A;  3LG6 A;  1FO5 A;  1EV9 A;  1GSU A;  1EOG A;  1F37 A;  1THX A;  1M0U A;  4K7N A;  3UAR A;  2VCQ A;  3HDC A;  2R2J A;  1AUC A;  2VAF A;  3L9U A;  3GKX A; 
#chains in the Genus database with same CATH topology
 3GKM A;  1BX9 A;  5COH A;  5J40 A;  1FOH A;  2F51 A;  4FYB A;  2A2P A;  5EVO A;  3FYG A;  2LST A;  3UAP A;  1Y6E A;  3KMN A;  4MMM A;  2A4V A;  5G30 A;  6GSU A;  5D8I A;  1WPI A;  1TK0 B;  1NHO A;  2VIM A;  5DQY A;  4D73 B;  5AGY A;  2OAC A;  4IHU A;  5D96 A;  1EOH A;  4MCU A;  4N0V A;  3RFR C;  3IC4 A;  3VWU A;  3EU3 A;  1DBY A;  5ID2 A;  2B1K A;  3KCM A;  4QQ7 A;  5A5K A;  2AHE A;  1EP7 A;  1O73 A;  1NM3 A;  1FOV A;  2H1A A;  3TKS E;  2OE0 A;  1ZYN A;  2DJK A;  4LMW A;  2IN3 A;  3W6G A;  3FEU A;  1E6B A;  2YWI A;  1DUG A;  5JWR B;  2HI7 A;  1QMV A;  4G0I A;  2RUE A;  3H79 A;  2O7K A;  3HVS A;  4OCE A;  3IA1 A;  4MF5 A;  2YAN A;  4F0C A;  3BOA A;  5JWO B;  1TI3 A;  4PX1 A;  3KJY A;  1XWA A;  5ECI B;  14GS A;  4YKF A;  2EIO A;  1ML6 A;  6GSW A;  3QPM A;  2YPM A;  2KP1 A;  5B6M A;  2H70 A;  4L8E A;  1SVO A;  4AKI A;  3H93 A;  16GS A;  1SK2 A;  1GLP A;  3FZA A;  3LWA A;  1GUL A;  3MDK A;  3US3 A;  2A4H A;  1U88 A;  3UL3 A;  5KN3 A;  2DIY A;  3EMX A;  1FW1 A;  1E2Y A;  3A2X A;  2GT6 A;  2PVQ A;  3D0Z A;  4I97 A;  1Z9H A;  1QXH A;  2WCI A;  3CTG A;  4PQ1 A;  4DVC A;  5GAP D;  3NIV A;  3ERG A;  2DJ1 A;  2H1B A;  2WFC A;  3ZZX A;  1CQH A;  5IIZ A;  2EFH A;  1B48 A;  3IV4 A;  1GTA A;  2HSN A;  4K8M A;  4OWY A;  4G0K A;  1ABA A;  3E3E A;  2FD3 A;  1TKD B;  2DML A;  1LU4 A;  1R5A A;  1LBK A;  2H1G A;  4NXI A;  4K2D A;  3TKQ A;  2N5B A;  1J0F A;  2C0G A;  4IBP A;  2VCW A;  2XC2 A;  4LL4 B;  1DE2 A;  2H0G A;  1SL1 B;  4EC0 A;  5GST A;  1GUK A;  2P31 A;  3FR9 A;  3HJM A;  1NW2 A;  2H01 A;  3TDG A;  3CMI A;  5CRG A;  2PWJ A;  2YOI A;  4MZC A;  4HQS A;  3PPU A;  2OBK A;  5ECS A;  3TOU A;  2L59 A;  1YY7 A;  4BA7 A;  4O32 A;  3D6I A;  4XRD A;  2C0E A;  5ABR A;  1A2M A;  4NPB A;  1KNG A;  1GNE A;  4KDY A;  4H86 A;  1DE1 A;  2DBC A;  2GS3 A;  1M9B A;  1M99 A;  3HZ4 A;  5H5R A;  4HEA 2;  5IPG A;  5CRH A;  5C04 A;  2XHF A;  4MJA A;  2TRX A;  3GH6 A;  1AW9 A;  2NPB A;  1U6T A;  1G7O A;  1BYE A;  3A5I A;  4NWY A;  3UOM A;  3ZTL A;  3APS A;  5ECQ B;  3WGE A;  5D9W A;  4KH7 A;  1ZMA A;  1UN2 A;  2K8V A;  4HS1 A;  5F8B A;  1Z5Y E;  2C3T A;  1XBS A;  4MDC A;  4HOJ A;  3DGQ A;  5ID2 B;  4DSQ A;  1FG4 A;  4F03 A;  1T7P B;  3F6F A;  4XHM A;  1PRX A;  3KGK A;  3GKN A;  3J7Y b;  3KP9 A;  2M46 A;  2VCT A;  5A4V A;  5GZZ B;  1FVK A;  2HYX A;  2HRK B;  4F82 A;  3F4S A;  3GTU B;  1RK4 A;  4V2L A;  4KND A;  4JRR A;  3D4M A;  2P5Q A;  1VRS D;  2AB6 A;  1YEX A;  1YEW C;  3L0H A;  1O81 A;  1OAZ A;  1TK8 B;  4FXY P;  3TJK A;  2ZCT A;  1PX7 A;  2QC7 A;  3A2W A;  3RHC A;  4EIP A;  3QAG A;  2LKU A;  2O89 A;  2HE3 A;  5DJL A;  3N5O A;  3LXZ A;  2KUC A;  3E0U A;  2MBT A;  1SD9 A;  5INY A;  4G0L A;  2UZ8 A;  3DRN A;  1AQW A;  2B7J A;  1Y1U A;  3D22 A;  3QFB C;  1MDK A;  3HY2 A;  2GQM A;  3I43 A;  4N30 A;  2IIY A;  3CRT A;  3F63 A;  3P90 A;  4KA0 A;  3CWG A;  1PA3 A;  5G5F A;  5ECM B;  2VKZ G;  2H66 A;  1PSQ A;  4GLT A;  9GSS A;  1O6J A;  4MJC A;  1A0R P;  4KW6 A;  2LEG A;  2VO4 A;  1A2J A;  1QK8 A;  4ECJ A;  1O85 A;  1K0A A;  4IS0 A;  3HCZ A;  3WT2 A;  1V57 A;  3KZQ A;  2JU5 A;  3IOS A;  4MH3 A;  4ZL8 A;  3TJG A;  4L5O A;  5D9X A;  2H6X A;  5J4V A;  2N5A A;  3RDW A;  3G7I A;  4Q5Q A;  5ECL B;  2K9F A;  4NHW A;  8GSS A;  4ACS A;  1UVZ A;  2NBS A;  4Z2U A;  4I6X A;  3LGC A;  4ZB9 A;  3H1N A;  4KAE A;  1S4B P;  1EZK A;  3MNG A;  1S3R A;  4YKG A;  4IGJ A;  1X9S B;  2R0P A;  4ML1 A;  2FUG 2;  4PGT A;  3SBC A;  3F6D A;  1XWG A;  2LRC A;  4JU5 A;  4FYC A;  4LL1 B;  4CDO A;  2WJU A;  2FWE A;  2I9H A;  3C7M A;  6GSV A;  4KE3 A;  1F3A A;  3OR5 A;  2FWF A;  4ZL7 A;  3EWL A;  4ZB8 A;  4RQR A;  