4ISDA

Crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
187
Chain Sequence
SQKPITLYVGADYVSAFAMSAFVVLKEKGLDFEIRTVDLKSKQQEVSLTRRVPTLQHDRFTLSESSAIAEYLDEVYPAPHYAAVLPADRETRALARQLQAWIRSDFMPLGEAAQLACEKLLSAADRLIDDERYGVFGDWCIADTDFALMLNRLVACGDPVPPKVLRYVERQWARPSVQQWVKQKRDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal structure of GLUTATHIONE TRANSFERASE homolog from BURKHOLDERIA GL BGR1, TARGET EFI-501803, with bound glutathione
rcsb
source organism Burkholderia glumae
molecule tags Transferase
total genus 65
structure length 187
sequence length 211
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14834 GST_C_4 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4isdA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4isdA01
3R3EA 4Z7XA 3IC4A 1R5PA 4WBJA 4AJ7A 2HZEB 1KBNA 3C71A 3F6DA 5COHA 1ZGNA 2GZZA 1TKDB 1SKRB 3HY2A 2VCWA 4CW9A 1JZRA 2DMLA 2DLXA 5DCHA 5KN2A 4XRDA 1GSYA 2WS2A 1A8LA 4XS4B 6GSWA 4DSSA 1SL2B 4GSSA 1RQMA 2HSNB 18GSA 4KGIA 3QPMA 3DXBA 5JCUA 3IR4A 1ZOFA 4I6XA 3L4NA 1T00A 2XPEA 5EPFA 3FZAA 5DALB 4OFNA 5CNWA 5CRGA 3HKRA 2GZPA 1M9AA 5IMCA 2F3MA 1W89A 3GN3A 4G9HA 3UL3A 1AUCA 4POMA 5KN0A 4JEDA 3ZFLA 3WGEA 2K9FA 4K7NA 2H6ZA 2X8GA 3DRNA 2P0GA 1FO5A 1W4VA 2EIOA 4FYUA 1U6TA 4QL7A 5G30A 1EZKA 3GURA 1TRVA 5CAXA 3E9JB 4O7HA 3C1RA 1XXUA 3ISOA 4IP6A 3W6GA 2TIRA 1K0DA 4EL1A 4RQRA 2UZ8A 4JZQA 1I9DA 3GH9A 2BMXA 5C00A 2GQKA 2A2RA 1V98A 4L0WA 1E6BA 3FR9A 5H5QA 2N5BA 2VL3A 4IVFA 2HRFA 3IXRA 3H8QA 4X43A 1K0NA 3IPZA 3ED3A 5F07A 2VLVA 2X99A 2A4VA 2VAFA 2PVQA 5HR3A 2QGVA 1GULA 3P7XA 4N30A 2VCXA 2IN3A 4EF0A 4IGJA 4KX4A 4FQUA 4PGTA 1OAZA 1WP0A 4Q5QA 1TK5B 1NHYA 3CSJA 4N10A 5G31A 2RM5A 4OCFA 2AJQB 1V2AA 4K6XA 3IRAA 1XW5A 2O87A 4EXJA 4BWQA 5A5KA 4NV2A 4PURA 3VFIA 4F82A 3ZREA 1V58A 1TXXA 2GT6A 4KNDA 1LJRA 3IK7A 4XTSA 2JZSA 4DSSB 5B8BA 2OACA 1FVJA 1GSEA 4USSA 4KCAA 5ECIB 1V57A 3LG6A 1T3BA 4ML1A 3UVTA 2H66A 2VCTA 5HR1A 2CAQA 5G5FA 1PSQA 1QQ2A 5IPHA 4NV5A 2I1UA 9GSSA 1IYHA 2H1AA 4HQZA 3QD9A 1AQVA 4G2EA 1Y6EA 2GDRA 5CRDA 1O73A 4IQAA 3US3A 3L9UA 5L71A 3EMPA 2CZ3A 2NBSA 3WYWA 2HSHA 1USBA 2O85A 2IMEA 3HVSA 4V2LA 4WEYA 1H75A 2B7KA 5F05A 2O8VB 3VWUA 2BTOT 3ZLPA 1N8JA 2B5YA 5IMZA 3ERFA 1XFLA 3A2WA 4WXTA 5IO2A 4WETA 6GSSA 3D6IA 3V1WA 3J7Yk 5J9CA 4G0IA 3DKSA 1WIKA 2VIMA 1BAYA 2KLXA 5G5EA 4PQHA 1ACVA 2H6XA 1EEMA 1GRXA 1IYIA 1K3OA 1AQWA 5ABRA 1XWKA 3KMOA 4E8HA 4AJ6A 5IOWA 2H72A 3GL3A 3NIVA 3P90A 1EV4A 3FRCA 3CYNA 4RI6A 2P5RA 2C3TA 3FK8A 3HYPA 2GSQA 2V6KA 3C7MA 4TXOB 4HU9A 3WT1A 2HSMA 4ZB9A 1MDIA 4K2DA 2DJKA 1SL1B 3W8JA 5A4VA 2LUSA 4LL4B 3LXZA 1URMA 1Y25A 5F8BA 1H4OA 3TJJA 3H79A 3F63A 3DWVA 3TJKA 3TDGA 1EP7A 1TK8B 1T4ZA 3O76A 1X9SB 1B48A 4FYBA 4TR3A 1XOBA 1OKDA 4ECCA 2D2ZA 1ZL9A 1O6JA 4JBBA 2WULA 3HJOA 4EVMA 3U5RE 3HJPA 2RLIA 1DE2A 1OKTA 1ERUA 1TU8A 2PU9C 2VD1A 1A8YA 3HZ8A 3O3TA 1SL0B 2ES7A 2CVDA 4JRRA 5D9VA 4GXZA 3TUEA 3L9SA 2R3XA 3TOTA 3GFKA 3C8EA 1SKSB 4Q5RA 5DJLA 5DCGA 3NZNA 3GKMA 4J2FA 3IHQA 4NWYA 3VLNA 1GSDA 1XVQA 1BYEA 2E2GA 2GSRA 1XBSA 3ZIJA 1WOUA 1R7HA 2YWNA 2H1GA 4KDYA 2V2GA 4MZBA 4DEJA 2L57A 1Z5YE 1A0FA 4IBPA 3RHCA 4EDYA 3GIXA 2P31A 1KEBA 1PRXA 5J41A 4YQMA 4PQ1A 4EE0A 3RDWA 1PA3A 4BVYB 4LLRA 4D73B 4L8EA 5FHIA 4KH7A 3BJ5A 4QL9A 2IPAA 3HXSA 1EOGA 2X8HA 2YN1A 3TKPA 2X8CA 3ZZXA 2FWGA 2I3YA 4L0UA 1M2DA 1YEXA 3RBTA 2HSMB 5A4WA 2CX3A 1GTBA 1OC3A 1WWJA 2C3NA 1X5CA 2JZTA 3IAS2 4WF5A 4HOJA 5DALA 2C8UA 4FO5A 2JADA 2OE0A 1ST9A 1XPVA 3DD3A 2MYGA 5INYA 1XOAA 4TR1B 3FKFA 3M1GA 1B4PA 4MJAA 1V40A 1HD2A 2HXKA 2X64A 4F0BA 3FY7A 4KDXA 2HZFA 2DJJA 2EIQA 4BVXA 1CQGA 4WKWA 1HNCA 3TRQA 3F3RA 4GTUA 1B8XA 6GSUA 3TB2A 3TRPA 2FY6A 2DJ1A 3GV1A 1K0MA 1THXA 4IS0A 4MDCA 2I9HA 11GSA 1OC9B 3H93A 5LD0A 4TOPA 1JZWA 2VD0A 2E0QA 2LJAA 3HJMA 1YDKA 1QXHA 2H0HA 4OD7A 2VCZA 1AIUA 2PGTA 1X5DA 5B6MA 4TW5A 1VGLA 4V2NA 10GSA 5B8AA 3HVVA 4ML6A 3DMLA 3WGXA 3EINA 4ID0A 4GCIA 2IMKA 2K8VA 2H6YA 5DDLA 2DIZA 5H5SA 4MJCA 2YV9A 5EVOA 4ISDA 4ZBBA 1ABAA 3LYKA 4QQ7A 1O8WA 5CP1A 2H0IA 3L78A 2QKEA 2HRKB 2H30A 3L0HA 5ECNB 1XWBA 1S3CA 3G7JA 3I9V2 1O7UA 2YWIA 3FR6A 4XHMA 4NMUA 2LRCA 12GSA 4EC0A 2F9SA 1JZOA 2VCVA 5G2ZA 4OFMA 2PVOC 3TOUA 1PGTA 2B3SA 4LMWA 4LA1A 1K3YA 1YKAA 2G2QA 1XW9A 2C0GA 1WMJA 4GQCA 3A2VA 4TR4A 3GX0A 2CQ9A 4ECJA 3Q74A 2DBCA 2YZUA 2MZCA 5JCWA 2HRNA 2AYTA 1SK0A 1PL1A 2C1YA 5IMFA 1A23A 5GSTA 2LEGA 4L5LA 3GHAA 4MABA 2R5GA 3HHVA 4GLTA 1FAAA 2RM6A 4TRXA 4EUYA 2VOCA 4G0KA 1PD21 3IBHA 3VWWA 4K0GA 4IJ3A 4MPFA 1GTAA 3F4TA 2KP1A 2LRNA 3VI5A 5DJMA 3P8WA 4BVXB 2JZRA 4K8MA 3ZTLA 3QMXA 2KHPA 4MLYA 2MMZA 3GH6A 1TP9A 2YWOA 2LQOA 4N0VA 1ILOA 2WDUA 2CVBA 5B6NA 1Z6NA 1WJKA 2IMFA 5E4WA 1EGOA 4GF0A 2FWEA 3BBYA 4AF2A 4OCEA 1PX7A 5DBQA 3J7Yb 4NHWA 2PMTA 3CSHA 3N9JA 4HS1A 3QFBC 2H76A 1G6WA 3VPTA 3ZIVA 2LJKA 4X0XA 1F6MC 2WB9A 3RHBA 14GSA 2B5EA 2FD3A 3FHKA 3IOSA 3AY8A 4PNGA 4AGSA 1GSFA 5HFGA 1PMTA 2QSIA 4G0LA 1TW9A 3IAM2 4XS6A 4RQXA 4TXOA 1KNGA 1X9MB 1AC1A 2MBSA 3RPNA 1YQ1A 2JSYA 3GL5A 3QDNA 1ERTA 5LCZA 1M0UA 4Q5FA 3F9UA 5AN1A 4F2IA 1ZYEA 5IOXA 1K0CA 4K7OA 2GQMA 2WGRA 4NPBA 1MDJA 1EWXA 1F3BA 4NXIA 4FIWA 4O32A 2M46A 3GKNA 3C1SA 4K0NA 5IM9A 2HNLA 5J9BA 5JWQB 4ZBAA 1GSSA 1HYUA 2REMA 1U87A 2AHEA 4V1Ap 3UEMA 1FVKA 1F2EA 3UBLA 17GSA 1GUHA 2XPDA 3APSA 1LBKA 3KCMA 2XBIA 2HLSA 2FNOA 1FG4A 5HR2A 3E3EA 4I97A 3UVHA 1TOFA 4HU7A 3FEUA 2HI7A 2RIIA 3G7YA 3G7IA 2YCDA 4H86A 3HZ4A 3E0UA 3KMNA 3A2XA 5IMDA 2GQLA 4IP1A 2L6DA 4GWRA 1KTEA 3D4MA 4PUFC 2PUKC 3BOAA 1OE8A 2WCIA 2VUPA 2XC2A 3BCIA 4KA0A 1BEDA 2FA4A 5IO0A 5JWOB 1G0TA 1X0RA 1XCCA 1AQXA 5D9WA 1PL2A 3VWVA 1WRYA 19GSA 2VL2A 3LYPA 3EVIA 5KEJA 3K8NA 4TVEA 3L9VA 4ZL9A 3Q19A 2R37A 4BVYA 5D93A 4D73A 3ZRDA 20GSA 4ZB6A 1XIYA 3LQ7A 1GNWA 2GS3A 1YZXA 5CO3A 5D8IA 1O8XA 3SWLA 4FYCA 3PR8A 1O81A 2YJHA 4O92A 2MMOA 3IA1A 1MTCA 2LRTA 2I4AA 1FB6A 1MD3A 2Z9SA 3CSIA 1B9XC 2CX4A 2H0GA 1R26A 4JR6A 7GSSA 5HR0A 2PPTA 1K0AA 2CV4A 4I2TA 3W8SA 1T1VA 2G0FA 3A5WA 4ILFA 4TR1A 4KUNA 2FA8A 2B1KA 1Z6MA 3TJBA 1BJXA 5GZZB 2CZ2A 3D21A 1RK4A 3QAVA 2C80A 2VCQA 22GSA 3HDCA 2KP2A 1BX9A 2CA8A 4MZWA 4RI7A 3EE2A 4BL7A 1M2AA 1OC9A 1G7OA 5G1KA 5D9TA 3P2AA 2GZYA 2GTUA 5CRHA 3KP8A 5DVBA 1T8EB 4IN0A 4F9ZA 2C0DA 4HI7A 1YKCA 4I5QA 3KTBA 2GSSA 1GL8A 3DEXA 6GSTA 4F0CA 1B4QA 1V9WA 4POBA 3CBUA 1SK2A 1N2AA 3ZITA 2V41A 4HDEA 4BPYA 4KF9A 1SYXA 2YZHA 5HQPA 2LTKA 4WR5A 2TRXA 2HRKA 4MPGA 2GLRA 3EC3A 1F3AA 4PXOA 3QAWA 4ACSA 3QFAC 5LNKe 1J08A 4OMVA 3KP9A 1ZYQB 3KZQA 1UA5A 8GSSA 1U3AA 4DSQA 3GX8A 2M72A 5AIXA 2B6MA 4N0ZA 2H19A 2C3QA 3EU3A 3IK9A 4GQFA 3D22A 4MA9A 4PNFA 4IKHA 2BJXA 2CVKA 3KIJA 2WZ9A 2JL4A 1ZMAA 1YF0A 2E7PA 2RUEA 1FOVA 1QMVA 4V1Ag 2LNSA 3S9FA 2H1BA 4G10A 2FCHA 3IV4A 5D9XA 4IELA 3F3QA 4KE3A 2MMAA 2HE3A 3PPUA 4ZIJA 1OYJA 2V1MA 2DC5A 2NVLA 4HZ2A 1SK1A 2NPBA 1QK8A 2LNTA 2MBTA 3ZMKA 5CRWA 1J9BA 2PN8A 3A3TA 4EO3A 2JSZA 3Q6OA 1BQ7A 4MMMA 2AV4A 3LWAA 3KH9A 1JLWA 3EYTA 1GP1A 3D4TA 4BL7B 3KEBA 3WGDA 2VL2C 3FW2A 2H73A 1OE7A 5AGYA 1OVNA 3ZFBA 3BD2A 2DJ0A 3ZL5A 4MZCA 4K9ZA 4HZ4A 1QGVA 1JZDA 2WJUA 2IIYA 3ZVJA 1Z7RA 2AAWA 5B7CA 3ME7A 3M3MA 5CYYA 1G6YA 1SYRA 1FW1A 1LU4A 4N11A 2HRAA 1UVZA 4IW9A 4MK3A 3G9BA 3CXGA 4IJIA 1VF3A 4GSNA 5FWGA 1A2MA 3TJGA 5AISA 1BG5A 3RAZA 1ERWA 2OJLA 2DJ2A 4HUAA 4LMVA 2M80A 5KN3A 4PUAA 1GUMA 5F0GA 2H74A 2JU5A 2CAIA 2AUVA 4MH3A 1JLVA 3GSTA 1A2LA 3H4KA 1M9BA 3D0ZA 3UBKA 2OBKA 1K3LA 5ECQB 2H71A 3GYKA 2L4CA 4EDZA 2IMDA 4L5OA 1Q98A 3VI7A 2NTOA 4DSRA 4KB3A 2FWHA 1NSWA 4WR4A 3LGCA 2HT9A 3H1NA 6GSXA 2HSYA 2K18A 5ELAA 2OKAA 2ZNMA 1QFNA 5JWRB 1GUKA 4I8BA 4LL1B 4ZL8A 4J57E 2YOIA 5DQSA 2FWFA 1DE1A 3WT2A 4NAXA 1FHEA 2K8SA 1F9MA 3CRUA 1ZCPA 1O85A 1SJZA 1ON4A 1PKWA 2VO4A 2FHEA 5FT3A 3QAGA 4P3YB 2L4QA 2HYXA 1OC8A 1PN9A 4EKZA 4YQVA 3FR3A 4ZBDA 2GVPA 2LS5A 3FZ4A 3Q18A 4KCEA 2LJRA 2ALBA 4PQIA 5J3RA 2TRCP 3KGKA 5D73A 3MWHA 3RPPA 4YQUA 5ECMB 1FB0A 2GSTA 2R6KA 1U88A 5ECPB 4CHSA 2H01A 1GLPA 2VLUA 2E2MA 1GTUA 3FZ5A 4MCUA 2RUFA 4MH2A 5ECRB 2YWMA 3D5JA 1YF1A 1K0OA 4ZILA 2IFQA 1UC7A 1JFUA 2F51A 2MMNA 3HVXA 3SBCA 4HJ2A 1M7TA 5C04A 4HQSA 3ZYWA 5CREA 3EU4A 3CMIA 3TCOA 1T7PB 4CDOA 2VLTA 1Q4JA 3QR6A 4F03A 3PH9A 2YANA 5GSSA 3F4RA 3GTUB 3ZVJD 3TGZA 3NOFA 5J4UA 3I43A 2CT6A 2KOKA 2KUCA 2O89A 2H70A 3O6TA 2A2SA 3BCKA 1C72A 3KJYA 3R2QA 4K7IA 3FZ9A 3IDVA 3MNGA 2P5QA 4ECBA 4MJBA 1TTZA 1HNBA 1AW9A 2WRTA 1MD4A 2L59A 3CTGA 2N5FA 5GAND 2PWJA 1R5AA 3VPQA 3LEFA 1A0RP 1JHBA 1CQHA 4ZL7A 3MSZA 3HD5A 1ML6A 4RUVA 4KDUA 4KAEA 2DSAA 2LSTA 3CRTA 2I81A 1TRSA 1SKWB 1VF2A 4GSTA 3QOUA 4XRAA 3DGQA 3TKSA 2LQQA 1UN2A 5ID2A 3EMXA 5J5NA 2VM2A 4JR4A 2YP6A 3LJRA 2VL9A 3UOMA 1X9WB 2L5OA 3APQA 1B9YC 2IL3A 4ZXGA 2HFDA 2XBQA 4POLA 2C0FA 1TRWA 3ME8A 5A4UA 3FYGA 1F37A 5IQYA 1S3DA 1U3IA 3KM6A 2WFCA 1GLQA 3LFLA 3M0FA 1XZOA 2FUG2 1Z3EA 1GSUA 3DVWA 3U6VA 5JCGA 2B5XA 5IMVA 4TR0A 4ZB8A 1HQOA 1SENA 5AIVA 5ENUA 1DSBA 2YPMA 3C73A 3DIEA 1THOA 1DUGA 3GSSA 3LORA 5ECHB 2DJ3A 1HNAA 4PX1A 3GA4A 3F4SA 2IFQB 3TKRA 3UMAA 3GMFA 1E2YA 4WF4A 2QC7A 3WD6A 1Z7PA 1XWAA 1J0FA 1TRUA 2V6OA 1R4WA 3LSZA 3UIWA 1ZZYA 2HQTA 2EC4A 3HCZA 1YEPA 2K6VA 1XVWA 2OBIA 3TKQA 3ERWA 1EOHA 5D96A 1GWCA 2J23A 5E59A 3TKSE 4KSMA 4X1UA 5ELGA 3UAPA 5DAKA 1M99A 4E8EA 2YJ7A 3APOA 1G7EA 2OADA 2LKUA 5HFKA 4OO5A 4HJMA 1DBYA 3QCPA 2B7JA 3MDKA 5DQYA 4PTSA 4HEA2 5EY6A 3IE3A 1EGRA 5IIZA 4FH8A 4WBRD 1VRSD 4XIHA 1PX6A 3I69A 2VM1A 1XWCA 1TI1A 2GGTA 2PBJA 2R4VA 4JE1A 4BWSA 3KD0A 4MF6A 4ULXA 2JACA 3DVXA 2L6CA 2R2JA 4IHUA 3F0IA 5ID2B 1TI3A 3F8UA 4TN8A 1NW2A 3I6AA 16GSA 1YY7A 4JU5A 3KXOA 3F6FA 4Q5NA 2FGXA 4MF5A 5GAPD 2IMIA 3EWLA 1GSQA 1X5EA 4OO4A 5H5RA 5G1LA 2OA7A 1RW1A 2C4JA 2YNXA 1VF4A 4K1FA 1A2JA 2B1LA 3GKXA 2YV7A 3UJ1A 4MF7A 4V2MA 2LV3A 3UARA 3KH7A 3GNJA 1I5GA 4KW6A 4AJ8A 1NHOA 4KSOA 2ZCTA 2ON7A 4J56E 3VK9A 2ZUPA 6GSVA 4XS1A 3IC8A 2XHFA 3ERGA 3GUSA 2HZEA 1WE0A 1SJIA 1VF1A 2F8AA 1PKZA 1MEKA 4IQ1A 2DIYA 2EIRA 3KTLA 4I2UA 2J9HA 4OWYA 3HA9A 3TKSC 3VURA 1Z9HA 3TJFA 4XCSA 5HFIA 1SD8A 2OE1A 5ECLB 5BMUA 4G19A 1TU7A 1ERVA 4XS4A 1GTIA 2NDOA 3TRXA 2ON5A 5IMAA 4TKYA 2FLSA 5KN1A 2DMMA 5DAKB 5ECSA 3PINA 4YAPA 4GRFA 2GT5A 1SU9A 4MJEA 5IPGA 3GRXA 3MAKA 1AXDA 2L5LA 2H8LA 2C0EA 3M9KA 3LXTA 2F8FA 4YH2A 3DYRA 2OE3A 5EL8A 4DVCA 2IWTA 1TK0B 2PERA 4ECIA 1GH2A 3JCML 1NM3A 2O7KA 1WPIA 1QUWA 4OFTA 4MP4A 6GSYA 1XW6A 2IJYA 1XWGA 1EV9A 3EURA 3PGTA 1SD9A 2N5AA 4BA7A 4TXVA 3CTFA 1GNEA 1PQNA 3OR5A 1TJDA 3VWXA 2H75A 1A24A 2AB6A 5F06A 4NHZA 1EP8A 1SJ6A 5ECOB 1AAZA 2H1DA 1M2BA 3N5OA 4O5RA 3M9JA 1K0BA 1EEJA 4YAVA 1TDIA 5ECKB 3ZMLA 1YJ6A 1T4YA 1MDKA 3GTUA 2V32A 1S3AA 4POKA 3GKKA 13GSA 3M8NA
