4IT6A

Crystal structure of amino acid residues 1-120 of cg17282
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
117
structure length
113
Chain Sequence
DWYVGTEWEDKNRGLAKKVIGLQFTEMDKPTIISTVEFSVNKKATNLGGRPSKYLVATYPQKHSLEMGTSLTAVDCYLELLLQQFVPGETAACSITTKTGERIEFELKLEKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Noncanonical FK506-Binding Protein BDBT Binds DBT to Enhance Its Circadian Function and Forms Foci at Night.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Unknown function
molecule keywords CG17282
total genus 20
structure length 113
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18023 FKBP_N_2 BDBT FKBP like N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.60 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4it6A00
4IT4A 4IT6A
chains in the Genus database with same CATH superfamily
2O92A 1ITXA 1LL4A 1EIBA 4WK9A 2DT0A 3ODKA 1Q6UA 1W1PA 1E9LA 2QF8A 1LL7A 3VAWA 2OLHA 1WNOA 4UDMA 4WIWA 3AQUA 1XRVA 1NWRA 4Z2GA 1SR0A 2G8ZA 1N1AA 2RQSA 2PPPA 4IT4A 1HXVA 1W9UA 2WLZA 4P8VA 1NWSA 3O5EA 4MAVA 4JYSA 1FD9A 2MNTA 3H9RB 2YBUA 5GPRA 4DRIA 1JNEA 1EQ3A 4DH0A 1JVWA 3CHCA 1ZBWA 1FKTA 3PA7A 3WQVA 3TC5A 3ARTA 3UI6A 1HKMA 1FKJA 3IKGA 3O5QA 4MNMA 4N19A 4P8UA 1D7JA 4DRPA 1YATA 3TDBA 3WD0A 4WKHA 3RM4A 4DIPA 3ARXA 2K8IA 5HT1A 4HBOA 2PPNA 3O5RA 5HTGA 3NI6A 3G6MA 3WL0A 5DEZA 3OA5A 2DSWA 4J4NA 1QPLA 3WD1A 1M5YA 4W9QA 4DWSD 3BXWA 2LPVA 1NWUA 5DIUA 4JFKA 4FAPA 1F40A 4S3KA 2MLXA 3O5MA 3GU0A 4U85A 3RFWA 4KR0B 4Q22A 3O5JA 3O5GA 1XHGA 4DRJA 4ODNA 2RURA 3PRDA 1O6IA 2ZQSA 2DG4A 1LG2A 4DZ3A 3AS2A 4ITZA 5I98A 3ARPA 1ZBKA 4QT3A 3I6CA 2XP7A 5BXJA 1L1PA 2WK2A 3O5LA 1FKFA 1E6PA 5DO2A 2PI6A 4HARA 4LAVA 4L72B 3ARYA 2PBCA 2ETNA 2KE0A 3ARWA 3RMEA 5HUAA 4QZVB 4WKFA 5DITA 4TW7A 1U79A 1VF8A 5GPGA 1W26A 4MPKA 3PRBA 2F21A 3O5KA 4G50A 4P8XA 3O5OA 1EDQA 1E6ZA 1OGBA 1Q6HA 3JXVA 4BF8A 2B5UB 3ARZA 3KAHA 1HJVA 1JNDA 2IF4A 3IKDA 4TYOA 1Q1CA 4IQ2A 1FKHA 3B9EA 4MNLA 2DSUA 2M2AA 5D75A 3O5FA 3B7XA 2ESCA 4O2TA 1BL4A 2FDMA 1P5QA 1NH6A 5JH8A 4MTVA 2ZR6A 2RUCA 4Z2HA 1FFRA 4JFLA 4DZ2A 1FKRA 2WLYA 1Q6IA 1J4RA 3WIJA 4Z2KA 4PTMA 2KR7A 1ZBVA 3B9DA 4URIA 