4IT6A

Crystal structure of amino acid residues 1-120 of cg17282
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
117
structure length
113
Chain Sequence
DWYVGTEWEDKNRGLAKKVIGLQFTEMDKPTIISTVEFSVNKKATNLGGRPSKYLVATYPQKHSLEMGTSLTAVDCYLELLLQQFVPGETAACSITTKTGERIEFELKLEKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Noncanonical FK506-Binding Protein BDBT Binds DBT to Enhance Its Circadian Function and Forms Foci at Night.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Unknown function
molecule keywords CG17282
total genus 20
structure length 113
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18023 FKBP_N_2 BDBT FKBP like N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.60 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4it6A00
4IT6A 4IT4A
chains in the Genus database with same CATH superfamily
2DT0A 4TW7A 1ROUA 4WKAA 1JNDA 2ZR4A 3UI5A 5HTGA 2AWGA 4HBOA 4MAVA 2WK2A 5HBFA 3WD4A 1UR9A 4LAVA 3KAHA 2LKNA 4DRMA 3RFWA 4BF8A 3O5OA 1ZL1A 1D2KA 3O5IA 3O5PA 1W9UA 1J4HA 1HJWA 5I98A 4DRNA 4JFJA 4J4OA 1LQ0A 1FKGA 1ZCNA 5BXJA 4W5UA 3OOBA 3KAIA 3UF8A 3O5JA 4DRHA 4ODPA 1ZBKA 4URIA 2RURA 3GU0A 3WL1A 2WLYA 3WD3A 4JFLA 2ZR6A 3PRAA 2ITKA 3WD2A 1GPFA 2O9OA 2WLZA 3CHFA 2LPVA 1OGBA 1LJYA 3IK8A 4ML4A 3TDBA 2DSVA 1EYMA 4ODRA 3B9AA 3EY6A 3KACA 1IX5A 4FN2A 3FAPA 3IHZA 4Z2LA 4Z2KA 2DG3A 3O5GA 4P8VA 1NH6A 2FAPA 1JNSA 2A3BA 1EHNA 1X6LA 1X6NA 1HXVA 4NSBA 3CGNA 4DT4A 4MGVA 4Z2HA 3I6CA 1F40A 4Q22A 1FKSA 1D7IA 3UI4A 2OFNA 1QZ2A 4Q7NA 4C02B 4U84A 2M08A 1EDQA 1SYTA 4MPKA 2DSWA 1EQ3A 1Q1CA 3CGMA 5DIVA 2G41A 3ARUA 2ZQUA 2VN1A 1HJXA 2XPAA 1Q6IA 5HW7A 1J4RA 3AQUA 1QPLA 3KCEA 1Q6HA 1FKBA 4U86A 1TFVA 3KZ7A 3O5FA 3O5RA 3WH0A 1W9PA 2Q5AA 1KT0A 1LG1A 5B8IC 4S3KA 2F23A 4ODLA 4NNRA 4MNJA 4JYSA 3KAGA 1HKIA 2DPEA 2VCDA 3TC5A 4KQZA 4TNSA 4DRJA 2PI6A 4HBEA 1JCHB 4MTVA 1GOIA 2AOSA 4DH0A 2XP7A 4ODOA 1NMVA 1HKMA 3CHDA 3G6LA 3RM9A 1LL4A 2XP6A 4G50A 3ARQA 4Z2IA 4XAKA 1OGGA 4KR0B 1BL4A 5GPRA 4HARA 3ARZA 3TCZA 2QF8A 2YBUA 3WL0A 1YW5A 4ODMA 5D75A 1J6YA 1FKHA 3O5KA 2OLHA 3CHEA 4IPXA 3ARXA 2MNTA 3KADA 3AS1A 3JYJA 4DWSD 2F2DA 4ODKA 4ZPTR 1KT1A 4O2TA 3AS0A 