chains in the Genus database with same CATH superfamily
3R3EA 4Z7XA 3IC4A 1R5PA 4WBJA 4AJ7A 2HZEB 1KBNA 3C71A 3F6DA 5COHA 1ZGNA 2GZZA 1TKDB 1SKRB 3HY2A 2VCWA 4CW9A 1JZRA 2DMLA 2DLXA 5DCHA 5KN2A 5BMUB 4XRDA 1GSYA 2WS2A 1A8LA 4XS4B 6GSWA 4DSSA 1SL2B 4GSSA 1RQMA 2HSNB 18GSA 4KGIA 3QPMA 3DXBA 5JCUA 3IR4A 1ZOFA 4I6XA 3L4NA 2WW3A 1T00A 2XPEA 5EPFA 3FZAA 5DALB 4OFNA 5CNWA 5CRGA 3HKRA 2GZPA 1M9AA 5IMCA 1M3IA 2F3MA 1W89A 3GN3A 4G9HA 3UL3A 1AUCA 4POMA 5KN0A 4JEDA 3ZFLA 3WGEA 2K9FA 4K7NA 2H6ZA 2X8GA 3DRNA 2P0GA 1FO5A 1W4VA 2EIOA 4FYUA 1U6TA 4QL7A 5G30A 1EZKA 3GURA 1TRVA 5CAXA 3E9JB 4O7HA 2WW1A 3C1RA 1XXUA 3ISOA 4IP6A 3W6GA 2TIRA 1K0DA 4EL1A 4RQRA 2UZ8A 4JZQA 1I9DA 1S3RA 3GH9A 2BMXA 2VKZG 5C00A 2GQKA 2A2RA 1V98A 4L0WA 1E6BA 3FR9A 5H5QA 2N5BA 2VL3A 4IVFA 2HRFA 3IXRA 3H8QA 4X43A 1K0NA 3IPZA 3ED3A 5F07A 2VLVA 2X99A 2A4VA 2VAFA 2PVQA 5HR3A 2QGVA 1GULA 3P7XA 4N30A 2VCXA 2IN3A 4EF0A 4IGJA 4KX4A 4FQUA 4PGTA 1OAZA 1WP0A 4Q5QA 1TK5B 1NHYA 3CSJA 4N10A 5G31A 2RM5A 4OCFA 2AJQB 1V2AA 4K6XA 3IRAA 1XW5A 2O87A 4EXJA 4BWQA 5A5KA 4NV2A 4PURA 3VFIA 4F82A 3ZREA 1V58A 1TXXA 2H1LA 2GT6A 4KNDA 1LJRA 3IK7A 4XTSA 2JZSA 4DSSB 5B8BA 2OACA 1FVJA 1GSEA 4USSA 4KCAA 5ECIB 1V57A 3LG6A 1T3BA 4ML1A 3UVTA 2H66A 2VCTA 1PFOA 2WVXA 5A1NB 5HR1A 2CAQA 5G5FA 4E68A 1PSQA 1QQ2A 5IPHA 4NV5A 2I1UA 9GSSA 1IYHA 2H1AA 4HQZA 3QD9A 1AQVA 4G2EA 1Y6EA 2GDRA 5CRDA 1XG8A 1O73A 4IQAA 3US3A 3L9UA 5L71A 3EMPA 2CZ3A 2NBSA 3WYWA 2HSHA 1USBA 2O85A 2IMEA 3HVSA 4V2LA 4WEYA 4Z2RA 1H75A 2B7KA 5F05A 4O5UA 2O8VB 3VWUA 2BTOT 3ZLPA 1N8JA 2B5YA 5IMZA 3ERFA 1XFLA 3A2WA 4WXTA 5IO2A 4AKHA 4HSCX 4WETA 6GSSA 3D6IA 3V1WA 3J7Yk 5J9CA 4G0IA 3DKSA 1WIKA 2VIMA 1BAYA 2KLXA 5G5EA 4PQHA 1ACVA 2H6XA 1EEMA 1GRXA 1IYIA 1K3OA 1AQWA 5ABRA 1XWKA 3KMOA 4E8HA 4AJ6A 5IOWA 2H72A 3GL3A 3NIVA 3P90A 1EV4A 3FRCA 3CYNA 4RI6A 2P5RA 2C3TA 3FK8A 3HYPA 4EIPA 2GSQA 2V6KA 3C7MA 4TXOB 4HU9A 3WT1A 2HSMA 4ZB9A 1MDIA 4K2DA 2DJKA 1SL1B 3W8JA 5A4VA 2LUSA 4LL4B 3LXZA 1URMA 1Y25A 5F8BA 1H4OA 3TJJA 3H79A 3F63A 3DWVA 3TJKA 3TDGA 1EP7A 1TK8B 1T4ZA 3O76A 1X9SB 1B48A 4FYBA 4ZB7A 4TR3A 1XOBA 1OKDA 4ECCA 2D2ZA 1ZL9A 1O6JA 1TXUA 4JBBA 2WULA 2WW2A 3HJOA 4EVMA 3U5RE 3HJPA 2RLIA 1DE2A 1OKTA 1ERUA 1TU8A 2PU9C 2VD1A 1A8YA 2WVYA 3HZ8A 3O3TA 1SL0B 2ES7A 2CVDA 4JRRA 5D9VA 4GXZA 3TUEA 3L9SA 3A5IA 2R3XA 3TOTA 3GFKA 5J47A 3C8EA 1SKSB 4Q5RA 5DJLA 5DCGA 4AKGA 3NZNA 3GKMA 4J2FA 3IHQA 4NWYA 3VLNA 1GSDA 1XVQA 1BYEA 2E2GA 2GSRA 1XBSA 3ZIJA 1WOUA 1R7HA 2YWNA 2H1GA 1SVMA 2O5VA 4KDYA 2V2GA 4MZBA 4DEJA 2L57A 1Z5YE 1A0FA 4IBPA 3RHCA 4EDYA 3GIXA 2P31A 1KEBA 1PRXA 5J41A 4YQMA 4PQ1A 4EE0A 3RDWA 1PA3A 4BVYB 4LLRA 4D73B 4L8EA 5FHIA 4KH7A 3BJ5A 4QL9A 2IPAA 3HXSA 1EOGA 2X8HA 2YN1A 3TKPA 2X8CA 3ZZXA 2FWGA 2I3YA 1SVOA 4L0UA 1M2DA 1YEXA 3RBTA 2HSNA 2HSMB 5A4WA 2CX3A 1GTBA 1OC3A 1WWJA 4G01A 2C3NA 1X5CA 2JZTA 3IAS2 4WF5A 4HOJA 5DALA 2WZSA 2C8UA 4FO5A 2JADA 2OE0A 1ST9A 1XPVA 3DD3A 2MYGA 5INYA 1XOAA 4TR1B 3FKFA 3M1GA 1B4PA 4MJAA 1V40A 1HD2A 2HXKA 2X64A 4F0BA 3FY7A 4KDXA 2HZFA 2DJJA 2EIQA 4BVXA 1CQGA 4WKWA 1HNCA 3TRQA 3F3RA 4GTUA 1B8XA 6GSUA 3TB2A 3TRPA 2FY6A 2DJ1A 3GV1A 1K0MA 1THXA 4IS0A 4MDCA 2I9HA 1ZYPA 2QA1A 11GSA 1OC9B 3H93A 5LD0A 2A2PA 4TOPA 1JZWA 2VD0A 2E0QA 2LJAA 3HJMA 1YDKA 1BG1A 1QXHA 2WW0A 2H0HA 4OD7A 4N3ZA 2VCZA 1AIUA 2PGTA 1X5DA 5B6MA 4TW5A 1VGLA 4V2NA 10GSA 2R0PA 5B8AA 3HVVA 4ML6A 3DMLA 3WGXA 3EINA 3LW9A 4ID0A 4GCIA 2IMKA 1Y1UA 2K8VA 2H6YA 5DDLA 2DIZA 5H5SA 4MJCA 2YV9A 5EVOA 4ISDA 4ZBBA 1ABAA 3LYKA 4QQ7A 1O8WA 5CP1A 2H0IA 3CHXC 3L78A 2QKEA 2HRKB 2H30A 3L0HA 2EFHA 5ECNB 1S3CA 1XWBA 3G7JA 3I9V2 1O7UA 2YWIA 3FR6A 4XHMA 4NMUA 2LRCA 12GSA 4EC0A 2F9SA 4K5RA 1JZOA 2VCVA 5G2ZA 4OFMA 2PVOC 3TOUA 1PGTA 2B3SA 4LMWA 4LA1A 1K3YA 1YKAA 2G2QA 1XW9A 2C0GA 1WMJA 4GQCA 3A2VA 4TR4A 3GX0A 2CQ9A 4ECJA 3Q74A 2DBCA 2YZUA 2MZCA 5JCWA 2HRNA 2AYTA 1SK0A 1PL1A 2C1YA 5IMFA 1A23A 5GSTA 5A1NA 2LEGA 4L5LA 3GHAA 4MABA 2R5GA 3HHVA 4GLTA 1FAAA 2RM6A 4TRXA 4EUYA 2VOCA 4G0KA 1PD21 3IBHA 3VWWA 4K0GA 4IJ3A 4MPFA 1GTAA 3F4TA 2KP1A 2LRNA 3VI5A 5DJMA 3P8WA 4BVXB 2JZRA 4K8MA 3ZTLA 3QMXA 2KHPA 4MLYA 2MMZA 3GH6A 1TP9A 2YWOA 2LQOA 4N0VA 1ILOA 2WDUA 2CVBA 5B6NA 1Z6NA 1WJKA 2IMFA 5E4WA 1EGOA 4GF0A 2FWEA 4Z2TA 3BBYA 4AF2A 4OCEA 1PX7A 5DBQA 3J7Yb 4NHWA 2PMTA 3CSHA 3N9JA 4HS1A 3QFBC 2H76A 1G6WA 3VPTA 3ZIVA 2LJKA 4X0XA 1F6MC 2WB9A 5A34A 3RHBA 14GSA 2B5EA 2FD3A 3FHKA 3IOSA 3AY8A 4PNGA 4AGSA 1GSFA 5HFGA 1PMTA 2QSIA 4G0LA 1TW9A 3IAM2 3FMWA 4XS6A 4RQXA 4TXOA 1KNGA 1X9MB 1AC1A 2MBSA 3RPNA 1YQ1A 2JSYA 3GL5A 3QDNA 1ERTA 5LCZA 1M0UA 4Q5FA 3F9UA 5AN1A 4F2IA 1ZYEA 5IOXA 1K0CA 4K7OA 2GQMA 2WGRA 4NPBA 1MDJA 4PI2C 1EWXA 1F3BA 4NXIA 4FIWA 4O32A 2M46A 3GKNA 3C1SA 4K2XA 4EIQA 4K0NA 5IM9A 2HNLA 5J9BA 5JWQB 4ZBAA 1GSSA 1HYUA 2REMA 1U87A 2AHEA 2WVZA 4V1Ap 3UEMA 1FVKA 1F2EA 3UBLA 17GSA 1GUHA 2XPDA 3APSA 1LBKA 3KCMA 2XBIA 2HLSA 2FNOA 1FG4A 5HR2A 3E3EA 2EFEA 4I97A 3UVHA 1TOFA 4HU7A 3FEUA 2HI7A 1SVLA 2RIIA 3G7YA 3G7IA 2YCDA 4H86A 3HZ4A 3E0UA 3KMNA 5J4VA 3A2XA 5IMDA 2GQLA 4IP1A 2L6DA 4GWRA 1KTEA 3D4MA 4PI0C 4PUFC 2PUKC 3BOAA 1OE8A 2WCIA 2VUPA 2XC2A 3BCIA 4KA0A 1BEDA 2FA4A 5IO0A 5JWOB 2R0GA 1G0TA 1X0RA 1XCCA 1AQXA 5D9WA 1PL2A 3VWVA 4A5PA 1WRYA 19GSA 2VL2A 3LYPA 3EVIA 5KEJA 3K8NA 4TVEA 3L9VA 4ZL9A 3Q19A 2R37A 4BVYA 5D93A 2UV8G 4D73A 3ZRDA 5A34B 20GSA 4ZB6A 1XIYA 3LQ7A 1GNWA 2GS3A 1YZXA 1ZYNA 5CO3A 5D8IA 3IHGA 1O8XA 3SWLA 4FYCA 3PR8A 1O81A 2YJHA 4O92A 2MMOA 3IA1A 1M3JA 1MTCA 2LRTA 2I4AA 1FB6A 1MD3A 2Z9SA 3CSIA 1B9XC 2CX4A 3TU3B 2H0GA 1R26A 4JR6A 7GSSA 5HR0A 2PPTA 1K0AA 2CV4A 4I2TA 3W8SA 1T1VA 2DKHA 2G0FA 3A5WA 4ILFA 4TR1A 4KUNA 2FA8A 2B1KA 1Z6MA 3TJBA 1BJXA 4AKIA 5GZZB 2CZ2A 3D21A 1RK4A 3QAVA 2C80A 2VCQA 22GSA 3HDCA 2KP2A 2R0CA 1BX9A 2CA8A 4MZWA 4RI7A 3EE2A 4BL7A 1M2AA 1OC9A 1G7OA 5G1KA 5D9TA 3P2AA 2GZYA 2GTUA 5CRHA 3KP8A 5DVBA 1T8EB 3HVNA 4IN0A 4F9ZA 2C0DA 4HI7A 1YKCA 4I5QA 4O5QA 3KTBA 2GSSA 1GL8A 3DEXA 1BF5A 6GSTA 4F0CA 1B4QA 1V9WA 4POBA 3CBUA 1SK2A 1N2AA 3ZITA 2V41A 4HDEA 4BPYA 4KF9A 1SYXA 2YZHA 5HQPA 2LTKA 4WR5A 2TRXA 2HRKA 4MPGA 2GLRA 3EC3A 3HMJG 1F3AA 4PXOA 3QAWA 4ACSA 3QFAC 5LNKe 1J08A 4OMVA 3KP9A 1ZYQB 3KZQA 1UA5A 8GSSA 1U3AA 4DSQA 3GX8A 1YEWC 2M72A 5AIXA 2B6MA 4N0ZA 2H19A 2C3QA 3EU3A 3IK9A 4GQFA 3D22A 3EPTA 4MA9A 4PNFA 4IKHA 2BJXA 2O3EA 2CVKA 3KIJA 2WZ9A 2JL4A 1ZMAA 1YF0A 2E7PA 2RUEA 1FOVA 1QMVA 4V1Ag 2LNSA 3S9FA 2H1BA 4G10A 2FCHA 3IV4A 5D9XA 4IELA 3F3QA 4KE3A 2MMAA 2HE3A 3PPUA 4ZIJA 1OYJA 2V1MA 2DC5A 2NVLA 4HZ2A 3RGBC 1SK1A 5KOWA 2NPBA 1QK8A 2LNTA 2MBTA 3ZMKA 5CRWA 1J9BA 5J40A 2PN8A 3A3TA 4EO3A 2JSZA 3Q6OA 1BQ7A 2X49A 4MMMA 2AV4A 3LWAA 3KH9A 1JLWA 3EYTA 1GP1A 3D4TA 4BL7B 3KEBA 3WGDA 2VL2C 3FW2A 2H73A 1OE7A 5AGYA 1OVNA 3ZFBA 3BD2A 4FXYP 2DJ0A 3ZL5A 4MZCA 4K9ZA 4HZ4A 4ICYA 1QGVA 1JZDA 2WJUA 2IIYA 3ZVJA 1Z7RA 2AAWA 5B7CA 3ME7A 3M3MA 5CYYA 1G6YA 1SYRA 1FW1A 1LU4A 2OT3A 4N11A 2HRAA 1UVZA 4IW9A 4MK3A 3G9BA 3CXGA 1FOHA 4IJIA 1YVLA 1VF3A 4GSNA 5FWGA 1A2MA 3TJGA 5AISA 1BG5A 3RAZA 1ERWA 2OJLA 2DJ2A 4HUAA 4LMVA 2M80A 5KN3A 4PUAA 4YKFA 1GUMA 5F0GA 2H74A 2JU5A 1I1IP 2CAIA 2AUVA 2EFCA 4X4JA 4MH3A 1JLVA 3GSTA 1A2LA 3H4KA 1M9BA 3D0ZA 3UBKA 2OBKA 1K3LA 5BRTA 5ECQB 2H71A 3GYKA 2L4CA 4EDZA 2IMDA 4L5OA 1Q98A 3VI7A 2NTOA 4DSRA 4KB3A 2FWHA 1NSWA 4WR4A 3LGCA 2HT9A 3H1NA 6GSXA 2HSYA 2K18A 5ELAA 2OKAA 4AKXB 2ZNMA 1QFNA 5JWRB 1GUKA 4I8BA 4LL1B 4ZL8A 4J57E 2YOIA 5DQSA 2FWFA 1DE1A 3CWGA 4NAXA 1FHEA 2K8SA 1F9MA 3WT2A 3CRUA 1ZCPA 1O85A 1SJZA 1ON4A 1PKWA 2VO4A 2FHEA 5FT3A 3QAGA 4P3YB 2L4QA 2HYXA 1OC8A 1PN9A 4W66A 4EKZA 4YQVA 3FR3A 4ZBDA 2GVPA 2LS5A 3FZ4A 4AI6A 3Q18A 4KCEA 2LJRA 2ALBA 1N25A 4PQIA 5J3RA 2TRCP 3KGKA 5D73A 3MWHA 3RPPA 4YQUA 5ECMB 1FB0A 2GSTA 2R6KA 1U88A 5ECPB 4CHSA 2H01A 1GLPA 2VLUA 2E2MA 1GTUA 3FZ5A 4MCUA 2RUFA 4MH2A 5ECRB 2YWMA 3D5JA 1YF1A 1K0OA 4ZILA 2IFQA 1UC7A 1JFUA 2F51A 2MMNA 3HVXA 3SBCA 4HJ2A 1M7TA 5C04A 4HQSA 3ZYWA 5CREA 3EU4A 3CMIA 3TCOA 1T7PB 4CDOA 2VLTA 1Q4JA 3QR6A 4F03A 3PH9A 4YKGA 2YANA 5GSSA 3F4RA 3GTUB 3ZVJD 3TGZA 3NOFA 3CQFA 5J4UA 3I43A 2CT6A 2KOKA 2KUCA 2O89A 2H70A 3O6TA 2A2SA 3BCKA 1C72A 3KJYA 3R2QA 4K7IA 3FZ9A 3IDVA 3MNGA 2P5QA 4ECBA 4MJBA 1TTZA 1HNBA 1AW9A 2WRTA 1MD4A 2L59A 3CTGA 2N5FA 5GAND 2PWJA 1R5AA 3VPQA 3LEFA 1A0RP 1JHBA 1CQHA 4ZL7A 3MSZA 3HD5A 1ML6A 4RUVA 4KDUA 4KAEA 2DSAA 2LSTA 3CRTA 2A4HA 2O36A 2I81A 1TRSA 1SKWB 1VF2A 4GSTA 3QOUA 4XRAA 3DGQA 3TKSA 2LQQA 1UN2A 5ID2A 3EMXA 5J5NA 2VM2A 4JR4A 2YP6A 4QMKA 3LJRA 2VL9A 4MNNA 3UOMA 1X9WB 2L5OA 3APQA 1B9YC 2IL3A 4ZXGA 2HFDA 2XBQA 4K5SA 4POLA 2C0FA 1TRWA 3ME8A 5A4UA 3FYGA 1F37A 5IQYA 1S3DA 3RFRC 1U3IA 3KM6A 2WFCA 1GLQA 3LFLA 3M0FA 1XZOA 2FUG2 1Z3EA 2QA2A 1GSUA 3DVWA 3U6VA 5JCGA 2B5XA 3MIXA 5IMVA 4TR0A 4ZB8A 1HQOA 1SENA 5AIVA 5ENUA 1DSBA 2YPMA 3C73A 3DIEA 1THOA 1DUGA 3GSSA 3LORA 5ECHB 2DJ3A 1HNAA 4PX1A 3GA4A 3F4SA 2IFQB 3TKRA 3UMAA 