2IUZA 2UZ5A 4ODKA 1QPFA 3UQBA 1LJYA 1LL6A 2P4VA 1KT1A 1A7XA 3EY6A 4QT2A 3ARRA 5B8IC 2XP6A 1H0IA 3CHEA 1FKDA 1PBKA 2ZR5A 2PV3A 4DWSA 4ODRA 4AY1A 4Z2IA 1D6OA 5HKGA 3CGNA 4WKAA 4LAYA 2XP4A 3B8SA 3WD3A 1J4HA 1KT0A 4MGVA 4U86A 1FFQA 3AROA 3WQWA 3O5PA 4JFMA 1R9HA 3AS3A 2KI3A 4U84A 4W9OA 1YW5A 3IHZA 1F8AB 4ZPVR 2MLYA 2FKEA 2O9OA 2MF9A 2DT3A 3UI4A 1HKJA 2XP9A 1E6RA 2XPBA 1C9HA 1X6NA 3FXYA 3WKZA 1WB0A 3JYJA 1ZCNA 4KQZA 4FN2A 2AWGA 1FAPA 4LGXA 2JZVA 1HJXA 1GOIA 4W5UA 1ZB5A 4ML4A 5GQBA 3UI5A 2ZQVA 1D2KA 2A3AA 2LGOA 1IX5A 1ZBCA 2XPAA 4DRNA 2L2SA 1CTNA 2M1IA 5HWCA 4Z2LA 3G6LA 2ITKA 3PR9A 2DG9A 4TW8A 3WD2A 2YBTA 1UR9A 3ARVA 2F4EA 3PRAA 1HKKA 3KABA 1W1VA 3KAGA 1JCHB 1ZU8A 4DROA 1FKIA 1NMWA 3WH0A 1EYMA 2PN0A 2AOSA 1JNSA 3KADA 1ZK6A 4ODMA 3BMBA 2VN1A 4WJXA 1NWTA 4R5EA 2N87A 1OGGA 4TX0A 1SYTA 3JYMA 3W4RA 4ZS6A 1ZL1A 2Q5AA 1NSGA 3NTPA 4XAKA 4C02B 2KGJA 4Z2JA 3O5DA 3KCEA 1FKBA 1K9TA 2RUDA 4S3JA 1FKSA 4GGQA 1FKLA 1E44A 4MSPA 1KFWA 4ODOA 3ARSA 5HW6A 4J4OA 4IQCA 3RGCA 4ODPA 2F23A 2F2DA 1D7IA 2ZQTA 3ALFA 2RUQA 2ZR4A 2A3EA 1WAWA 3O5IA 2DPEA 4ODLA 1ROTA 2M08A 4JFJA 4G2PA 2LJ4A 3CHDA 3FY1A 3ARQA 1J6YA 1FJDA 1GRJA 1T11A 2MPHA 3MDYB 3KACA 1J4IA 2DSZA 2MLZA 3IK8A 3LUOA 2XP3A 1QZ2A 4TW6A 2A3CA 1UR8A 3ARUA 3KAIA 1RD6A 3UQIA 4NNRA 1W1YA 5J6EA 1H0GA 3NRKA 2Y78A 4MNKA 4DRQA 5DF0A 2RSEA 4LAWA 3GPKA 2KFWA 3EIPA 2G41A 1ROUA 4L3NA 3AS0A 4Q7NA 4GIVA 3RM8A 3KZ7A 3AS1A 2XP8A 1W9VA 4NZCA 2DT2A 2ZQUA 4DWSB 4MNJA 1BKFA 4ZPTR 4P8WA 3CHFA 2EULA 2LKNA 1HJWA 3TCZA 4DRKA 1GUVA 1NMVA 3KAFA 3B9AA 4DRHA 1GPFA 3UQAA 4ZPWR 2PPOA 1D7HA 1TCOC 5HBFA 2DG3A 2KO7A 2FAPA 2A3BA 4W9PA 3WD4A 4R0XA 2WM0A 3CH9A 2D9FA 1EHNA 1Y0OA 4DWSC 3WL1A 5HW7A 1FKGA 5HWBA 4IPXA 2PV2A 1W9PA 2VCDA 1FKKA 1JNTA 4QIBA 1E6NA 4TNSA 4DT4A 1LG1A 2PV1A 4DRMA 2OFNA 3OOBA 1PINA 1W1TA 2DT1A 3UF8A 5HW8A 3QOKA 4NSBA 4ODQA 1HKIA 1TFVA 3FAPA 3RM9A 1X6LA 4LAXA 2XP5A 4JFIA 3ALGA 3CZ8A 4HBEA 1B6CA 4IT6A 3CGMA 1E15A 1LQ0A 2DSVA 5DIVA 3GTYX 2B31A 1OWQA
chains in the Genus database with same CATH topology