2MLZA 3NTPA 4JFIA 1LL6A 3UQAA 3OA5A 3AS3A 1C9HA 1N1AA 2ZQSA 1FKTA 1H0IA 3RM8A 2PPPA 2MF9A 2PV3A 3PR9A 1E15A 4ODNA 3RMEA 2B31A 3O5DA 3WD0A 3CHCA 1NWUA 4LAWA 4DROA 1NWSA 4W9PA 2LJ4A 4IT4A 2KO7A 1UR8A 1FKKA 4W9OA 1RD6A 5DIUA 1W1PA 1D7HA 2IF4A 3W4RA 2KFWA 2KI3A 3ODKA 4Z2JA 3JXVA 4DZ3A 3KABA 5DO2A 2ZQVA 5J6EA 4WKHA 5HKGA 5DITA 5DF0A 2KR7A 1FAPA 4DRKA 1TCOC 4ITZA 3B8SA 1ZBVA 4WJXA 4DRQA 4ZPVR 1SR0A 2A3CA 1XHGA 4U85A 5HT1A 3CH9A 2ZR5A 1FKJA 4DRIA 1FFQA 2XP3A 1WB0A 1JNTA 3B9DA 4ZPWR 5GPGA 1D6OA 2PV1A 3B9EA 4DZ2A 2F21A 3CZ8A 1WNOA 3PRBA 2M1IA 4QT2A 2RQSA 1EIBA 3G6MA 5HUAA 4QIBA 1W1YA 3ARTA 1FKRA 1LL7A 1NWRA 4MNMA 1YATA 1VF8A 2XP4A 2DG9A 2KGJA 2JZVA 3ARWA 1R9HA 2DT2A 3FY1A 1ITXA 4TX0A 4DWSC 3ARPA 2XP9A 1W1VA 4UDMA 1ROTA 2FKEA 2WM0A 3WD1A 2XP8A 4ODQA 2N87A 3JYMA 1W1TA 2B5UB 1NMWA 1W26A 1ZBCA 5DEZA 2KE0A 4P8XA 4AY1A 3WQWA 3GTYX 2EULA 1O6IA 5HW8A 4TW6A 1FKFA 1Q6UA 4DWSA 2A3AA 1XRVA 3QOKA 1E6RA 2PBCA 2G8ZA 4IQCA 1F8AB 4Z2GA 4IQ2A 2F4EA 3NI6A 3VAWA 3O5LA 2DSUA 3ALGA 2PPNA 2L2SA 2UZ5A 3NRKA 1ZU8A 2M2AA 2RUQA 2DSZA 1P5QA 4DIPA 1J4IA 4MNKA 4ZS6A 1PBKA 2LGOA 1PINA 1FFRA 5HWCA 3ARSA 3UQIA 3H9RB 4QT3A 3O5MA 4LAXA 1A7XA 2RUCA 2PV2A 2MLYA 4DWSB 3ARVA 2XP5A 1GUVA 3O5QA 4J4NA 2A3EA 3UI6A 3AS2A 4GIVA 2O92A 4LAYA 2IUZA 2RSEA 2DT3A 4QZVB 1FJDA 2DT1A 1HJVA 4L72B 2ETNA 1H0GA 1NWTA 4MSPA 1QPFA 2ESCA 1BKFA 3PA7A 1B6CA 2DG4A 1W9VA 3IKGA 3PRDA 4FAPA 4NZCA 3O5EA 2MPHA 4G2PA 3ARRA 1T11A 3ARYA 1GRJA 1Y0OA 4P8WA 1FKDA 3FXYA 1U79A 5HWBA 4DRPA 1E6NA 3ALFA 4R5EA 3RM4A 1LG2A 2YBTA 2Y78A 3AROA 4S3JA 4W9QA 5HW6A 2FDMA 3BXWA 3WQVA 4PTMA 2PN0A 4TYOA 2RUDA 1D7JA 1FD9A 2MLXA 1L1PA 1ZB5A 1FKIA 4P8UA 1HKJA 3KAFA 3WIJA 4JFMA 4L3NA 1E44A 1CTNA 1ZBWA 1KFWA 4N19A 2XPBA 1WAWA 3EIPA 5JH8A 4IT6A 4LGXA 1E6ZA 3RGCA 4WK9A 1M5YA 1JNEA 1HKKA 4R0XA 4JFKA 2P4VA 1OWQA 1K9TA 1E9LA 2ZQTA 1E6PA 4MNLA 3WKZA 2D9FA 4WKFA 4WIWA 3MDYB 3B7XA 1JVWA 3LUOA 1NSGA 1FKLA 4TW8A 3IKDA 3UQBA 4GGQA 2PPOA 2K8IA 3BMBA 3GPKA 1ZK6A 5GQBA
chains in the Genus database with same CATH topology
