4ITUA

Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s-hpcdh) bound to s-hpc and nadh
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
253
structure length
253
Chain Sequence
NRLKNEVIAITGGGAGIGLAIASAALREGAKVALIDLDQGLAERSAAMLSTGGAVAKGFGADVTKAADITAAITSAEQTIGSLTGLVNNAGIAGFGSVHDADAAAWDRIMAVNVTGTFLASKAALAGMLERHKGTIVNFGSVAGLVGIPTMAAYCAAKGAIVNLTRQMAADYSGRGVRVNAVCPGTVTSTGMGQQLLGSDTSPEVQARRLAKYPIGRFGTPEDIAEAVIFLLSDQAAFVTGAAFAVDGGMTAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Crystal structures of S-HPCDH reveal determinants of stereospecificity for R- and S-hydroxypropyl-coenzyme M dehydrogenases.
pubmed doi rcsb
source organism Xanthobacter autotrophicus
molecule tags Oxidoreductase
total genus 90
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ituA00
4UVGA 1ZXLA 2EKPA 1YO6A 3O38A 1M66A 3WMWA 1B8PA 1PR9A 1LA2A 2Y05A 3LVFO 5CDYA 1ONOA 1V8BA 3INGA 5L7TA 2WM3A 2QIOA 4HNHA 1P31A 4BKPA 3SBOA 2BFMA 2QZ9A 2B5WA 4OYRA 3FN4A 4O59O 2X58A 4A0SA 1DRWA 2DFVA 4HWKA 1VRWA 3EK2A 5BSGA 2NLOA 3KTDA 2ZCUA 4W7HA 4JP3A 1PGNA 1X15A 2VOJA 1BXZA 1LLQA 5DZSA 4IDEA 3F6YA 3BAZA 4FW8A 5EPOA 1EE9A 3ZZNA 4EEXA 2D59A 5U4QA 2OMEA 3X2EA 2WD7B 5JY6A 2C7GA 4K1LA 3H5AA 2VTDA 1N5DA 2WE7A 4KQWA 2E6UX 2VOEA 3QWFA 4MP6A 3ZU4A 3BZUA 4GSLA 1PGQA 3VH4A 3LSYA 1HSZA 1LRLA 1HDZA 1JQBA 4E6PA 3JQBC 5A06A 2PR2A 5AQ1A 1TB4A 3E5RA 2P5YA 1PWXA 1ZUD1 1P0FA 3RBXA 3I9JA 3A1NA 4F46A 4XR4A 3DQPA 1KIFA 1HDRA 2YDXA 3OJOA 5B1YA 2NACA 4ND1A 3UHAA 3L4BC 4WASA 5ENVA 5DOZA 4PG7A 4FOOA 1DLIA 1YQXA 4I9NA 4ALKA 4MKRA 2RIRA 3U5TA 3U62A 1Z74A 2GN9A 3I1JA 3OQ1A 4I8XA 3A4VA 1A72A 5IAAA 2WE8A 1UH5A 3BMQB 3D3EA 3D5TA 3FNFA 4NFYA 1I8TA 3NRCA 1PZHA 4D46A 2HK7A 1LLCA 1U7HA 1ISJA 4A2CA 2O4UX 4GAEA 3UN1A 3I23A 