2O92A 1ITXA 1LL4A 1EIBA 4WK9A 2DT0A 3ODKA 1Q6UA 1W1PA 1E9LA 2QF8A 1LL7A 3VAWA 2OLHA 1WNOA 4WIWA 3AQUA 1XRVA 1NWRA 4Z2GA 1SR0A 2G8ZA 1N1AA 2RQSA 2PPPA 4IT4A 1HXVA 1W9UA 2WLZA 4P8VA 1NWSA 3O5EA 4MAVA 4JYSA 1FD9A 2MNTA 3H9RB 2YBUA 5GPRA 4DRIA 1JNEA 1EQ3A 4DH0A 1JVWA 3CHCA 1ZBWA 1FKTA 3PA7A 3WQVA 3TC5A 3ARTA 3UI6A 1HKMA 1FKJA 3IKGA 3O5QA 4MNMA 4N19A 4P8UA 1D7JA 4DRPA 1YATA 3TDBA 3WD0A 4WKHA 3RM4A 4DIPA 3ARXA 5HT1A 4HBOA 2PPNA 3O5RA 5HTGA 3NI6A 3G6MA 3WL0A 5DEZA 3OA5A 2DSWA 4J4NA 1QPLA 3WD1A 1M5YA 4W9QA 4DWSD 3BXWA 2LPVA 1NWUA 5DIUA 4JFKA 4FAPA 1F40A 4S3KA 2MLXA 3O5MA 4U85A 3RFWA 4KR0B 4Q22A 3O5JA 3O5GA 1XHGA 4DRJA 4ODNA 2RURA 3PRDA 1O6IA 2ZQSA 2DG4A 1LG2A 4DZ3A 3AS2A 4ITZA 5I98A 3ARPA 1ZBKA 4QT3A 3I6CA 2XP7A 5BXJA 1L1PA 2WK2A 3O5LA 1FKFA 1E6PA 5DO2A 2PI6A 4HARA 4LAVA 4L72B 3ARYA 2PBCA 2KE0A 3ARWA 3RMEA 5HUAA 4QZVB 4WKFA 5DITA 4TW7A 1U79A 1VF8A 5GPGA 1W26A 4MPKA 3PRBA 2F21A 3O5KA 4G50A 4P8XA 3O5OA 1EDQA 1E6ZA 1OGBA 1Q6HA 3JXVA 4BF8A 3ARZA 3KAHA 1HJVA 1JNDA 2IF4A 3IKDA 4TYOA 1Q1CA 4IQ2A 1FKHA 3B9EA 4MNLA 2DSUA 2M2AA 5D75A 3O5FA 3B7XA 2ESCA 4O2TA 1BL4A 2FDMA 1P5QA 1NH6A 5JH8A 4MTVA 2ZR6A 2RUCA 4Z2HA 1FFRA 4JFLA 4DZ2A 1FKRA 2WLYA 1Q6IA 1J4RA 3WIJA 4Z2KA 4PTMA 2KR7A 1ZBVA 3B9DA 4URIA 2IUZA 2UZ5A 4ODKA 1QPFA 3UQBA 1LJYA 1LL6A 1KT1A 1A7XA 3EY6A 4QT2A 3ARRA 5B8IC 2XP6A 1H0IA 3CHEA 1FKDA 1PBKA 2ZR5A 2PV3A 4DWSA 4ODRA 4AY1A 4Z2IA 1D6OA 5HKGA 3CGNA 4WKAA 4LAYA 2XP4A 3B8SA 3WD3A 1J4HA 1KT0A 4MGVA 4U86A 1FFQA 3AROA 3WQWA 3O5PA 4JFMA 1R9HA 3AS3A 2KI3A 4U84A 4W9OA 1YW5A 3IHZA 1F8AB 4ZPVR 2MLYA 2FKEA 2O9OA 2MF9A 2DT3A 3UI4A 1HKJA 2XP9A 1E6RA 2XPBA 1C9HA 1X6NA 3FXYA 3WKZA 1WB0A 3JYJA 4KQZA 1ZCNA 4FN2A 2AWGA 1FAPA 4LGXA 2JZVA 1HJXA 1GOIA 4W5UA 1ZB5A 4ML4A 5GQBA 3UI5A 2ZQVA 1D2KA 2A3AA 2LGOA 1IX5A 1ZBCA 2XPAA 4DRNA 2L2SA 1CTNA 2M1IA 5HWCA 4Z2LA 3G6LA 2ITKA 3PR9A 2DG9A 4TW8A 3WD2A 2YBTA 1UR9A 3ARVA 2F4EA 3PRAA 1HKKA 3KABA 1W1VA 3KAGA 1ZU8A 4DROA 1FKIA 1NMWA 3WH0A 1EYMA 2AOSA 1JNSA 3KADA 1ZK6A 4ODMA 2VN1A 4WJXA 1NWTA 4R5EA 2N87A 1OGGA 4TX0A 1SYTA 3JYMA 3W4RA 4ZS6A 1ZL1A 2Q5AA 1NSGA 3NTPA 4XAKA 4C02B 2KGJA 4Z2JA 3O5DA 3KCEA 1FKBA 1K9TA 2RUDA 4S3JA 1FKSA 4GGQA 1FKLA 4MSPA 1KFWA 4ODOA 3ARSA 5HW6A 4J4OA 4IQCA 3RGCA 4ODPA 2F2DA 1D7IA 2ZQTA 3ALFA 2RUQA 2ZR4A 2A3EA 