2DT0A 4TW7A 1ROUA 4WKAA 1JNDA 2ZR4A 3UI5A 5HTGA 2AWGA 4HBOA 4MAVA 2WK2A 5HBFA 3WD4A 1UR9A 4LAVA 3KAHA 2LKNA 4DRMA 3RFWA 4BF8A 3O5OA 1ZL1A 1D2KA 3O5IA 3O5PA 1W9UA 1J4HA 1HJWA 5I98A 4DRNA 4JFJA 4J4OA 1LQ0A 1FKGA 1ZCNA 5BXJA 4W5UA 3OOBA 3KAIA 3UF8A 3O5JA 4DRHA 4ODPA 1ZBKA 4URIA 2RURA 3WL1A 2WLYA 3WD3A 4JFLA 2ZR6A 3PRAA 2ITKA 3WD2A 1GPFA 2O9OA 2WLZA 3CHFA 2LPVA 1OGBA 1LJYA 3IK8A 4ML4A 3TDBA 2DSVA 1EYMA 4ODRA 3B9AA 3EY6A 3KACA 1IX5A 4FN2A 3FAPA 3IHZA 4Z2LA 4Z2KA 2DG3A 3O5GA 4P8VA 1NH6A 2FAPA 1JNSA 2A3BA 1EHNA 1X6LA 1X6NA 1HXVA 4NSBA 3CGNA 4DT4A 4MGVA 4Z2HA 3I6CA 1F40A 4Q22A 1FKSA 1D7IA 3UI4A 2OFNA 1QZ2A 4Q7NA 4C02B 4U84A 2M08A 1EDQA 1SYTA 4MPKA 2DSWA 1EQ3A 1Q1CA 3CGMA 5DIVA 2G41A 3ARUA 2ZQUA 2VN1A 1HJXA 2XPAA 1Q6IA 5HW7A 1J4RA 3AQUA 1QPLA 3KCEA 1Q6HA 1FKBA 4U86A 1TFVA 3KZ7A 3O5FA 3O5RA 3WH0A 1W9PA 2Q5AA 1KT0A 1LG1A 5B8IC 4S3KA 4ODLA 4NNRA 4MNJA 4JYSA 3KAGA 1HKIA 2DPEA 2VCDA 3TC5A 4KQZA 4TNSA 4DRJA 2PI6A 4HBEA 4MTVA 1GOIA 2AOSA 4DH0A 2XP7A 4ODOA 1NMVA 1HKMA 3CHDA 3G6LA 3RM9A 1LL4A 2XP6A 4G50A 3ARQA 4Z2IA 4XAKA 1OGGA 4KR0B 1BL4A 5GPRA 4HARA 3ARZA 3TCZA 2QF8A 2YBUA 3WL0A 1YW5A 4ODMA 5D75A 1J6YA 1FKHA 3O5KA 2OLHA 3CHEA 4IPXA 3ARXA 2MNTA 3KADA 3AS1A 3JYJA 4DWSD 2F2DA 4ODKA 4ZPTR 1KT1A 4O2TA 3AS0A 2MLZA 3NTPA 4JFIA 1LL6A 3UQAA 3OA5A 3AS3A 1C9HA 1N1AA 2ZQSA 1FKTA 1H0IA 3RM8A 2PPPA 2MF9A 2PV3A 3PR9A 1E15A 4ODNA 3RMEA 2B31A 3O5DA 3WD0A 3CHCA 1NWUA 4LAWA 4DROA 1NWSA 4W9PA 2LJ4A 4IT4A 2KO7A 1UR8A 1FKKA 4W9OA 1RD6A 5DIUA 1W1PA 1D7HA 2IF4A 3W4RA 2KFWA 2KI3A 3ODKA 4Z2JA 3JXVA 4DZ3A 3KABA 5DO2A 2ZQVA 5J6EA 4WKHA 5HKGA 5DITA 5DF0A 2KR7A 1FAPA 4DRKA 4ITZA 1TCOC 3B8SA 1ZBVA 4WJXA 4DRQA 4ZPVR 1SR0A 2A3CA 1XHGA 4U85A 5HT1A 3CH9A 2ZR5A 1FKJA 4DRIA 1FFQA 2XP3A 1WB0A 1JNTA 3B9DA 4ZPWR 5GPGA 1D6OA 2PV1A 3B9EA 4DZ2A 2F21A 3CZ8A 1WNOA 3PRBA 2M1IA 4QT2A 2RQSA 1EIBA 3G6MA 5HUAA 4QIBA 1W1YA 3ARTA 1FKRA 1LL7A 1NWRA 4MNMA 1YATA 1VF8A 2XP4A 2DG9A 2KGJA 2JZVA 3ARWA 1R9HA 2DT2A 3FY1A 1ITXA 4TX0A 4DWSC 3ARPA 2XP9A 1W1VA 1ROTA 2FKEA 2WM0A 3WD1A 2XP8A 4ODQA 2N87A 3JYMA 1W1TA 1NMWA 1W26A 1ZBCA 5DEZA 2KE0A 4P8XA 4AY1A 3WQWA 1O6IA 5HW8A 4TW6A 1FKFA 1Q6UA 4DWSA 2A3AA 1XRVA 3QOKA 1E6RA 2PBCA 2G8ZA 4IQCA 1F8AB 4Z2GA 4IQ2A 2F4EA 3NI6A 3VAWA 3O5LA 2DSUA 3ALGA 2PPNA 2L2SA 2UZ5A 3NRKA 