3GMFA 1E2YA 4WF4A 2QC7A 3WD6A 1Z7PA 1XWAA 1J0FA 1TRUA 2V6OA 1R4WA 3LSZA 3UIWA 1ZZYA 2HQTA 2EC4A 3HCZA 1YEPA 2K6VA 1XVWA 2OBIA 3TKQA 3ERWA 1EOHA 5D96A 5A5HA 1GWCA 2J23A 5E59A 3TKSE 4KSMA 4X1UA 5ELGA 3UAPA 5DAKA 1M99A 4E8EA 2YJ7A 1S4BP 3APOA 1G7EA 2DKIA 2OADA 2LKUA 5HFKA 4OO5A 4HJMA 1DBYA 3QCPA 2B7JA 3MDKA 5DQYA 4PTSA 4HEA2 5EY6A 2X4AA 3IE3A 1EGRA 5IIZA 4FH8A 4WBRD 1VRSD 4PHZC 4XIHA 1PX6A 3I69A 2VM1A 1XWCA 1TI1A 2GGTA 2PBJA 2R4VA 4JE1A 4BWSA 3KD0A 2WVXB 4GDFA 4MF6A 4ULXA 2JACA 3DVXA 2L6CA 2R2JA 4IHUA 3F0IA 5ID2B 1TI3A 3F8UA 4TN8A 1NW2A 5KOXA 3I6AA 16GSA 1YY7A 4JU5A 3KXOA 3F6FA 4Q5NA 2FGXA 4MF5A 5GAPD 2IMIA 3EWLA 1GSQA 1X5EA 4OO4A 3MYDA 5H5RA 5G1LA 2OA7A 1RW1A 2C4JA 2YNXA 1VF4A 4K1FA 1A2JA 2B1LA 3GKXA 2YV7A 3UJ1A 4MF7A 4V2MA 2LV3A 3UARA 3KH7A 3GNJA 1I5GA 4KW6A 4AJ8A 1NHOA 4KSOA 2ZCTA 2ON7A 4J56E 3VK9A 2ZUPA 6GSVA 4XS1A 3IC8A 2XHFA 3ERGA 3GUSA 2HZEA 1WE0A 1SJIA 1VF1A 4Z2UA 2F8AA 1PKZA 1MEKA 4IQ1A 2DIYA 2EIRA 3KTLA 4I2UA 2J9HA 4OWYA 3HA9A 3TKSC 3VURA 1Z9HA 3TJFA 4XCSA 5HFIA 1SD8A 2OE1A 5ECLB 5BMUA 4G19A 1TU7A 1ERVA 5A5HB 4XS4A 1GTIA 2NDOA 3TRXA 4BIKA 2ON5A 5IMAA 4TKYA 2FLSA 5KN1A 2DMMA 5DAKB 5ECSA 3PINA 4YAPA 4GRFA 2GT5A 1SU9A 4MJEA 5IPGA 3GRXA 3MAKA 1AXDA 2L5LA 2H8LA 2C0EA 3M9KA 3LXTA 2F8FA 4YH2A 3DYRA 2OE3A 5EL8A 4DVCA 2IWTA 4CY8A 1TK0B 2PERA 4ECIA 1GH2A 3JCML 1NM3A 2O7KA 1WPIA 1QUWA 2EFDA 4OFTA 4MP4A 6GSYA 1XW6A 2IJYA 1XWGA 1EV9A 3EURA 3PGTA 1SD9A 2N5AA 4BA7A 4TXVA 3CTFA 1GNEA 1PQNA 3OR5A 1TJDA 3VWXA 2H75A 1A24A 2AB6A 5F06A 4NHZA 1EP8A 4CY6A 1SJ6A 5ECOB 1AAZA 2H1DA 1M2BA 3N5OA 4O5RA 5J4YA 3M9JA 1K0BA 1EEJA 4YAVA 1TDIA 5ECKB 3ZMLA 1YJ6A 1T4YA 1PN0A 1MDKA 3GTUA 2V32A 1S3AA 4POKA 3GKKA 13GSA 3M8NA
chains in the Genus database with same CATH topology
3R3EA 4Z7XA 3IC4A 1R5PA 4WBJA 4AJ7A 2HZEB 1KBNA 3C71A 3F6DA 5COHA 1ZGNA 2GZZA 1TKDB 1SKRB 3HY2A 2VCWA 4CW9A 1JZRA 2DMLA 2DLXA 5DCHA 5KN2A 5BMUB 4XRDA 1GSYA 2WS2A 1A8LA 4XS4B 6GSWA 4DSSA 1SL2B 4GSSA 1RQMA 2HSNB 18GSA 4KGIA 3QPMA 3DXBA 5JCUA 3IR4A 1ZOFA 4I6XA 3L4NA 1T00A 2XPEA 5EPFA 3FZAA 5DALB 4OFNA 5CNWA 5CRGA 3HKRA 2GZPA 1M9AA 5IMCA 2F3MA 1W89A 3GN3A 4G9HA 3UL3A 1AUCA 4POMA 5KN0A 4JEDA 3ZFLA 3WGEA 2K9FA 4K7NA 2H6ZA 2X8GA 3DRNA 2P0GA 1FO5A 1W4VA 2EIOA 4FYUA 1U6TA 4QL7A 5G30A 1EZKA 3GURA 1TRVA 5CAXA 3E9JB 4O7HA 3C1RA 1XXUA 3ISOA 4IP6A 3W6GA 2TIRA 1K0DA 4EL1A 4RQRA 2UZ8A 4JZQA 1I9DA 3GH9A 2BMXA 2VKZG 5C00A 2GQKA 2A2RA 1V98A 4L0WA 1E6BA 3FR9A 5H5QA 2N5BA 2VL3A 4IVFA 2HRFA 3IXRA 3H8QA 4X43A 1K0NA 3IPZA 3ED3A 5F07A 2VLVA 2X99A 2A4VA 2VAFA 2PVQA 5HR3A 2QGVA 1GULA 3P7XA 4N30A 2VCXA 2IN3A 4EF0A 4IGJA 4KX4A 4FQUA 4PGTA 1OAZA 1WP0A 4Q5QA 1TK5B 1NHYA 3CSJA 4N10A 5G31A 2RM5A 4OCFA 2AJQB 1V2AA 4K6XA 3IRAA 1XW5A 2O87A 4EXJA 4BWQA 5A5KA 4NV2A 4PURA 3VFIA 4F82A 3ZREA 1V58A 1TXXA 2H1LA 2GT6A 4KNDA 1LJRA 3IK7A 4XTSA 2JZSA 4DSSB 5B8BA 2OACA 1FVJA 1GSEA 4USSA 4KCAA 5ECIB 1V57A 3LG6A 1T3BA 4ML1A 3UVTA 2H66A 2VCTA 5A1NB 5HR1A 2CAQA 5G5FA 4E68A 1PSQA 1QQ2A 5IPHA 4NV5A 2I1UA 9GSSA 1IYHA 2H1AA 4HQZA 3QD9A 1AQVA 4G2EA 1Y6EA 2GDRA 5CRDA 1O73A 4IQAA 3US3A 3L9UA 5L71A 3EMPA 2CZ3A 2NBSA 3WYWA 2HSHA 1USBA 2O85A 2IMEA 3HVSA 4V2LA 4WEYA 4Z2RA 1H75A 2B7KA 5F05A 4O5UA 2O8VB 3VWUA 2BTOT 3ZLPA 1N8JA 2B5YA 5IMZA 3ERFA 1XFLA 3A2WA 4WXTA 5IO2A 4AKHA 4WETA 6GSSA 3D6IA 3V1WA 3J7Yk 5J9CA 4G0IA 3DKSA 1WIKA 2VIMA 1BAYA 2KLXA 5G5EA 4PQHA 1ACVA 2H6XA 1EEMA 1GRXA 1IYIA 1K3OA 1AQWA 5ABRA 1XWKA 3KMOA 4E8HA 4AJ6A 5IOWA 2H72A 3GL3A 3NIVA 3P90A 1EV4A 3FRCA 3CYNA 4RI6A 2P5RA 2C3TA 3FK8A 3HYPA 4EIPA 2GSQA 2V6KA 3C7MA 4TXOB 4HU9A 3WT1A 2HSMA 4ZB9A 1MDIA 4K2DA 2DJKA 1SL1B 3W8JA 5A4VA 2LUSA 4LL4B 3LXZA 1URMA 1Y25A 5F8BA 1H4OA 3TJJA 3H79A 3F63A 3DWVA 3TJKA 3TDGA 1EP7A 1TK8B 1T4ZA 3O76A 1X9SB 1B48A 4FYBA 4ZB7A 4TR3A 1XOBA 1OKDA 4ECCA 2D2ZA 1ZL9A 1O6JA 1TXUA 4JBBA 2WULA 3HJOA 4EVMA 3U5RE 3HJPA 2RLIA 1DE2A 1OKTA 1ERUA 1TU8A 2PU9C 2VD1A 1A8YA 3HZ8A 3O3TA 1SL0B 2ES7A 2CVDA 4JRRA 5D9VA 4GXZA 3TUEA 3L9SA 3A5IA 2R3XA 3TOTA 3GFKA 5J47A 3C8EA 1SKSB 4Q5RA 5DJLA 5DCGA 4AKGA 3NZNA 3GKMA 4J2FA 3IHQA 4NWYA 3VLNA 1GSDA 1XVQA 1BYEA 2E2GA 2GSRA 1XBSA 3ZIJA 1WOUA 1R7HA 2YWNA 2H1GA 1SVMA 2O5VA 4KDYA 2V2GA 4MZBA 4DEJA 2L57A 1Z5YE 1A0FA 4IBPA 3RHCA 4EDYA 3GIXA 2P31A 1KEBA 1PRXA 5J41A 4YQMA 4PQ1A 4EE0A 3RDWA 1PA3A 4BVYB 4LLRA 4D73B 4L8EA 5FHIA 4KH7A 3BJ5A 4QL9A 2IPAA 3HXSA 1EOGA 2X8HA 2YN1A 3TKPA 2X8CA 3ZZXA 2FWGA 2I3YA 1SVOA 4L0UA 1M2DA 1YEXA 3RBTA 2HSNA 2HSMB 5A4WA 2CX3A 1GTBA 1OC3A 1WWJA 4G01A 2C3NA 1X5CA 2JZTA 3IAS2 4WF5A 4HOJA 5DALA 2C8UA 4FO5A 2JADA 2OE0A 1ST9A 1XPVA 3DD3A 2MYGA 5INYA 1XOAA 4TR1B 3FKFA 3M1GA 1B4PA 4MJAA 1V40A 1HD2A 2HXKA 2X64A 4F0BA 3FY7A 4KDXA 2HZFA 2DJJA 2EIQA 4BVXA 1CQGA 4WKWA 1HNCA 3TRQA 3F3RA 4GTUA 1B8XA 6GSUA 3TB2A 3TRPA 2FY6A 2DJ1A 3GV1A 1K0MA 1THXA 4IS0A 4MDCA 2I9HA 1ZYPA 2QA1A 11GSA 1OC9B 3H93A 5LD0A 2A2PA 4TOPA 1JZWA 2VD0A 2E0QA 2LJAA 3HJMA 1YDKA 1BG1A 1QXHA 2H0HA 4OD7A 4N3ZA 2VCZA 1AIUA 2PGTA 1X5DA 5B6MA 4TW5A 1VGLA 4V2NA 10GSA 2R0PA 5B8AA 3HVVA 4ML6A 3DMLA 3WGXA 3EINA 3LW9A 4ID0A 4GCIA 2IMKA 1Y1UA 2K8VA 2H6YA 5DDLA 2DIZA 5H5SA 4MJCA 2YV9A 5EVOA 4ISDA 4ZBBA 1ABAA 3LYKA 4QQ7A 1O8WA 5CP1A 2H0IA 3L78A 2QKEA 2HRKB 2H30A 3L0HA 2EFHA 5ECNB 1S3CA 1XWBA 3G7JA 3I9V2 1O7UA 2YWIA 3FR6A 4XHMA 4NMUA 2LRCA 12GSA 4EC0A 2F9SA 4K5RA 1JZOA 2VCVA 5G2ZA 4OFMA 2PVOC 3TOUA 1PGTA 2B3SA 4LMWA 4LA1A 1K3YA 1YKAA 2G2QA 1XW9A 2C0GA 1WMJA 4GQCA 3A2VA 4TR4A 3GX0A 2CQ9A 4ECJA 3Q74A 2DBCA 2YZUA 2MZCA 5JCWA 2HRNA 2AYTA 1SK0A 1PL1A 2C1YA 5IMFA 1A23A 5GSTA 5A1NA 2LEGA 4L5LA 3GHAA 4MABA 2R5GA 3HHVA 4GLTA 1FAAA 2RM6A 4TRXA 4EUYA 2VOCA 4G0KA 1PD21 3IBHA 3VWWA 4K0GA 4IJ3A 4MPFA 1GTAA 3F4TA 2KP1A 2LRNA 3VI5A 5DJMA 3P8WA 4BVXB 2JZRA 4K8MA 3ZTLA 3QMXA 2KHPA 4MLYA 2MMZA 3GH6A 1TP9A 2YWOA 2LQOA 4N0VA 1ILOA 2WDUA 2CVBA 5B6NA 1Z6NA 1WJKA 2IMFA 5E4WA 1EGOA 4GF0A 2FWEA 4Z2TA 3BBYA 4AF2A 4OCEA 1PX7A 5DBQA 3J7Yb 4NHWA 2PMTA 3CSHA 3N9JA 4HS1A 3QFBC 2H76A 1G6WA 3VPTA 3ZIVA 2LJKA 4X0XA 1F6MC 2WB9A 5A34A 3RHBA 14GSA 2B5EA 2FD3A 3FHKA 3IOSA 3AY8A 4PNGA 4AGSA 1GSFA 5HFGA 1PMTA 2QSIA 4G0LA 1TW9A 3IAM2 3FMWA 4XS6A 4RQXA 4TXOA 1KNGA 1X9MB 1AC1A 2MBSA 3RPNA 1YQ1A 2JSYA 3GL5A 3QDNA 1ERTA 5LCZA 1M0UA 4Q5FA 3F9UA 5AN1A 4F2IA 1ZYEA 5IOXA 1K0CA 4K7OA 2GQMA 2WGRA 4NPBA 1MDJA 1EWXA 1F3BA 4NXIA 4FIWA 4O32A 2M46A 3GKNA 3C1SA 4K2XA 4EIQA 4K0NA 5IM9A 2HNLA 5J9BA 5JWQB 4ZBAA 1GSSA 1HYUA 2REMA 1U87A 2AHEA 4V1Ap 3UEMA 1FVKA 1F2EA 3UBLA 17GSA 1GUHA 2XPDA 3APSA 1LBKA 3KCMA 2XBIA 2HLSA 2FNOA 1FG4A 5HR2A 3E3EA 2EFEA 4I97A 3UVHA 1TOFA 4HU7A 3FEUA 2HI7A 1SVLA 2RIIA 3G7YA 3G7IA 2YCDA 4H86A 3HZ4A 3E0UA 3KMNA 5J4VA 3A2XA 5IMDA 2GQLA 4IP1A 2L6DA 4GWRA 1KTEA 3D4MA 4PUFC 2PUKC 3BOAA 1OE8A 2WCIA 2VUPA 2XC2A 3BCIA 4KA0A 1BEDA 2FA4A 5IO0A 5JWOB 2R0GA 1G0TA 1X0RA 1XCCA 1AQXA 5D9WA 1PL2A 3VWVA 4A5PA 1WRYA 19GSA 2VL2A 3LYPA 3EVIA 5KEJA 3K8NA 4TVEA 3L9VA 4ZL9A 3Q19A 2R37A 4BVYA 5D93A 2UV8G 4D73A 3ZRDA 5A34B 20GSA 4ZB6A 1XIYA 3LQ7A 1GNWA 2GS3A 1YZXA 1ZYNA 5CO3A 5D8IA 3IHGA 1O8XA 3SWLA 4FYCA 3PR8A 1O81A 2YJHA 4O92A 2MMOA 3IA1A 1MTCA 2LRTA 2I4AA 1FB6A 1MD3A 2Z9SA 3CSIA 1B9XC 2CX4A 3TU3B 2H0GA 1R26A 4JR6A 7GSSA 5HR0A 2PPTA 1K0AA 2CV4A 4I2TA 3W8SA 1T1VA 2DKHA 2G0FA 3A5WA 4ILFA 4TR1A 4KUNA 2FA8A 2B1KA 1Z6MA 3TJBA 1BJXA 4AKIA 5GZZB 2CZ2A 3D21A 1RK4A 3QAVA 2C80A 2VCQA 22GSA 3HDCA 2KP2A 2R0CA 1BX9A 2CA8A 4MZWA 4RI7A 3EE2A 4BL7A 1M2AA 1OC9A 1G7OA 5G1KA 5D9TA 3P2AA 2GZYA 2GTUA 5CRHA 3KP8A 5DVBA 1T8EB 4IN0A 4F9ZA 2C0DA 4HI7A 1YKCA 4I5QA 4O5QA 3KTBA 2GSSA 1GL8A 3DEXA 1BF5A 6GSTA 4F0CA 1B4QA 1V9WA 4POBA 3CBUA 1SK2A 1N2AA 3ZITA 2V41A 4HDEA 4BPYA 4KF9A 1SYXA 2YZHA 5HQPA 2LTKA 4WR5A 2TRXA 2HRKA 4MPGA 2GLRA 3EC3A 3HMJG 1F3AA 4PXOA 3QAWA 4ACSA 3QFAC 5LNKe 1J08A 4OMVA 3KP9A 1ZYQB 3KZQA 1UA5A 8GSSA 1U3AA 4DSQA 3GX8A 2M72A 5AIXA 2B6MA 4N0ZA 2H19A 2C3QA 3EU3A 3IK9A 4GQFA 3D22A 3EPTA 4MA9A 4PNFA 4IKHA 2BJXA 2CVKA 3KIJA 2WZ9A 2JL4A 1ZMAA 1YF0A 2E7PA 2RUEA 1FOVA 1QMVA 4V1Ag 2LNSA 3S9FA 2H1BA 4G10A 2FCHA 3IV4A 5D9XA 4IELA 3F3QA 4KE3A 2MMAA 2HE3A 3PPUA 4ZIJA 1OYJA 2V1MA 2DC5A 2NVLA 4HZ2A 1SK1A 5KOWA 2NPBA 1QK8A 2LNTA 2MBTA 3ZMKA 5CRWA 1J9BA 5J40A 2PN8A 3A3TA 4EO3A 2JSZA 3Q6OA 1BQ7A 2X49A 4MMMA 2AV4A 3LWAA 3KH9A 1JLWA 3EYTA 1GP1A 3D4TA 4BL7B 3KEBA 3WGDA 2VL2C 3FW2A 2H73A 1OE7A 5AGYA 1OVNA 3ZFBA 3BD2A 2DJ0A 3ZL5A 4MZCA 4K9ZA 4HZ4A 4ICYA 1QGVA 1JZDA 2WJUA 2IIYA 3ZVJA 1Z7RA 2AAWA 5B7CA 3ME7A 3M3MA 5CYYA 1G6YA 1SYRA 1FW1A 1LU4A 2OT3A 4N11A 2HRAA 1UVZA 4IW9A 4MK3A 3G9BA 3CXGA 1FOHA 4IJIA 1YVLA 1VF3A 4GSNA 5FWGA 1A2MA 3TJGA 5AISA 1BG5A 3RAZA 1ERWA 2OJLA 2DJ2A 4HUAA 4LMVA 2M80A 5KN3A 4PUAA 4YKFA 1GUMA 5F0GA 2H74A 2JU5A 2CAIA 2AUVA 2EFCA 4X4JA 4MH3A 1JLVA 3GSTA 1A2LA 3H4KA 1M9BA 3D0ZA 3UBKA 2OBKA 1K3LA 5BRTA 5ECQB 2H71A 3GYKA 2L4CA 4EDZA 2IMDA 4L5OA 1Q98A 3VI7A 2NTOA 4DSRA 4KB3A 2FWHA 1NSWA 4WR4A 3LGCA 2HT9A 3H1NA 6GSXA 2HSYA 2K18A 5ELAA 2OKAA 4AKXB 2ZNMA 1QFNA 5JWRB 1GUKA 4I8BA 4LL1B 4ZL8A 4J57E 2YOIA 5DQSA 2FWFA 1DE1A 3CWGA 4NAXA 1FHEA 2K8SA 1F9MA 3WT2A 3CRUA 1ZCPA 1O85A 1SJZA 1ON4A 1PKWA 2VO4A 2FHEA 5FT3A 3QAGA 4P3YB 2L4QA 2HYXA 1OC8A 1PN9A 4W66A 4EKZA 4YQVA 3FR3A 4ZBDA 2GVPA 2LS5A 3FZ4A 4AI6A 3Q18A 4KCEA 2LJRA 2ALBA 1N25A 4PQIA 5J3RA 2TRCP 3KGKA 5D73A 3MWHA 3RPPA 4YQUA 5ECMB 1FB0A 2GSTA 2R6KA 1U88A 5ECPB 4CHSA 2H01A 1GLPA 2VLUA 2E2MA 1GTUA 3FZ5A 4MCUA 2RUFA 4MH2A 5ECRB 2YWMA 3D5JA 1YF1A 1K0OA 4ZILA 2IFQA 1UC7A 1JFUA 2F51A 2MMNA 3HVXA 3SBCA 4HJ2A 1M7TA 5C04A 4HQSA 3ZYWA 5CREA 3EU4A 3CMIA 3TCOA 1T7PB 4CDOA 2VLTA 1Q4JA 3QR6A 4F03A 3PH9A 4YKGA 2YANA 5GSSA 3F4RA 3GTUB 3ZVJD 3TGZA 3NOFA 5J4UA 3I43A 2CT6A 2KOKA 2KUCA 2O89A 2H70A 3O6TA 2A2SA 3BCKA 1C72A 3KJYA 3R2QA 4K7IA 3FZ9A 3IDVA 3MNGA 