4IT6A

Crystal structure of amino acid residues 1-120 of cg17282
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
117
structure length
113
Chain Sequence
DWYVGTEWEDKNRGLAKKVIGLQFTEMDKPTIISTVEFSVNKKATNLGGRPSKYLVATYPQKHSLEMGTSLTAVDCYLELLLQQFVPGETAACSITTKTGERIEFELKLEKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG17282
publication title Noncanonical FK506-Binding Protein BDBT Binds DBT to Enhance Its Circadian Function and Forms Foci at Night.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Unknown function
total genus 20
structure length 113
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18023 FKBP_N_2 BDBT FKBP like N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.60 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4it6A00
4IT6A 4IT4A
chains in the Genus database with same CATH superfamily
4Z2LA 1FFRA 2XP5A 1EIBA 4KQZA 1CTNA 1FKBA 3AS0A 4N19A 4W5UA 1N1AA 1W1TA 2RQSA 3KADA 5HWCA 3KABA 3B8SA 1XRVA 4S3KA 3PR9A 2KE0A 1WAWA 1GPFA 3ARRA 4R0XA 1NWUA 3TCZA 4ZPTR 1R9HA 4ODOA 2ZQSA 2RUDA 1GOIA 3AS2A 4BF8A 4ODLA 2IUZA 1HKIA 3B9EA 4ODRA 1KT1A 4MGVA 4R5EA 1NMVA 1OGBA 1E6RA 4PTMA 1NH6A 2PBCA 3IHZA 1EYMA 4S3JA 1FJDA 4DRPA 1C9HA 2MLXA 4DRNA 3WQWA 2LPVA 3B9DA 3JYMA 3ODKA 2M08A 3ARZA 1FFQA 3ARYA 2RUQA 3CZ8A 1E6NA 5GPRA 2A3BA 2MPHA 1Q6HA 1D2KA 1OWQA 5DEZA 2D9FA 4AY1A 2A3AA 2ZQUA 3CGMA 4P8XA 1JVWA 1E15A 1PBKA 1Q6IA 2AOSA 1IX5A 4HBOA 1JNSA 2G41A 5I98A 3TC5A 5DO2A 4JFKA 2WLYA 1NSGA 1HXVA 3ARVA 1FKIA 3B9AA 1TCOC 4DRMA 3CHDA 3CH9A 3WD1A 4IQ2A 3UI6A 3O5PA 4XAKA 4TX0A 3WL1A 4JYSA 2DT2A 1W1YA 1FKSA 1JNEA 1JNDA 4MSPA 3UQAA 1SR0A 1FD9A 2OFNA 4DRHA 1HKKA 1ZB5A 4ML4A 3O5KA 2YBUA 4C02B 4DWSC 1YATA 3KACA 3UQIA 1P5QA 1FKKA 5B8IC 1FAPA 2PV1A 5DF0A 2XPAA 2MLZA 4IQCA 1FKJA 3JXVA 2PV2A 4QZVB 2PN0A 1UR8A 2ETNA 3KAHA 4QT2A 3UI4A 5HUAA 2DG9A 1J4IA 1XHGA 2WLZA 3CHFA 5J6EA 4WIWA 4O2TA 1GUVA 4DRKA 1J4HA 3I6CA 3ARTA 5HWBA 4DRJA 3KCEA 1ZBCA 1X6NA 1WNOA 4WKAA 3WQVA 3WD2A 4WK9A 3IKGA 4ZPVR 1L1PA 3TDBA 4JFMA 1FKRA 1O6IA 2ITKA 1HKMA 1ZBWA 1KFWA 1HJXA 2PPOA 2KO7A 4IT4A 2DSVA 1D7HA 2PV3A 2MF9A 3AS1A 1LL6A 1ZCNA 3NI6A 4J4OA 2ZR6A 3RGCA 3AQUA 