2FHSA 2C07A 2NU9A 3P7MA 3PDUA 2WWRA 4XA8A 3UCXA 4B79A 1R4NA 3ICCA 3WYCA 3DR3A 1UZLA 1U3UA 3FBTA 4J3FA 4P4LA 3ZHYA 4YWJA 3H4VA 1T2CA 3FTNA 1LDGA 3HFSA 5JAMA 4CMIA 4CR6A 4E5YA 3ETDA 4LCJA 1QV6A 2HJRA 5HTOA 2X0IA 5CPFA 1M2WA 3F1KA 3OFSA 2FMUA 2VCYA 1DJNA 4J7XA 1B26A 4RDHA 5KJCA 1FDSA 2NUAA 4R1SA 1NVGA 5LCXA 3ENKA 1BSVA 1Y6JA 3O26A 4MP8A 2AHRA 2H1SA 2YQ4A 1XELA 2ZYGA 2I3GA 3GA0A 3KVOA 2X0RA 4XZ3A 3WSVA 1R6DA 3H3JA 1WMBA 2DLDA 3NTOA 4N7RA 4EJ6A 2O3QA 1KEWA 3GEMA 1ENYA 3L77A 4AG3A 1F06A 4I1IA 1AHIA 1ZSNA 3KEOA 2X23A 3D64A 2JCXA 1UAGA 5A9RA 4JX8A 1LDYA 3HDJA 3B70A 4MKXA 2P68A 2Y1GA 2PV7A 3RJ9A 1QRRA 1ZK2A 3AY7A 3K6JA 4ZVVA 3D5QA 2EJWA 4YAEA 3IIEA 4E2XA 3K2BA 3GN2A 3TQHA 2BFPA 2BGKA 2Y0DA 4FS3A 3WLFA 3JQ7A 4RVUA 5IDXA 4RPJA 3WWYA 1DDOA 1G1AA 3CE6A 1E7WA 2FPGA 3AW9A 4JP2A 4QXMA 4MPDA 1H0KA 1GUFA 2EWMA 4KWIA 1E3WB 4OSOA 5BR7A 2P91A 3GNSA 3ASUA 4AL4A 1NAHA 3F47A 4WK6A 4L0QA 3T7EA 4YQZA 2WDZA 4NIMA 2AXQA 4OXYA 4PLGA 4A03A 3ZCXA 2Q1UA 4J0FA 4ITUA 3E9NA 1I3NA 3QVWA 1WVGA 3P2YA 4LVUA 1KVRA 1LC3A 4IDAA 4W82A 2GGSA 5HBRA 3RQSA 5L4NA 3OJ0A 4D43A 3RU9A 1R66A 1B14A 1TEHA 2B4TO 4A27A 3H65A 3H9QA 1BGVA 2VUUA 3OIGA 1C1DB 4LK3A 2DTEA 2VHYA 2B4RO 3G0OA 1ONPA 4AJLA 1PGJA 3ZNNA 1N2SA 4LSWA 5JCJD 2E49A 1RM4A 1FK8A 1H6DA 3JQ6A 2BF7A 3LDHA 5KCZA 1IYZA 1ZKMA 3ETGA 2QG4A 5L95A 2HU2A 3JV7A 4YJFA 5HS4A 2J6IA 3C3XA 1A71A 1UUFA 2R2GA 3RUHA 4AFNA 1BXKA 3GPIA 5KVCA 2WMDA 4EDFA 2H6EA 1HETA 3ZN2A 5CDUA 5A9SB 5DOVA 5F1OA 6LDHA 5H82A 2IE0A 4J49A 3ZWMA 1BDBA 1R16A 1WP4A 1YOVA 2Y68A 3GF4A 3GVPA 3VC7A 1B2LA 1JDJA 1IZ0A 1D8AA 1HDXA 3PEFA 1XGKA 4CR8A 1VE9A 4XQ9A 5DCYA 4AJKA 1HDOA 5B12A 3O8QB 2V6FA 1YJ8A 1TT5B 1MLDA 2DAPA 1ZFNA 5JLAA 1WPQA 2J5KA 1VPDA 3VDQA 4HXYA 4NHEA 3PWKA 3S1LA 4CMBA 1J0XO 1EQ2A 1UZNA 