3FRC A;  3BCI A;  5IOW A;  2H6Y A;  3APO A;  2E0Q A;  1OE8 A;  1MD4 A;  2ON7 A;  2O5V A;  2HRF A;  1K0D A;  1Q4J A;  2JZT A;  2VLV A;  1XW5 A;  2HNL A;  2IMD A;  2E2G A;  6GSY A;  3FW2 A;  4EDZ A;  5ECO B;  1S3C A;  5AIS A;  1OKT A;  1SK1 A;  2XPD A;  4N0Z A;  1JZD A;  2NTO A;  3VLN A;  3IAM 2;  3IXR A;  4AJ6 A;  1Z7P A;  3GN3 A;  4ECB A;  4RUV A;  1SYX A;  3GHA A;  2YZH A;  3IPZ A;  4ML6 A;  5FWG A;  2HLS A;  1XCC A;  1TTZ A;  2B5Y A;  1XVW A;  2PPT A;  10GS A;  2IFQ A;  3TUE A;  5F0G A;  2GGT A;  3EVI A;  4PI0 C;  4MF6 A;  1I1I P;  1V98 A;  2C4J A;  4NHZ A;  3HYP A;  2ON5 A;  1EV4 A;  3KD0 A;  3C1S A;  2AUV A;  2H19 A;  4KDU A;  4PXO A;  1GSD A;  1SYR A;  4JBB A;  3Q6O A;  2REM A;  5DDL A;  4MAB A;  3TGZ A;  4HDE A;  1WWJ A;  5IO0 A;  1YDK A;  5AN1 A;  2DJJ A;  4HI7 A;  1PFO A;  3DEX A;  1SVM A;  4PQI A;  2P0G A;  3IHG A;  3O3T A;  2FNO A;  2WZ9 A;  3UEM A;  2WRT A;  2BJX A;  3EE2 A;  3ZVJ A;  2O36 A;  2E2M A;  3VWX A;  1HYU A;  2LJR A;  5J4Y A;  3LSZ A;  4IQA A;  4AJ8 A;  2H76 A;  2CA8 A;  4K2X A;  1USB A;  1YQ1 A;  5IMC A;  3Q18 A;  4YAV A;  2C3Q A;  1OVN A;  1QGV A;  2K18 A;  3MYD A;  4BPY A;  1GSE A;  3ZIV A;  1AQX A;  2MMZ A;  2PER A;  3FR6 A;  4GSN A;  4TXV A;  1SKR B;  4Q5F A;  4AKX B;  2HZE A;  3EIN A;  5E4W A;  5J47 A;  2F3M A;  5HR3 A;  3HVX A;  2B3S A;  1M7T A;  5DBQ A;  3L9V A;  3GH9 A;  3FK8 A;  5AIX A;  2JAD A;  3GA4 A;  2QSI A;  1B9Y C;  2HSM A;  4XS6 A;  1TXX A;  3KH9 A;  3M8N A;  4EDY A;  3HJP A;  1SL0 B;  3R3E A;  4HZ4 A;  4OO5 A;  1XW6 A;  1R26 A;  2K8S A;  2LRT A;  2BMX A;  2DJ0 A;  1O8X A;  1VF4 A;  1F3B A;  1YKC A;  4EVM A;  1TXU A;  4TR0 A;  1GSS A;  4MZW A;  3F9U A;  3TKP A;  1BAY A;  4TR1 A;  1EP8 A;  4X1U A;  4HJ2 A;  2HRK A;  1N25 A;  4PUR A;  5D9T A;  3GTU A;  4OCF A;  1OC9 A;  3WYW A;  2HFD A;  3ME7 A;  3UJ1 A;  1U3A A;  1SKS B;  1GSF A;  5IQY A;  5IM9 A;  4Z2T A;  3DVW A;  3VFI A;  1YF0 A;  4BIK A;  1M2A A;  1PL2 A;  2LNS A;  3ZIJ A;  4I5Q A;  1G0T A;  4KDX A;  4GQC A;  1X9M B;  2CZ2 A;  1SJZ A;  3UIW A;  2FWH A;  4EKZ A;  2GVP A;  1K0B A;  4FIW A;  1JHB A;  1QUW A;  1GUH A;  4K6X A;  2H75 A;  3W8S A;  3M0F A;  5B7C A;  2L5O A;  2M80 A;  2H0H A;  3ZFB A;  1PX6 A;  3ZRE A;  3CQF A;  2C80 A;  4N10 A;  2R6K A;  4O5Q A;  2VOC A;  4MK3 A;  2OJL A;  2HXK A;  3F3R A;  3GFK A;  7GSS A;  4V2N A;  5KOW A;  2GQL A;  3O6T A;  2WW1 A;  1TRV A;  4K7O A;  5DQS A;  2JSY A;  2CV4 A;  3CHX C;  2VM1 A;  4PNF A;  1RW1 A;  4RI7 A;  1TP9 A;  3LXT A;  2IFQ B;  4OMV A;  4PTS A;  4KCE A;  2G2Q A;  4ZB6 A;  5IMA A;  2ALB A;  3F4T A;  1WE0 A;  1V2A A;  4F0B A;  5F06 A;  3Q74 A;  4GWR A;  1GWC A;  1MTC A;  3EYT A;  1N2A A;  4FO5 A;  2MYG A;  3QDN A;  1A2L A;  3DML A;  2DKH A;  2EC4 A;  2CVK A;  4OFN A;  2PN8 A;  3CRU A;  3DWV A;  5J9C A;  1R4W A;  1X5D A;  2K6V A;  2H6Z A;  1PQN A;  4BVX A;  4HU9 A;  2XPE A;  5CRE A;  3M3M A;  2PVO C;  5DAK B;  3F3Q A;  3TB2 A;  3QCP A;  2I3Y A;  1YVL A;  2WGR A;  5CAX A;  4ZIJ A;  2V6O A;  2EFE A;  2GSQ A;  2HRA A;  2KLX A;  1GTB A;  3KTL A;  2WW3 A;  5EL8 A;  3R2Q A;  5BRT A;  4TKY A;  2X99 A;  2F8A A;  2DMM A;  1Z7R A;  4OFT A;  3VI7 A;  2C0D A;  2GLR A;  2FA4 A;  5BMU B;  5JCG A;  3FKF A;  4DSS B;  4O7H A;  1ILO A;  1SEN A;  4PI2 C;  4OD7 A;  2FLS A;  2KP2 A;  2O87 A;  2X8G A;  2HZE B;  2B5E A;  2PUK C;  3PIN A;  2DSA A;  2I4A A;  3ZRD A;  4MA9 A;  1GSQ A;  3UBK A;  2H72 A;  1KEB A;  2MMO A;  2R3X A;  4K0N A;  2IL3 A;  5LCZ A;  5J3R A;  2HSM B;  2V41 A;  4NAX A;  2X8C A;  2EFC A;  1FB0 A;  3D21 A;  5KN1 A;  2RLI A;  5A5H B;  1O8W A;  4ECC A;  5G2Z A;  1H75 A;  1GNW A;  2GDR A;  1BG1 A;  3UVT A;  4PNG A;  2B6M A;  4WF4 A;  4XS4 B;  2XBQ A;  1WJK A;  3QAV A;  4RQX A;  1F2E A;  1KBN A;  4YAP A;  6GST A;  1WMJ A;  3QR6 A;  4HUA A;  4PUF C;  4TR1 B;  1G6W A;  2X49 A;  2J23 A;  3U6V A;  1W4V A;  2NVL A;  2VL3 