1E6ZA 2WK2A 4G2PA 3EIPA 5HKGA 1NWRA 4W9QA 4DWSD 3ARWA 1W9VA 1D7JA 3B7XA 4TW6A 4ITZA 4MTVA 1LJYA 3ARUA 3FXYA 3UQBA 4Q7NA 3MDYB 1LL7A 2JZVA 4DZ2A 4U86A 2M2AA 4DWSB 1W9UA 2FDMA 2YBTA 3O5EA 1T11A 2O9OA 3PRAA 3QOKA 1TFVA 1RD6A 2VN1A 2XP7A 4ODKA 1EHNA 2F23A 3OOBA 3WKZA 2ZR5A 4IT6A 1NWSA 4FAPA 3CGNA 1NWTA 2XP8A 4U84A 2XP9A 5DIVA 4MNMA 2OLHA 3VAWA 3G6LA 1H0IA 3O5LA 2N87A 4TNSA 3H9RB 2LJ4A 3KAFA 2KR7A 3EY6A 1UR9A 3ARXA 4FN2A 4MPKA 4NNRA 4P8WA 1WB0A 3O5FA 3NTPA 3AROA 4DZ3A 4LAWA 4Q22A 3ARPA 4QT3A 3NRKA 4WKHA 2DPEA 2F2DA 1QPFA 1GRJA 2WM0A 3FY1A 1VF8A 1F8AB 2M1IA 3IK8A 3RM4A 1ZU8A 1LG2A 4KR0B 4DROA 4P8UA 1EQ3A 3RM8A 2A3EA 2Q5AA 3ALFA 1BL4A 4MNLA 1E6PA 2LGOA 2DSZA 1Y0OA 2DSUA 2XPBA 1ROTA 1ZBVA 1B6CA 1E44A 2KFWA 5DITA 4JFIA 3O5OA 4P8VA 1W1PA 2L2SA 2MNTA 3LUOA 3BMBA 4NSBA 5HBFA 1J4RA 4WJXA 3CHCA 5GQBA 3G6MA 2ZQVA 2KI3A 4Z2KA 4TW7A 3JYJA 3WD3A 3WL0A 4GIVA 1ZK6A 1W1VA 4ODQA 2ESCA 3ARQA 2ZQTA 5D75A 2KGJA 3GTYX 2A3CA 1FKDA 3KAIA 4DWSA 5HTGA 1FKTA 4WKFA 3WIJA 5HW7A 3ARSA 1ROUA 3RFWA 4GGQA 3KAGA 4DIPA 4JFLA 2B5UB 4J4NA 4L72B 1FKHA 1QPLA 3WD4A 3PA7A 4ODMA 1A7XA 2FKEA 5HT1A 2F21A 3O5DA 2RURA 1BKFA 2AWGA 3KZ7A 2VCDA 1QZ2A 2P4VA 3UF8A 3O5JA 1OGGA 2DT3A 5DIUA 2DG4A 2O92A 1KT0A 1W9PA 4MNJA 4ODNA 4TW8A 2RUCA 1K9TA 3GPKA 2PPNA 4DRQA 4G50A 3CHEA 4Z2GA 4LAYA 4IPXA 4W9PA 2EULA 1D7IA 4U85A 3O5GA 3BXWA 3IKDA 1HKJA 1H0GA 1HJWA 1Q6UA 4JFJA 4DT4A 1J6YA 3RMEA 3O5IA 4TYOA 2G8ZA 2Y78A 4HARA 3AS3A 1SYTA 4UDMA 4DH0A 2XP3A 3PRDA 1W26A 1ITXA 2DT0A 2XP4A 2XP6A 2DSWA 2UZ5A 3OA5A 4LAVA 1FKLA 1JCHB 1LQ0A 2DG3A 2RSEA 2ZR4A 2LKNA 3O5QA 4LAXA 1ZBKA 2PI6A 2FAPA 1YW5A 2PPPA 4Z2HA 5JH8A 3GU0A 4MAVA 4HBEA 5HW8A 4LGXA 4QIBA 2K8IA 4ZPWR 3WD0A 4Z2IA 4URIA 4DRIA 4ODPA 3O5RA 1M5YA 2B31A 3UI5A 3PRBA 1JNTA 1NMWA 5GPGA 1HJVA 1PINA 1X6LA 1LL4A 1LG1A 4Z2JA 2IF4A 1Q1CA 1U79A 4W9OA 1D6OA 3WH0A 5BXJA 3O5MA 3W4RA 1E9LA 4L3NA 3RM9A 3FAPA 1FKFA 2MLYA 2DT1A 1EDQA 1F40A 1FKGA 4MNKA 2QF8A 5HW6A 3ALGA 4NZCA 2F4EA 4ZS6A 1ZL1A
chains in the Genus database with same CATH topology