1SOWA 4G81A 2V7PA 1BWSA 1E77A 1PZGA 2FOIA 3E48A 4IJKA 4ALJA 5G4KA 4PLVA 3H9JA 2ZYAA 2O3JA 1PJTA 4GGPA 3KSUA 3DBHA 4B7XA 1QXSA 1JAXA 1ZEJA 4MVJG 3DBRA 1QR6A 1RM3A 2NVUA 5GZ6A 3RWBA 4D79A 4MIOA 3NGLA 5H81A 1NAIA 2W90A 2X5OA 4G65A 5L7YA 3Q11A 3GRPA 4OAQA 4II3A 2YDYA 4XGKA 1JKIA 4RVFA 1EVZA 5TS3A 2D8AA 3VPFA 2C7VA 5GMOA 3NTRA 3BMNA 2JFGA 3G49A 4K9DA 3S2FA 3WFJA 3RC9A 3GGOA 3PLRA 4XEHA 1B15A 4M49A 1NFFA 3WNVA 2NQTA 1D1SA 4RL6A 4KDFA 2ZB8A 4KTVE 4OOEA 2P4HX 4JJFA 1QYCA 4L74A 5DCWA 1Y5MA 4IDGA 4Y6PA 4M87A 1Y9EA 4B4VA 4CUZA 2QRKA 3QIVA 1K89A 2Z1NA 3MJVA 4CLRB 1E7SA 4BKRA 1AGNA 4WLNA 1E7RA 4JK3A 3UGKA 1N1GA 3I6QA 4CMEC 4NBRA 6ADHA 1GTMA 5ER6A 1E6WA 2CDAA 4JBIA 4XYEA 1E3IA 5HRUA 3NKLA 5J23A 3AM5A 1FXSA 1LDMA 4CM8A 4PVCA 1CERA 3IS3A 4BNTA 1MC5A 3ZWVA 2YV1A 1VC2A 1VSVA 3GRKA 5G0TA 2PKQO 4PG8A 3WMXA 1CJCA 3HB4X 1WXDA 3BMCB 5BNTA 4C7KA 3RFTA 3ZU5A 4YRDA 3TFOA 1M76A 1BVUA 1SPXA 3OJEA 3GEDA 4RPGA 3OEWA 1UXHA 4PCVA 2VUSA 1EVYA 1U2GA 1MB4A 1N9GA 2J8ZA 4NBTA 4ND3A 2IXAA 1SC6A 4N54A 4D42A 3SC4A 3GVXA 3RCBA 3WBFA 5FF9A 1NPYA 4EJ0A 1ZK4A 2QYTA 3KM0A 5KIAA 1TLTA 1UJMA 2NADA 4FC6A 4F3YA 3OF2A 3GDFA 3JSAA 3L9XA 3IOYA 2EERA 2GUGA 3CZRA 3GHYA 4JJIA 3UFXA 1SEPA 4WUVA 2D4AA 4DIBA 1FDVA 2HK9A 3DZJA 3JYNA 4KP7A 1DB3A 3A9WA 3KYDB 1ZH8A 3RBVA 1ENPA 3K96A 5ITVA 2J5RA 3SXPA 1U8XX 1QG6A 4TRNA 1WW8A 3AI1A 5K0ZA 4MIEA 1JVBA 3SX2A 1J6UA 2CVOA 1Z7EA 3D0OA 3ZWPA 1YB5A 1TVEA 3GAZA 1HL3A 3RAJA 1AHHA 4YT4A 4EZBA 1Y9AA 4ROSA 4M8SA 4NJOA 3VZPA 3ETEA 4YBZA 2E4AA 1V9LA 1V3VA 3D4OA 1E92A 2FPIA 4BMVA 4CMJA 4BB6A 3SLGA 1NFQA 4NU6A 4PG6A 1GYRA 4BNYA 3ONEA 2NTVA 2PFGA 3PQFA 5EQDA 4UVEA 4CUJA 3D4NA 1BTOA 1LDBA 1PTJA 2GRAA 2FP4A 4NPCA 1B3RA 1I33A 3H9UA 3AUSA 5A3VA 3V2UA 3QVSA 5T57A 3DHYA 1ONNA 1IPFA 5COQA 