1ZU8A 2M2AA 2RUQA 2DSZA 1P5QA 4DIPA 1J4IA 4MNKA 4ZS6A 1PBKA 2LGOA 1PINA 1FFRA 5HWCA 3ARSA 3UQIA 3H9RB 4QT3A 3O5MA 4LAXA 1A7XA 2RUCA 2PV2A 2MLYA 4DWSB 3ARVA 2XP5A 1GUVA 3O5QA 4J4NA 2A3EA 3UI6A 3AS2A 4GIVA 2O92A 4LAYA 2IUZA 2RSEA 2DT3A 4QZVB 1FJDA 2DT1A 1HJVA 4L72B 1H0GA 1NWTA 4MSPA 1QPFA 2ESCA 1BKFA 3PA7A 1B6CA 2DG4A 1W9VA 3IKGA 3PRDA 4FAPA 4NZCA 3O5EA 2MPHA 4G2PA 3ARRA 1T11A 3ARYA 1Y0OA 4P8WA 1FKDA 3FXYA 1U79A 5HWBA 4DRPA 1E6NA 3ALFA 4R5EA 3RM4A 1LG2A 2YBTA 2Y78A 3AROA 4S3JA 4W9QA 5HW6A 2FDMA 3BXWA 3WQVA 4PTMA 4TYOA 2RUDA 1D7JA 1FD9A 2MLXA 1L1PA 1ZB5A 1FKIA 4P8UA 1HKJA 3KAFA 3WIJA 4JFMA 4L3NA 1CTNA 1ZBWA 1KFWA 4N19A 2XPBA 1WAWA 5JH8A 4IT6A 4LGXA 1E6ZA 3RGCA 4WK9A 1M5YA 1JNEA 1HKKA 4R0XA 4JFKA 1OWQA 1K9TA 1E9LA 2ZQTA 1E6PA 4MNLA 3WKZA 2D9FA 4WKFA 4WIWA 3MDYB 3B7XA 1JVWA 3LUOA 1NSGA 1FKLA 4TW8A 3IKDA 3UQBA 4GGQA 2PPOA 2K8IA 3GPKA 1ZK6A 5GQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT6 A;  4IT4 A; 
#chains in the Genus database with same CATH topology
 2DT0 A;  4TW7 A;  1ROU A;  4WKA A;  1JND A;  2ZR4 A;  3UI5 A;  5HTG A;  2AWG A;  4HBO A;  4MAV A;  2WK2 A;  5HBF A;  3WD4 A;  1UR9 A;  4LAV A;  3KAH A;  2LKN A;  4DRM A;  3RFW A;  4BF8 A;  3O5O A;  1ZL1 A;  1D2K A;  3O5I A;  3O5P A;  1W9U A;  1J4H A;  1HJW A;  5I98 A;  4DRN A;  4JFJ A;  4J4O A;  1LQ0 A;  1FKG A;  1ZCN A;  5BXJ A;  4W5U A;  3OOB A;  3KAI A;  3UF8 A;  3O5J A;  4DRH A;  4ODP A;  1ZBK A;  4URI A;  2RUR A;  3GU0 A;  3WL1 A;  2WLY A;  3WD3 A;  4JFL A;  2ZR6 A;  3PRA A;  2ITK A;  3WD2 A;  1GPF A;  2O9O A;  2WLZ A;  3CHF A;  2LPV A;  1OGB A;  1LJY A;  3IK8 A;  4ML4 A;  3TDB A;  2DSV A;  1EYM A;  4ODR A;  3B9A A;  3EY6 A;  3KAC A;  1IX5 A;  4FN2 A;  3FAP A;  3IHZ A;  4Z2L A;  4Z2K A;  2DG3 A;  3O5G A;  4P8V A;  1NH6 A;  2FAP A;  1JNS A;  2A3B A;  1EHN A;  1X6L A;  1X6N A;  1HXV A;  4NSB A;  3CGN A;  4DT4 A;  4MGV A;  4Z2H A;  3I6C A;  1F40 A;  4Q22 A;  1FKS A;  1D7I A;  3UI4 A;  2OFN A;  1QZ2 A;  4Q7N A;  4C02 B;  4U84 A;  2M08 A;  1EDQ A;  1SYT A;  4MPK A;  2DSW A;  1EQ3 A;  1Q1C A;  3CGM A;  5DIV A;  2G41 A;  3ARU A;  2ZQU A;  2VN1 A;  1HJX A;  2XPA A;  