A;  4NV5 A;  3G7J A;  3MAK A;  1EEM A;  4NMU A;  2YV9 A;  3EU4 A;  1PN0 A;  2C3N A;  1OC9 B;  2WW0 A;  1R5P A;  1VF2 A;  4ULX A;  2LUS A;  1VF1 A;  4DSR A;  3HMJ G;  3L9U A;  2MBS A;  2F8F A;  3TOT A;  1EWX A;  5HQP A;  2RM6 A;  2VD0 A;  3TKR A;  4EUY A;  3D5J A;  1MDI A;  5D9V A;  4POL A;  4EO3 A;  4GTU A;  2GTU A;  2JAC A;  2YWN A;  3DD3 A;  1YJ6 A;  2X64 A;  3TRP A;  4XCS A;  4XIH A;  4KCA A;  4PQH A;  2O8V B;  1XW9 A;  4WXT A;  1HNB A;  4RI6 A;  5JCU A;  4BWS A;  1SKW B;  3FMW A;  5B8A A;  2YJH A;  4Q5R A;  2R5G A;  2H30 A;  3A3T A;  3HXS A;  2O85 A;  2YV7 A;  4JE1 A;  3TRX A;  3HA9 A;  1YF1 A;  4K9Z A;  2HSH A;  3Q19 A;  2J9H A;  3TU3 B;  3LOR A;  3P2A A;  3GIX A;  3WD6 A;  3CXG A;  4ZL9 A;  3IDV A;  2LQQ A;  1SVL A;  1AC1 A;  2FA8 A;  2F9S A;  1YKA A;  1U87 A;  1GL8 A;  4OFM A;  3KMO A;  3FZ9 A;  1IYI A;  2LTK A;  3IAS 2;  4KB3 A;  4JR6 A;  2HZF A;  2LNT A;  4GST A;  4BVX B;  1ACV A;  5L71 A;  2FCH A;  3L78 A;  4TW5 A;  2LS5 A;  2TIR A;  1PKW A;  1MDJ A;  1KTE A;  5A1N B;  4GDF A;  3RAZ A;  3KXO A;  4MZB A;  1WOU A;  4MPF A;  2QA1 A;  2OKA A;  2VCX A;  3LQ7 A;  2JZS A;  1BG5 A;  3L4N A;  2KHP A;  3C1R A;  3ISO A;  5HR1 A;  1WIK A;  1EGR A;  3GV1 A;  3FY7 A;  1V40 A;  1AIU A;  1OKD A;  4ZIL A;  5H5S A;  2YZU A;  3DKS A;  2AAW A;  4V1A g;  4P3Y B;  1O7U A;  2Z9S A;  2TRC P;  2VCZ A;  2YP6 A;  1M2B A;  4XRA A;  2VLT A;  1Z6N A;  1YEP A;  1W89 A;  2PU9 C;  3ZML A;  4IW9 A;  1HQO A;  3TJB A;  1THO A;  2FGX A;  4YH2 A;  4I8B A;  1PD2 1;  3IBH A;  3LYK A;  1XWK A;  2NDO A;  2BTO T;  3M9J A;  3BJ5 A;  2L4Q A;  2IJY A;  4PHZ C;  2GQK A;  3TCO A;  4YQU A;  2CVD A;  3IC8 A;  2I81 A;  1K0O A;  1DSB A;  3MIX A;  2VD1 A;  1XPV A;  2R0G A;  4G2E A;  1EEJ A;  2H71 A;  3VUR A;  1BQ7 A;  1A24 A;  2CZ3 A;  4K0G A;  3I6A A;  1Y25 A;  3H8Q A;  4G01 A;  3HHV A;  3BBY A;  12GS A;  4IQ1 A;  3O76 A;  5A34 B;  1SL2 B;  3DVX A;  4IN0 A;  2H74 A;  2IMF A;  3G9B A;  3KH7 A;  4N11 A;  2L6C A;  5J5N A;  4ILF A;  1ZYQ B;  5ENU A;  5DAL B;  3J7Y k;  1CQG A;  3G7Y A;  1XWC A;  5B8B A;  4XTS A;  5G1K A;  2AYT A;  1TOF A;  1VF3 A;  2HRN A;  1FAA A;  3GRX A;  2VL2 C;  1G6Y A;  4NV2 A;  1OC8 A;  4AKG A;  3C8E A;  1TU7 A;  2HSY A;  4FQU A;  2IME A;  1T4Y A;  1TJD A;  4V1A p;  2D2Z A;  3C73 A;  2YWO A;  4KSM A;  3N9J A;  2IMI A;  3VWW A;  2GSS A;  2EIR A;  5CNW A;  5DAK A;  1T00 A;  2C0F A;  2LQO A;  4O5U A;  1TW9 A;  5KEJ A;  2VUP A;  18GS A;  5EPF A;  3HZ8 A;  3ERF A;  5CP1 A;  5B6N A;  5J41 A;  3LJR A;  2WZS A;  4BVY B;  1MD3 A;  2B7K A;  2OE1 A;  4QL9 A;  4AGS A;  3GL3 A;  1C72 A;  5BMU A;  5J4U A;  2ZNM A;  4L0W A;  4DSS A;  4IP1 A;  4O92 A;  3P8W A;  2IMK A;  2IWT A;  1BF5 A;  5ELG A;  4GF0 A;  2OBI A;  4HQZ A;  1ZGN A;  2CT6 A;  1AXD A;  4O5R A;  3DYR A;  2OT3 A;  2H0I A;  2CAQ A;  4LA1 A;  1XWB A;  2JL4 A;  3FHK A;  2VL2 A;  5ECH B;  5D93 A;  1AAZ A;  4EF0 A;  2CQ9 A;  5HR2 A;  3TKS C;  3BCK A;  2V2G A;  2LV3 A;  2FWG A;  5F05 A;  1S3D A;  2GZZ A;  5EY6 A;  1ERU A;  5J9B A;  5A5H A;  1FHE A;  3H4K A;  4JED A;  3ED3 A;  5CRD A;  3CSH A;  4E8H A;  4XS4 A;  3VK9 A;  4DEJ A;  1K0C A;  4TXO B;  2IPA A;  4ZBA A;  2KOK A;  3U5R E;  2OA7 A;  2CX4 A;  17GS A;  3FR3 A;  5ELA A;  2LJA A;  4I2U A;  4AKH A;  3AY8 A;  3GUS A;  2GST A;  2P5R A;  4IKH A;  3UMA A;  4MJE A;  1T1V A;  4WEY A;  5FHI A;  1Z6M A;  3QAW A;  4TOP A;  3IE3 A;  3A5W A;  5G31 A;  4F2I A;  2DJ3 A;  2WVZ A;  1XFL A;  2XBI A;  5GSS A;  4LMV A;  2H8L A;  4GXZ A;  4LLR A;  5GAN D;  5IOX A;  4ID0 A;  4ZB7 A;  2LRN A;  4G19 A;  2JSZ A;  1ERW A;  2X8H A;  1J9B A;  1S3A A;  1AQV A;  2GZP A;  2VL9 A;  1SD8 A;  4GSS A;  4EL1 A;  3TJF A;  4MP4 A;  1PMT A;  4POB A;  1XOB A;  1A8Y A;  2H1L A;  2EIQ A;  4CW9 A;  4WBR D;  1MEK A;  3TKS A;  1X0R A;  5G5E A;  4ZBB A;  2QGV A;  3LYP A;  5ECP B;  6GSX A;  2C1Y A;  4AF2 A;  1K3L A;  2MMN