4Z2LA 1FFRA 2XP5A 1EIBA 4KQZA 1CTNA 1FKBA 3AS0A 4N19A 4W5UA 1N1AA 1W1TA 2RQSA 3KADA 5HWCA 3KABA 3B8SA 1XRVA 4S3KA 3PR9A 2KE0A 1WAWA 1GPFA 3ARRA 4R0XA 1NWUA 3TCZA 4ZPTR 1R9HA 4ODOA 2ZQSA 2RUDA 1GOIA 3AS2A 4BF8A 4ODLA 2IUZA 1HKIA 3B9EA 4ODRA 1KT1A 4MGVA 4R5EA 1NMVA 1OGBA 1E6RA 4PTMA 1NH6A 2PBCA 3IHZA 1EYMA 4S3JA 1FJDA 4DRPA 1C9HA 2MLXA 4DRNA 3WQWA 2LPVA 3B9DA 3JYMA 3ODKA 2M08A 3ARZA 1FFQA 3ARYA 2RUQA 3CZ8A 1E6NA 5GPRA 2A3BA 2MPHA 1Q6HA 1D2KA 1OWQA 5DEZA 2D9FA 4AY1A 2A3AA 2ZQUA 3CGMA 4P8XA 1JVWA 1E15A 1PBKA 1Q6IA 2AOSA 1IX5A 4HBOA 1JNSA 2G41A 5I98A 3TC5A 5DO2A 4JFKA 2WLYA 1NSGA 1HXVA 3ARVA 1FKIA 3B9AA 1TCOC 4DRMA 3CHDA 3CH9A 3WD1A 4IQ2A 3UI6A 3O5PA 4XAKA 4TX0A 3WL1A 4JYSA 2DT2A 1W1YA 1FKSA 1JNEA 1JNDA 4MSPA 3UQAA 1SR0A 1FD9A 2OFNA 4DRHA 1HKKA 1ZB5A 4ML4A 3O5KA 2YBUA 4C02B 4DWSC 1YATA 3KACA 3UQIA 1P5QA 1FKKA 5B8IC 1FAPA 2PV1A 5DF0A 2XPAA 2MLZA 4IQCA 1FKJA 3JXVA 2PV2A 4QZVB 1UR8A 3KAHA 4QT2A 3UI4A 5HUAA 2DG9A 1J4IA 1XHGA 2WLZA 3CHFA 5J6EA 4WIWA 4O2TA 1GUVA 4DRKA 1J4HA 3I6CA 3ARTA 5HWBA 4DRJA 3KCEA 1ZBCA 1X6NA 1WNOA 4WKAA 3WQVA 3WD2A 4WK9A 3IKGA 4ZPVR 1L1PA 3TDBA 4JFMA 1FKRA 1O6IA 2ITKA 1HKMA 1ZBWA 1KFWA 1HJXA 2PPOA 2KO7A 4IT4A 2DSVA 1D7HA 2PV3A 2MF9A 3AS1A 1LL6A 1ZCNA 3NI6A 4J4OA 2ZR6A 3RGCA 3AQUA 1E6ZA 2WK2A 4G2PA 5HKGA 1NWRA 4W9QA 4DWSD 3ARWA 1W9VA 1D7JA 3B7XA 4TW6A 4ITZA 4MTVA 1LJYA 3ARUA 3FXYA 3UQBA 4Q7NA 3MDYB 1LL7A 2JZVA 4DZ2A 4U86A 2M2AA 4DWSB 1W9UA 2FDMA 2YBTA 3O5EA 1T11A 2O9OA 3PRAA 3QOKA 1TFVA 1RD6A 2VN1A 2XP7A 4ODKA 1EHNA 3OOBA 3WKZA 2ZR5A 4IT6A 1NWSA 4FAPA 3CGNA 1NWTA 2XP8A 4U84A 2XP9A 5DIVA 4MNMA 2OLHA 3VAWA 3G6LA 1H0IA 3O5LA 2N87A 4TNSA 3H9RB 2LJ4A 3KAFA 2KR7A 3EY6A 1UR9A 3ARXA 4FN2A 4MPKA 4NNRA 4P8WA 1WB0A 3O5FA 3NTPA 3AROA 4DZ3A 4LAWA 4Q22A 3ARPA 4QT3A 3NRKA 4WKHA 2DPEA 2F2DA 1QPFA 2WM0A 3FY1A 1VF8A 1F8AB 2M1IA 3IK8A 3RM4A 1ZU8A 1LG2A 4KR0B 4DROA 4P8UA 1EQ3A 3RM8A 2A3EA 2Q5AA 3ALFA 1BL4A 4MNLA 1E6PA 2LGOA 2DSZA 1Y0OA 2DSUA 2XPBA 1ROTA 1ZBVA 1B6CA 2KFWA 5DITA 4JFIA 3O5OA 4P8VA 1W1PA 2L2SA 2MNTA 3LUOA 4NSBA 5HBFA 1J4RA 4WJXA 3CHCA 5GQBA 3G6MA 2ZQVA 2KI3A 4Z2KA 4TW7A 3JYJA 3WD3A 3WL0A 4GIVA 1ZK6A 1W1VA 4ODQA 2ESCA 3ARQA 2ZQTA 5D75A 2KGJA 2A3CA 1FKDA 3KAIA 4DWSA 5HTGA 1FKTA 4WKFA 3WIJA 5HW7A 3ARSA 1ROUA 3RFWA 4GGQA 3KAGA 4DIPA 