1Q6I A;  5HW7 A;  1J4R A;  3AQU A;  1QPL A;  3KCE A;  1Q6H A;  1FKB A;  4U86 A;  1TFV A;  3KZ7 A;  3O5F A;  3O5R A;  3WH0 A;  1W9P A;  2Q5A A;  1KT0 A;  1LG1 A;  5B8I C;  4S3K A;  2F23 A;  4ODL A;  4NNR A;  4MNJ A;  4JYS A;  3KAG A;  1HKI A;  2DPE A;  2VCD A;  3TC5 A;  4KQZ A;  4TNS A;  4DRJ A;  2PI6 A;  4HBE A;  1JCH B;  4MTV A;  1GOI A;  2AOS A;  4DH0 A;  2XP7 A;  4ODO A;  1NMV A;  1HKM A;  3CHD A;  3G6L A;  3RM9 A;  1LL4 A;  2XP6 A;  4G50 A;  3ARQ A;  4Z2I A;  4XAK A;  1OGG A;  4KR0 B;  1BL4 A;  5GPR A;  4HAR A;  3ARZ A;  3TCZ A;  2QF8 A;  2YBU A;  3WL0 A;  1YW5 A;  4ODM A;  5D75 A;  1J6Y A;  1FKH A;  3O5K A;  2OLH A;  3CHE A;  4IPX A;  3ARX A;  2MNT A;  3KAD A;  3AS1 A;  3JYJ A;  4DWS D;  2F2D A;  4ODK A;  4ZPT R;  1KT1 A;  4O2T A;  3AS0 A;  2MLZ A;  3NTP A;  4JFI A;  1LL6 A;  3UQA A;  3OA5 A;  3AS3 A;  1C9H A;  1N1A A;  2ZQS A;  1FKT A;  1H0I A;  3RM8 A;  2PPP A;  2MF9 A;  2PV3 A;  3PR9 A;  1E15 A;  4ODN A;  3RME A;  2B31 A;  3O5D A;  3WD0 A;  3CHC A;  1NWU A;  4LAW A;  4DRO A;  1NWS A;  4W9P A;  2LJ4 A;  4IT4 A;  2KO7 A;  1UR8 A;  1FKK A;  4W9O A;  1RD6 A;  5DIU A;  1W1P A;  1D7H A;  2IF4 A;  3W4R A;  2KFW A;  2KI3 A;  3ODK A;  4Z2J A;  3JXV A;  4DZ3 A;  3KAB A;  5DO2 A;  2ZQV A;  5J6E A;  4WKH A;  5HKG A;  5DIT A;  5DF0 A;  2KR7 A;  1FAP A;  4DRK A;  1TCO C;  4ITZ A;  3B8S A;  1ZBV A;  4WJX A;  4DRQ A;  4ZPV R;  1SR0 A;  2A3C A;  1XHG A;  4U85 A;  5HT1 A;  3CH9 A;  2ZR5 A;  1FKJ A;  4DRI A;  1FFQ A;  2XP3 A;  1WB0 A;  1JNT A;  3B9D A;  4ZPW R;  5GPG A;  1D6O A;  2PV1 A;  3B9E A;  4DZ2 A;  2F21 A;  3CZ8 A;  1WNO A;  3PRB A;  2M1I A;  4QT2 A;  2RQS A;  1EIB A;  3G6M A;  5HUA A;  4QIB A;  1W1Y A;  3ART A;  1FKR A;  1LL7 A;  1NWR A;  4MNM A;  1YAT A;  1VF8 A;  2XP4 A;  2DG9 A;  2KGJ A;  2JZV A;  3ARW A;  1R9H A;  2DT2 A;  3FY1 A;  1ITX A;  4TX0 A;  4DWS C;  3ARP A;  2XP9 A;  1W1V A;  4UDM A;  1ROT A;  2FKE A;  2WM0 A;  3WD1 A;  2XP8 A;  4ODQ A;  2N87 A;  3JYM A;  1W1T A;  2B5U B;  1NMW A;  1W26 A;  1ZBC A;  5DEZ A;  2KE0 A;  4P8X A;  4AY1 A;  3WQW A;  3GTY X;  2EUL A;  1O6I A;  5HW8 A;  4TW6 A;  1FKF A;  1Q6U A;  4DWS