A;  3RPP A;  4KUN A;  3QMX A;  4X4J A;  1LJR A;  3IK7 A;  4MJB A;  5IMD A;  5A4W A;  5HFK A;  1ST9 A;  2YN1 A;  2VLU A;  20GS A;  4IVF A;  5LD0 A;  3GYK A;  3VPT A;  1M3I A;  4WET A;  1NHY A;  4V2M A;  3GX0 A;  1X5E A;  3DIE A;  5ECN B;  4OO4 A;  1XG8 A;  2YWM A;  4FH8 A;  5A1N A;  3QFA C;  1T3B A;  3HVN A;  1PGT A;  4X43 A;  2VCV A;  1BED A;  3S9F A;  3PH9 A;  5HFI A;  6GSS A;  1T8E B;  3DXB A;  1GTI A;  3I69 A;  2WS2 A;  1K3Y A;  1ZZY A;  4EXJ A;  2WVX A;  4KGI A;  4WR5 A;  1X5C A;  3K8N A;  3RBT A;  5CRW A;  4TVE A;  3GX8 A;  2RM5 A;  5DVB A;  2L4C A;  3M1G A;  5H5Q A;  3I9V 2;  3MSZ A;  3F4R A;  2GZY A;  4XS1 A;  2M72 A;  2R0C A;  1ZOF A;  4MLY A;  4GCI A;  3LFL A;  2CX3 A;  2X4A A;  1TDI A;  1HNA A;  4HZ2 A;  3APQ A;  3WGD A;  1UC7 A;  1OYJ A;  3PGT A;  1T4Z A;  4JZQ A;  1ERT A;  1I9D A;  2A2R A;  1GUM A;  4F9Z A;  3ZYW A;  3ZFL A;  1GRX A;  4AJ7 A;  3WGX A;  1SJI A;  3KP8 A;  1UA5 A;  4KSO A;  1H4O A;  1GTU A;  2R4V A;  4WR4 A;  3FZ5 A;  4Z2R A;  1GP1 A;  4G10 A;  5JCW A;  3EPT A;  1N8J A;  5A34 A;  2B5X A;  3RHB A;  3ZLP A;  4CY6 A;  2I1U A;  2C8U A;  2E7P A;  3VWV A;  4X0X A;  1XOA A;  1FVJ A;  5F07 A;  2YNX A;  19GS A;  5FT3 A;  3KEB A;  5DCG A;  3HD5 A;  4KX4 A;  1JLW A;  3CBU A;  5DAL A;  4E8E A;  4TN8 A;  4CY8 A;  3GNJ A;  1TRW A;  3EUR A;  1ON4 A;  3WT1 A;  1GLQ A;  1ZYE A;  4MNN A;  1K3O A;  1RQM A;  2DKI A;  3W8J A;  4GRF A;  3M9K A;  4Q5N A;  3C71 A;  5CYY A;  2ES7 A;  2QA2 A;  4W66 A;  4IP6 A;  1X9W B;  3KTB A;  1K0M A;  2H1D A;  4BL7 A;  4ICY A;  13GS A;  1YZX A;  5IMZ A;  3KIJ A;  1PN9 A;  3ZIT A;  1SJ6 A;  4IJI A;  2VM2 A;  1XXU A;  1OC3 A;  4HSC X;  2FHE A;  4A5P A;  4MPG A;  3F8U A;  2WDU A;  3LEF A;  4WKW A;  5KN2 A;  1J08 A;  4USS A;  4E68 A;  2QKE A;  4K1F A;  1G7E A;  22GS A;  3CTF A;  5LNK e;  3GSS A;  4BVY A;  4GQF A;  3JCM L;  3EC3 A;  3GST A;  1ZCP A;  1A0F A;  3GKK A;  4K5S A;  3VPQ A;  4IJ3 A;  5E59 A;  4EIQ A;  2H73 A;  4L5L A;  2L5L A;  4YQV A;  4I2T A;  3UVH A;  3HKR A;  1JFU A;  2PGT A;  1XZO A;  5ECR B;  3MWH A;  4PUA A;  1TRS A;  2YCD A;  3CSJ A;  1WP0 A;  1M3J A;  5DCH A;  3KM6 A;  4CHS A;  3PR8 A;  4Z7X A;  1FB6 A;  2HSN B;  1PL1 A;  4KF9 A;  2B1L A;  4ZXG A;  3V1W A;  4AI6 A;  1HNC A;  3SWL A;  1GH2 A;  2GSR A;  4HJM A;  4K5R A;  1PKZ A;  2MMA A;  4ISD A;  3GL5 A;  1V58 A;  3ZMK A;  4WF5 A;  1B4Q A;  2WUL A;  3L9S A;  3E9J B;  2L57 A;  4YQM A;  1M2D A;  3HJO A;  2WVX B;  2PBJ A;  1F9M A;  4TXO A;  3CYN A;  3IHQ A;  4D73 A;  2DJ2 A;  4WBJ A;  1EGO A;  4K7I A;  2N5F A;  1B4P A;  4EE0 A;  5G1L A;  3CSI A;  2YJ7 A;  3IK9 A;  2V1M A;  2WB9 A;  5HR0 A;  11GS A;  2CVB A;  2DLX A;  4J2F A;  2RII A;  1V9W A;  5C00 A;  5ECK B;  1F6M C;  1TU8 A;  3NOF A;  1QQ2 A;  1A8L A;  3FZ4 A;  3P7X A;  1HD2 A;  1TK5 B;  1WRY A;  1JLV A;  3LW9 A;  2V6K A;  4POK A;  3IR4 A;  1K0N A;  4ZBD A;  2HQT A;  2DIZ A;  3TJJ A;  1U3I A;  3IRA A;  4TR4 A;  1B9X C;  5JWQ B;  2UV8 G;  3ERW A;  4BWQ A;  2A2S A;  3NZN A;  4MF7 A;  2OAD A;  3A2V A;  1SU9 A;  3GMF A;  2G0F A;  3HVV A;  1URM A;  4QMK A;  3QD9 A;  5KOX A;  1JZO A;  3RPN A;  5D73 A;  1XVQ A;  5IPH A;  4ECI A;  1A23 A;  4J57 E;  5AIV A;  4L0U A;  1BJX A;  4MH2 A;  4N3Z A;  4JR4 A;  2OE3 A;  1ZL9 A;  1ZYP A;  1Z3E A;  4POM A;  1GSY A;  5HFG A;  4BL7 B;  2AJQ B;  2L6D A;  3QOU A;  4FYU A;  4HU7 A;  2FY6 A;  2WVY A;  1B8X A;  4TR3 A;  4G9H A;  1JZR A;  1OE7 A;  2PMT A;  5CO3 A;  3VI5 A;  1TI1 A;  3F0I A;  1SK0 A;  2DC5 A;  3ZVJ D;  1IYH A;  5DJM A;  5IMV A;  1TRU A;  2JZR A;  3ZL5 A;  3BD2 A;  3TRQ A;  1VGL A;  2CAI A;  2HT9 A;  4QL7 A;  3GUR A;  2LJK A;  3RGB C;  2O3E A;  3D4T A;  2RUF A;  4J56 E;  1I5G A;  3EMP A;  1R7H A;  5A4U A;  1ERV A;  1M9A A;  5IO2 A;  1JZW A;  2ZUP A;  5KN0 A;  3UBL A;  1Q98 A;  2AV4 A;  4TRX A;  2MZC A;  4IEL A;  3ME8 A;  1NSW A;  1QFN A;  2R37 A;  2WW2 A;  5IMF A;  2GT5 A;  1XIY A;  3LG6 A;  1FO5 A;  1EV9 A;  1GSU A;  1EOG A;  1F37 A;  1THX A;  1M0U A;  4K7N A;  3UAR A;  2VCQ A;  3HDC A;  2R2J A;  1AUC A;  2EFD A;  2VAF A;  2V32 A;  3GKX A; 