3LU1A 1JU9A 2PH5A 2VYNA 3OHSX 2IDZA 3B6ZA 4BGUA 5HM8A 5G4LA 5JAIA 1AN9A 1YB1A 4YAKA 1X13A 1RWBA 1VL0A 4RVHA 4AJ4A 2NSDA 3TWOA 1I30A 4J4BA 2CF5A 3FWNA 4W6ZA 2OOSA 4F45A 4E2WA 4D41A 1EVJA 3GFGA 1M6HA 5AXBA 2VZ0A 3DZHA 4JBGA 3DMTC 3O4RA 1HWYA 1U3WA 4ILKA 5EQFA 3TZCA 4ZGWA 1I10A 1XU9A 1YL6A 1R12A 2VNAA 5JPIA 4PN3A 2X5JO 2C2XA 2C54A 3KRTA 5JO0A 1H6AA 5KVQA 4ZHSA 3LYLA 2ZCVA 4AJ2A 5EERA 3DBLA 2UYYA 3OMLA 4ALNA 1PGPA 4J2OA 3RI3A 3V2HA 1LBEA 1LRJA 5CAEA 4TKMA 5TF4A 3S2IA 3FR8A 3WGOA 2PTGA 5KOIA 3U0BA 4DLLA 3F1LA 4D7AA 4II2A 1E3EA 1X14A 1Z73A 4WNIA 4AVYA 4I9UA 4R4JA 4Z0HO 3ZV5A 2NU6A 4FOSA 1LUAA 4D3FA 1YVEI 4E5KA 3PQDA 1PGOA 3GUCA 5ILGA 4XCVA 1PS8A 3L0DA 1OBFO 4XB1A 3TZHA 3O03A 1WAMA 1SO8A 2DUWA 3KBOA 4CUKA 4PGFA 2G5CA 4CV3A 4DMLA 3RC7A 2O2SA 3O9ZA 2UV8A 5BSEA 2YYYA 1KVSA 1Q7CA 4O63O 3U49A 4DC1A 3EYWA 2V6MA 4EYEA 4DQUA 1R37A 1YRLA 3GMDA 4PZCA 1W8DA 1T4BA 2EHDA 3JD4A 3HB5X 1FDUA 1ISIA 4IXWA 3EY4A 2YHIA 4JLWA 1W6UA 1MXHA 3L6OO 4WLEA 3ZWOA 3AK4A 2C5EA 4BNIA 5CG2A 3PHJA 1YXMA 2FN7A 3ZV3A 5G0SA 3H5NA 1PQUA 3V1YA 5BNIA 4L4RA 1ZZEA 3GC6A 3FF4A 2GZ3A 1Q1NA 3S8MA 3CMMA 2Q4EA 2XF8A 2JHFA 3WWZA 2ZTVA 5C3MA 5C5IA 1G6KA 1FMCA 1GEGA 2AMFA 1H6BA 2UUOA 2AQKA 1FDWA 4DQVA 4LMRA 1Q0HA 4S1VA 1XCBA 1IE3A 3R1IA 2Q2VA 1GZ6A 4UUPA 3HUDA 4GKVA 3AU8A 4IIUA 4CM5A 4RF5A 5AXCA 4BO4A 1Q2XA 2IZ0A 4K6FA 4D0SA 1RYEA 3PVZA 5JDIC 4NZ9A 1SOVA 2AG8A 1ARZA 3AUTA 3SJ7A 2E37A 4WLUA 3PGXA 3PP8A 1DC3A 4CMCA 4EEZA 5ER9A 3MEQA 5DP1A 1YDWA 4DPMA 3JQFA 1SB8A 3JQBA 2GLXA 3FI9A 1EZ4A 1SAYA 3JQAD 3JD1A 1X1TA 5EJ2A 1H2BA 1EK5A 1OZAA 2GNAA 4U7WA 3JTMA 1XYGA 3K73O 2O23A 2GD1O 3G17A 5JFOA 2EIHA 3L4BA 3KB6A 3MJSA 3ULKA 3RC2A 1KBZA 1Z82A 2CDBA 3C7DB 4BNWA 3MOGA 3NAQA 3OEYA 3HJAA 5F5NA 1HZZA 3RUAA 1KEPA 4YXFA 2D1YA 