A;  2A3A A;  1XRV A;  3QOK A;  1E6R A;  2PBC A;  2G8Z A;  4IQC A;  1F8A B;  4Z2G A;  4IQ2 A;  2F4E A;  3NI6 A;  3VAW A;  3O5L A;  2DSU A;  3ALG A;  2PPN A;  2L2S A;  2UZ5 A;  3NRK A;  1ZU8 A;  2M2A A;  2RUQ A;  2DSZ A;  1P5Q A;  4DIP A;  1J4I A;  4MNK A;  4ZS6 A;  1PBK A;  2LGO A;  1PIN A;  1FFR A;  5HWC A;  3ARS A;  3UQI A;  3H9R B;  4QT3 A;  3O5M A;  4LAX A;  1A7X A;  2RUC A;  2PV2 A;  2MLY A;  4DWS B;  3ARV A;  2XP5 A;  1GUV A;  3O5Q A;  4J4N A;  2A3E A;  3UI6 A;  3AS2 A;  4GIV A;  2O92 A;  4LAY A;  2IUZ A;  2RSE A;  2DT3 A;  4QZV B;  1FJD A;  2DT1 A;  1HJV A;  4L72 B;  2ETN A;  1H0G A;  1NWT A;  4MSP A;  1QPF A;  2ESC A;  1BKF A;  3PA7 A;  1B6C A;  2DG4 A;  1W9V A;  3IKG A;  3PRD A;  4FAP A;  4NZC A;  3O5E A;  2MPH A;  4G2P A;  3ARR A;  1T11 A;  3ARY A;  1GRJ A;  1Y0O A;  4P8W A;  1FKD A;  3FXY A;  1U79 A;  5HWB A;  4DRP A;  1E6N A;  3ALF A;  4R5E A;  3RM4 A;  1LG2 A;  2YBT A;  2Y78 A;  3ARO A;  4S3J A;  4W9Q A;  5HW6 A;  2FDM A;  3BXW A;  3WQV A;  4PTM A;  2PN0 A;  4TYO A;  2RUD A;  1D7J A;  1FD9 A;  2MLX A;  1L1P A;  1ZB5 A;  1FKI A;  4P8U A;  1HKJ A;  3KAF A;  3WIJ A;  4JFM A;  4L3N A;  1E44 A;  1CTN A;  1ZBW A;  1KFW A;  4N19 A;  2XPB A;  1WAW A;  3EIP A;  5JH8 A;  4IT6 A;  4LGX A;  1E6Z A;  3RGC A;  4WK9 A;  1M5Y A;  1JNE A;  1HKK A;  4R0X A;  4JFK A;  2P4V A;  1OWQ A;  1K9T A;  1E9L A;  2ZQT A;  1E6P A;  4MNL A;  3WKZ A;  2D9F A;  4WKF A;  4WIW A;  3MDY B;  3B7X A;  1JVW A;  3LUO A;  1NSG A;  1FKL A;  4TW8 A;  3IKD A;  3UQB A;  4GGQ A;  2PPO A;  2K8I A;  3BMB A;  3GPK A;  1ZK6 A;  5GQB A; 
#chains in the Genus database with same CATH homology
 2DT0 A;  4TW7 A;  1ROU A;  4WKA A;  1JND A;  2ZR4 A;  3UI5 A;  5HTG A;  2AWG A;  4HBO A;  4MAV A;  2WK2 A;  5HBF A;  3WD4 A;  1UR9 A;  4LAV A;  3KAH A;  2LKN A;  4DRM A;  3RFW A;  4BF8 A;  3O5O A;  1ZL1 A;  1D2K A;  3O5I A;  3O5P A;  1W9U A;  1J4H A;  1HJW A;  5I98 A;  4DRN A;  4JFJ A;  4J4O A;  1LQ0 A;  1FKG A;  1ZCN A;  5BXJ A;  4W5U A;  3OOB A;  3KAI A;  3UF8 A;  3O5J A;  4DRH A;  4ODP A;  1ZBK A;  4URI A;  2RUR A;  3WL1 A;  2WLY A;  3WD3 A;  4JFL A;  2ZR6 A;  3PRA A;  