2P5QA 4ECBA 4MJBA 1TTZA 1HNBA 1AW9A 2WRTA 1MD4A 2L59A 3CTGA 2N5FA 5GAND 2PWJA 1R5AA 3VPQA 3LEFA 1A0RP 1JHBA 1CQHA 4ZL7A 3MSZA 3HD5A 1ML6A 4RUVA 4KDUA 4KAEA 2DSAA 2LSTA 3CRTA 2A4HA 2I81A 1TRSA 1SKWB 1VF2A 4GSTA 3QOUA 4XRAA 3DGQA 3TKSA 2LQQA 1UN2A 5ID2A 3EMXA 5J5NA 2VM2A 4JR4A 2YP6A 4QMKA 3LJRA 2VL9A 4MNNA 3UOMA 1X9WB 2L5OA 3APQA 1B9YC 2IL3A 4ZXGA 2HFDA 2XBQA 4K5SA 4POLA 2C0FA 1TRWA 3ME8A 5A4UA 3FYGA 1F37A 5IQYA 1S3DA 1U3IA 3KM6A 2WFCA 1GLQA 3LFLA 3M0FA 1XZOA 2FUG2 1Z3EA 2QA2A 1GSUA 3DVWA 3U6VA 5JCGA 2B5XA 3MIXA 5IMVA 4TR0A 4ZB8A 1HQOA 1SENA 5AIVA 5ENUA 1DSBA 2YPMA 3C73A 3DIEA 1THOA 1DUGA 3GSSA 3LORA 5ECHB 2DJ3A 1HNAA 4PX1A 3GA4A 3F4SA 2IFQB 3TKRA 3UMAA 3GMFA 1E2YA 4WF4A 2QC7A 3WD6A 1Z7PA 1XWAA 1J0FA 1TRUA 2V6OA 1R4WA 3LSZA 3UIWA 1ZZYA 2HQTA 2EC4A 3HCZA 1YEPA 2K6VA 1XVWA 2OBIA 3TKQA 3ERWA 1EOHA 5D96A 5A5HA 1GWCA 2J23A 5E59A 3TKSE 4KSMA 4X1UA 5ELGA 3UAPA 5DAKA 1M99A 4E8EA 2YJ7A 3APOA 1G7EA 2DKIA 2OADA 2LKUA 5HFKA 4OO5A 4HJMA 1DBYA 3QCPA 2B7JA 3MDKA 5DQYA 4PTSA 4HEA2 5EY6A 2X4AA 3IE3A 1EGRA 5IIZA 4FH8A 4WBRD 1VRSD 4XIHA 1PX6A 3I69A 2VM1A 1XWCA 1TI1A 2GGTA 2PBJA 2R4VA 4JE1A 4BWSA 3KD0A 4GDFA 4MF6A 4ULXA 2JACA 3DVXA 2L6CA 2R2JA 4IHUA 3F0IA 5ID2B 1TI3A 3F8UA 4TN8A 1NW2A 5KOXA 3I6AA 16GSA 1YY7A 4JU5A 3KXOA 3F6FA 4Q5NA 2FGXA 4MF5A 5GAPD 2IMIA 3EWLA 1GSQA 1X5EA 4OO4A 3MYDA 5H5RA 5G1LA 2OA7A 1RW1A 2C4JA 2YNXA 1VF4A 4K1FA 1A2JA 2B1LA 3GKXA 2YV7A 3UJ1A 4MF7A 4V2MA 2LV3A 3UARA 3KH7A 3GNJA 1I5GA 4KW6A 4AJ8A 1NHOA 4KSOA 2ZCTA 2ON7A 4J56E 3VK9A 2ZUPA 6GSVA 4XS1A 3IC8A 2XHFA 3ERGA 3GUSA 2HZEA 1WE0A 1SJIA 1VF1A 4Z2UA 2F8AA 1PKZA 1MEKA 4IQ1A 2DIYA 2EIRA 3KTLA 4I2UA 2J9HA 4OWYA 3HA9A 3TKSC 3VURA 1Z9HA 3TJFA 4XCSA 5HFIA 1SD8A 2OE1A 5ECLB 5BMUA 4G19A 1TU7A 1ERVA 5A5HB 4XS4A 1GTIA 2NDOA 3TRXA 2ON5A 5IMAA 4TKYA 2FLSA 5KN1A 2DMMA 5DAKB 5ECSA 3PINA 4YAPA 4GRFA 2GT5A 1SU9A 4MJEA 5IPGA 3GRXA 3MAKA 1AXDA 2L5LA 2H8LA 2C0EA 3M9KA 3LXTA 2F8FA 4YH2A 3DYRA 2OE3A 5EL8A 4DVCA 2IWTA 4CY8A 1TK0B 2PERA 4ECIA 1GH2A 3JCML 1NM3A 2O7KA 1WPIA 1QUWA 2EFDA 4OFTA 4MP4A 6GSYA 1XW6A 2IJYA 1XWGA 1EV9A 3EURA 3PGTA 1SD9A 2N5AA 4BA7A 4TXVA 3CTFA 1GNEA 1PQNA 3OR5A 1TJDA 3VWXA 2H75A 1A24A 2AB6A 5F06A 4NHZA 1EP8A 4CY6A 1SJ6A 5ECOB 1AAZA 2H1DA 1M2BA 3N5OA 4O5RA 5J4YA 3M9JA 1K0BA 1EEJA 4YAVA 1TDIA 5ECKB 3ZMLA 1YJ6A 1T4YA 1PN0A 1MDKA 3GTUA 2V32A 1S3AA 4POKA 3GKKA 13GSA 3M8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R3E A;  4Z7X A;  3IC4 A;  1R5P A;  4WBJ A;  4AJ7 A;  2HZE B;  1KBN A;  3C71 A;  3F6D A;  5COH A;  1ZGN A;  2GZZ A;  1TKD B;  1SKR B;  3HY2 A;  2VCW A;  4CW9 A;  1JZR A;  2DML A;  2DLX A;  5DCH A;  5KN2 A;  4XRD A;  1GSY A;  2WS2 A;  1A8L A;  4XS4 B;  6GSW A;  4DSS A;  1SL2 B;  4GSS A;  1RQM A;  2HSN B;  18GS A;  4KGI A;  3QPM A;  3DXB A;  5JCU A;  3IR4 A;  1ZOF A;  4I6X A;  3L4N A;  1T00 A;  2XPE A;  5EPF A;  3FZA A;  5DAL B;  4OFN A;  5CNW A;  5CRG A;  3HKR A;  2GZP A;  1M9A A;  5IMC A;  2F3M A;  1W89 A;  3GN3 A;  4G9H A;  3UL3 A;  1AUC A;  4POM A;  5KN0 A;  4JED A;  3ZFL A;  3WGE A;  2K9F A;  4K7N A;  2H6Z A;  2X8G A;  3DRN A;  2P0G A;  1FO5 A;  1W4V A;  2EIO A;  4FYU A;  1U6T A;  4QL7 A;  5G30 A;  1EZK A;  3GUR A;  1TRV A;  5CAX A;  3E9J B;  4O7H A;  3C1R A;  1XXU A;  3ISO A;  4IP6 A;  3W6G A;  2TIR A;  1K0D A;  4EL1 A;  4RQR A;  2UZ8 A;  4JZQ A;  1I9D A;  3GH9 A;  2BMX A;  5C00 A;  2GQK A;  2A2R A;  1V98 A;  4L0W A;  1E6B A;  3FR9 A;  5H5Q A;  2N5B A;  2VL3 A;  4IVF A;  2HRF A;  3IXR A;  3H8Q A;  4X43 A;  1K0N A;  3IPZ A;  3ED3 A;  5F07 A;  2VLV A;  2X99 A;  2A4V A;  2VAF A;  2PVQ A;  5HR3 A;  2QGV A;  1GUL A;  3P7X A;  4N30 A;  2VCX A;  2IN3 A;  4EF0 A;  4IGJ A;  4KX4 A;  4FQU A;  4PGT A;  1OAZ A;  1WP0 A;  4Q5Q A;  1TK5 B;  1NHY A;  3CSJ A;  4N10 A;  5G31 A;  2RM5 A;  4OCF A;  2AJQ B;  1V2A A;  4K6X A;  3IRA A;  1XW5 A;  2O87 A;  4EXJ A;  4BWQ A;  5A5K A;  4NV2 A;  4PUR A;  3VFI A;  4F82 A;  3ZRE A;  1V58 A;  1TXX A;  2GT6 A;  4KND A;  1LJR A;  3IK7 A;  4XTS A;  2JZS A;  4DSS B;  5B8B A;  2OAC A;  1FVJ A;  1GSE A;  4USS A;  4KCA A;  5ECI B;  1V57 A;  3LG6 A;  1T3B A;  4ML1 A;  3UVT A;  2H66 A;  2VCT A;  5HR1 A;  2CAQ A;  5G5F A;  1PSQ A;  1QQ2 A;  5IPH A;  4NV5 A;  2I1U A;  9GSS A;  1IYH A;  2H1A A;  4HQZ A;  3QD9 A;  1AQV A;  4G2E A;  1Y6E A;  2GDR A;  5CRD A;  1O73 A;  4IQA A;  3US3 A;  3L9U A;  5L71 A;  3EMP A;  2CZ3 A;  2NBS A;  3WYW A;  2HSH A;  1USB A;  2O85 A;  2IME A;  3HVS A;  4V2L A;  4WEY A;  1H75 A;  2B7K A;  5F05 A;  2O8V B;  3VWU A;  2BTO T;  3ZLP A;  1N8J A;  2B5Y A;  5IMZ A;  3ERF A;  1XFL A;  3A2W A;  4WXT A;  5IO2 A;  4WET A;  6GSS A;  3D6I A;  3V1W A;  3J7Y k;  5J9C A;  4G0I A;  3DKS A;  1WIK A;  2VIM A;  1BAY A;  2KLX A;  5G5E A;  4PQH A;  1ACV A;  2H6X A;  1EEM A;  1GRX A;  1IYI A;  1K3O A;  1AQW A;  5ABR A;  1XWK A;  3KMO A;  4E8H A;  4AJ6 A;  5IOW A;  2H72 A;  3GL3 A;  3NIV A;  3P90 A;  1EV4 A;  3FRC A;  3CYN A;  4RI6 A;  2P5R A;  2C3T A;  3FK8 A;  3HYP A;  2GSQ A;  2V6K A;  3C7M A;  4TXO B;  4HU9 A;  3WT1 A;  2HSM A;  4ZB9 A;  1MDI A;  4K2D A;  2DJK A;  1SL1 B;  3W8J A;  5A4V A;  2LUS A;  4LL4 B;  3LXZ A;  1URM A;  1Y25 A;  5F8B A;  1H4O A;  3TJJ A;  3H79 A;  3F63 A;  3DWV A;  3TJK A;  3TDG A;  1EP7 A;  1TK8 B;  1T4Z A;  3O76 A;  1X9S B;  1B48 A;  4FYB A;  4TR3 A;  1XOB A;  1OKD A;  4ECC A;  2D2Z A;  1ZL9 A;  1O6J A;  4JBB A;  2WUL A;  3HJO A;  4EVM A;  3U5R E;  3HJP A;  2RLI A;  1DE2 A;  1OKT A;  1ERU A;  1TU8 A;  2PU9 C;  2VD1 A;  1A8Y A;  3HZ8 A;  3O3T A;  1SL0 B;  2ES7 A;  2CVD A;  4JRR A;  5D9V A;  4GXZ A;  3TUE A;  3L9S A;  2R3X A;  3TOT A;  3GFK A;  3C8E A;  1SKS B;  4Q5R A;  5DJL A;  5DCG A;  3NZN A;  3GKM A;  4J2F A;  3IHQ A;  4NWY A;  3VLN A;  1GSD A;  1XVQ A;  1BYE A;  2E2G A;  2GSR A;  1XBS A;  3ZIJ A;  1WOU A;  1R7H A;  2YWN A;  2H1G A;  4KDY A;  2V2G A;  4MZB A;  4DEJ A;  2L57 A;  1Z5Y E;  1A0F A;  4IBP A;  3RHC A;  4EDY A;  3GIX A;  2P31 A;  1KEB A;  1PRX A;  5J41 A;  4YQM A;  4PQ1 A;  4EE0 A;  3RDW A;  1PA3 A;  4BVY B;  4LLR A;  4D73 B;  4L8E A;  5FHI A;  4KH7 A;  3BJ5 A;  4QL9 A;  2IPA A;  3HXS A;  1EOG A;  2X8H A;  2YN1 A;  3TKP A;  2X8C A;  3ZZX A;  2FWG A;  2I3Y A;  4L0U A;  1M2D A;  1YEX A;  3RBT A;  2HSM B;  5A4W A;  2CX3 A;  1GTB A;  1OC3 A;  1WWJ A;  2C3N A;  1X5C A;  2JZT A;  3IAS 2;  4WF5 A;  4HOJ A;  5DAL A;  2C8U A;  4FO5 A;  2JAD A;  2OE0 A;  1ST9 A;  1XPV A;  3DD3 A;  2MYG A;  5INY A;  1XOA A;  4TR1 B;  3FKF A;  3M1G A;  1B4P A;  4MJA A;  1V40 A;  1HD2 A;  2HXK A;  2X64 A;  4F0B A;  3FY7 A;  4KDX A;  2HZF A;  2DJJ A;  2EIQ A;  4BVX A;  1CQG A;  4WKW A;  1HNC A;  3TRQ A;  3F3R A;  4GTU A;  1B8X A;  6GSU A;  3TB2 A;  3TRP A;  2FY6 A;  2DJ1 A;  3GV1 A;  1K0M A;  1THX A;  4IS0 A;  4MDC A;  2I9H A;  11GS A;  1OC9 B;  3H93 A;  5LD0 A;  4TOP A;  1JZW A;  2VD0 A;  2E0Q A;  2LJA A;  3HJM A;  1YDK A;  1QXH A;  2H0H A;  4OD7 A;  2VCZ A;  1AIU A;  2PGT A;  1X5D A;  5B6M A;  4TW5 A;  1VGL A;  4V2N A;  10GS A;  5B8A A;  3HVV A;  4ML6 A;  3DML A;  3WGX A;  3EIN A;  4ID0 A;  4GCI A;  2IMK A;  2K8V A;  2H6Y A;  5DDL A;  2DIZ A;  5H5S A;  4MJC A;  2YV9 A;  5EVO A;  4ISD A;  4ZBB A;  1ABA A;  3LYK A;  4QQ7 A;  1O8W A;  5CP1 A;  2H0I A;  3L78 A;  2QKE A;  2HRK B;  2H30 A;  3L0H A;  5ECN B;  1XWB A;  1S3C A;  3G7J A;  3I9V 2;  1O7U A;  2YWI A;  3FR6 A;  4XHM A;  4NMU A;  2LRC A;  12GS A;  4EC0 A;  2F9S A;  1JZO A;  2VCV A;  5G2Z A;  4OFM A;  2PVO C;  3TOU A;  1PGT A;  2B3S A;  4LMW A;  4LA1 A;  1K3Y A;  1YKA A;  2G2Q A;  1XW9 A;  2C0G A;  1WMJ A;  4GQC A;  3A2V A;  4TR4 A;  3GX0 A;  2CQ9 A;  4ECJ A;  3Q74 A;  2DBC A;  2YZU A;  2MZC A;  5JCW A;  2HRN A;  2AYT A;  1SK0 A;  1PL1 A;  2C1Y A;  5IMF A;  1A23 A;  5GST A;  2LEG A;  4L5L A;  3GHA A;  4MAB A;  2R5G A;  3HHV A;  4GLT A;  1FAA A;  2RM6 A;  4TRX A;  4EUY A;  2VOC A;  4G0K A;  1PD2 1;  3IBH A;  3VWW A;  4K0G A;  4IJ3 A;  4MPF A;  1GTA A;  3F4T A;  2KP1 A;  2LRN A;  3VI5 A;  5DJM A;  3P8W A;  4BVX B;  2JZR A;  4K8M A;  3ZTL A;  3QMX A;  2KHP A;  4MLY A;  2MMZ A;  3GH6 A;  1TP9 A;  2YWO A;  2LQO A;  4N0V A;  1ILO A;  2WDU A;  2CVB A;  5B6N A;  1Z6N A;  1WJK A;  2IMF A;  5E4W A;  1EGO A;  4GF0 A;  2FWE A;  3BBY A;  4AF2 A;  4OCE A;  1PX7 A;  5DBQ A;  3J7Y b;  4NHW A;  2PMT A;  3CSH A;  3N9J A;  4HS1 A;  3QFB C;  2H76 A;  1G6W A;  3VPT A;  3ZIV A;  2LJK A;  4X0X A;  1F6M C;  2WB9 A;  3RHB A;  14GS A;  2B5E A;  2FD3 A;  3FHK A;  3IOS A;  3AY8 A;  4PNG A;  4AGS A;  1GSF A;  5HFG A;  1PMT A;  2QSI A;  4G0L A;  1TW9 A;  3IAM 2;  4XS6 A;  4RQX A;  4TXO A;  1KNG A;  1X9M B;  1AC1 A;  2MBS A;  3RPN A;  1YQ1 A;  2JSY A;  3GL5 A;  3QDN A;  1ERT A;  5LCZ A;  1M0U A;  4Q5F A;  3F9U A;  5AN1 A;  4F2I A;  1ZYE A;  5IOX A;  1K0C A;  4K7O A;  2GQM A;  2WGR A;  4NPB A;  1MDJ A;  1EWX A;  1F3B A;  4NXI A;  4FIW A;  4O32 A;  2M46 A;  3GKN A;  3C1S A;  4K0N A;  5IM9 A;  2HNL A;  5J9B A;  5JWQ B;  4ZBA A;  1GSS A;  1HYU A;  2REM A;  1U87 A;  2AHE A;  4V1A p;  3UEM A;  1FVK A;  1F2E A;  3UBL A;  17GS A;  1GUH A;  2XPD A;  3APS A;  1LBK A;  3KCM A;  2XBI A;  2HLS A;  2FNO A;  1FG4 A;  5HR2 A;  3E3E A;  4I97 A;  3UVH A;  1TOF A;  4HU7 A;  3FEU A;  2HI7 A;  2RII A;  3G7Y A;  3G7I A;  2YCD A;  4H86 A;  3HZ4 A;  3E0U A;  3KMN A;  3A2X A;  5IMD A;  2GQL A;  4IP1 A;  2L6D A;  4GWR A;  1KTE A;  3D4M A;  4PUF C;  2PUK C;  3BOA A;  1OE8 A;  2WCI A;  2VUP A;  2XC2 A;  3BCI A;  4KA0 A;  1BED A;  2FA4 A;  5IO0 A;  5JWO B;  1G0T A;  1X0R A;  1XCC A;  1AQX A;  5D9W A;  1PL2 A;  3VWV A;  1WRY A;  19GS A;  2VL2 A;  3LYP A;  3EVI A;  5KEJ A;  