1WAWA 3O5IA 2DPEA 4ODLA 1ROTA 2M08A 4JFJA 4G2PA 2LJ4A 3CHDA 3FY1A 3ARQA 1J6YA 1FJDA 1T11A 2MPHA 3MDYB 3KACA 1J4IA 2DSZA 2MLZA 3IK8A 3LUOA 2XP3A 1QZ2A 4TW6A 2A3CA 1UR8A 3ARUA 3KAIA 1RD6A 3UQIA 4NNRA 1W1YA 5J6EA 1H0GA 3NRKA 2Y78A 4MNKA 4DRQA 5DF0A 2RSEA 4LAWA 3GPKA 2KFWA 2G41A 1ROUA 4L3NA 3AS0A 4Q7NA 4GIVA 3RM8A 3KZ7A 3AS1A 2XP8A 1W9VA 4NZCA 2DT2A 2ZQUA 4DWSB 4MNJA 1BKFA 4ZPTR 4P8WA 3CHFA 2LKNA 1HJWA 3TCZA 4DRKA 1GUVA 1NMVA 3KAFA 3B9AA 4DRHA 1GPFA 3UQAA 4ZPWR 2PPOA 1D7HA 1TCOC 5HBFA 2DG3A 2KO7A 2FAPA 2A3BA 4W9PA 3WD4A 4R0XA 2WM0A 3CH9A 2D9FA 1EHNA 1Y0OA 4DWSC 3WL1A 5HW7A 1FKGA 5HWBA 4IPXA 2PV2A 1W9PA 2VCDA 1FKKA 1JNTA 4QIBA 1E6NA 4TNSA 4DT4A 1LG1A 2PV1A 4DRMA 2OFNA 3OOBA 1PINA 1W1TA 2DT1A 3UF8A 5HW8A 3QOKA 4NSBA 4ODQA 1HKIA 1TFVA 3FAPA 3RM9A 1X6LA 4LAXA 4JFIA 2XP5A 3ALGA 3CZ8A 4HBEA 1B6CA 4IT6A 3CGMA 1E15A 1LQ0A 2DSVA 5DIVA 2K8IA 2B31A 1OWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT4 A;  4IT6 A; 
#chains in the Genus database with same CATH topology
 2O92 A;  1ITX A;  1LL4 A;  1EIB A;  4WK9 A;  2DT0 A;  3ODK A;  1Q6U A;  1W1P A;  1E9L A;  2QF8 A;  1LL7 A;  3VAW A;  2OLH A;  1WNO A;  4UDM A;  4WIW A;  3AQU A;  1XRV A;  1NWR A;  4Z2G A;  1SR0 A;  2G8Z A;  1N1A A;  2RQS A;  2PPP A;  4IT4 A;  1HXV A;  1W9U A;  2WLZ A;  4P8V A;  1NWS A;  3O5E A;  4MAV A;  4JYS A;  1FD9 A;  2MNT A;  3H9R B;  2YBU A;  5GPR A;  4DRI A;  1JNE A;  1EQ3 A;  4DH0 A;  1JVW A;  3CHC A;  1ZBW A;  1FKT A;  3PA7 A;  3WQV A;  3TC5 A;  3ART A;  3UI6 A;  1HKM A;  1FKJ A;  3IKG A;  3O5Q A;  4MNM A;  4N19 A;  4P8U A;  1D7J A;  4DRP A;  1YAT A;  3TDB A;  3WD0 A;  4WKH A;  3RM4 A;  4DIP A;  3ARX A;  2K8I A;  5HT1 A;  4HBO A;  2PPN A;  3O5R A;  5HTG A;  3NI6 A;  3G6M A;  3WL0 A;  5DEZ A;  3OA5 A;  2DSW A;  4J4N A;  1QPL A;  3WD1 A;  1M5Y A;  4W9Q A;  4DWS D;  3BXW A;  2LPV A;  1NWU A;  5DIU A;  4JFK A;  4FAP A;  1F40 A;  4S3K A;  2MLX A;  3O5M A;  3GU0 A;  4U85 A;  3RFW A;  4KR0 B;  4Q22 A;  3O5J A;  3O5G A;  1XHG A;  4DRJ A;  4ODN A;  2RUR A;  3PRD A;  1O6I A;  2ZQS A;  2DG4 A;  1LG2 A;  4DZ3 A;  3AS2 A;  4ITZ A;  5I98 A;  3ARP A;  1ZBK A;  4QT3 A;  