4JFLA 4J4NA 4L72B 1FKHA 1QPLA 3WD4A 3PA7A 4ODMA 1A7XA 2FKEA 5HT1A 2F21A 3O5DA 2RURA 1BKFA 2AWGA 3KZ7A 2VCDA 1QZ2A 3UF8A 3O5JA 1OGGA 2DT3A 5DIUA 2DG4A 2O92A 1KT0A 1W9PA 4MNJA 4ODNA 4TW8A 2RUCA 1K9TA 3GPKA 2PPNA 4DRQA 4G50A 3CHEA 4Z2GA 4LAYA 4IPXA 4W9PA 1D7IA 4U85A 3O5GA 3BXWA 3IKDA 1HKJA 1H0GA 1HJWA 1Q6UA 4JFJA 4DT4A 1J6YA 3RMEA 3O5IA 4TYOA 2G8ZA 2Y78A 4HARA 3AS3A 1SYTA 4DH0A 2XP3A 3PRDA 1W26A 1ITXA 2DT0A 2XP4A 2XP6A 2DSWA 2UZ5A 3OA5A 4LAVA 1FKLA 1LQ0A 2DG3A 2RSEA 2ZR4A 2LKNA 3O5QA 4LAXA 1ZBKA 2PI6A 2FAPA 1YW5A 2PPPA 4Z2HA 5JH8A 4MAVA 4HBEA 5HW8A 4LGXA 4QIBA 2K8IA 4ZPWR 3WD0A 4Z2IA 4URIA 4DRIA 4ODPA 3O5RA 1M5YA 2B31A 3UI5A 3PRBA 1JNTA 1NMWA 5GPGA 1HJVA 1PINA 1X6LA 1LL4A 1LG1A 4Z2JA 2IF4A 1Q1CA 1U79A 4W9OA 1D6OA 3WH0A 5BXJA 3O5MA 3W4RA 1E9LA 4L3NA 3RM9A 3FAPA 1FKFA 2MLYA 2DT1A 1EDQA 1F40A 1FKGA 4MNKA 2QF8A 5HW6A 3ALGA 4NZCA 2F4EA 4ZS6A 1ZL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT6 A;  4IT4 A; 
#chains in the Genus database with same CATH topology
 4Z2L A;  1FFR A;  2XP5 A;  1EIB A;  4KQZ A;  1CTN A;  1FKB A;  3AS0 A;  4N19 A;  4W5U A;  1N1A A;  1W1T A;  2RQS A;  3KAD A;  5HWC A;  3KAB A;  3B8S A;  1XRV A;  4S3K A;  3PR9 A;  2KE0 A;  1WAW A;  1GPF A;  3ARR A;  4R0X A;  1NWU A;  3TCZ A;  4ZPT R;  1R9H A;  4ODO A;  2ZQS A;  2RUD A;  1GOI A;  3AS2 A;  4BF8 A;  4ODL A;  2IUZ A;  1HKI A;  3B9E A;  4ODR A;  1KT1 A;  4MGV A;  4R5E A;  1NMV A;  1OGB A;  1E6R A;  4PTM A;  1NH6 A;  2PBC A;  3IHZ A;  1EYM A;  4S3J A;  1FJD A;  4DRP A;  1C9H A;  2MLX A;  4DRN A;  3WQW A;  2LPV A;  3B9D A;  3JYM A;  3ODK A;  2M08 A;  3ARZ A;  1FFQ A;  3ARY A;  2RUQ A;  3CZ8 A;  1E6N A;  5GPR A;  2A3B A;  2MPH A;  1Q6H A;  1D2K A;  1OWQ A;  5DEZ A;  2D9F A;  4AY1 A;  2A3A A;  2ZQU A;  3CGM A;  4P8X A;  1JVW A;  1E15 A;  1PBK A;  1Q6I A;  2AOS A;  1IX5 A;  4HBO A;  1JNS A;  2G41 A;  5I98 A;  3TC5 A;  5DO2 A;  4JFK A;  2WLY A;  1NSG A;  1HXV A;  3ARV A;  1FKI A;  3B9A A;  1TCO C;  4DRM A;  3CHD A;  3CH9 A;  3WD1 A;  4IQ2 A;  3UI6 A;  3O5P A;  4XAK A;  4TX0 A;  3WL1 A;  4JYS A;  2DT2 A;  1W1Y A;  1FKS A;  1JNE A;  1JND A;  4MSP A;  3UQA A;  