4H15A 1N1EA 3ZHZA 3GH3A 1P44A 4PLHA 3GGPA 4CLEA 1ID1A 1R0SA 4PVDA 1AXEA 1NQOA 2RAFA 3AI3A 3S2GA 3SVTA 1HT0A 2RH4A 3HN7A 1D7OA 5I7SA 3NDIA 4FB5A 2VT3A 1E1LA 2P9EA 2W98A 2E48A 3L4SO 3E18A 4A26A 3NJ8A 2BGMA 2VTEA 3TF5A 2HRBA 5L40A 2CNBA 2G17A 1PL7A 3Q2IA 1JTVA 1C3VA 4LSMA 4R54A 5KJFA 3MZ0A 1V35A 5DULA 4E4YA 1A9YA 3RROA 5A1TA 3AOGA 5BQFA 3D3WA 1A7KA 1Y7TA 1I0ZA 1MFPA 3DMYA 2YV3A 4Q3AA 5GZ1A 3D4PA 5ILOA 1E5LA 4NJMB 5COAA 2OL4A 4O6VA 3I52A 4B3JA 3NYWA 3K5PA 4J7CA 4N5NA 4CQLB 4YJGB 5JXWA 4XYBA 4HFMA 2GO1A 5EMHA 2DPGA 5BT9A 3ONFA 4FFPA 4FFOA 4EUEA 3VPHA 4P4NA 3WGGA 3NV9A 1R0LA 2JL1A 2VHWA 3HHPA 5CDTA 4P22A 2I76A 3ZDFA 2C29D 4Q3EA 1PJ4A 1EBUA 2Q1TA 3HSKA 4KDEA 3WB9A 4PLWA 3C1TA 3DZGA 4YRBA 4PG4A 1P33A 4INAA 2CUKA 1B8VA 3G3EA 3AWDA 3ST7A 4CQMA 1JKFA 1UP4A 1LX6A 1V3TA 3JQ8A 3PWZA 3F9IA 2ZTUA 4R5HA 5U9CA 1LQTA 4BO6A 2C82A 4CPDA 3TZQA 1E1KA 4BNHA 1S6YA 2G0TA 3RKUA 2X9GA 3NEPX 5T6BA 1NPDA 4JN6B 3W8DA 3FBGA 4MJLA 4DIFA 1HE5A 2NVBA 5LDGA 2OO5A 3K8ZA 4X54A 1V3UA 1ZSVA 4FFRA 4IUYA 3N7UA 3OA2A 1UXIA 3NT2A 3WICA 4W9NC 4NG5A 3VTFA 5DF1A 5L45A 3GGGA 3JQFC 5IDYA 1MXFA 4BNGA 5DN9A 3V1UA 3DTTA 1ZW1A 2DPHA 2HMUA 2X4GA 4CM3A 3I9LA 4B3HA 1LQUA 4WECA 1I2CA 3PHGA 2DTXA 4GWGA 1DJQA 2WD7A 1I36A 2B37A 4J1QA 3W8FA 3E82A 4UVDA 4IJWA 3VZRA 5IF3A 4QSMA 2DBRA 2UAGA 3ROMA 3TL3A 2IZZA 3QY9A 1DFGA 1NVTA 1VKNA 2EF1A 4GX5A 4Q39A 3DAFA 5FFFA 2Y1FA 4K28A 3STHA 1PQWA 1DIGA 2Y66A 3I83A 4BQPA 4IBOA 2BGLA 4YTEA 2X86A 2HQ1A 2BLLA 5A02A 2XOXA 1MG0A 1XDWA 2V6BA 1DPGA 1CYDA 2X9VA 3ZV6A 1YONA 1K3TA 1ZXBA 1XIVA 3GNQA 4FSHA 1LSJA 3BMQA 2QQ5A 4CV2A 2ZTMA 1C0IA 3I9KA 3V8BA 1SMKA 1L1FA 1NQTA 1DRUA 4CLXA 4YR9A 2NNLD 3WSWA 4NQZA 3EDMA 2CFCA 2WYWA 2FR1A 2C5AA 3EZYA 5F21A 1I32A 5T67A 3ZWYA 3HG7A 1VJ1A 3INRA 2NU8A 3DWFA 3IJPA 2Q49A 3BIOA 1XLTA 3B20A 2Z1MA 4WOKA 4MDHA 2VNSA 2PLAA 5JO9A 5JCXA 3RSHA 1O95A 4RLHA 1OFGA 3HQ4O 4UAGA 2GF2A 1XWFA 4A73A 1EDOA 5COBA 3DTYA 3ROKA 4BV8A 3IP3A 4CMAA 5EL0A 3F46A 4BKQA 1ISFA 1I24A 3CMCO 5DCUA 1UZMA 4FD3A 4ZN6A 1C1XB 2ZQZA 3ZU3A 3UCFA 4LRSB 1SBYA 4PLPA 3WIEA 2FR0A 5JAQA 5TT0A 1A7AA 1H5QA 4XR9A 4J1SA 2SCUA 3UXYA 3MTJA 4BO1A 3EAGA 1E0DA 4L4SA 3EUWA 5JMWA 4H16A 1I3MA 2ZB7A 1IY8A 4HP8A 2Y93A 3GK3A 4PFJA 4WNCA 3LC1O 4PG5A 3BTSA 4PLTA 1JWAB 4NFSA 3U3XA 1TT7A 2PA3A 2GASA 2HAEA 4RDIA 3PWSA 3PZBA 1QP8A 3BYZA 1D1TA 4DQXA 2P4QA 2VZ8A 4CMEA 5A03A 1B7GO 4UULA 1A4UA 2UVDA 2VRBA 3I5MA 1UP6A 3M1LA 4TQGA 4P8RA 1AUPA 2BI8A 2FSSA 2R00C 1T2EA 4GSKA 3RUEA 3BMOA 4DTIA 3OICA 3VDRA 1LNQA 4RJTA 3OJFA 4KMSA 5HS6A 2QHXA 4UVIA 2I99A 3JYLA 1MC4A 1YDEA 4L4XA 4BIIA 1DAOA 2EGHA 5F1KA 1NBOA 1PZFA 4TKLA 1HDGO 2PZJA 8ADHA 4RPLA 5TRTA 1KY5A 4RORA 3ZWAA 4YT5A 4R16A 3EMKA 5LDHA 4R9RA 3ON5A 2PGJA 4KUEA 4QFCA 1H93A 1HDCA 1GPJA 3C1AA 4XQGA 2I6TA 4MKZA 1Q7BA 3QVTA 3QWIA 1UXJA 4L8VA 2YW9A 1XKQA 1R4MB 1NP3A 3K9QO 4ZD6A 4W4TA 3PJGA 1GU7A 3K92A 5DBFA 1E3LA 2W8ZA 5FWNA 5KJ1A 1PJCA 1QLHA 4YJHB 3VZSA 3FCOA 3GPDG 5B4UA 1ORRA 3NT4A 5A9TA 1ZSYA 3Q3CA 4DA9A 1ADFA 4WLVA 3PYLA 4RLSA 3P19A 1UDCA 2WTBA 4BV9A 1OMOA 5IXYA 3ONDA 1EDZA 5C7LO 3I4CA 4XGIA 1GUZA 5JY1A 3CSDA 5U1PA 4KQXA 4MVJH 2QZZA 1DC5A 4ZQGA 3CH6A 1HSOA 2H63A 5T5QA 3SEFA 1PL6A 5A9SA 3OETA 4MVJM 4CM4A 1JLLA 3I4FA 4GI2A 4G2NA 5HWSA 4HUJA 1GFSA 4QT0A 1P1JA 4NR0A 1ML3A 4PIVA 4QEDA 3VAZA 2DBZA 3DBHB 3NGXA 4YJDA 3FRJA 1RKXA 4AJIA 2UUPA 3K2EA 3O8QA 1LSOA 1O9BA 1HYGA 2PD6A 3C7AA 1ADBA 3U4HA 1GV1A 4IXTA 3BTVA 1Q7GA 1P0CA 1SEVA 2POQX 4GX2A 1FJHA 3TJRA 4M55A 3ZWXA 3LC7O 2EV9A 2PWZA 2ZKLA 4WCFB 4UVHA 4IS2A 1LLUA 3WQQA 3JYPA 3COSA 1QLJA 3DMTA 