3I6C A;  2XP7 A;  5BXJ A;  1L1P A;  2WK2 A;  3O5L A;  1FKF A;  1E6P A;  5DO2 A;  2PI6 A;  4HAR A;  4LAV A;  4L72 B;  3ARY A;  2PBC A;  2ETN A;  2KE0 A;  3ARW A;  3RME A;  5HUA A;  4QZV B;  4WKF A;  5DIT A;  4TW7 A;  1U79 A;  1VF8 A;  5GPG A;  1W26 A;  4MPK A;  3PRB A;  2F21 A;  3O5K A;  4G50 A;  4P8X A;  3O5O A;  1EDQ A;  1E6Z A;  1OGB A;  1Q6H A;  3JXV A;  4BF8 A;  2B5U B;  3ARZ A;  3KAH A;  1HJV A;  1JND A;  2IF4 A;  3IKD A;  4TYO A;  1Q1C A;  4IQ2 A;  1FKH A;  3B9E A;  4MNL A;  2DSU A;  2M2A A;  5D75 A;  3O5F A;  3B7X A;  2ESC A;  4O2T A;  1BL4 A;  2FDM A;  1P5Q A;  1NH6 A;  5JH8 A;  4MTV A;  2ZR6 A;  2RUC A;  4Z2H A;  1FFR A;  4JFL A;  4DZ2 A;  1FKR A;  2WLY A;  1Q6I A;  1J4R A;  3WIJ A;  4Z2K A;  4PTM A;  2KR7 A;  1ZBV A;  3B9D A;  4URI A;  2IUZ A;  2UZ5 A;  4ODK A;  1QPF A;  3UQB A;  1LJY A;  1LL6 A;  2P4V A;  1KT1 A;  1A7X A;  3EY6 A;  4QT2 A;  3ARR A;  5B8I C;  2XP6 A;  1H0I A;  3CHE A;  1FKD A;  1PBK A;  2ZR5 A;  2PV3 A;  4DWS A;  4ODR A;  4AY1 A;  4Z2I A;  1D6O A;  5HKG A;  3CGN A;  4WKA A;  4LAY A;  2XP4 A;  3B8S A;  3WD3 A;  1J4H A;  1KT0 A;  4MGV A;  4U86 A;  1FFQ A;  3ARO A;  3WQW A;  3O5P A;  4JFM A;  1R9H A;  3AS3 A;  2KI3 A;  4U84 A;  4W9O A;  1YW5 A;  3IHZ A;  1F8A B;  4ZPV R;  2MLY A;  2FKE A;  2O9O A;  2MF9 A;  2DT3 A;  3UI4 A;  1HKJ A;  2XP9 A;  1E6R A;  2XPB A;  1C9H A;  1X6N A;  3FXY A;  3WKZ A;  1WB0 A;  3JYJ A;  1ZCN A;  4KQZ A;  4FN2 A;  2AWG A;  1FAP A;  4LGX A;  2JZV A;  1HJX A;  1GOI A;  4W5U A;  1ZB5 A;  4ML4 A;  5GQB A;  3UI5 A;  2ZQV A;  1D2K A;  2A3A A;  2LGO A;  1IX5 A;  1ZBC A;  2XPA A;  4DRN A;  2L2S A;  1CTN A;  2M1I A;  5HWC A;  4Z2L A;  3G6L A;  2ITK A;  3PR9 A;  2DG9 A;  4TW8 A;  3WD2 A;  2YBT A;  1UR9 A;  3ARV A;  2F4E A;  3PRA A;  1HKK A;  3KAB A;  1W1V A;  3KAG A;  1JCH B;  1ZU8 A;  4DRO A;  1FKI A;  1NMW A;  3WH0 A;  1EYM A;  2PN0 A;  2AOS A;  1JNS A;  3KAD A;  1ZK6 A;  4ODM A;  3BMB A;  2VN1 A;  4WJX A;  1NWT A;  4R5E A;  2N87 A;  1OGG A;  4TX0 A;  1SYT A;  3JYM A;  3W4R A;  4ZS6 A;  1ZL1 A;  2Q5A A;  1NSG A;  3NTP A;  4XAK A;  4C02 B;  2KGJ A;  4Z2J A;  3O5D A;  3KCE A;  1FKB