2ITK A;  3WD2 A;  1GPF A;  2O9O A;  2WLZ A;  3CHF A;  2LPV A;  1OGB A;  1LJY A;  3IK8 A;  4ML4 A;  3TDB A;  2DSV A;  1EYM A;  4ODR A;  3B9A A;  3EY6 A;  3KAC A;  1IX5 A;  4FN2 A;  3FAP A;  3IHZ A;  4Z2L A;  4Z2K A;  2DG3 A;  3O5G A;  4P8V A;  1NH6 A;  2FAP A;  1JNS A;  2A3B A;  1EHN A;  1X6L A;  1X6N A;  1HXV A;  4NSB A;  3CGN A;  4DT4 A;  4MGV A;  4Z2H A;  3I6C A;  1F40 A;  4Q22 A;  1FKS A;  1D7I A;  3UI4 A;  2OFN A;  1QZ2 A;  4Q7N A;  4C02 B;  4U84 A;  2M08 A;  1EDQ A;  1SYT A;  4MPK A;  2DSW A;  1EQ3 A;  1Q1C A;  3CGM A;  5DIV A;  2G41 A;  3ARU A;  2ZQU A;  2VN1 A;  1HJX A;  2XPA A;  1Q6I A;  5HW7 A;  1J4R A;  3AQU A;  1QPL A;  3KCE A;  1Q6H A;  1FKB A;  4U86 A;  1TFV A;  3KZ7 A;  3O5F A;  3O5R A;  3WH0 A;  1W9P A;  2Q5A A;  1KT0 A;  1LG1 A;  5B8I C;  4S3K A;  4ODL A;  4NNR A;  4MNJ A;  4JYS A;  3KAG A;  1HKI A;  2DPE A;  2VCD A;  3TC5 A;  4KQZ A;  4TNS A;  4DRJ A;  2PI6 A;  4HBE A;  4MTV A;  1GOI A;  2AOS A;  4DH0 A;  2XP7 A;  4ODO A;  1NMV A;  1HKM A;  3CHD A;  3G6L A;  3RM9 A;  1LL4 A;  2XP6 A;  4G50 A;  3ARQ A;  4Z2I A;  4XAK A;  1OGG A;  4KR0 B;  1BL4 A;  5GPR A;  4HAR A;  3ARZ A;  3TCZ A;  2QF8 A;  2YBU A;  3WL0 A;  1YW5 A;  4ODM A;  5D75 A;  1J6Y A;  1FKH A;  3O5K A;  2OLH A;  3CHE A;  4IPX A;  3ARX A;  2MNT A;  3KAD A;  3AS1 A;  3JYJ A;  4DWS D;  2F2D A;  4ODK A;  4ZPT R;  1KT1 A;  4O2T A;  3AS0 A;  2MLZ A;  3NTP A;  4JFI A;  1LL6 A;  3UQA A;  3OA5 A;  3AS3 A;  1C9H A;  1N1A A;  2ZQS A;  1FKT A;  1H0I A;  3RM8 A;  2PPP A;  2MF9 A;  2PV3 A;  3PR9 A;  1E15 A;  4ODN A;  3RME A;  2B31 A;  3O5D A;  3WD0 A;  3CHC A;  1NWU A;  4LAW A;  4DRO A;  1NWS A;  4W9P A;  2LJ4 A;  4IT4 A;  2KO7 A;  1UR8 A;  1FKK A;  4W9O A;  1RD6 A;  5DIU A;  1W1P A;  1D7H A;  2IF4 A;  3W4R A;  2KFW A;  2KI3 A;  3ODK A;  4Z2J A;  3JXV A;  4DZ3 A;  3KAB A;  5DO2 A;  2ZQV A;  5J6E A;  4WKH A;  5HKG A;  5DIT A;  5DF0 A;  2KR7 A;  1FAP A;  4DRK A;  4ITZ A;  1TCO C;  3B8S A;  1ZBV A;  4WJX A;  4DRQ A;  4ZPV R;  1SR0 A;  2A3C A;  1XHG A;  4U85 A;  5HT1 A;  3CH9 A;  2ZR5 A;  1FKJ A;  4DRI A;  1FFQ A;  2XP3 A;  1WB0 A;  1JNT A;  3B9D A;  4ZPW R;  