3K8N A;  4TVE A;  3L9V A;  4ZL9 A;  3Q19 A;  2R37 A;  4BVY A;  5D93 A;  4D73 A;  3ZRD A;  20GS A;  4ZB6 A;  1XIY A;  3LQ7 A;  1GNW A;  2GS3 A;  1YZX A;  5CO3 A;  5D8I A;  1O8X A;  3SWL A;  4FYC A;  3PR8 A;  1O81 A;  2YJH A;  4O92 A;  2MMO A;  3IA1 A;  1MTC A;  2LRT A;  2I4A A;  1FB6 A;  1MD3 A;  2Z9S A;  3CSI A;  1B9X C;  2CX4 A;  2H0G A;  1R26 A;  4JR6 A;  7GSS A;  5HR0 A;  2PPT A;  1K0A A;  2CV4 A;  4I2T A;  3W8S A;  1T1V A;  2G0F A;  3A5W A;  4ILF A;  4TR1 A;  4KUN A;  2FA8 A;  2B1K A;  1Z6M A;  3TJB A;  1BJX A;  5GZZ B;  2CZ2 A;  3D21 A;  1RK4 A;  3QAV A;  2C80 A;  2VCQ A;  22GS A;  3HDC A;  2KP2 A;  1BX9 A;  2CA8 A;  4MZW A;  4RI7 A;  3EE2 A;  4BL7 A;  1M2A A;  1OC9 A;  1G7O A;  5G1K A;  5D9T A;  3P2A A;  2GZY A;  2GTU A;  5CRH A;  3KP8 A;  5DVB A;  1T8E B;  4IN0 A;  4F9Z A;  2C0D A;  4HI7 A;  1YKC A;  4I5Q A;  3KTB A;  2GSS A;  1GL8 A;  3DEX A;  6GST A;  4F0C A;  1B4Q A;  1V9W A;  4POB A;  3CBU A;  1SK2 A;  1N2A A;  3ZIT A;  2V41 A;  4HDE A;  4BPY A;  4KF9 A;  1SYX A;  2YZH A;  5HQP A;  2LTK A;  4WR5 A;  2TRX A;  2HRK A;  4MPG A;  2GLR A;  3EC3 A;  1F3A A;  4PXO A;  3QAW A;  4ACS A;  3QFA C;  5LNK e;  1J08 A;  4OMV A;  3KP9 A;  1ZYQ B;  3KZQ A;  1UA5 A;  8GSS A;  1U3A A;  4DSQ A;  3GX8 A;  2M72 A;  5AIX A;  2B6M A;  4N0Z A;  2H19 A;  2C3Q A;  3EU3 A;  3IK9 A;  4GQF A;  3D22 A;  4MA9 A;  4PNF A;  4IKH A;  2BJX A;  2CVK A;  3KIJ A;  2WZ9 A;  2JL4 A;  1ZMA A;  1YF0 A;  2E7P A;  2RUE A;  1FOV A;  1QMV A;  4V1A g;  2LNS A;  3S9F A;  2H1B A;  4G10 A;  2FCH A;  3IV4 A;  5D9X A;  4IEL A;  3F3Q A;  4KE3 A;  2MMA A;  2HE3 A;  3PPU A;  4ZIJ A;  1OYJ A;  2V1M A;  2DC5 A;  2NVL A;  4HZ2 A;  1SK1 A;  2NPB A;  1QK8 A;  2LNT A;  2MBT A;  3ZMK A;  5CRW A;  1J9B A;  2PN8 A;  3A3T A;  4EO3 A;  2JSZ A;  3Q6O A;  1BQ7 A;  4MMM A;  2AV4 A;  3LWA A;  3KH9 A;  1JLW A;  3EYT A;  1GP1 A;  3D4T A;  4BL7 B;  3KEB A;  3WGD A;  2VL2 C;  3FW2 A;  2H73 A;  1OE7 A;  5AGY A;  1OVN A;  3ZFB A;  3BD2 A;  2DJ0 A;  3ZL5 A;  4MZC A;  4K9Z A;  4HZ4 A;  1QGV A;  1JZD A;  2WJU A;  2IIY A;  3ZVJ A;  1Z7R A;  2AAW A;  5B7C A;  3ME7 A;  3M3M A;  5CYY A;  1G6Y A;  1SYR A;  1FW1 A;  1LU4 A;  4N11 A;  2HRA A;  1UVZ A;  4IW9 A;  4MK3 A;  3G9B A;  3CXG A;  4IJI A;  1VF3 A;  4GSN A;  5FWG A;  1A2M A;  3TJG A;  5AIS A;  1BG5 A;  3RAZ A;  1ERW A;  2OJL A;  2DJ2 A;  4HUA A;  4LMV A;  2M80 A;  5KN3 A;  4PUA A;  1GUM A;  5F0G A;  2H74 A;  2JU5 A;  2CAI A;  2AUV A;  4MH3 A;  1JLV A;  3GST A;  1A2L A;  3H4K A;  1M9B A;  3D0Z A;  3UBK A;  2OBK A;  1K3L A;  5ECQ B;  2H71 A;  3GYK A;  2L4C A;  4EDZ A;  2IMD A;  4L5O A;  1Q98 A;  3VI7 A;  2NTO A;  4DSR A;  4KB3 A;  2FWH A;  1NSW A;  4WR4 A;  3LGC A;  2HT9 A;  3H1N A;  6GSX A;  2HSY A;  2K18 A;  5ELA A;  2OKA A;  2ZNM A;  1QFN A;  5JWR B;  1GUK A;  4I8B A;  4LL1 B;  4ZL8 A;  4J57 E;  2YOI A;  5DQS A;  2FWF A;  1DE1 A;  3WT2 A;  4NAX A;  1FHE A;  2K8S A;  1F9M A;  3CRU A;  1ZCP A;  1O85 A;  1SJZ A;  1ON4 A;  1PKW A;  2VO4 A;  2FHE A;  5FT3 A;  3QAG A;  4P3Y B;  2L4Q A;  2HYX A;  1OC8 A;  1PN9 A;  4EKZ A;  4YQV A;  3FR3 A;  4ZBD A;  2GVP A;  2LS5 A;  3FZ4 A;  3Q18 A;  4KCE A;  2LJR A;  2ALB A;  4PQI A;  5J3R A;  2TRC P;  3KGK A;  5D73 A;  3MWH A;  3RPP A;  4YQU A;  5ECM B;  1FB0 A;  2GST A;  2R6K A;  1U88 A;  5ECP B;  4CHS A;  2H01 A;  1GLP A;  2VLU A;  2E2M A;  1GTU A;  3FZ5 A;  4MCU A;  2RUF A;  4MH2 A;  5ECR B;  2YWM A;  3D5J A;  1YF1 A;  1K0O A;  4ZIL A;  2IFQ A;  1UC7 A;  1JFU A;  2F51 A;  2MMN A;  3HVX A;  3SBC A;  4HJ2 A;  1M7T A;  5C04 A;  4HQS A;  3ZYW A;  5CRE A;  3EU4 A;  3CMI A;  3TCO A;  1T7P B;  4CDO A;  2VLT A;  1Q4J A;  3QR6 A;  4F03 A;  3PH9 A;  2YAN A;  5GSS A;  3F4R A;  3GTU B;  3ZVJ D;  3TGZ A;  3NOF A;  5J4U A;  3I43 A;  2CT6 A;  2KOK A;  2KUC A;  2O89 A;  2H70 A;  3O6T A;  2A2S A;  3BCK A;  1C72 A;  3KJY A;  3R2Q A;  4K7I A;  3FZ9 A;  3IDV A;  3MNG A;  2P5Q A;  4ECB A;  4MJB A;  1TTZ A;  1HNB A;  1AW9 A;  2WRT A;  1MD4 A;  2L59 A;  3CTG A;  2N5F A;  5GAN D;  2PWJ A;  1R5A A;  3VPQ A;  3LEF A;  1A0R P;  1JHB A;  1CQH A;  4ZL7 A;  3MSZ A;  3HD5 A;  1ML6 A;  4RUV A;  4KDU A;  4KAE A;  2DSA A;  2LST A;  3CRT A;  2I81 A;  1TRS A;  1SKW B;  1VF2 A;  4GST A;  3QOU A;  4XRA A;  3DGQ A;  3TKS A;  2LQQ A;  1UN2 A;  5ID2 A;  3EMX A;  5J5N A;  2VM2 A;  4JR4 A;  2YP6 A;  3LJR A;  2VL9 A;  3UOM A;  1X9W B;  2L5O A;  3APQ A;  1B9Y C;  2IL3 A;  4ZXG A;  2HFD A;  2XBQ A;  4POL A;  2C0F A;  1TRW A;  3ME8 A;  5A4U A;  3FYG A;  1F37 A;  5IQY A;  1S3D A;  1U3I A;  3KM6 A;  2WFC A;  1GLQ A;  3LFL A;  3M0F A;  1XZO A;  2FUG 2;  1Z3E A;  1GSU A;  3DVW A;  3U6V A;  5JCG A;  2B5X A;  5IMV A;  4TR0 A;  4ZB8 A;  1HQO A;  1SEN A;  5AIV A;  5ENU A;  1DSB A;  2YPM A;  3C73 A;  3DIE A;  1THO A;  1DUG A;  3GSS A;  3LOR A;  5ECH B;  2DJ3 A;  1HNA A;  4PX1 A;  3GA4 A;  3F4S A;  2IFQ B;  3TKR A;  3UMA A;  3GMF A;  1E2Y A;  4WF4 A;  2QC7 A;  3WD6 A;  1Z7P A;  1XWA A;  1J0F A;  1TRU A;  2V6O A;  1R4W A;  3LSZ A;  3UIW A;  1ZZY A;  2HQT A;  2EC4 A;  3HCZ A;  1YEP A;  2K6V A;  1XVW A;  2OBI A;  3TKQ A;  3ERW A;  1EOH A;  5D96 A;  1GWC A;  2J23 A;  5E59 A;  3TKS E;  4KSM A;  4X1U A;  5ELG A;  3UAP A;  5DAK A;  1M99 A;  4E8E A;  2YJ7 A;  3APO A;  1G7E A;  2OAD A;  2LKU A;  5HFK A;  4OO5 A;  4HJM A;  1DBY A;  3QCP A;  2B7J A;  3MDK A;  5DQY A;  4PTS A;  4HEA 2;  5EY6 A;  3IE3 A;  1EGR A;  5IIZ A;  4FH8 A;  4WBR D;  1VRS D;  4XIH A;  1PX6 A;  3I69 A;  2VM1 A;  1XWC A;  1TI1 A;  2GGT A;  2PBJ A;  2R4V A;  4JE1 A;  4BWS A;  3KD0 A;  4MF6 A;  4ULX A;  2JAC A;  3DVX A;  2L6C A;  2R2J A;  4IHU A;  3F0I A;  5ID2 B;  1TI3 A;  3F8U A;  4TN8 A;  1NW2 A;  3I6A A;  16GS A;  1YY7 A;  4JU5 A;  3KXO A;  3F6F A;  4Q5N A;  2FGX A;  4MF5 A;  5GAP D;  2IMI A;  3EWL A;  1GSQ A;  1X5E A;  4OO4 A;  5H5R A;  5G1L A;  2OA7 A;  1RW1 A;  2C4J A;  2YNX A;  1VF4 A;  4K1F A;  1A2J A;  2B1L A;  3GKX A;  2YV7 A;  3UJ1 A;  4MF7 A;  4V2M A;  2LV3 A;  3UAR A;  3KH7 A;  3GNJ A;  1I5G A;  4KW6 A;  4AJ8 A;  1NHO A;  4KSO A;  2ZCT A;  2ON7 A;  4J56 E;  3VK9 A;  2ZUP A;  6GSV A;  4XS1 A;  3IC8 A;  2XHF A;  3ERG A;  3GUS A;  2HZE A;  1WE0 A;  1SJI A;  1VF1 A;  2F8A A;  1PKZ A;  1MEK A;  4IQ1 A;  2DIY A;  2EIR A;  3KTL A;  4I2U A;  2J9H A;  4OWY A;  3HA9 A;  3TKS C;  3VUR A;  1Z9H A;  3TJF A;  4XCS A;  5HFI A;  1SD8 A;  2OE1 A;  5ECL B;  5BMU A;  4G19 A;  1TU7 A;  1ERV A;  4XS4 A;  1GTI A;  2NDO A;  3TRX A;  2ON5 A;  5IMA A;  4TKY A;  2FLS A;  5KN1 A;  2DMM A;  5DAK B;  5ECS A;  3PIN A;  4YAP A;  4GRF A;  2GT5 A;  1SU9 A;  4MJE A;  5IPG A;  3GRX A;  3MAK A;  1AXD A;  2L5L A;  2H8L A;  2C0E A;  3M9K A;  3LXT A;  2F8F A;  4YH2 A;  3DYR A;  2OE3 A;  5EL8 A;  4DVC A;  2IWT A;  1TK0 B;  2PER A;  4ECI A;  1GH2 A;  3JCM L;  1NM3 A;  2O7K A;  1WPI A;  1QUW A;  4OFT A;  4MP4 A;  6GSY A;  1XW6 A;  2IJY A;  1XWG A;  1EV9 A;  3EUR A;  3PGT A;  1SD9 A;  2N5A A;  4BA7 A;  4TXV A;  3CTF A;  1GNE A;  1PQN A;  3OR5 A;  1TJD A;  3VWX A;  2H75 A;  1A24 A;  2AB6 A;  5F06 A;  4NHZ A;  1EP8 A;  1SJ6 A;  5ECO B;  1AAZ A;  2H1D A;  1M2B A;  3N5O A;  4O5R A;  3M9J A;  1K0B A;  1EEJ A;  4YAV A;  1TDI A;  5ECK B;  3ZML A;  1YJ6 A;  1T4Y A;  1MDK A;  3GTU A;  2V32 A;  1S3A A;  4POK A;  3GKK A;  13GS A;  3M8N A; 
#chains in the Genus database with same CATH topology
 3R3E A;  4Z7X A;  3IC4 A;  1R5P A;  4WBJ A;  4AJ7 A;  2HZE B;  1KBN A;  3C71 A;  3F6D A;  5COH A;  1ZGN A;  2GZZ A;  1TKD B;  1SKR B;  3HY2 A;  2VCW A;  4CW9 A;  1JZR A;  2DML A;  2DLX A;  5DCH A;  5KN2 A;  5BMU B;  4XRD A;  1GSY A;  2WS2 A;  1A8L A;  4XS4 B;  6GSW A;  4DSS A;  1SL2 B;  4GSS A;  1RQM A;  2HSN B;  18GS A;  4KGI A;  3QPM A;  3DXB A;  5JCU A;  3IR4 A;  1ZOF A;  4I6X A;  3L4N A;  2WW3 A;  1T00 A;  2XPE A;  5EPF A;  3FZA A;  5DAL B;  4OFN A;  5CNW A;  5CRG A;  3HKR A;  2GZP A;  1M9A A;  5IMC A;  1M3I A;  2F3M A;  1W89 A;  3GN3 A;  4G9H A;  3UL3 A;  1AUC A;  4POM A;  5KN0 A;  4JED A;  3ZFL A;  3WGE A;  2K9F A;  4K7N A;  2H6Z A;  2X8G A;  3DRN A;  2P0G A;  1FO5 A;  1W4V A;  2EIO A;  4FYU A;  1U6T A;  4QL7 A;  5G30 A;  1EZK A;  3GUR A;  1TRV A;  5CAX A;  3E9J B;  4O7H A;  2WW1 A;  3C1R A;  1XXU A;  3ISO A;  4IP6 A;  3W6G A;  2TIR A;  1K0D A;  4EL1 A;  4RQR A;  2UZ8 A;  4JZQ A;  1I9D A;  1S3R A;  3GH9 A;  2BMX A;  2VKZ G;  5C00 A;  2GQK A;  2A2R A;  1V98 A;  4L0W A;  1E6B A;  3FR9 A;  5H5Q A;  2N5B A;  2VL3 A;  4IVF A;  2HRF A;  3IXR A;  3H8Q A;  4X43 A;  1K0N A;  3IPZ A;  3ED3 A;  5F07 A;  2VLV A;  2X99 A;  2A4V A;  2VAF A;  2PVQ A;  5HR3 A;  2QGV A;  1GUL A;  3P7X A;  4N30 A;  2VCX A;  2IN3 A;  4EF0 A;  4IGJ A;  4KX4 A;  4FQU A;  4PGT A;  1OAZ A;  1WP0 A;  4Q5Q A;  1TK5 B;  1NHY A;  3CSJ A;  4N10 A;  5G31 A;  2RM5 A;  4OCF A;  2AJQ B;  1V2A A;  4K6X A;  3IRA A;  1XW5 A;  2O87 A;  4EXJ A;  4BWQ A;  5A5K A;  4NV2 A;  4PUR A;  3VFI A;  4F82 A;  3ZRE A;  1V58 A;  1TXX A;  2H1L A;  2GT6 A;  4KND A;  1LJR A;  3IK7 A;  4XTS A;  2JZS A;  4DSS B;  5B8B A;  2OAC A;  1FVJ A;  1GSE A;  4USS A;  4KCA A;  5ECI B;  1V57 A;  3LG6 A;  1T3B A;  4ML1 A;  3UVT A;  2H66 A;  2VCT A;  1PFO A;  2WVX A;  5A1N B;  5HR1 A;  2CAQ A;  5G5F A;  4E68 A;  1PSQ A;  1QQ2 A;  5IPH A;  4NV5 A;  2I1U A;  9GSS A;  1IYH A;  2H1A A;  4HQZ A;  3QD9 A;  1AQV A;  4G2E A;  1Y6E A;  2GDR A;  5CRD A;  1XG8 A;  1O73 A;  4IQA A;  3US3 A;  3L9U A;  5L71 A;  3EMP A;  2CZ3 A;  2NBS A;  3WYW A;  2HSH A;  1USB A;  2O85 A;  2IME A;  3HVS A;  4V2L A;  4WEY A;  4Z2R A;  1H75 A;  2B7K A;  5F05 A;  4O5U A;  2O8V B;  3VWU A;  2BTO T;  