A;  1K9T A;  2RUD A;  4S3J A;  1FKS A;  4GGQ A;  1FKL A;  1E44 A;  4MSP A;  1KFW A;  4ODO A;  3ARS A;  5HW6 A;  4J4O A;  4IQC A;  3RGC A;  4ODP A;  2F23 A;  2F2D A;  1D7I A;  2ZQT A;  3ALF A;  2RUQ A;  2ZR4 A;  2A3E A;  1WAW A;  3O5I A;  2DPE A;  4ODL A;  1ROT A;  2M08 A;  4JFJ A;  4G2P A;  2LJ4 A;  3CHD A;  3FY1 A;  3ARQ A;  1J6Y A;  1FJD A;  1GRJ A;  1T11 A;  2MPH A;  3MDY B;  3KAC A;  1J4I A;  2DSZ A;  2MLZ A;  3IK8 A;  3LUO A;  2XP3 A;  1QZ2 A;  4TW6 A;  2A3C A;  1UR8 A;  3ARU A;  3KAI A;  1RD6 A;  3UQI A;  4NNR A;  1W1Y A;  5J6E A;  1H0G A;  3NRK A;  2Y78 A;  4MNK A;  4DRQ A;  5DF0 A;  2RSE A;  4LAW A;  3GPK A;  2KFW A;  3EIP A;  2G41 A;  1ROU A;  4L3N A;  3AS0 A;  4Q7N A;  4GIV A;  3RM8 A;  3KZ7 A;  3AS1 A;  2XP8 A;  1W9V A;  4NZC A;  2DT2 A;  2ZQU A;  4DWS B;  4MNJ A;  1BKF A;  4ZPT R;  4P8W A;  3CHF A;  2EUL A;  2LKN A;  1HJW A;  3TCZ A;  4DRK A;  1GUV A;  1NMV A;  3KAF A;  3B9A A;  4DRH A;  1GPF A;  3UQA A;  4ZPW R;  2PPO A;  1D7H A;  1TCO C;  5HBF A;  2DG3 A;  2KO7 A;  2FAP A;  2A3B A;  4W9P A;  3WD4 A;  4R0X A;  2WM0 A;  3CH9 A;  2D9F A;  1EHN A;  1Y0O A;  4DWS C;  3WL1 A;  5HW7 A;  1FKG A;  5HWB A;  4IPX A;  2PV2 A;  1W9P A;  2VCD A;  1FKK A;  1JNT A;  4QIB A;  1E6N A;  4TNS A;  4DT4 A;  1LG1 A;  2PV1 A;  4DRM A;  2OFN A;  3OOB A;  1PIN A;  1W1T A;  2DT1 A;  3UF8 A;  5HW8 A;  3QOK A;  4NSB A;  4ODQ A;  1HKI A;  1TFV A;  3FAP A;  3RM9 A;  1X6L A;  4LAX A;  2XP5 A;  4JFI A;  3ALG A;  3CZ8 A;  4HBE A;  1B6C A;  4IT6 A;  3CGM A;  1E15 A;  1LQ0 A;  2DSV A;  5DIV A;  3GTY X;  2B31 A;  1OWQ A; 
#chains in the Genus database with same CATH homology
 2O92 A;  1ITX A;  1LL4 A;  1EIB A;  4WK9 A;  2DT0 A;  3ODK A;  1Q6U A;  1W1P A;  1E9L A;  2QF8 A;  1LL7 A;  3VAW A;  2OLH A;  1WNO A;  4WIW A;  3AQU A;  1XRV A;  1NWR A;  4Z2G A;  1SR0 A;  2G8Z A;  1N1A A;  2RQS A;  2PPP A;  4IT4 A;  1HXV A;  1W9U A;  2WLZ A;  4P8V A;  1NWS A;  3O5E A;  4MAV A;  4JYS A;  1FD9 A;  2MNT A;  3H9R B;  2YBU A;  5GPR A;  4DRI A;  1JNE A;  1EQ3 A;  4DH0 A;  1JVW A;  3CHC A;  1ZBW A;  1FKT A;  3PA7 A;  3WQV A;  3TC5 A;  3ART A;  3UI6 A;  1HKM A;  