1SR0 A;  1FD9 A;  2OFN A;  4DRH A;  1HKK A;  1ZB5 A;  4ML4 A;  3O5K A;  2YBU A;  4C02 B;  4DWS C;  1YAT A;  3KAC A;  3UQI A;  1P5Q A;  1FKK A;  5B8I C;  1FAP A;  2PV1 A;  5DF0 A;  2XPA A;  2MLZ A;  4IQC A;  1FKJ A;  3JXV A;  2PV2 A;  4QZV B;  2PN0 A;  1UR8 A;  2ETN A;  3KAH A;  4QT2 A;  3UI4 A;  5HUA A;  2DG9 A;  1J4I A;  1XHG A;  2WLZ A;  3CHF A;  5J6E A;  4WIW A;  4O2T A;  1GUV A;  4DRK A;  1J4H A;  3I6C A;  3ART A;  5HWB A;  4DRJ A;  3KCE A;  1ZBC A;  1X6N A;  1WNO A;  4WKA A;  3WQV A;  3WD2 A;  4WK9 A;  3IKG A;  4ZPV R;  1L1P A;  3TDB A;  4JFM A;  1FKR A;  1O6I A;  2ITK A;  1HKM A;  1ZBW A;  1KFW A;  1HJX A;  2PPO A;  2KO7 A;  4IT4 A;  2DSV A;  1D7H A;  2PV3 A;  2MF9 A;  3AS1 A;  1LL6 A;  1ZCN A;  3NI6 A;  4J4O A;  2ZR6 A;  3RGC A;  3AQU A;  1E6Z A;  2WK2 A;  4G2P A;  3EIP A;  5HKG A;  1NWR A;  4W9Q A;  4DWS D;  3ARW A;  1W9V A;  1D7J A;  3B7X A;  4TW6 A;  4ITZ A;  4MTV A;  1LJY A;  3ARU A;  3FXY A;  3UQB A;  4Q7N A;  3MDY B;  1LL7 A;  2JZV A;  4DZ2 A;  4U86 A;  2M2A A;  4DWS B;  1W9U A;  2FDM A;  2YBT A;  3O5E A;  1T11 A;  2O9O A;  3PRA A;  3QOK A;  1TFV A;  1RD6 A;  2VN1 A;  2XP7 A;  4ODK A;  1EHN A;  2F23 A;  3OOB A;  3WKZ A;  2ZR5 A;  4IT6 A;  1NWS A;  4FAP A;  3CGN A;  1NWT A;  2XP8 A;  4U84 A;  2XP9 A;  5DIV A;  4MNM A;  2OLH A;  3VAW A;  3G6L A;  1H0I A;  3O5L A;  2N87 A;  4TNS A;  3H9R B;  2LJ4 A;  3KAF A;  2KR7 A;  3EY6 A;  1UR9 A;  3ARX A;  4FN2 A;  4MPK A;  4NNR A;  4P8W A;  1WB0 A;  3O5F A;  3NTP A;  3ARO A;  4DZ3 A;  4LAW A;  4Q22 A;  3ARP A;  4QT3 A;  3NRK A;  4WKH A;  2DPE A;  2F2D A;  1QPF A;  1GRJ A;  2WM0 A;  3FY1 A;  1VF8 A;  1F8A B;  2M1I A;  3IK8 A;  3RM4 A;  1ZU8 A;  1LG2 A;  4KR0 B;  4DRO A;  4P8U A;  1EQ3 A;  3RM8 A;  2A3E A;  2Q5A A;  3ALF A;  1BL4 A;  4MNL A;  1E6P A;  2LGO A;  2DSZ A;  1Y0O A;  2DSU A;  2XPB A;  1ROT A;  1ZBV A;  1B6C A;  1E44 A;  2KFW A;  5DIT A;  4JFI A;  3O5O A;  4P8V A;  1W1P A;  2L2S A;  2MNT A;  3LUO A;  3BMB A;  4NSB A;  5HBF A;  1J4R A;  4WJX A;  3CHC A;  5GQB A;  3G6M A;  2ZQV A;  2KI3 A;  4Z2K A;  4TW7 A;  3JYJ A;  3WD3 A;  3WL0 A;  4GIV A;  1ZK6 A;  1W1V A;  4ODQ A;  2ESC A;  3ARQ A;  2ZQT A;  5D75 A;  2KGJ A;  3GTY X;  2A3C A;  1FKD A;  3KAI A;  4DWS A;  5HTG A;  1FKT A;  4WKF A;  3WIJ A;  5HW7 A;  3ARS A;  1ROU A;  3RFW A;  4GGQ A;  3KAG A;  4DIP A;  4JFL A;  2B5U B;  4J4N A;  4L72 B;  1FKH A;  1QPL A;  3WD4 A;  3PA7 A;  4ODM A;  1A7X A;  2FKE A;  5HT1 A;  2F21 A;  3O5D A;  2RUR A;  1BKF A;  2AWG A;  3KZ7 A;  2VCD A;  1QZ2 A;  2P4V A;  3UF8 A;  3O5J A;  1OGG A;  2DT3 A;  5DIU A;  2DG4 A;  2O92 A;  1KT0 A;  1W9P A;  4MNJ A;  4ODN A;  4TW8 A;  2RUC A;  1K9T A;  3GPK A;  2PPN A;  4DRQ A;  4G50 A;  3CHE A;  4Z2G A;  4LAY A;  4IPX A;  4W9P A;  2EUL A;  1D7I A;  4U85 A;  3O5G A;  3BXW A;  3IKD A;  1HKJ A;  1H0G A;  1HJW A;  1Q6U A;  4JFJ A;  4DT4 A;  1J6Y A;  3RME A;  3O5I A;  4TYO A;  2G8Z A;  2Y78 A;  4HAR A;  3AS3 A;  1SYT A;  4UDM A;  4DH0 A;  2XP3 A;  3PRD A;  1W26 A;  1ITX A;  2DT0 A;  2XP4 A;  2XP6 A;  2DSW A;  2UZ5 A;  3OA5 A;  4LAV A;  1FKL A;  1JCH B;  1LQ0 A;  2DG3 A;  2RSE A;  2ZR4 A;  2LKN A;  3O5Q A;  4LAX A;  1ZBK A;  2PI6 A;  2FAP A;  1YW5 A;  2PPP A;  4Z2H A;  5JH8 A;  3GU0 A;  4MAV A;  4HBE A;  5HW8 A;  4LGX A;  4QIB A;  2K8I A;  4ZPW R;  3WD0 A;  4Z2I A;  4URI A;  4DRI A;  4ODP A;  3O5R A;  1M5Y A;  2B31 A;  3UI5 A;  3PRB A;  1JNT A;  1NMW A;  5GPG A;  1HJV A;  1PIN A;  1X6L A;  1LL4 A;  1LG1 A;  4Z2J A;  2IF4 A;  1Q1C A;  1U79 A;  4W9O A;  1D6O A;  3WH0 A;  5BXJ A;  3O5M A;  3W4R A;  1E9L A;  4L3N A;  3RM9 A;  3FAP A;  1FKF A;  2MLY A;  2DT1 A;  1EDQ A;  1F40 A;  1FKG A;  4MNK A;  2QF8 A;  5HW6 A;  3ALG A;  4NZC A;  2F4E A;  4ZS6 A;  1ZL1 A; 
#chains in the Genus database with same CATH homology
 4Z2L A;  1FFR A;  2XP5 A;  1EIB A;  4KQZ A;  1CTN A;  1FKB A;  3AS0 A;  4N19 A;  4W5U A;  1N1A A;  1W1T A;  2RQS A;  3KAD A;  5HWC A;  3KAB A;  3B8S A;  1XRV A;  4S3K A;  3PR9 A;  2KE0 A;  1WAW A;  1GPF A;  3ARR A;  4R0X A;  1NWU A;  3TCZ A;  4ZPT R;  1R9H A;  4ODO A;  2ZQS A;  2RUD A;  1GOI A;  3AS2 A;  4BF8 A;  4ODL A;  2IUZ A;  1HKI A;  3B9E A;  4ODR A;  1KT1 A;  4MGV A;  4R5E A;  1NMV A;  1OGB A;  1E6R A;  4PTM A;  1NH6 A;  2PBC A;  3IHZ A;  1EYM A;  4S3J A;  1FJD A;  