3ZLP A;  1N8J A;  2B5Y A;  5IMZ A;  3ERF A;  1XFL A;  3A2W A;  4WXT A;  5IO2 A;  4AKH A;  4HSC X;  4WET A;  6GSS A;  3D6I A;  3V1W A;  3J7Y k;  5J9C A;  4G0I A;  3DKS A;  1WIK A;  2VIM A;  1BAY A;  2KLX A;  5G5E A;  4PQH A;  1ACV A;  2H6X A;  1EEM A;  1GRX A;  1IYI A;  1K3O A;  1AQW A;  5ABR A;  1XWK A;  3KMO A;  4E8H A;  4AJ6 A;  5IOW A;  2H72 A;  3GL3 A;  3NIV A;  3P90 A;  1EV4 A;  3FRC A;  3CYN A;  4RI6 A;  2P5R A;  2C3T A;  3FK8 A;  3HYP A;  4EIP A;  2GSQ A;  2V6K A;  3C7M A;  4TXO B;  4HU9 A;  3WT1 A;  2HSM A;  4ZB9 A;  1MDI A;  4K2D A;  2DJK A;  1SL1 B;  3W8J A;  5A4V A;  2LUS A;  4LL4 B;  3LXZ A;  1URM A;  1Y25 A;  5F8B A;  1H4O A;  3TJJ A;  3H79 A;  3F63 A;  3DWV A;  3TJK A;  3TDG A;  1EP7 A;  1TK8 B;  1T4Z A;  3O76 A;  1X9S B;  1B48 A;  4FYB A;  4ZB7 A;  4TR3 A;  1XOB A;  1OKD A;  4ECC A;  2D2Z A;  1ZL9 A;  1O6J A;  1TXU A;  4JBB A;  2WUL A;  2WW2 A;  3HJO A;  4EVM A;  3U5R E;  3HJP A;  2RLI A;  1DE2 A;  1OKT A;  1ERU A;  1TU8 A;  2PU9 C;  2VD1 A;  1A8Y A;  2WVY A;  3HZ8 A;  3O3T A;  1SL0 B;  2ES7 A;  2CVD A;  4JRR A;  5D9V A;  4GXZ A;  3TUE A;  3L9S A;  3A5I A;  2R3X A;  3TOT A;  3GFK A;  5J47 A;  3C8E A;  1SKS B;  4Q5R A;  5DJL A;  5DCG A;  4AKG A;  3NZN A;  3GKM A;  4J2F A;  3IHQ A;  4NWY A;  3VLN A;  1GSD A;  1XVQ A;  1BYE A;  2E2G A;  2GSR A;  1XBS A;  3ZIJ A;  1WOU A;  1R7H A;  2YWN A;  2H1G A;  1SVM A;  2O5V A;  4KDY A;  2V2G A;  4MZB A;  4DEJ A;  2L57 A;  1Z5Y E;  1A0F A;  4IBP A;  3RHC A;  4EDY A;  3GIX A;  2P31 A;  1KEB A;  1PRX A;  5J41 A;  4YQM A;  4PQ1 A;  4EE0 A;  3RDW A;  1PA3 A;  4BVY B;  4LLR A;  4D73 B;  4L8E A;  5FHI A;  4KH7 A;  3BJ5 A;  4QL9 A;  2IPA A;  3HXS A;  1EOG A;  2X8H A;  2YN1 A;  3TKP A;  2X8C A;  3ZZX A;  2FWG A;  2I3Y A;  1SVO A;  4L0U A;  1M2D A;  1YEX A;  3RBT A;  2HSN A;  2HSM B;  5A4W A;  2CX3 A;  1GTB A;  1OC3 A;  1WWJ A;  4G01 A;  2C3N A;  1X5C A;  2JZT A;  3IAS 2;  4WF5 A;  4HOJ A;  5DAL A;  2WZS A;  2C8U A;  4FO5 A;  2JAD A;  2OE0 A;  1ST9 A;  1XPV A;  3DD3 A;  2MYG A;  5INY A;  1XOA A;  4TR1 B;  3FKF A;  3M1G A;  1B4P A;  4MJA A;  1V40 A;  1HD2 A;  2HXK A;  2X64 A;  4F0B A;  3FY7 A;  4KDX A;  2HZF A;  2DJJ A;  2EIQ A;  4BVX A;  1CQG A;  4WKW A;  1HNC A;  3TRQ A;  3F3R A;  4GTU A;  1B8X A;  6GSU A;  3TB2 A;  3TRP A;  2FY6 A;  2DJ1 A;  3GV1 A;  1K0M A;  1THX A;  4IS0 A;  4MDC A;  2I9H A;  1ZYP A;  2QA1 A;  11GS A;  1OC9 B;  3H93 A;  5LD0 A;  2A2P A;  4TOP A;  1JZW A;  2VD0 A;  2E0Q A;  2LJA A;  3HJM A;  1YDK A;  1BG1 A;  1QXH A;  2WW0 A;  2H0H A;  4OD7 A;  4N3Z A;  2VCZ A;  1AIU A;  2PGT A;  1X5D A;  5B6M A;  4TW5 A;  1VGL A;  4V2N A;  10GS A;  2R0P A;  5B8A A;  3HVV A;  4ML6 A;  3DML A;  3WGX A;  3EIN A;  3LW9 A;  4ID0 A;  4GCI A;  2IMK A;  1Y1U A;  2K8V A;  2H6Y A;  5DDL A;  2DIZ A;  5H5S A;  4MJC A;  2YV9 A;  5EVO A;  4ISD A;  4ZBB A;  1ABA A;  3LYK A;  4QQ7 A;  1O8W A;  5CP1 A;  2H0I A;  3CHX C;  3L78 A;  2QKE A;  2HRK B;  2H30 A;  3L0H A;  2EFH A;  5ECN B;  1S3C A;  1XWB A;  3G7J A;  3I9V 2;  1O7U A;  2YWI A;  3FR6 A;  4XHM A;  4NMU A;  2LRC A;  12GS A;  4EC0 A;  2F9S A;  4K5R A;  1JZO A;  2VCV A;  5G2Z A;  4OFM A;  2PVO C;  3TOU A;  1PGT A;  2B3S A;  4LMW A;  4LA1 A;  1K3Y A;  1YKA A;  2G2Q A;  1XW9 A;  2C0G A;  1WMJ A;  4GQC A;  3A2V A;  4TR4 A;  3GX0 A;  2CQ9 A;  4ECJ A;  3Q74 A;  2DBC A;  2YZU A;  2MZC A;  5JCW A;  2HRN A;  2AYT A;  1SK0 A;  1PL1 A;  2C1Y A;  5IMF A;  1A23 A;  5GST A;  5A1N A;  2LEG A;  4L5L A;  3GHA A;  4MAB A;  2R5G A;  3HHV A;  4GLT A;  1FAA A;  2RM6 A;  4TRX A;  4EUY A;  2VOC A;  4G0K A;  1PD2 1;  3IBH A;  3VWW A;  4K0G A;  4IJ3 A;  4MPF A;  1GTA A;  3F4T A;  2KP1 A;  2LRN A;  3VI5 A;  5DJM A;  3P8W A;  4BVX B;  2JZR A;  4K8M A;  3ZTL A;  3QMX A;  2KHP A;  4MLY A;  2MMZ A;  3GH6 A;  1TP9 A;  2YWO A;  2LQO A;  4N0V A;  1ILO A;  2WDU A;  2CVB A;  5B6N A;  1Z6N A;  1WJK A;  2IMF A;  5E4W A;  1EGO A;  4GF0 A;  2FWE A;  4Z2T A;  3BBY A;  4AF2 A;  4OCE A;  1PX7 A;  5DBQ A;  3J7Y b;  4NHW A;  2PMT A;  3CSH A;  3N9J A;  4HS1 A;  3QFB C;  2H76 A;  1G6W A;  3VPT A;  3ZIV A;  2LJK A;  4X0X A;  1F6M C;  2WB9 A;  5A34 A;  3RHB A;  14GS A;  2B5E A;  2FD3 A;  3FHK A;  3IOS A;  3AY8 A;  4PNG A;  4AGS A;  1GSF A;  5HFG A;  1PMT A;  2QSI A;  4G0L A;  1TW9 A;  3IAM 2;  3FMW A;  4XS6 A;  4RQX A;  4TXO A;  1KNG A;  1X9M B;  1AC1 A;  2MBS A;  3RPN A;  1YQ1 A;  2JSY A;  3GL5 A;  3QDN A;  1ERT A;  5LCZ A;  1M0U A;  4Q5F A;  3F9U A;  5AN1 A;  4F2I A;  1ZYE A;  5IOX A;  1K0C A;  4K7O A;  2GQM A;  2WGR A;  4NPB A;  1MDJ A;  4PI2 C;  1EWX A;  1F3B A;  4NXI A;  4FIW A;  4O32 A;  2M46 A;  3GKN A;  3C1S A;  4K2X A;  4EIQ A;  4K0N A;  5IM9 A;  2HNL A;  5J9B A;  5JWQ B;  4ZBA A;  1GSS A;  1HYU A;  2REM A;  1U87 A;  2AHE A;  2WVZ A;  4V1A p;  3UEM A;  1FVK A;  1F2E A;  3UBL A;  17GS A;  1GUH A;  2XPD A;  3APS A;  1LBK A;  3KCM A;  2XBI A;  2HLS A;  2FNO A;  1FG4 A;  5HR2 A;  3E3E A;  2EFE A;  4I97 A;  3UVH A;  1TOF A;  4HU7 A;  3FEU A;  2HI7 A;  1SVL A;  2RII A;  3G7Y A;  3G7I A;  2YCD A;  4H86 A;  3HZ4 A;  3E0U A;  3KMN A;  5J4V A;  3A2X A;  5IMD A;  2GQL A;  4IP1 A;  2L6D A;  4GWR A;  1KTE A;  3D4M A;  4PI0 C;  4PUF C;  2PUK C;  3BOA A;  1OE8 A;  2WCI A;  2VUP A;  2XC2 A;  3BCI A;  4KA0 A;  1BED A;  2FA4 A;  5IO0 A;  5JWO B;  2R0G A;  1G0T A;  1X0R A;  1XCC A;  1AQX A;  5D9W A;  1PL2 A;  3VWV A;  4A5P A;  1WRY A;  19GS A;  2VL2 A;  3LYP A;  3EVI A;  5KEJ A;  3K8N A;  4TVE A;  3L9V A;  4ZL9 A;  3Q19 A;  2R37 A;  4BVY A;  5D93 A;  2UV8 G;  4D73 A;  3ZRD A;  5A34 B;  20GS A;  4ZB6 A;  1XIY A;  3LQ7 A;  1GNW A;  2GS3 A;  1YZX A;  1ZYN A;  5CO3 A;  5D8I A;  3IHG A;  1O8X A;  3SWL A;  4FYC A;  3PR8 A;  1O81 A;  2YJH A;  4O92 A;  2MMO A;  3IA1 A;  1M3J A;  1MTC A;  2LRT A;  2I4A A;  1FB6 A;  1MD3 A;  2Z9S A;  3CSI A;  1B9X C;  2CX4 A;  3TU3 B;  2H0G A;  1R26 A;  4JR6 A;  7GSS A;  5HR0 A;  2PPT A;  1K0A A;  2CV4 A;  4I2T A;  3W8S A;  1T1V A;  2DKH A;  2G0F A;  3A5W A;  4ILF A;  4TR1 A;  4KUN A;  2FA8 A;  2B1K A;  1Z6M A;  3TJB A;  1BJX A;  4AKI A;  5GZZ B;  2CZ2 A;  3D21 A;  1RK4 A;  3QAV A;  2C80 A;  2VCQ A;  22GS A;  3HDC A;  2KP2 A;  2R0C A;  1BX9 A;  2CA8 A;  4MZW A;  4RI7 A;  3EE2 A;  4BL7 A;  1M2A A;  1OC9 A;  1G7O A;  5G1K A;  5D9T A;  3P2A A;  2GZY A;  2GTU A;  5CRH A;  3KP8 A;  5DVB A;  1T8E B;  3HVN A;  4IN0 A;  4F9Z A;  2C0D A;  4HI7 A;  1YKC A;  4I5Q A;  4O5Q A;  3KTB A;  2GSS A;  1GL8 A;  3DEX A;  1BF5 A;  6GST A;  4F0C A;  1B4Q A;  1V9W A;  4POB A;  3CBU A;  1SK2 A;  1N2A A;  3ZIT A;  2V41 A;  4HDE A;  4BPY A;  4KF9 A;  1SYX A;  2YZH A;  5HQP A;  2LTK A;  4WR5 A;  2TRX A;  2HRK A;  4MPG A;  2GLR A;  3EC3 A;  3HMJ G;  1F3A A;  4PXO A;  3QAW A;  4ACS A;  3QFA C;  5LNK e;  1J08 A;  4OMV A;  3KP9 A;  1ZYQ B;  3KZQ A;  1UA5 A;  8GSS A;  1U3A A;  4DSQ A;  3GX8 A;  1YEW C;  2M72 A;  5AIX A;  2B6M A;  4N0Z A;  2H19 A;  2C3Q A;  3EU3 A;  3IK9 A;  4GQF A;  3D22 A;  3EPT A;  4MA9 A;  4PNF A;  4IKH A;  2BJX A;  2O3E A;  2CVK A;  3KIJ A;  2WZ9 A;  2JL4 A;  1ZMA A;  1YF0 A;  2E7P A;  2RUE A;  1FOV A;  1QMV A;  4V1A g;  2LNS A;  3S9F A;  2H1B A;  4G10 A;  2FCH A;  3IV4 A;  5D9X A;  4IEL A;  3F3Q A;  4KE3 A;  2MMA A;  2HE3 A;  3PPU A;  4ZIJ A;  1OYJ A;  2V1M A;  2DC5 A;  2NVL A;  4HZ2 A;  3RGB C;  1SK1 A;  5KOW A;  2NPB A;  1QK8 A;  2LNT A;  2MBT A;  3ZMK A;  5CRW A;  1J9B A;  5J40 A;  2PN8 A;  3A3T A;  4EO3 A;  2JSZ A;  3Q6O A;  1BQ7 A;  2X49 A;  4MMM A;  2AV4 A;  3LWA A;  3KH9 A;  1JLW A;  3EYT A;  1GP1 A;  3D4T A;  4BL7 B;  3KEB A;  3WGD A;  2VL2 C;  3FW2 A;  2H73 A;  1OE7 A;  5AGY A;  1OVN A;  3ZFB A;  3BD2 A;  4FXY P;  2DJ0 A;  3ZL5 A;  4MZC A;  4K9Z A;  4HZ4 A;  4ICY A;  1QGV A;  1JZD A;  2WJU A;  2IIY A;  3ZVJ A;  1Z7R A;  2AAW A;  5B7C A;  3ME7 A;  3M3M A;  5CYY A;  1G6Y A;  1SYR A;  1FW1 A;  1LU4 A;  2OT3 A;  4N11 A;  2HRA A;  1UVZ A;  4IW9 A;  4MK3 A;  3G9B A;  3CXG A;  1FOH A;  4IJI A;  1YVL A;  1VF3 A;  4GSN A;  5FWG A;  1A2M A;  3TJG A;  5AIS A;  1BG5 A;  3RAZ A;  1ERW A;  2OJL A;  2DJ2 A;  4HUA A;  4LMV A;  2M80 A;  5KN3 A;  4PUA A;  4YKF A;  1GUM A;  5F0G A;  2H74 A;  2JU5 A;  1I1I P;  2CAI A;  2AUV A;  2EFC A;  4X4J A;  4MH3 A;  1JLV A;  3GST A;  1A2L A;  3H4K A;  1M9B A;  3D0Z A;  3UBK A;  2OBK A;  1K3L A;  5BRT A;  5ECQ B;  2H71 A;  3GYK A;  2L4C A;  4EDZ A;  2IMD A;  4L5O A;  1Q98 A;  3VI7 A;  2NTO A;  4DSR A;  4KB3 A;  2FWH A;  1NSW A;  4WR4 A;  3LGC A;  2HT9 A;  3H1N A;  6GSX A;  2HSY A;  2K18 A;  5ELA A;  2OKA A;  4AKX B;  2ZNM A;  1QFN A;  5JWR B;  1GUK A;  4I8B A;  4LL1 B;  4ZL8 A;  4J57 E;  2YOI A;  5DQS A;  2FWF A;  1DE1 A;  3CWG A;  4NAX A;  1FHE A;  2K8S A;  1F9M A;  3WT2 A;  3CRU A;  1ZCP A;  1O85 A;  1SJZ A;  1ON4 A;  1PKW A;  2VO4 A;  2FHE A;  5FT3 A;  3QAG A;  4P3Y B;  2L4Q A;  2HYX A;  1OC8 A;  1PN9 A;  4W66 A;  4EKZ A;  4YQV A;  3FR3 A;  4ZBD A;  2GVP A;  2LS5 A;  3FZ4 A;  4AI6 A;  3Q18 A;  4KCE A;  2LJR A;  2ALB A;  1N25 A;  4PQI A;  5J3R A;  2TRC P;  3KGK A;  5D73 A;  3MWH A;  3RPP A;  4YQU A;  5ECM B;  1FB0 A;  2GST A;  2R6K A;  1U88 A;  5ECP B;  4CHS A;  2H01 A;  1GLP A;  2VLU A;  2E2M A;  1GTU A;  3FZ5 A;  4MCU A;  2RUF A;  4MH2 A;  5ECR B;  2YWM A;  3D5J A;  1YF1 A;  1K0O A;  4ZIL A;  2IFQ A;  1UC7 A;  1JFU A;  2F51 A;  2MMN A;  3HVX A;  3SBC A;  4HJ2 A;  1M7T A;  5C04 A;  4HQS A;  3ZYW A;  5CRE A;  3EU4 A;  3CMI A;  3TCO A;  1T7P B;  4CDO A;  2VLT A;  1Q4J A;  3QR6 A;  4F03 A;  3PH9 A;  4YKG A;  2YAN A;  5GSS A;  3F4R A;  3GTU B;  3ZVJ D;  3TGZ A;  3NOF A;  3CQF A;  5J4U