1FKJ A;  3IKG A;  3O5Q A;  4MNM A;  4N19 A;  4P8U A;  1D7J A;  4DRP A;  1YAT A;  3TDB A;  3WD0 A;  4WKH A;  3RM4 A;  4DIP A;  3ARX A;  5HT1 A;  4HBO A;  2PPN A;  3O5R A;  5HTG A;  3NI6 A;  3G6M A;  3WL0 A;  5DEZ A;  3OA5 A;  2DSW A;  4J4N A;  1QPL A;  3WD1 A;  1M5Y A;  4W9Q A;  4DWS D;  3BXW A;  2LPV A;  1NWU A;  5DIU A;  4JFK A;  4FAP A;  1F40 A;  4S3K A;  2MLX A;  3O5M A;  4U85 A;  3RFW A;  4KR0 B;  4Q22 A;  3O5J A;  3O5G A;  1XHG A;  4DRJ A;  4ODN A;  2RUR A;  3PRD A;  1O6I A;  2ZQS A;  2DG4 A;  1LG2 A;  4DZ3 A;  3AS2 A;  4ITZ A;  5I98 A;  3ARP A;  1ZBK A;  4QT3 A;  3I6C A;  2XP7 A;  5BXJ A;  1L1P A;  2WK2 A;  3O5L A;  1FKF A;  1E6P A;  5DO2 A;  2PI6 A;  4HAR A;  4LAV A;  4L72 B;  3ARY A;  2PBC A;  2KE0 A;  3ARW A;  3RME A;  5HUA A;  4QZV B;  4WKF A;  5DIT A;  4TW7 A;  1U79 A;  1VF8 A;  5GPG A;  1W26 A;  4MPK A;  3PRB A;  2F21 A;  3O5K A;  4G50 A;  4P8X A;  3O5O A;  1EDQ A;  1E6Z A;  1OGB A;  1Q6H A;  3JXV A;  4BF8 A;  3ARZ A;  3KAH A;  1HJV A;  1JND A;  2IF4 A;  3IKD A;  4TYO A;  1Q1C A;  4IQ2 A;  1FKH A;  3B9E A;  4MNL A;  2DSU A;  2M2A A;  5D75 A;  3O5F A;  3B7X A;  2ESC A;  4O2T A;  1BL4 A;  2FDM A;  1P5Q A;  1NH6 A;  5JH8 A;  4MTV A;  2ZR6 A;  2RUC A;  4Z2H A;  1FFR A;  4JFL A;  4DZ2 A;  1FKR A;  2WLY A;  1Q6I A;  1J4R A;  3WIJ A;  4Z2K A;  4PTM A;  2KR7 A;  1ZBV A;  3B9D A;  4URI A;  2IUZ A;  2UZ5 A;  4ODK A;  1QPF A;  3UQB A;  1LJY A;  1LL6 A;  1KT1 A;  1A7X A;  3EY6 A;  4QT2 A;  3ARR A;  5B8I C;  2XP6 A;  1H0I A;  3CHE A;  1FKD A;  1PBK A;  2ZR5 A;  2PV3 A;  4DWS A;  4ODR A;  4AY1 A;  4Z2I A;  1D6O A;  5HKG A;  3CGN A;  4WKA A;  4LAY A;  2XP4 A;  3B8S A;  3WD3 A;  1J4H A;  1KT0 A;  4MGV A;  4U86 A;  1FFQ A;  3ARO A;  3WQW A;  3O5P A;  4JFM A;  1R9H A;  3AS3 A;  2KI3 A;  4U84 A;  4W9O A;  1YW5 A;  3IHZ A;  1F8A B;  4ZPV R;  2MLY A;  2FKE A;  2O9O A;  2MF9 A;  2DT3 A;  3UI4 A;  1HKJ A;  2XP9 A;  1E6R A;  2XPB A;  1C9H A;  1X6N A;  3FXY A;  3WKZ A;  1WB0 A;  3JYJ A;  4KQZ A;  1ZCN A;  4FN2 A;  2AWG A;  1FAP A;  4LGX A;  2JZV A;  1HJX A;  1GOI A;  4W5U A;  1ZB5 A;  4ML4 A;  5GQB A;  3UI5 A;  2ZQV A;  1D2K A;  