#chains in the Genus database with same CATH homology
 3GKM A;  1BX9 A;  5COH A;  5J40 A;  1FOH A;  2F51 A;  4FYB A;  2A2P A;  5EVO A;  3FYG A;  2LST A;  3UAP A;  1Y6E A;  3KMN A;  4MMM A;  2A4V A;  5G30 A;  6GSU A;  5D8I A;  1WPI A;  1TK0 B;  1NHO A;  2VIM A;  5DQY A;  4D73 B;  5AGY A;  2OAC A;  4IHU A;  5D96 A;  1EOH A;  4MCU A;  4N0V A;  3IC4 A;  3VWU A;  3EU3 A;  1DBY A;  5ID2 A;  2B1K A;  3KCM A;  4QQ7 A;  5A5K A;  2AHE A;  1EP7 A;  1O73 A;  1NM3 A;  1FOV A;  2H1A A;  3TKS E;  2OE0 A;  1ZYN A;  2DJK A;  4LMW A;  2IN3 A;  3W6G A;  3FEU A;  1E6B A;  2YWI A;  1DUG A;  5JWR B;  2HI7 A;  1QMV A;  4G0I A;  2RUE A;  3H79 A;  2O7K A;  3HVS A;  4OCE A;  3IA1 A;  4MF5 A;  2YAN A;  4F0C A;  3BOA A;  5JWO B;  1TI3 A;  4PX1 A;  3KJY A;  1XWA A;  5ECI B;  14GS A;  4YKF A;  2EIO A;  1ML6 A;  6GSW A;  3QPM A;  2YPM A;  2KP1 A;  5B6M A;  2H70 A;  4L8E A;  1SVO A;  4AKI A;  3H93 A;  16GS A;  1SK2 A;  1GLP A;  3FZA A;  3LWA A;  1GUL A;  3MDK A;  3US3 A;  2A4H A;  1U88 A;  3UL3 A;  5KN3 A;  2DIY A;  3EMX A;  1FW1 A;  1E2Y A;  3A2X A;  2GT6 A;  2PVQ A;  3D0Z A;  4I97 A;  1Z9H A;  1QXH A;  2WCI A;  3CTG A;  4PQ1 A;  4DVC A;  5GAP D;  3NIV A;  3ERG A;  2DJ1 A;  2H1B A;  2WFC A;  3ZZX A;  1CQH A;  5IIZ A;  2EFH A;  1B48 A;  3IV4 A;  1GTA A;  2HSN A;  4K8M A;  4OWY A;  4G0K A;  1ABA A;  3E3E A;  2FD3 A;  1TKD B;  2DML A;  1LU4 A;  1R5A A;  1LBK A;  2H1G A;  4NXI A;  4K2D A;  3TKQ A;  2N5B A;  1J0F A;  2C0G A;  4IBP A;  2VCW A;  2XC2 A;  4LL4 B;  1DE2 A;  2H0G A;  1SL1 B;  4EC0 A;  5GST A;  1GUK A;  2P31 A;  3FR9 A;  3HJM A;  1NW2 A;  2H01 A;  3TDG A;  3CMI A;  5CRG A;  2PWJ A;  2YOI A;  4MZC A;  4HQS A;  3PPU A;  2OBK A;  5ECS A;  3TOU A;  2L59 A;  1YY7 A;  4BA7 A;  4O32 A;  3D6I A;  4XRD A;  2C0E A;  5ABR A;  1A2M A;  4NPB A;  1KNG A;  1GNE A;  4KDY A;  4H86 A;  1DE1 A;  2DBC A;  2GS3 A;  1M9B A;  1M99 A;  3HZ4 A;  5H5R A;  4HEA 2;  5IPG A;  5CRH A;  5C04 A;  2XHF A;  4MJA A;  2TRX A;  3GH6 A;  1AW9 A;  2NPB A;  1U6T A;  1G7O A;  1BYE A;  3A5I A;  4NWY A;  3UOM A;  3ZTL A;  3APS A;  5ECQ B;  3WGE A;  5D9W A;  4KH7 A;  1ZMA A;  1UN2 A;  2K8V A;  4HS1 A;  5F8B A;  1Z5Y E;  2C3T A;  1XBS A;  4MDC A;  4HOJ A;  3DGQ A;  5ID2 B;  4DSQ A;  1FG4 A;  4F03 A;  1T7P B;  3F6F A;  4XHM A;  1PRX A;  3KGK A;  3GKN A;  3J7Y b;  3KP9 A;  2M46 A;  2VCT A;  5A4V A;  5GZZ B;  1FVK A;  2HYX A;  2HRK B;  4F82 A;  3F4S A;  3GTU B;  1RK4 A;  4V2L A;  4KND A;  4JRR A;  3D4M A;  2P5Q A;  1VRS D;  2AB6 A;  1YEX A;  3L0H A;  1O81 A;  1OAZ A;  1TK8 B;  3TJK A;  2ZCT A;  1PX7 A;  2QC7 A;  3A2W A;  3RHC A;  4EIP A;  3QAG A;  2LKU A;  2O89 A;  2HE3 A;  5DJL A;  3N5O A;  3LXZ A;  2KUC A;  3E0U A;  2MBT A;  1SD9 A;  5INY A;  4G0L A;  2UZ8 A;  3DRN A;  1AQW A;  2B7J A;  1Y1U A;  3D22 A;  3QFB C;  1MDK A;  3HY2 A;  2GQM A;  3I43 A;  4N30 A;  2IIY A;  3CRT A;  3F63 A;  3P90 A;  4KA0 A;  3CWG A;  1PA3 A;  5G5F A;  5ECM B;  2VKZ G;  2H66 A;  1PSQ A;  4GLT A;  9GSS A;  1O6J A;  4MJC A;  1A0R P;  4KW6 A;  2LEG A;  2VO4 A;  1A2J A;  1QK8 A;  4ECJ A;  1O85 A;  1K0A A;  4IS0 A;  3HCZ A;  3WT2 A;  1V57 A;  3KZQ A;  2JU5 A;  3IOS A;  4MH3 A;  4ZL8 A;  3TJG A;  4L5O A;  5D9X A;  2H6X A;  5J4V A;  2N5A A;  3RDW A;  3G7I A;  4Q5Q A;  5ECL B;  2K9F A;  4NHW A;  8GSS A;  4ACS A;  1UVZ A;  2NBS A;  4Z2U A;  4I6X A;  3LGC A;  4ZB9 A;  3H1N A;  4KAE A;  1EZK A;  3MNG A;  4YKG A;  4IGJ A;  1X9S B;  2R0P A;  4ML1 A;  2FUG 2;  4PGT A;  3SBC A;  3F6D A;  1XWG A;  2LRC A;  4JU5 A;  4FYC A;  4LL1 B;  4CDO A;  2WJU A;  2FWE A;  2I9H A;  3C7M A;  6GSV A;  4KE3 A;  1F3A A;  3OR5 A;  2FWF A;  4ZL7 A;  3EWL A;  4ZB8 A;  4RQR A;  3FRC A;  3BCI