5GPG A;  1D6O A;  2PV1 A;  3B9E A;  4DZ2 A;  2F21 A;  3CZ8 A;  1WNO A;  3PRB A;  2M1I A;  4QT2 A;  2RQS A;  1EIB A;  3G6M A;  5HUA A;  4QIB A;  1W1Y A;  3ART A;  1FKR A;  1LL7 A;  1NWR A;  4MNM A;  1YAT A;  1VF8 A;  2XP4 A;  2DG9 A;  2KGJ A;  2JZV A;  3ARW A;  1R9H A;  2DT2 A;  3FY1 A;  1ITX A;  4TX0 A;  4DWS C;  3ARP A;  2XP9 A;  1W1V A;  1ROT A;  2FKE A;  2WM0 A;  3WD1 A;  2XP8 A;  4ODQ A;  2N87 A;  3JYM A;  1W1T A;  1NMW A;  1W26 A;  1ZBC A;  5DEZ A;  2KE0 A;  4P8X A;  4AY1 A;  3WQW A;  1O6I A;  5HW8 A;  4TW6 A;  1FKF A;  1Q6U A;  4DWS A;  2A3A A;  1XRV A;  3QOK A;  1E6R A;  2PBC A;  2G8Z A;  4IQC A;  1F8A B;  4Z2G A;  4IQ2 A;  2F4E A;  3NI6 A;  3VAW A;  3O5L A;  2DSU A;  3ALG A;  2PPN A;  2L2S A;  2UZ5 A;  3NRK A;  1ZU8 A;  2M2A A;  2RUQ A;  2DSZ A;  1P5Q A;  4DIP A;  1J4I A;  4MNK A;  4ZS6 A;  1PBK A;  2LGO A;  1PIN A;  1FFR A;  5HWC A;  3ARS A;  3UQI A;  3H9R B;  4QT3 A;  3O5M A;  4LAX A;  1A7X A;  2RUC A;  2PV2 A;  2MLY A;  4DWS B;  3ARV A;  2XP5 A;  1GUV A;  3O5Q A;  4J4N A;  2A3E A;  3UI6 A;  3AS2 A;  4GIV A;  2O92 A;  4LAY A;  2IUZ A;  2RSE A;  2DT3 A;  4QZV B;  1FJD A;  2DT1 A;  1HJV A;  4L72 B;  1H0G A;  1NWT A;  4MSP A;  1QPF A;  2ESC A;  1BKF A;  3PA7 A;  1B6C A;  2DG4 A;  1W9V A;  3IKG A;  3PRD A;  4FAP A;  4NZC A;  3O5E A;  2MPH A;  4G2P A;  3ARR A;  1T11 A;  3ARY A;  1Y0O A;  4P8W A;  1FKD A;  3FXY A;  1U79 A;  5HWB A;  4DRP A;  1E6N A;  3ALF A;  4R5E A;  3RM4 A;  1LG2 A;  2YBT A;  2Y78 A;  3ARO A;  4S3J A;  4W9Q A;  5HW6 A;  2FDM A;  3BXW A;  3WQV A;  4PTM A;  4TYO A;  2RUD A;  1D7J A;  1FD9 A;  2MLX A;  1L1P A;  1ZB5 A;  1FKI A;  4P8U A;  1HKJ A;  3KAF A;  3WIJ A;  4JFM A;  4L3N A;  1CTN A;  1ZBW A;  1KFW A;  4N19 A;  2XPB A;  1WAW A;  5JH8 A;  4IT6 A;  4LGX A;  1E6Z A;  3RGC A;  4WK9 A;  1M5Y A;  1JNE A;  1HKK A;  4R0X A;  4JFK A;  1OWQ A;  1K9T A;  1E9L A;  2ZQT A;  1E6P A;  4MNL A;  3WKZ A;  2D9F A;  4WKF A;  4WIW A;  3MDY B;  3B7X A;  1JVW A;  3LUO A;  1NSG A;  1FKL A;  4TW8 A;  3IKD A;  3UQB A;  4GGQ A;  2PPO A;  2K8I A;  3GPK A;  1ZK6 A;  5GQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...