2A3A A;  2LGO A;  1IX5 A;  1ZBC A;  2XPA A;  4DRN A;  2L2S A;  1CTN A;  2M1I A;  5HWC A;  4Z2L A;  3G6L A;  2ITK A;  3PR9 A;  2DG9 A;  4TW8 A;  3WD2 A;  2YBT A;  1UR9 A;  3ARV A;  2F4E A;  3PRA A;  1HKK A;  3KAB A;  1W1V A;  3KAG A;  1ZU8 A;  4DRO A;  1FKI A;  1NMW A;  3WH0 A;  1EYM A;  2AOS A;  1JNS A;  3KAD A;  1ZK6 A;  4ODM A;  2VN1 A;  4WJX A;  1NWT A;  4R5E A;  2N87 A;  1OGG A;  4TX0 A;  1SYT A;  3JYM A;  3W4R A;  4ZS6 A;  1ZL1 A;  2Q5A A;  1NSG A;  3NTP A;  4XAK A;  4C02 B;  2KGJ A;  4Z2J A;  3O5D A;  3KCE A;  1FKB A;  1K9T A;  2RUD A;  4S3J A;  1FKS A;  4GGQ A;  1FKL A;  4MSP A;  1KFW A;  4ODO A;  3ARS A;  5HW6 A;  4J4O A;  4IQC A;  3RGC A;  4ODP A;  2F2D A;  1D7I A;  2ZQT A;  3ALF A;  2RUQ A;  2ZR4 A;  2A3E A;  1WAW A;  3O5I A;  2DPE A;  4ODL A;  1ROT A;  2M08 A;  4JFJ A;  4G2P A;  2LJ4 A;  3CHD A;  3FY1 A;  3ARQ A;  1J6Y A;  1FJD A;  1T11 A;  2MPH A;  3MDY B;  3KAC A;  1J4I A;  2DSZ A;  2MLZ A;  3IK8 A;  3LUO A;  2XP3 A;  1QZ2 A;  4TW6 A;  2A3C A;  1UR8 A;  3ARU A;  3KAI A;  1RD6 A;  3UQI A;  4NNR A;  1W1Y A;  5J6E A;  1H0G A;  3NRK A;  2Y78 A;  4MNK A;  4DRQ A;  5DF0 A;  2RSE A;  4LAW A;  3GPK A;  2KFW A;  2G41 A;  1ROU A;  4L3N A;  3AS0 A;  4Q7N A;  4GIV A;  3RM8 A;  3KZ7 A;  3AS1 A;  2XP8 A;  1W9V A;  4NZC A;  2DT2 A;  2ZQU A;  4DWS B;  4MNJ A;  1BKF A;  4ZPT R;  4P8W A;  3CHF A;  2LKN A;  1HJW A;  3TCZ A;  4DRK A;  1GUV A;  1NMV A;  3KAF A;  3B9A A;  4DRH A;  1GPF A;  3UQA A;  4ZPW R;  2PPO A;  1D7H A;  1TCO C;  5HBF A;  2DG3 A;  2KO7 A;  2FAP A;  2A3B A;  4W9P A;  3WD4 A;  4R0X A;  2WM0 A;  3CH9 A;  2D9F A;  1EHN A;  1Y0O A;  4DWS C;  3WL1 A;  5HW7 A;  1FKG A;  5HWB A;  4IPX A;  2PV2 A;  1W9P A;  2VCD A;  1FKK A;  1JNT A;  4QIB A;  1E6N A;  4TNS A;  4DT4 A;  1LG1 A;  2PV1 A;  4DRM A;  2OFN A;  3OOB A;  1PIN A;  1W1T A;  2DT1 A;  3UF8 A;  5HW8 A;  3QOK A;  4NSB A;  4ODQ A;  1HKI A;  1TFV A;  3FAP A;  3RM9 A;  1X6L A;  4LAX A;  4JFI A;  2XP5 A;  3ALG A;  3CZ8 A;  4HBE A;  1B6C A;  4IT6 A;  3CGM A;  1E15 A;  1LQ0 A;  2DSV A;  5DIV A;  2K8I A;  2B31 A;  1OWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...