A;  5IOW A;  2H6Y A;  3APO A;  2E0Q A;  1OE8 A;  1MD4 A;  2ON7 A;  2O5V A;  2HRF A;  1K0D A;  1Q4J A;  2JZT A;  2VLV A;  1XW5 A;  2HNL A;  2IMD A;  2E2G A;  6GSY A;  3FW2 A;  4EDZ A;  5ECO B;  1S3C A;  5AIS A;  1OKT A;  1SK1 A;  2XPD A;  4N0Z A;  1JZD A;  2NTO A;  3VLN A;  3IAM 2;  3IXR A;  4AJ6 A;  1Z7P A;  3GN3 A;  4ECB A;  4RUV A;  1SYX A;  3GHA A;  2YZH A;  3IPZ A;  4ML6 A;  5FWG A;  2HLS A;  1XCC A;  1TTZ A;  2B5Y A;  1XVW A;  2PPT A;  10GS A;  2IFQ A;  3TUE A;  5F0G A;  2GGT A;  3EVI A;  4MF6 A;  1V98 A;  2C4J A;  4NHZ A;  3HYP A;  2ON5 A;  1EV4 A;  3KD0 A;  3C1S A;  2AUV A;  2H19 A;  4KDU A;  4PXO A;  1GSD A;  1SYR A;  4JBB A;  3Q6O A;  2REM A;  5DDL A;  4MAB A;  3TGZ A;  4HDE A;  1WWJ A;  5IO0 A;  1YDK A;  5AN1 A;  2DJJ A;  4HI7 A;  3DEX A;  1SVM A;  4PQI A;  2P0G A;  3IHG A;  3O3T A;  2FNO A;  2WZ9 A;  3UEM A;  2WRT A;  2BJX A;  3EE2 A;  3ZVJ A;  2E2M A;  3VWX A;  1HYU A;  2LJR A;  5J4Y A;  3LSZ A;  4IQA A;  4AJ8 A;  2H76 A;  2CA8 A;  4K2X A;  1USB A;  1YQ1 A;  5IMC A;  3Q18 A;  4YAV A;  2C3Q A;  1OVN A;  1QGV A;  2K18 A;  3MYD A;  4BPY A;  1GSE A;  3ZIV A;  1AQX A;  2MMZ A;  2PER A;  3FR6 A;  4GSN A;  4TXV A;  1SKR B;  4Q5F A;  4AKX B;  2HZE A;  3EIN A;  5E4W A;  5J47 A;  2F3M A;  5HR3 A;  3HVX A;  2B3S A;  1M7T A;  5DBQ A;  3L9V A;  3GH9 A;  3FK8 A;  5AIX A;  2JAD A;  3GA4 A;  2QSI A;  1B9Y C;  2HSM A;  4XS6 A;  1TXX A;  3KH9 A;  3M8N A;  4EDY A;  3HJP A;  1SL0 B;  3R3E A;  4HZ4 A;  4OO5 A;  1XW6 A;  1R26 A;  2K8S A;  2LRT A;  2BMX A;  2DJ0 A;  1O8X A;  1VF4 A;  1F3B A;  1YKC A;  4EVM A;  1TXU A;  4TR0 A;  1GSS A;  4MZW A;  3F9U A;  3TKP A;  1BAY A;  4TR1 A;  1EP8 A;  4X1U A;  4HJ2 A;  2HRK A;  1N25 A;  4PUR A;  5D9T A;  3GTU A;  4OCF A;  1OC9 A;  3WYW A;  2HFD A;  3ME7 A;  3UJ1 A;  1U3A A;  1SKS B;  1GSF A;  5IQY A;  5IM9 A;  4Z2T A;  3DVW A;  3VFI A;  1YF0 A;  1M2A A;  1PL2 A;  2LNS A;  3ZIJ A;  4I5Q A;  1G0T A;  4KDX A;  4GQC A;  1X9M B;  2CZ2 A;  1SJZ A;  3UIW A;  2FWH A;  4EKZ A;  2GVP A;  1K0B A;  4FIW A;  1JHB A;  1QUW A;  1GUH A;  4K6X A;  2H75 A;  3W8S A;  3M0F A;  5B7C A;  2L5O A;  2M80 A;  2H0H A;  3ZFB A;  1PX6 A;  3ZRE A;  2C80 A;  4N10 A;  2R6K A;  4O5Q A;  2VOC A;  4MK3 A;  2OJL A;  2HXK A;  3F3R A;  3GFK A;  7GSS A;  4V2N A;  5KOW A;  2GQL A;  3O6T A;  1TRV A;  4K7O A;  5DQS A;  2JSY A;  2CV4 A;  2VM1 A;  4PNF A;  1RW1 A;  4RI7 A;  1TP9 A;  3LXT A;  2IFQ B;  4OMV A;  4PTS A;  4KCE A;  2G2Q A;  4ZB6 A;  5IMA A;  2ALB A;  3F4T A;  1WE0 A;  1V2A A;  4F0B A;  5F06 A;  3Q74 A;  4GWR A;  1GWC A;  1MTC A;  3EYT A;  1N2A A;  4FO5 A;  2MYG A;  3QDN A;  1A2L A;  3DML A;  2DKH A;  2EC4 A;  2CVK A;  4OFN A;  2PN8 A;  3CRU A;  3DWV A;  5J9C A;  1R4W A;  1X5D A;  2K6V A;  2H6Z A;  1PQN A;  4BVX A;  4HU9 A;  2XPE A;  5CRE A;  3M3M A;  2PVO C;  5DAK B;  3F3Q A;  3TB2 A;  3QCP A;  2I3Y A;  1YVL A;  2WGR A;  5CAX A;  4ZIJ A;  2V6O A;  2EFE A;  2GSQ A;  2HRA A;  2KLX A;  1GTB A;  3KTL A;  5EL8 A;  3R2Q A;  5BRT A;  4TKY A;  2X99 A;  2F8A A;  2DMM A;  1Z7R A;  4OFT A;  3VI7 A;  2C0D A;  2GLR A;  2FA4 A;  5BMU B;  5JCG A;  3FKF A;  4DSS B;  4O7H A;  1ILO A;  1SEN A;  4OD7 A;  2FLS A;  2KP2 A;  2O87 A;  2X8G A;  2HZE B;  2B5E A;  2PUK C;  3PIN A;  2DSA A;  2I4A A;  3ZRD A;  4MA9 A;  1GSQ A;  3UBK A;  2H72 A;  1KEB A;  2MMO A;  2R3X A;  4K0N A;  2IL3 A;  5LCZ A;  5J3R A;  2HSM B;  2V41 A;  4NAX A;  2X8C A;  2EFC A;  1FB0 A;  3D21 A;  5KN1 A;  2RLI A;  5A5H B;  1O8W A;  4ECC A;  5G2Z A;  1H75 A;  1GNW A;  2GDR A;  1BG1 A;  3UVT A;  4PNG A;  2B6M A;  4WF4 A;  4XS4 B;  2XBQ A;  1WJK A;  3QAV A;  4RQX A;  1F2E A;  1KBN A;  4YAP A;  6GST A;  1WMJ A;  3QR6 A;  4HUA A;  4PUF C;  4TR1 B;  1G6W A;  2X49 A;  2J23 A;  3U6V A;  1W4V A;  2NVL A;  2VL3 A;  4NV5 A;  3G7J A;  3MAK A;  1EEM A;  4NMU A;  2YV9 A;  3EU4 A;  1PN0 A;  2C3N A;  1OC9 B;  1R5P A;  