A;  3I43 A;  2CT6 A;  2KOK A;  2KUC A;  2O89 A;  2H70 A;  3O6T A;  2A2S A;  3BCK A;  1C72 A;  3KJY A;  3R2Q A;  4K7I A;  3FZ9 A;  3IDV A;  3MNG A;  2P5Q A;  4ECB A;  4MJB A;  1TTZ A;  1HNB A;  1AW9 A;  2WRT A;  1MD4 A;  2L59 A;  3CTG A;  2N5F A;  5GAN D;  2PWJ A;  1R5A A;  3VPQ A;  3LEF A;  1A0R P;  1JHB A;  1CQH A;  4ZL7 A;  3MSZ A;  3HD5 A;  1ML6 A;  4RUV A;  4KDU A;  4KAE A;  2DSA A;  2LST A;  3CRT A;  2A4H A;  2O36 A;  2I81 A;  1TRS A;  1SKW B;  1VF2 A;  4GST A;  3QOU A;  4XRA A;  3DGQ A;  3TKS A;  2LQQ A;  1UN2 A;  5ID2 A;  3EMX A;  5J5N A;  2VM2 A;  4JR4 A;  2YP6 A;  4QMK A;  3LJR A;  2VL9 A;  4MNN A;  3UOM A;  1X9W B;  2L5O A;  3APQ A;  1B9Y C;  2IL3 A;  4ZXG A;  2HFD A;  2XBQ A;  4K5S A;  4POL A;  2C0F A;  1TRW A;  3ME8 A;  5A4U A;  3FYG A;  1F37 A;  5IQY A;  1S3D A;  3RFR C;  1U3I A;  3KM6 A;  2WFC A;  1GLQ A;  3LFL A;  3M0F A;  1XZO A;  2FUG 2;  1Z3E A;  2QA2 A;  1GSU A;  3DVW A;  3U6V A;  5JCG A;  2B5X A;  3MIX A;  5IMV A;  4TR0 A;  4ZB8 A;  1HQO A;  1SEN A;  5AIV A;  5ENU A;  1DSB A;  2YPM A;  3C73 A;  3DIE A;  1THO A;  1DUG A;  3GSS A;  3LOR A;  5ECH B;  2DJ3 A;  1HNA A;  4PX1 A;  3GA4 A;  3F4S A;  2IFQ B;  3TKR A;  3UMA A;  3GMF A;  1E2Y A;  4WF4 A;  2QC7 A;  3WD6 A;  1Z7P A;  1XWA A;  1J0F A;  1TRU A;  2V6O A;  1R4W A;  3LSZ A;  3UIW A;  1ZZY A;  2HQT A;  2EC4 A;  3HCZ A;  1YEP A;  2K6V A;  1XVW A;  2OBI A;  3TKQ A;  3ERW A;  1EOH A;  5D96 A;  5A5H A;  1GWC A;  2J23 A;  5E59 A;  3TKS E;  4KSM A;  4X1U A;  5ELG A;  3UAP A;  5DAK A;  1M99 A;  4E8E A;  2YJ7 A;  1S4B P;  3APO A;  1G7E A;  2DKI A;  2OAD A;  2LKU A;  5HFK A;  4OO5 A;  4HJM A;  1DBY A;  3QCP A;  2B7J A;  3MDK A;  5DQY A;  4PTS A;  4HEA 2;  5EY6 A;  2X4A A;  3IE3 A;  1EGR A;  5IIZ A;  4FH8 A;  4WBR D;  1VRS D;  4PHZ C;  4XIH A;  1PX6 A;  3I69 A;  2VM1 A;  1XWC A;  1TI1 A;  2GGT A;  2PBJ A;  2R4V A;  4JE1 A;  4BWS A;  3KD0 A;  2WVX B;  4GDF A;  4MF6 A;  4ULX A;  2JAC A;  3DVX A;  2L6C A;  2R2J A;  4IHU A;  3F0I A;  5ID2 B;  1TI3 A;  3F8U A;  4TN8 A;  1NW2 A;  5KOX A;  3I6A A;  16GS A;  1YY7 A;  4JU5 A;  3KXO A;  3F6F A;  4Q5N A;  2FGX A;  4MF5 A;  5GAP D;  2IMI A;  3EWL A;  1GSQ A;  1X5E A;  4OO4 A;  3MYD A;  5H5R A;  5G1L A;  2OA7 A;  1RW1 A;  2C4J A;  2YNX A;  1VF4 A;  4K1F A;  1A2J A;  2B1L A;  3GKX A;  2YV7 A;  3UJ1 A;  4MF7 A;  4V2M A;  2LV3 A;  3UAR A;  3KH7 A;  3GNJ A;  1I5G A;  4KW6 A;  4AJ8 A;  1NHO A;  4KSO A;  2ZCT A;  2ON7 A;  4J56 E;  3VK9 A;  2ZUP A;  6GSV A;  4XS1 A;  3IC8 A;  2XHF A;  3ERG A;  3GUS A;  2HZE A;  1WE0 A;  1SJI A;  1VF1 A;  4Z2U A;  2F8A A;  1PKZ A;  1MEK A;  4IQ1 A;  2DIY A;  2EIR A;  3KTL A;  4I2U A;  2J9H A;  4OWY A;  3HA9 A;  3TKS C;  3VUR A;  1Z9H A;  3TJF A;  4XCS A;  5HFI A;  1SD8 A;  2OE1 A;  5ECL B;  5BMU A;  4G19 A;  1TU7 A;  1ERV A;  5A5H B;  4XS4 A;  1GTI A;  2NDO A;  3TRX A;  4BIK A;  2ON5 A;  5IMA A;  4TKY A;  2FLS A;  5KN1 A;  2DMM A;  5DAK B;  5ECS A;  3PIN A;  4YAP A;  4GRF A;  2GT5 A;  1SU9 A;  4MJE A;  5IPG A;  3GRX A;  3MAK A;  1AXD A;  2L5L A;  2H8L A;  2C0E A;  3M9K A;  3LXT A;  2F8F A;  4YH2 A;  3DYR A;  2OE3 A;  5EL8 A;  4DVC A;  2IWT A;  4CY8 A;  1TK0 B;  2PER A;  4ECI A;  1GH2 A;  3JCM L;  1NM3 A;  2O7K A;  1WPI A;  1QUW A;  2EFD A;  4OFT A;  4MP4 A;  6GSY A;  1XW6 A;  2IJY A;  1XWG A;  1EV9 A;  3EUR A;  3PGT A;  1SD9 A;  2N5A A;  4BA7 A;  4TXV A;  3CTF A;  1GNE A;  1PQN A;  3OR5 A;  1TJD A;  3VWX A;  2H75 A;  1A24 A;  2AB6 A;  5F06 A;  4NHZ A;  1EP8 A;  4CY6 A;  1SJ6 A;  5ECO B;  1AAZ A;  2H1D A;  1M2B A;  3N5O A;  4O5R A;  5J4Y A;  3M9J A;  1K0B A;  1EEJ A;  4YAV A;  1TDI A;  5ECK B;  3ZML A;  1YJ6 A;  1T4Y A;  1PN0 A;  1MDK A;  3GTU A;  2V32 A;  1S3A A;  4POK A;  3GKK A;  13GS A;  3M8N A; 
#chains in the Genus database with same CATH homology
 3R3E A;  4Z7X A;  3IC4 A;  1R5P A;  4WBJ A;  4AJ7 A;  2HZE B;  1KBN A;  3C71 A;  3F6D A;  5COH A;  1ZGN A;  2GZZ A;  1TKD B;  1SKR B;  3HY2 A;  2VCW A;  4CW9 A;  1JZR A;  2DML A;  2DLX A;  5DCH A;  5KN2 A;  5BMU B;  4XRD A;  1GSY A;  2WS2 A;  1A8L A;  4XS4 B;  6GSW A;  4DSS A;  1SL2 B;  4GSS A;  1RQM A;  2HSN B;  18GS A;  4KGI A;  3QPM A;  3DXB A;  5JCU A;  3IR4 A;  1ZOF A;  4I6X A;  3L4N A;  1T00 A;  2XPE A;  5EPF A;  3FZA A;  5DAL B;  4OFN A;  5CNW A;  5CRG A;  3HKR A;  2GZP A;  1M9A A;  5IMC A;  2F3M A;  1W89 A;  3GN3 A;  4G9H A;  3UL3 A;  1AUC A;  4POM A;  5KN0 A;  4JED A;  3ZFL A;  3WGE A;  2K9F A;  4K7N A;  2H6Z A;  2X8G A;  3DRN A;  2P0G A;  1FO5 A;  1W4V A;  2EIO A;  4FYU A;  1U6T A;  4QL7 A;  5G30 A;  1EZK A;  3GUR A;  1TRV A;  5CAX A;  3E9J B;  4O7H A;  3C1R A;  1XXU A;  3ISO A;  4IP6 A;  3W6G A;  2TIR A;  1K0D A;  4EL1 A;  4RQR A;  2UZ8 A;  4JZQ A;  1I9D A;  3GH9 A;  2BMX A;  2VKZ G;  5C00 A;  2GQK A;  2A2R A;  1V98 A;  4L0W A;  1E6B A;  3FR9 A;  5H5Q A;  2N5B A;  2VL3 A;  4IVF A;  2HRF A;  3IXR A;  3H8Q A;  4X43 A;  1K0N A;  3IPZ A;  3ED3 A;  5F07 A;  2VLV A;  2X99 A;  2A4V A;  2VAF A;  2PVQ A;  5HR3 A;  2QGV A;  1GUL A;  3P7X A;  4N30 A;  2VCX A;  2IN3 A;  4EF0 A;  4IGJ A;  4KX4 A;  4FQU A;  4PGT A;  1OAZ A;  1WP0 A;  4Q5Q A;  1TK5 B;  1NHY A;  3CSJ A;  4N10 A;  5G31 A;  2RM5 A;  4OCF A;  2AJQ B;  1V2A A;  4K6X A;  3IRA A;  1XW5 A;  2O87 A;  4EXJ A;  4BWQ A;  5A5K A;  4NV2 A;  4PUR A;  3VFI A;  4F82 A;  3ZRE A;  1V58 A;  1TXX A;  2H1L A;  2GT6 A;  4KND A;  1LJR A;  3IK7 A;  4XTS A;  2JZS A;  4DSS B;  5B8B A;  2OAC A;  1FVJ A;  1GSE A;  4USS A;  4KCA A;  5ECI B;  1V57 A;  3LG6 A;  1T3B A;  4ML1 A;  3UVT A;  2H66 A;  2VCT A;  5A1N B;  5HR1 A;  2CAQ A;  5G5F A;  4E68 A;  1PSQ A;  1QQ2 A;  5IPH A;  4NV5 A;  2I1U A;  9GSS A;  1IYH A;  2H1A A;  4HQZ A;  3QD9 A;  1AQV A;  4G2E A;  1Y6E A;  2GDR A;  5CRD A;  1O73 A;  4IQA A;  3US3 A;  3L9U A;  5L71 A;  3EMP A;  2CZ3 A;  2NBS A;  3WYW A;  2HSH A;  1USB A;  2O85 A;  2IME A;  3HVS A;  4V2L A;  4WEY A;  4Z2R A;  1H75 A;  2B7K A;  5F05 A;  4O5U A;  2O8V B;  3VWU A;  2BTO T;  3ZLP A;  1N8J A;  2B5Y A;  5IMZ A;  3ERF A;  1XFL A;  3A2W A;  4WXT A;  5IO2 A;  4AKH A;  4WET A;  6GSS A;  3D6I A;  3V1W A;  3J7Y k;  5J9C A;  4G0I A;  3DKS A;  1WIK A;  2VIM A;  1BAY A;  2KLX A;  5G5E A;  4PQH A;  1ACV A;  2H6X A;  1EEM A;  1GRX A;  1IYI A;  1K3O A;  1AQW A;  5ABR A;  1XWK A;  3KMO A;  4E8H A;  4AJ6 A;  5IOW A;  2H72 A;  3GL3 A;  3NIV A;  3P90 A;  1EV4 A;  3FRC A;  3CYN A;  4RI6 A;  2P5R A;  2C3T A;  3FK8 A;  3HYP A;  4EIP A;  2GSQ A;  2V6K A;  3C7M A;  4TXO B;  4HU9 A;  3WT1 A;  2HSM A;  4ZB9 A;  1MDI A;  4K2D A;  2DJK A;  1SL1 B;  3W8J A;  5A4V A;  2LUS A;  4LL4 B;  3LXZ A;  1URM A;  1Y25 A;  5F8B A;  1H4O A;  3TJJ A;  3H79 A;  3F63 A;  3DWV A;  3TJK A;  3TDG A;  1EP7 A;  1TK8 B;  1T4Z A;  3O76 A;  1X9S B;  1B48 A;  4FYB A;  4ZB7 A;  4TR3 A;  1XOB A;  1OKD A;  4ECC A;  2D2Z A;  1ZL9 A;  1O6J A;  1TXU A;  4JBB A;  2WUL A;  3HJO A;  4EVM A;  3U5R E;  3HJP A;  2RLI A;  1DE2 A;  1OKT A;  1ERU A;  1TU8 A;  2PU9 C;  2VD1 A;  1A8Y A;  3HZ8 A;  3O3T A;  1SL0 B;  2ES7 A;  2CVD A;  4JRR A;  5D9V A;  4GXZ A;  3TUE A;  3L9S A;  3A5I A;  2R3X A;  3TOT A;  3GFK A;  5J47 A;  3C8E A;  1SKS B;  4Q5R A;  5DJL A;  5DCG A;  4AKG A;  3NZN A;  3GKM A;  4J2F A;  3IHQ A;  4NWY A;  3VLN A;  1GSD A;  1XVQ A;  1BYE A;  2E2G A;  2GSR A;  1XBS A;  3ZIJ A;  1WOU A;  1R7H A;  2YWN A;  2H1G A;  1SVM A;  2O5V A;  4KDY A;  2V2G A;  4MZB A;  4DEJ A;  2L57 A;  1Z5Y E;  1A0F A;  4IBP A;  3RHC A;  4EDY A;  3GIX A;  2P31 A;  1KEB A;  1PRX A;  5J41 A;  4YQM A;  4PQ1 A;  4EE0 A;  3RDW A;  1PA3 A;  4BVY B;  4LLR A;  4D73 B;  4L8E A;  5FHI A;  4KH7 A;  3BJ5 A;  4QL9 A;  2IPA A;  3HXS A;  1EOG A;  2X8H A;  2YN1 A;  3TKP A;  2X8C A;  3ZZX A;  2FWG A;  2I3Y A;  1SVO A;  4L0U A;  1M2D A;  1YEX A;  3RBT A;  2HSN A;  2HSM B;  5A4W A;  2CX3 A;  1GTB A;  1OC3 A;  1WWJ A;  4G01 A;  2C3N A;  1X5C A;  2JZT A;  3IAS 2;  4WF5 A;  4HOJ A;  5DAL A;  2C8U A;  4FO5 A;  2JAD A;  2OE0 A;  1ST9 A;  1XPV A;  3DD3 A;  2MYG A;  5INY A;  1XOA A;  4TR1 B;  3FKF A;  3M1G A;  1B4P A;  4MJA A;  1V40 A;  1HD2 A;  2HXK A;  2X64 A;  4F0B A;  3FY7 A;  4KDX A;  2HZF A;  2DJJ A;  2EIQ A;  4BVX A;  1CQG A;  4WKW A;  1HNC A;  3TRQ A;  3F3R A;  4GTU A;  1B8X A;  6GSU A;  3TB2 A;  3TRP A;  2FY6 A;  2DJ1 A;  3GV1 A;  1K0M A;  1THX A;  4IS0 A;  4MDC A;  2I9H A;  1ZYP A;  2QA1 A;  11GS A;  1OC9 B;  3H93 A;  5LD0 A;  2A2P A;  4TOP A;  1JZW A;  2VD0 A;  2E0Q A;  2LJA A;  3HJM A;  1YDK A;  1BG1 A;  1QXH A;  2H0H A;  4OD7 A;  4N3Z A;  2VCZ A;  1AIU A;  2PGT A;  1X5D A;  5B6M A;  4TW5 A;  1VGL A;  4V2N A;  10GS A;  2R0P A;  5B8A A;  3HVV A;  4ML6 A;  3DML A;  3WGX A;  3EIN A;  3LW9 A;  4ID0 A;  4GCI A;  2IMK A;  1Y1U A;  2K8V A;  2H6Y A;  5DDL A;  2DIZ A;  5H5S A;  4MJC A;  2YV9 A;  5EVO A;  4ISD A;  4ZBB A;  1ABA A;  3LYK A;  4QQ7 A;  1O8W A;  5CP1 A;  2H0I A;  3L78 A;  2QKE A;  2HRK B;  2H30 A;  3L0H A;  2EFH A;  5ECN B;  1S3C A;  1XWB A;  3G7J A;  3I9V 2;  1O7U A;  2YWI A;  3FR6 A;  4XHM A;  4NMU A;  2LRC A;  12GS A;  4EC0 A;  2F9S A;  4K5R A;  1JZO A;  2VCV A;  5G2Z A;  4OFM A;  2PVO C;  3TOU A;  1PGT A;  2B3S A;  4LMW A;  4LA1 A;  1K3Y A;  1YKA A;  2G2Q A;  1XW9 A;  2C0G A;  1WMJ A;  4GQC A;  3A2V A;  4TR4 A;  3GX0 A;  2CQ9 A;  4ECJ A;  3Q74 A;  2DBC A;  2YZU A;  2MZC A;  5JCW A;  2HRN A;  2AYT A;  1SK0 A;  1PL1 A;  2C1Y A;  5IMF A;  1A23 A;  5GST A;  5A1N A;  2LEG A;  4L5L A;  3GHA A;  4MAB A;  2R5G A;  3HHV A;  4GLT A;  1FAA A;  2RM6 A;  4TRX A;  4EUY A;  2VOC A;  4G0K A;  1PD2 1;  3IBH A;  3VWW A;  4K0G A;  4IJ3 A;  4MPF