4DRP A;  1C9H A;  2MLX A;  4DRN A;  3WQW A;  2LPV A;  3B9D A;  3JYM A;  3ODK A;  2M08 A;  3ARZ A;  1FFQ A;  3ARY A;  2RUQ A;  3CZ8 A;  1E6N A;  5GPR A;  2A3B A;  2MPH A;  1Q6H A;  1D2K A;  1OWQ A;  5DEZ A;  2D9F A;  4AY1 A;  2A3A A;  2ZQU A;  3CGM A;  4P8X A;  1JVW A;  1E15 A;  1PBK A;  1Q6I A;  2AOS A;  1IX5 A;  4HBO A;  1JNS A;  2G41 A;  5I98 A;  3TC5 A;  5DO2 A;  4JFK A;  2WLY A;  1NSG A;  1HXV A;  3ARV A;  1FKI A;  3B9A A;  1TCO C;  4DRM A;  3CHD A;  3CH9 A;  3WD1 A;  4IQ2 A;  3UI6 A;  3O5P A;  4XAK A;  4TX0 A;  3WL1 A;  4JYS A;  2DT2 A;  1W1Y A;  1FKS A;  1JNE A;  1JND A;  4MSP A;  3UQA A;  1SR0 A;  1FD9 A;  2OFN A;  4DRH A;  1HKK A;  1ZB5 A;  4ML4 A;  3O5K A;  2YBU A;  4C02 B;  4DWS C;  1YAT A;  3KAC A;  3UQI A;  1P5Q A;  1FKK A;  5B8I C;  1FAP A;  2PV1 A;  5DF0 A;  2XPA A;  2MLZ A;  4IQC A;  1FKJ A;  3JXV A;  2PV2 A;  4QZV B;  1UR8 A;  3KAH A;  4QT2 A;  3UI4 A;  5HUA A;  2DG9 A;  1J4I A;  1XHG A;  2WLZ A;  3CHF A;  5J6E A;  4WIW A;  4O2T A;  1GUV A;  4DRK A;  1J4H A;  3I6C A;  3ART A;  5HWB A;  4DRJ A;  3KCE A;  1ZBC A;  1X6N A;  1WNO A;  4WKA A;  3WQV A;  3WD2 A;  4WK9 A;  3IKG A;  4ZPV R;  1L1P A;  3TDB A;  4JFM A;  1FKR A;  1O6I A;  2ITK A;  1HKM A;  1ZBW A;  1KFW A;  1HJX A;  2PPO A;  2KO7 A;  4IT4 A;  2DSV A;  1D7H A;  2PV3 A;  2MF9 A;  3AS1 A;  1LL6 A;  1ZCN A;  3NI6 A;  4J4O A;  2ZR6 A;  3RGC A;  3AQU A;  1E6Z A;  2WK2 A;  4G2P A;  5HKG A;  1NWR A;  4W9Q A;  4DWS D;  3ARW A;  1W9V A;  1D7J A;  3B7X A;  4TW6 A;  4ITZ A;  4MTV A;  1LJY A;  3ARU A;  3FXY A;  3UQB A;  4Q7N A;  3MDY B;  1LL7 A;  2JZV A;  4DZ2 A;  4U86 A;  2M2A A;  4DWS B;  1W9U A;  2FDM A;  2YBT A;  3O5E A;  1T11 A;  2O9O A;  3PRA A;  3QOK A;  1TFV A;  1RD6 A;  2VN1 A;  2XP7 A;  4ODK A;  1EHN A;  3OOB A;  3WKZ A;  2ZR5 A;  4IT6 A;  1NWS A;  4FAP A;  3CGN A;  1NWT A;  2XP8 A;  4U84 A;  2XP9 A;  5DIV A;  4MNM A;  2OLH A;  3VAW A;  3G6L A;  1H0I A;  3O5L A;  2N87 A;  4TNS A;  3H9R B;  2LJ4 A;  3KAF A;  2KR7 A;  3EY6 A;  1UR9 A;  3ARX A;  4FN2 A;  4MPK A;  4NNR A;  4P8W A;  1WB0 A;  3O5F A;  3NTP A;  3ARO A;  4DZ3 A;  4LAW A;  4Q22 A;  3ARP A;  