3OIDA 3L9WA 3M2TA 1O94A 4D0RA 1CRWG 4EGFA 1P9LA 1O0SA 1HTBA 3OH8A 4PLFA 3W6ZA 3IMFA 3PZRA 3UAGA 4J43A 4IM7A 2QRLA 5EIOA 1MGOA 5TJ9A 3WJAA 5KVVA 4GVLA 4OKNA 5JYEA 3L07A 4WOJA 1CWUA 3LZ6A 4HFNA 4JJGA 5TX7A 1GQ2A 2O2YA 4D3SA 1HDYA 2BFOA 5IDQA 2EP7A 5JC8A 1I3LA 1PR3A 4FBGA 3BA1A 2VZ9A 3LT2A 3GZNB 3CPSA 2CZCA 4BO2A 1UAYA 2BI7A 3WIDA 2IYOA 2WYUA 2HMVA 3PRJA 4BNFA 1WMAA 1Y8RB 1LC0A 1KS9A 4GLLA 4Q3CA 4E12A 4CM8B 3WGIA 1PZEA 4E13A 3AOEA 3RKRA 3VH1A 2NTJA 3ABIA 1MG5A 4NU5A 5FI3A 3FD8A 2O7SA 5I7FA 5CEFA 3MWEB 4FIZA 1HZJA 1Z75A 4CLRA 2B35A 1F0YA 4LN1A 3A06A 1MX3A 1NNUA 4M1QA 1T1RA 1QORA 4UUNA 4XWYA 3NUGA 4RCVA 3ANLA 3JD2A 4CLOB 2C59A 3KETA 5F5LA 1Y5RA 1YL5A 2CSUA 2J3HA 2DUUA 3QE3A 2I9PA 3BMCA 3KOUA 2HJSA 4WE3A 3WNQA 4OIMA 2J3IA 3ZHXA 2R6JA 1I2BA 1LSUA 4HADA 4WGGA 4DVJA 4BMSA 2HRZA 3ZH2A 3GQVA 4JBHA 4CV0A 1HF3A 5TC4A 3KYCB 4LRTB 4UUMA 2QW8A 4CM7A 3GUYA 3MTGA 3ZWNA 4HNGA 4QO7A 3ZW9A 1GDHA 2O3TA 3Q2KA 2ZJ1A 5L53A 4DIOA 1DXYA 5I8ZA 4Z9XA 4CL3A 2AEJA 2DM6A 1WDMA 2DT5A 2TMGA 4JXKA 1K6XA 4J91A 1T25A 4J0EA 1PSDA 4DRYA 4YAJA 3ITKA 4NK5A 3ZNPA 1HE4A 3PHLA 1U5AA 4J1NA 5TSDA 2O3UA 3KYDA 1E6EA 2PD3A 1RM5A 2PZMA 2JFHA 1SCUA 1EMDA 1PS0A 4QO8A 1DIHA 2CVQA 4R1UA 2Q1SA 1NTOA 5I7EA 4E5MA 4XQCA 4AJEA 1ULUA 4L75A 3QHAA 3FPCA 4TROA 4DLAA 2YFQA 4DMMA 4YCAA 3VKVA 2PK3A 1K2WA 3BHMA 4IDDA 5JDIA 1QYXA 1V6AA 2Q50A 3PJDA 2VYND 3EHEA 5IZ4A 2XXJA 1X0VA 3PYMA 5I7VA 1U9JA 5L4LA 4LGVA 2J3JA 2NM0A 3RASA 4D45A 5CG1A 4BKUA 1UDBA 4RO0A 4TVBA 1VL8A 2F00A 4RF4A 5IXSA 4DLBA 1F14A 4CL8A 1E5QA 2D5CA 3FNEA 5C7IO 2XXBA 1Q0QA 1X0XA 4W7IA 3GN1A 4R5MA 4XD2A 5DBGA 4DPLA 2B4QA 3TZKA 1LSSA 4YAIA 3WYBA 1H94A 1YKFA 2HSDA 4XIYA 4UEOA 4U0KA 4Y6RA 4MVJA 4BNNA 3H9EO 2A35A 4U5QA 3NX4A 4FJ2A 3GZ4A 3MJ4A 4WCFC 2YY7A 4IQGA 