A;  1GTA A;  3F4T A;  2KP1 A;  2LRN A;  3VI5 A;  5DJM A;  3P8W A;  4BVX B;  2JZR A;  4K8M A;  3ZTL A;  3QMX A;  2KHP A;  4MLY A;  2MMZ A;  3GH6 A;  1TP9 A;  2YWO A;  2LQO A;  4N0V A;  1ILO A;  2WDU A;  2CVB A;  5B6N A;  1Z6N A;  1WJK A;  2IMF A;  5E4W A;  1EGO A;  4GF0 A;  2FWE A;  4Z2T A;  3BBY A;  4AF2 A;  4OCE A;  1PX7 A;  5DBQ A;  3J7Y b;  4NHW A;  2PMT A;  3CSH A;  3N9J A;  4HS1 A;  3QFB C;  2H76 A;  1G6W A;  3VPT A;  3ZIV A;  2LJK A;  4X0X A;  1F6M C;  2WB9 A;  5A34 A;  3RHB A;  14GS A;  2B5E A;  2FD3 A;  3FHK A;  3IOS A;  3AY8 A;  4PNG A;  4AGS A;  1GSF A;  5HFG A;  1PMT A;  2QSI A;  4G0L A;  1TW9 A;  3IAM 2;  3FMW A;  4XS6 A;  4RQX A;  4TXO A;  1KNG A;  1X9M B;  1AC1 A;  2MBS A;  3RPN A;  1YQ1 A;  2JSY A;  3GL5 A;  3QDN A;  1ERT A;  5LCZ A;  1M0U A;  4Q5F A;  3F9U A;  5AN1 A;  4F2I A;  1ZYE A;  5IOX A;  1K0C A;  4K7O A;  2GQM A;  2WGR A;  4NPB A;  1MDJ A;  1EWX A;  1F3B A;  4NXI A;  4FIW A;  4O32 A;  2M46 A;  3GKN A;  3C1S A;  4K2X A;  4EIQ A;  4K0N A;  5IM9 A;  2HNL A;  5J9B A;  5JWQ B;  4ZBA A;  1GSS A;  1HYU A;  2REM A;  1U87 A;  2AHE A;  4V1A p;  3UEM A;  1FVK A;  1F2E A;  3UBL A;  17GS A;  1GUH A;  2XPD A;  3APS A;  1LBK A;  3KCM A;  2XBI A;  2HLS A;  2FNO A;  1FG4 A;  5HR2 A;  3E3E A;  2EFE A;  4I97 A;  3UVH A;  1TOF A;  4HU7 A;  3FEU A;  2HI7 A;  1SVL A;  2RII A;  3G7Y A;  3G7I A;  2YCD A;  4H86 A;  3HZ4 A;  3E0U A;  3KMN A;  5J4V A;  3A2X A;  5IMD A;  2GQL A;  4IP1 A;  2L6D A;  4GWR A;  1KTE A;  3D4M A;  4PUF C;  2PUK C;  3BOA A;  1OE8 A;  2WCI A;  2VUP A;  2XC2 A;  3BCI A;  4KA0 A;  1BED A;  2FA4 A;  5IO0 A;  5JWO B;  2R0G A;  1G0T A;  1X0R A;  1XCC A;  1AQX A;  5D9W A;  1PL2 A;  3VWV A;  4A5P A;  1WRY A;  19GS A;  2VL2 A;  3LYP A;  3EVI A;  5KEJ A;  3K8N A;  4TVE A;  3L9V A;  4ZL9 A;  3Q19 A;  2R37 A;  4BVY A;  5D93 A;  2UV8 G;  4D73 A;  3ZRD A;  5A34 B;  20GS A;  4ZB6 A;  1XIY A;  3LQ7 A;  1GNW A;  2GS3 A;  1YZX A;  1ZYN A;  5CO3 A;  5D8I A;  3IHG A;  1O8X A;  3SWL A;  4FYC A;  3PR8 A;  1O81 A;  2YJH A;  4O92 A;  2MMO A;  3IA1 A;  1MTC A;  2LRT A;  2I4A A;  1FB6 A;  1MD3 A;  2Z9S A;  3CSI A;  1B9X C;  2CX4 A;  3TU3 B;  2H0G A;  1R26 A;  4JR6 A;  7GSS A;  5HR0 A;  2PPT A;  1K0A A;  2CV4 A;  4I2T A;  3W8S A;  1T1V A;  2DKH A;  2G0F A;  3A5W A;  4ILF A;  4TR1 A;  4KUN A;  2FA8 A;  2B1K A;  1Z6M A;  3TJB A;  1BJX A;  4AKI A;  5GZZ B;  2CZ2 A;  3D21 A;  1RK4 A;  3QAV A;  2C80 A;  2VCQ A;  22GS A;  3HDC A;  2KP2 A;  2R0C A;  1BX9 A;  2CA8 A;  4MZW A;  4RI7 A;  3EE2 A;  4BL7 A;  1M2A A;  1OC9 A;  1G7O A;  5G1K A;  5D9T A;  3P2A A;  2GZY A;  2GTU A;  5CRH A;  3KP8 A;  5DVB A;  1T8E B;  4IN0 A;  4F9Z A;  2C0D A;  4HI7 A;  1YKC A;  4I5Q A;  4O5Q A;  3KTB A;  2GSS A;  1GL8 A;  3DEX A;  1BF5 A;  6GST A;  4F0C A;  1B4Q A;  1V9W A;  4POB A;  3CBU A;  1SK2 A;  1N2A A;  3ZIT A;  2V41 A;  4HDE A;  4BPY A;  4KF9 A;  1SYX A;  2YZH A;  5HQP A;  2LTK A;  4WR5 A;  2TRX A;  2HRK A;  4MPG A;  2GLR A;  3EC3 A;  3HMJ G;  1F3A A;  4PXO A;  3QAW A;  4ACS A;  3QFA C;  5LNK e;  1J08 A;  4OMV A;  3KP9 A;  1ZYQ B;  3KZQ A;  1UA5 A;  8GSS A;  1U3A A;  4DSQ A;  3GX8 A;  2M72 A;  5AIX A;  2B6M A;  4N0Z A;  2H19 A;  2C3Q A;  3EU3 A;  3IK9 A;  4GQF A;  3D22 A;  3EPT A;  4MA9 A;  4PNF A;  4IKH A;  2BJX A;  2CVK A;  3KIJ A;  2WZ9 A;  2JL4 A;  1ZMA A;  1YF0 A;  2E7P A;  2RUE A;  1FOV A;  1QMV A;  4V1A g;  2LNS A;  3S9F A;  2H1B A;  4G10 A;  2FCH A;  3IV4 A;  5D9X A;  4IEL A;  3F3Q A;  4KE3 A;  2MMA A;  2HE3 A;  3PPU A;  4ZIJ A;  1OYJ A;  2V1M A;  2DC5 A;  2NVL A;  4HZ2 A;  1SK1 A;  5KOW A;  2NPB A;  1QK8 A;  2LNT A;  2MBT A;  3ZMK A;  5CRW A;  1J9B A;  5J40 A;  2PN8 A;  3A3T A;  4EO3 A;  2JSZ A;  3Q6O A;  1BQ7 A;  2X49 A;  4MMM A;  2AV4 A;  3LWA A;  3KH9 A;  1JLW A;  3EYT A;  1GP1 A;  3D4T A;  4BL7 B;  3KEB A;  3WGD A;  2VL2 C;  3FW2 A;  2H73 A;  1OE7 A;  5AGY A;  1OVN A;  3ZFB A;  3BD2 A;  2DJ0 A;  3ZL5 A;  4MZC A;  4K9Z A;  4HZ4 A;  4ICY A;  1QGV A;  1JZD A;  2WJU A;  2IIY A;  3ZVJ A;  1Z7R A;  2AAW A;  5B7C A;  3ME7 A;  3M3M A;  5CYY A;  1G6Y A;  1SYR A;  1FW1 A;  1LU4 A;  2OT3 A;  4N11 A;  2HRA A;  1UVZ A;  4IW9 A;  4MK3 A;  3G9B A;  3CXG A;  1FOH A;  4IJI A;  1YVL A;  1VF3 A;  4GSN A;  5FWG A;  1A2M A;  3TJG A;  5AIS A;  1BG5 A;  3RAZ A;  1ERW A;  2OJL A;  2DJ2 A;  4HUA A;  4LMV A;  2M80 A;  5KN3 A;  4PUA A;  4YKF A;  1GUM A;  5F0G A;  2H74 A;  2JU5 A;  2CAI A;  2AUV A;  2EFC A;  4X4J A;  4MH3 A;  1JLV A;  3GST A;  1A2L A;  3H4K A;  1M9B A;  3D0Z A;  3UBK A;  2OBK A;  1K3L A;  5BRT A;  5ECQ B;  2H71 A;  3GYK A;  2L4C A;  4EDZ A;  2IMD A;  4L5O A;  1Q98 A;  3VI7 A;  2NTO A;  4DSR A;  4KB3 A;  2FWH A;  1NSW A;  4WR4 A;  3LGC A;  2HT9 A;  3H1N A;  6GSX A;  2HSY A;  2K18 A;  5ELA A;  2OKA A;  4AKX B;  2ZNM A;  1QFN A;  5JWR B;  1GUK A;  4I8B A;  4LL1 B;  4ZL8 A;  4J57 E;  2YOI A;  5DQS A;  2FWF A;  1DE1 A;  3CWG A;  4NAX A;  1FHE A;  2K8S A;  1F9M A;  3WT2 A;  3CRU A;  1ZCP A;  1O85 A;  1SJZ A;  1ON4 A;  1PKW A;  2VO4 A;  2FHE A;  5FT3 A;  3QAG A;  4P3Y B;  2L4Q A;  2HYX A;  1OC8 A;  1PN9 A;  4W66 A;  4EKZ A;  4YQV A;  3FR3 A;  4ZBD A;  2GVP A;  2LS5 A;  3FZ4 A;  4AI6 A;  3Q18 A;  4KCE A;  2LJR A;  2ALB A;  1N25 A;  4PQI A;  5J3R A;  2TRC P;  3KGK A;  5D73 A;  3MWH A;  3RPP A;  4YQU A;  5ECM B;  1FB0 A;  2GST A;  2R6K A;  1U88 A;  5ECP B;  4CHS A;  2H01 A;  1GLP A;  2VLU A;  2E2M A;  1GTU A;  3FZ5 A;  4MCU A;  2RUF A;  4MH2 A;  5ECR B;  2YWM A;  3D5J A;  1YF1 A;  1K0O A;  4ZIL A;  2IFQ A;  1UC7 A;  1JFU A;  2F51 A;  2MMN A;  3HVX A;  3SBC A;  4HJ2 A;  1M7T A;  5C04 A;  4HQS A;  3ZYW A;  5CRE A;  3EU4 A;  3CMI A;  3TCO A;  1T7P B;  4CDO A;  2VLT A;  1Q4J A;  3QR6 A;  4F03 A;  3PH9 A;  4YKG A;  2YAN A;  5GSS A;  3F4R A;  3GTU B;  3ZVJ D;  3TGZ A;  3NOF A;  5J4U A;  3I43 A;  2CT6 A;  2KOK A;  2KUC A;  2O89 A;  2H70 A;  3O6T A;  2A2S A;  3BCK A;  1C72 A;  3KJY A;  3R2Q A;  4K7I A;  3FZ9 A;  3IDV A;  3MNG A;  2P5Q A;  4ECB A;  4MJB A;  1TTZ A;  1HNB A;  1AW9 A;  2WRT A;  1MD4 A;  2L59 A;  3CTG A;  2N5F A;  5GAN D;  2PWJ A;  1R5A A;  3VPQ A;  3LEF A;  1A0R P;  1JHB A;  1CQH A;  4ZL7 A;  3MSZ A;  3HD5 A;  1ML6 A;  4RUV A;  4KDU A;  4KAE A;  2DSA A;  2LST A;  3CRT A;  2A4H A;  2I81 A;  1TRS A;  1SKW B;  1VF2 A;  4GST A;  3QOU A;  4XRA A;  3DGQ A;  3TKS A;  2LQQ A;  1UN2 A;  5ID2 A;  3EMX A;  5J5N A;  2VM2 A;  4JR4 A;  2YP6 A;  4QMK A;  3LJR A;  2VL9 A;  4MNN A;  3UOM A;  1X9W B;  2L5O A;  3APQ A;  1B9Y C;  2IL3 A;  4ZXG A;  2HFD A;  2XBQ A;  4K5S A;  4POL A;  2C0F A;  1TRW A;  3ME8 A;  5A4U A;  3FYG A;  1F37 A;  5IQY A;  1S3D A;  1U3I A;  3KM6 A;  2WFC A;  1GLQ A;  3LFL A;  3M0F A;  1XZO A;  2FUG 2;  1Z3E A;  2QA2 A;  1GSU A;  3DVW A;  3U6V A;  5JCG A;  2B5X A;  3MIX A;  5IMV A;  4TR0 A;  4ZB8 A;  1HQO A;  1SEN A;  5AIV A;  5ENU A;  1DSB A;  2YPM A;  3C73 A;  3DIE A;  1THO A;  1DUG A;  3GSS A;  3LOR A;  5ECH B;  2DJ3 A;  1HNA A;  4PX1 A;  3GA4 A;  3F4S A;  2IFQ B;  3TKR A;  3UMA A;  3GMF A;  1E2Y A;  4WF4 A;  2QC7 A;  3WD6 A;  1Z7P A;  1XWA A;  1J0F A;  1TRU A;  2V6O A;  1R4W A;  3LSZ A;  3UIW A;  1ZZY A;  2HQT A;  2EC4 A;  3HCZ A;  1YEP A;  2K6V A;  1XVW A;  2OBI A;  3TKQ A;  3ERW A;  1EOH A;  5D96 A;  5A5H A;  1GWC A;  2J23 A;  5E59 A;  3TKS E;  4KSM A;  4X1U A;  5ELG A;  3UAP A;  5DAK A;  1M99 A;  4E8E A;  2YJ7 A;  3APO A;  1G7E A;  2DKI A;  2OAD A;  2LKU A;  5HFK A;  4OO5 A;  4HJM A;  1DBY A;  3QCP A;  2B7J A;  3MDK A;  5DQY A;  4PTS A;  4HEA 2;  5EY6 A;  2X4A A;  3IE3 A;  1EGR A;  5IIZ A;  4FH8 A;  4WBR D;  1VRS D;  4XIH A;  1PX6 A;  3I69 A;  2VM1 A;  1XWC A;  1TI1 A;  2GGT A;  2PBJ A;  2R4V A;  4JE1 A;  4BWS A;  3KD0 A;  4GDF A;  4MF6 A;  4ULX A;  2JAC A;  3DVX A;  2L6C A;  2R2J A;  4IHU A;  3F0I A;  5ID2 B;  1TI3 A;  3F8U A;  4TN8 A;  1NW2 A;  5KOX A;  3I6A A;  16GS A;  1YY7 A;  4JU5 A;  3KXO A;  3F6F A;  4Q5N A;  2FGX A;  4MF5 A;  5GAP D;  2IMI A;  3EWL A;  1GSQ A;  1X5E A;  4OO4 A;  3MYD A;  5H5R A;  5G1L A;  2OA7 A;  1RW1 A;  2C4J A;  2YNX A;  1VF4 A;  4K1F A;  1A2J A;  2B1L A;  3GKX A;  2YV7 A;  3UJ1 A;  4MF7 A;  4V2M A;  2LV3 A;  3UAR A;  3KH7 A;  3GNJ A;  1I5G A;  4KW6 A;  4AJ8 A;  1NHO A;  4KSO A;  2ZCT A;  2ON7 A;  4J56 E;  3VK9 A;  2ZUP A;  6GSV A;  4XS1 A;  3IC8 A;  2XHF A;  3ERG A;  3GUS A;  2HZE A;  1WE0 A;  1SJI A;  1VF1 A;  4Z2U A;  2F8A A;  1PKZ A;  1MEK A;  4IQ1 A;  2DIY A;  2EIR A;  3KTL A;  4I2U A;  2J9H A;  4OWY A;  3HA9 A;  3TKS C;  3VUR A;  1Z9H A;  3TJF A;  4XCS A;  5HFI A;  1SD8 A;  2OE1 A;  5ECL B;  5BMU A;  4G19 A;  1TU7 A;  1ERV A;  5A5H B;  4XS4 A;  1GTI A;  2NDO A;  3TRX A;  2ON5 A;  5IMA A;  4TKY A;  2FLS A;  5KN1 A;  2DMM A;  5DAK B;  5ECS A;  3PIN A;  4YAP A;  4GRF A;  2GT5 A;  1SU9 A;  4MJE A;  5IPG A;  3GRX A;  3MAK A;  1AXD A;  2L5L A;  2H8L A;  2C0E A;  3M9K A;  3LXT A;  2F8F A;  4YH2 A;  3DYR A;  2OE3 A;  5EL8 A;  4DVC A;  2IWT A;  4CY8 A;  1TK0 B;  2PER A;  4ECI A;  1GH2 A;  3JCM L;  1NM3 A;  2O7K A;  1WPI A;  1QUW A;  2EFD A;  4OFT A;  4MP4 A;  6GSY A;  1XW6 A;  2IJY A;  1XWG A;  1EV9 A;  3EUR A;  3PGT A;  1SD9 A;  2N5A A;  4BA7 A;  4TXV A;  3CTF A;  1GNE A;  1PQN A;  3OR5 A;  1TJD A;  3VWX A;  2H75 A;  1A24 A;  2AB6 A;  5F06 A;  4NHZ A;  1EP8 A;  4CY6 A;  1SJ6 A;  5ECO B;  1AAZ A;  2H1D A;  1M2B A;  3N5O A;  4O5R A;  5J4Y A;  3M9J A;  1K0B A;  1EEJ A;  4YAV A;  1TDI A;  5ECK B;  3ZML A;  1YJ6 A;  1T4Y A;  1PN0 A;  1MDK A;  3GTU A;  2V32 A;  1S3A A;  4POK A;  3GKK A;  13GS A;  3M8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...