1VF2 A;  4ULX A;  2LUS A;  1VF1 A;  4DSR A;  3HMJ G;  2MBS A;  2F8F A;  3TOT A;  1EWX A;  5HQP A;  2RM6 A;  2VD0 A;  3TKR A;  4EUY A;  3D5J A;  1MDI A;  5D9V A;  4POL A;  4EO3 A;  4GTU A;  2GTU A;  2JAC A;  2YWN A;  3DD3 A;  1YJ6 A;  2X64 A;  3TRP A;  4XCS A;  4XIH A;  4KCA A;  4PQH A;  2O8V B;  1XW9 A;  4WXT A;  1HNB A;  4RI6 A;  5JCU A;  4BWS A;  1SKW B;  3FMW A;  5B8A A;  2YJH A;  4Q5R A;  2R5G A;  2H30 A;  3A3T A;  3HXS A;  2O85 A;  2YV7 A;  4JE1 A;  3TRX A;  3HA9 A;  1YF1 A;  4K9Z A;  2HSH A;  3Q19 A;  2J9H A;  3TU3 B;  3LOR A;  3P2A A;  3GIX A;  3WD6 A;  3CXG A;  4ZL9 A;  3IDV A;  2LQQ A;  1SVL A;  1AC1 A;  2FA8 A;  2F9S A;  1YKA A;  1U87 A;  1GL8 A;  4OFM A;  3KMO A;  3FZ9 A;  1IYI A;  2LTK A;  3IAS 2;  4KB3 A;  4JR6 A;  2HZF A;  2LNT A;  4GST A;  4BVX B;  1ACV A;  5L71 A;  2FCH A;  3L78 A;  4TW5 A;  2LS5 A;  2TIR A;  1PKW A;  1MDJ A;  1KTE A;  5A1N B;  4GDF A;  3RAZ A;  3KXO A;  4MZB A;  1WOU A;  4MPF A;  2QA1 A;  2OKA A;  2VCX A;  3LQ7 A;  2JZS A;  1BG5 A;  3L4N A;  2KHP A;  3C1R A;  3ISO A;  5HR1 A;  1WIK A;  1EGR A;  3GV1 A;  3FY7 A;  1V40 A;  1AIU A;  1OKD A;  4ZIL A;  5H5S A;  2YZU A;  3DKS A;  2AAW A;  4V1A g;  4P3Y B;  1O7U A;  2Z9S A;  2TRC P;  2VCZ A;  2YP6 A;  1M2B A;  4XRA A;  2VLT A;  1Z6N A;  1YEP A;  1W89 A;  2PU9 C;  3ZML A;  4IW9 A;  1HQO A;  3TJB A;  1THO A;  2FGX A;  4YH2 A;  4I8B A;  1PD2 1;  3IBH A;  3LYK A;  1XWK A;  2NDO A;  2BTO T;  3M9J A;  3BJ5 A;  2L4Q A;  2IJY A;  2GQK A;  3TCO A;  4YQU A;  2CVD A;  3IC8 A;  2I81 A;  1K0O A;  1DSB A;  3MIX A;  2VD1 A;  1XPV A;  2R0G A;  4G2E A;  1EEJ A;  2H71 A;  3VUR A;  1BQ7 A;  1A24 A;  2CZ3 A;  4K0G A;  3I6A A;  1Y25 A;  3H8Q A;  4G01 A;  3HHV A;  3BBY A;  12GS A;  4IQ1 A;  3O76 A;  5A34 B;  1SL2 B;  3DVX A;  4IN0 A;  2H74 A;  2IMF A;  3G9B A;  3KH7 A;  4N11 A;  2L6C A;  5J5N A;  4ILF A;  1ZYQ B;  5ENU A;  5DAL B;  3J7Y k;  1CQG A;  3G7Y A;  1XWC A;  5B8B A;  4XTS A;  5G1K A;  2AYT A;  1TOF A;  1VF3 A;  2HRN A;  1FAA A;  3GRX A;  2VL2 C;  1G6Y A;  4NV2 A;  1OC8 A;  4AKG A;  3C8E A;  1TU7 A;  2HSY A;  4FQU A;  2IME A;  1T4Y A;  1TJD A;  4V1A p;  2D2Z A;  3C73 A;  2YWO A;  4KSM A;  3N9J A;  2IMI A;  3VWW A;  2GSS A;  2EIR A;  5CNW A;  5DAK A;  1T00 A;  2C0F A;  2LQO A;  4O5U A;  1TW9 A;  5KEJ A;  2VUP A;  18GS A;  5EPF A;  3HZ8 A;  3ERF A;  5CP1 A;  5B6N A;  5J41 A;  3LJR A;  4BVY B;  1MD3 A;  2B7K A;  2OE1 A;  4QL9 A;  4AGS A;  3GL3 A;  2V32 A;  1C72 A;  5BMU A;  5J4U A;  2ZNM A;  4L0W A;  4DSS A;  4IP1 A;  4O92 A;  3P8W A;  2IMK A;  2IWT A;  1BF5 A;  5ELG A;  4GF0 A;  2OBI A;  4HQZ A;  1ZGN A;  2CT6 A;  1AXD A;  4O5R A;  3DYR A;  2OT3 A;  2H0I A;  2CAQ A;  4LA1 A;  1XWB A;  2JL4 A;  3FHK A;  2VL2 A;  5ECH B;  5D93 A;  1AAZ A;  4EF0 A;  2CQ9 A;  5HR2 A;  3TKS C;  3BCK A;  2V2G A;  2LV3 A;  2FWG A;  5F05 A;  1S3D A;  2GZZ A;  5EY6 A;  1ERU A;  5J9B A;  5A5H A;  1FHE A;  3H4K A;  4JED A;  3ED3 A;  5CRD A;  3CSH A;  4E8H A;  4XS4 A;  3VK9 A;  4DEJ A;  1K0C A;  4TXO B;  2IPA A;  4ZBA A;  2KOK A;  3U5R E;  2OA7 A;  2CX4 A;  17GS A;  3FR3 A;  5ELA A;  2LJA A;  4I2U A;  4AKH A;  3AY8 A;  3GUS A;  2GST A;  2P5R A;  4IKH A;  3UMA A;  4MJE A;  1T1V A;  4WEY A;  5FHI A;  1Z6M A;  3QAW A;  4TOP A;  3IE3 A;  3A5W A;  5G31 A;  4F2I A;  2DJ3 A;  1XFL A;  2XBI A;  5GSS A;  4LMV A;  2H8L A;  4GXZ A;  4LLR A;  5GAN D;  5IOX A;  4ID0 A;  4ZB7 A;  2LRN A;  4G19 A;  2JSZ A;  1ERW A;  2X8H A;  1J9B A;  1S3A A;  1AQV A;  2GZP A;  2VL9 A;  1SD8 A;  4GSS A;  4EL1 A;  3TJF A;  4MP4 A;  1PMT A;  4POB A;  1XOB A;  1A8Y A;  2H1L A;  2EIQ A;  4CW9 A;  4WBR D;  1MEK A;  3TKS A;  1X0R A;  5G5E A;  4ZBB A;  2QGV A;  3LYP A;  5ECP B;  6GSX A;  2C1Y A;  4AF2 A;  1K3L A;  2MMN A;  3RPP A;  4KUN A;  3QMX A;  4X4J A;  1LJR A;  3IK7 A;  4MJB A;  5IMD A;  5A4W A;  5HFK A;  1ST9 A;  2YN1 A;  2VLU A;  20GS A;  4IVF A;  