4QT3 A;  3NRK A;  4WKH A;  2DPE A;  2F2D A;  1QPF A;  2WM0 A;  3FY1 A;  1VF8 A;  1F8A B;  2M1I A;  3IK8 A;  3RM4 A;  1ZU8 A;  1LG2 A;  4KR0 B;  4DRO A;  4P8U A;  1EQ3 A;  3RM8 A;  2A3E A;  2Q5A A;  3ALF A;  1BL4 A;  4MNL A;  1E6P A;  2LGO A;  2DSZ A;  1Y0O A;  2DSU A;  2XPB A;  1ROT A;  1ZBV A;  1B6C A;  2KFW A;  5DIT A;  4JFI A;  3O5O A;  4P8V A;  1W1P A;  2L2S A;  2MNT A;  3LUO A;  4NSB A;  5HBF A;  1J4R A;  4WJX A;  3CHC A;  5GQB A;  3G6M A;  2ZQV A;  2KI3 A;  4Z2K A;  4TW7 A;  3JYJ A;  3WD3 A;  3WL0 A;  4GIV A;  1ZK6 A;  1W1V A;  4ODQ A;  2ESC A;  3ARQ A;  2ZQT A;  5D75 A;  2KGJ A;  2A3C A;  1FKD A;  3KAI A;  4DWS A;  5HTG A;  1FKT A;  4WKF A;  3WIJ A;  5HW7 A;  3ARS A;  1ROU A;  3RFW A;  4GGQ A;  3KAG A;  4DIP A;  4JFL A;  4J4N A;  4L72 B;  1FKH A;  1QPL A;  3WD4 A;  3PA7 A;  4ODM A;  1A7X A;  2FKE A;  5HT1 A;  2F21 A;  3O5D A;  2RUR A;  1BKF A;  2AWG A;  3KZ7 A;  2VCD A;  1QZ2 A;  3UF8 A;  3O5J A;  1OGG A;  2DT3 A;  5DIU A;  2DG4 A;  2O92 A;  1KT0 A;  1W9P A;  4MNJ A;  4ODN A;  4TW8 A;  2RUC A;  1K9T A;  3GPK A;  2PPN A;  4DRQ A;  4G50 A;  3CHE A;  4Z2G A;  4LAY A;  4IPX A;  4W9P A;  1D7I A;  4U85 A;  3O5G A;  3BXW A;  3IKD A;  1HKJ A;  1H0G A;  1HJW A;  1Q6U A;  4JFJ A;  4DT4 A;  1J6Y A;  3RME A;  3O5I A;  4TYO A;  2G8Z A;  2Y78 A;  4HAR A;  3AS3 A;  1SYT A;  4DH0 A;  2XP3 A;  3PRD A;  1W26 A;  1ITX A;  2DT0 A;  2XP4 A;  2XP6 A;  2DSW A;  2UZ5 A;  3OA5 A;  4LAV A;  1FKL A;  1LQ0 A;  2DG3 A;  2RSE A;  2ZR4 A;  2LKN A;  3O5Q A;  4LAX A;  1ZBK A;  2PI6 A;  2FAP A;  1YW5 A;  2PPP A;  4Z2H A;  5JH8 A;  4MAV A;  4HBE A;  5HW8 A;  4LGX A;  4QIB A;  2K8I A;  4ZPW R;  3WD0 A;  4Z2I A;  4URI A;  4DRI A;  4ODP A;  3O5R A;  1M5Y A;  2B31 A;  3UI5 A;  3PRB A;  1JNT A;  1NMW A;  5GPG A;  1HJV A;  1PIN A;  1X6L A;  1LL4 A;  1LG1 A;  4Z2J A;  2IF4 A;  1Q1C A;  1U79 A;  4W9O A;  1D6O A;  3WH0 A;  5BXJ A;  3O5M A;  3W4R A;  1E9L A;  4L3N A;  3RM9 A;  3FAP A;  1FKF A;  2MLY A;  2DT1 A;  1EDQ A;  1F40 A;  1FKG A;  4MNK A;  2QF8 A;  5HW6 A;  3ALG A;  4NZC A;  2F4E A;  4ZS6 A;  1ZL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...