5LD0 A;  3GYK A;  3VPT A;  4WET A;  1NHY A;  4V2M A;  3GX0 A;  1X5E A;  3DIE A;  5ECN B;  4OO4 A;  2YWM A;  4FH8 A;  5A1N A;  3QFA C;  1T3B A;  1PGT A;  4X43 A;  2VCV A;  1BED A;  3S9F A;  3PH9 A;  5HFI A;  6GSS A;  1T8E B;  3DXB A;  1GTI A;  3I69 A;  2WS2 A;  1K3Y A;  1ZZY A;  4EXJ A;  4KGI A;  4WR5 A;  1X5C A;  3K8N A;  3RBT A;  5CRW A;  4TVE A;  3GX8 A;  2RM5 A;  5DVB A;  2L4C A;  3M1G A;  5H5Q A;  3I9V 2;  3MSZ A;  3F4R A;  2GZY A;  4XS1 A;  2M72 A;  2R0C A;  1ZOF A;  4MLY A;  4GCI A;  3LFL A;  2CX3 A;  2X4A A;  1TDI A;  1HNA A;  4HZ2 A;  3APQ A;  3WGD A;  1UC7 A;  1OYJ A;  3PGT A;  1T4Z A;  4JZQ A;  1ERT A;  1I9D A;  2A2R A;  1GUM A;  4F9Z A;  3ZYW A;  3ZFL A;  1GRX A;  4AJ7 A;  3WGX A;  1SJI A;  3KP8 A;  1UA5 A;  4KSO A;  1H4O A;  1GTU A;  2R4V A;  4WR4 A;  3FZ5 A;  4Z2R A;  1GP1 A;  4G10 A;  5JCW A;  3EPT A;  1N8J A;  5A34 A;  2B5X A;  3RHB A;  3ZLP A;  4CY6 A;  2I1U A;  2C8U A;  2E7P A;  3VWV A;  4X0X A;  1XOA A;  1FVJ A;  5F07 A;  2YNX A;  19GS A;  5FT3 A;  3KEB A;  5DCG A;  3HD5 A;  4KX4 A;  1JLW A;  3CBU A;  5DAL A;  4E8E A;  4TN8 A;  4CY8 A;  3GNJ A;  1TRW A;  3EUR A;  1ON4 A;  3WT1 A;  1GLQ A;  1ZYE A;  4MNN A;  1K3O A;  1RQM A;  2DKI A;  3W8J A;  4GRF A;  3M9K A;  4Q5N A;  3C71 A;  5CYY A;  2ES7 A;  2QA2 A;  4W66 A;  4IP6 A;  1X9W B;  3KTB A;  1K0M A;  2H1D A;  4BL7 A;  4ICY A;  13GS A;  1YZX A;  5IMZ A;  3KIJ A;  1PN9 A;  3ZIT A;  1SJ6 A;  4IJI A;  2VM2 A;  1XXU A;  1OC3 A;  2FHE A;  4A5P A;  4MPG A;  3F8U A;  2WDU A;  3LEF A;  4WKW A;  5KN2 A;  1J08 A;  4USS A;  4E68 A;  2QKE A;  4K1F A;  1G7E A;  22GS A;  3CTF A;  5LNK e;  3GSS A;  4BVY A;  4GQF A;  3JCM L;  3EC3 A;  3GST A;  1ZCP A;  1A0F A;  3GKK A;  4K5S A;  3VPQ A;  4IJ3 A;  5E59 A;  4EIQ A;  2H73 A;  4L5L A;  2L5L A;  4YQV A;  4I2T A;  3UVH A;  3HKR A;  1JFU A;  2PGT A;  1XZO A;  5ECR B;  3MWH A;  4PUA A;  1TRS A;  2YCD A;  3CSJ A;  1WP0 A;  5DCH A;  3KM6 A;  4CHS A;  3PR8 A;  4Z7X A;  1FB6 A;  2HSN B;  1PL1 A;  4KF9 A;  2B1L A;  4ZXG A;  3V1W A;  4AI6 A;  1HNC A;  3SWL A;  1GH2 A;  2GSR A;  4HJM A;  4K5R A;  1PKZ A;  2MMA A;  4ISD A;  3GL5 A;  1V58 A;  3ZMK A;  4WF5 A;  1B4Q A;  2WUL A;  3L9S A;  3E9J B;  2L57 A;  4YQM A;  1M2D A;  3HJO A;  2PBJ A;  1F9M A;  4TXO A;  3CYN A;  3IHQ A;  4D73 A;  2DJ2 A;  4WBJ A;  1EGO A;  4K7I A;  2N5F A;  1B4P A;  4EE0 A;  5G1L A;  3CSI A;  2YJ7 A;  3IK9 A;  2V1M A;  2WB9 A;  5HR0 A;  11GS A;  2CVB A;  2DLX A;  4J2F A;  2RII A;  1V9W A;  5C00 A;  5ECK B;  1F6M C;  1TU8 A;  3NOF A;  1QQ2 A;  1A8L A;  3FZ4 A;  3P7X A;  1HD2 A;  1TK5 B;  1WRY A;  1JLV A;  3LW9 A;  2V6K A;  4POK A;  3IR4 A;  1K0N A;  4ZBD A;  2HQT A;  2DIZ A;  3TJJ A;  1U3I A;  3IRA A;  4TR4 A;  1B9X C;  5JWQ B;  2UV8 G;  3ERW A;  4BWQ A;  2A2S A;  3NZN A;  4MF7 A;  2OAD A;  3A2V A;  1SU9 A;  3GMF A;  2G0F A;  3HVV A;  1URM A;  4QMK A;  3QD9 A;  5KOX A;  1JZO A;  3RPN A;  5D73 A;  1XVQ A;  5IPH A;  4ECI A;  1A23 A;  4J57 E;  5AIV A;  4L0U A;  1BJX A;  4MH2 A;  4N3Z A;  4JR4 A;  2OE3 A;  1ZL9 A;  1ZYP A;  1Z3E A;  4POM A;  1GSY A;  5HFG A;  4BL7 B;  2AJQ B;  2L6D A;  3QOU A;  4FYU A;  4HU7 A;  2FY6 A;  1B8X A;  4TR3 A;  4G9H A;  1JZR A;  1OE7 A;  2PMT A;  5CO3 A;  3VI5 A;  1TI1 A;  3F0I A;  1SK0 A;  2DC5 A;  3ZVJ D;  1IYH A;  5DJM A;  5IMV A;  1TRU A;  2JZR A;  3ZL5 A;  3BD2 A;  3TRQ A;  1VGL A;  2CAI A;  2HT9 A;  4QL7 A;  3GUR A;  2LJK A;  3D4T A;  2RUF A;  4J56 E;  1I5G A;  3EMP A;  1R7H A;  5A4U A;  1ERV A;  1M9A A;  5IO2 A;  1JZW A;  2ZUP A;  5KN0 A;  3UBL A;  1Q98 A;  2AV4 A;  4TRX A;  2MZC A;  4IEL A;  3ME8 A;  1NSW A;  1QFN A;  2R37 A;  5IMF A;  2GT5 A;  1XIY A;  3LG6 A;  1FO5 A;  1EV9 A;  1GSU A;  1EOG A;  1F37 A;  1THX A;  1M0U A;  4K7N A;  3UAR A;  2VCQ A;  3HDC A;  2R2J A;  1AUC A;  2EFD A;  2VAF A;  3L9U A;  3GKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...