5KKCA 1BXGB 2EKQA 2HLPA 5T64A 4TWRA 1P1KA 4PZEA 4AJHA 3DOCA 3ZI0A 3MWDB 1DC4A 3KSZO 1ZJZA 2X6TA 4ONEA 2ZTLA 1NR1A 1ISGA 2RBEA 3AOEC 2LDXA 2AQ8A 4CMHA 4BO5A 1U8FO 1GADO 4XRRA 3ZW8A 4FGWA 4GX0A 4Z9YA 1IUKA 5CHEA 5AYVA 1BG6A 2YQ5A 2X9NA 5IZCA 4TRRA 2EJVA 1YWGO 4YPOA 5K9ZA 3Q9NA 1KY4A 1X7DA 3VVBA 1E3JA 2GCGA 4YEDA 5IDWA 1J4AA 1UP7A 4FPXA 3LT0A 1XEAA 2BH9A 5B4VA 4AICA 3I3OA 1MA0A 5IJZA 4MVJP 1PWZA 1YQGA 5EN4A 5BNFA 1KVUA 4ND5A 5AXAA 3Q0EA 5JSFA 4B7UA 5DT9A 1GAEO 1DAPA 1LDEA 2C20A 5CEEA 3PLNA 1MV8A 1PJLA 2Y0CA 2ZJ0A 4PLZA 1P1FA 1XG5A 3JYOA 1L7DA 2VQ3A 3PIDA 3CXRA 4BO9A 3K30A 4IPTA 4RZHA 3IKTA 3D7LA 4PRKA 3RD5A 5I8WA 4BGVA 2HDHA 2W2KB 4BOYA 3U4CA 4J9VA 3FNHA 4NI5A 2CDCA 4DL9A 4GLOA 2VHXA 3I9MA 4PZDA 4MVJI 1F17A 4TRJA 3P2OA 1HEUA 3PI7A 1YBVA 3LLVA 1VJTA 1DRVA 1S7CA 3T7CA 1C14A 1DIAA 1OI7A 2GN8A 4OGWA 3W4JA 3GVHA 3WG9A 2CMDA 1MUUA 3QJ5A 4YT8A 3E1KA 2X8LA 2NVWA 4FFLA 4H3VA 2HMSA 4TMFA 3WXBA 2RHRA 1O5IA 2Q1WA 4CM9A 1P77A 3WOHA 1EVIA 3E03A 3LK7A 4W9NA 5JE8A 5K6AC 3JQAB 3U4IA 1M67A 2FPPA 3AJRA 3PYXA 3WS7A 2C0CA 2JAHA 4NDNE 2FWMX 1ISHA 3V1TC 2JHGA 3C85A 1B3BA 2EG9A 4GGOA 2VWQA 4F6LA 1U3TA 2PKQP 3C24A 4XKJA 1BW9B 4DYDA 3C1OA 3ZWWA 1U2DA 1ZK0A 3MJTA 4ID9A 4YQYA 4QX6A 3JQEA 4RF3A 3E8XA 1Y8QA 2C2YA 2VT2A 3CINA 2XPCA 1ZMTA 1ADCA 4Z6KA 1LDNA 1H2HA 1B16A 5A4DA 1WNTA 3WBBA 1P45A 1PL8A 4U8GA 2NQ8A 4IINA 4NK4A 1PS9A 1PIWA 4P38A 1B8UA 1D4FA 1GL3A 2IXBA 3C8MA 5TIIA 3DZIA 5F1PA 2UDPA 5JAZA 3CUKA 3DHNA 1QYDA 2JAPA 2VHZA 1NYTA 1OC4A 3DONA 3PGJA 5L4SA 3VVCA 1NFRA 3JQGB 3GDOA 3FPLA 1DEHA 1LEHA 3RUFA 4E3ZA 4I08A 5IZCC 1Y81A 3ASVA 1DO8A 1HLDA 4CLDA 5THQA 1FDTA 4BGIA 3IAHA 3WQRA 3P5SA 3HDQA 2AQHA 2ZB4A 4MIYA 1WLYA 3AI2A 4MO2A 4OH1A 2F1KA 2HO5A 3RBZA 1GYQA 4B4WA 3BHIA 1PQPA 1P3DA 2PGLA 4OKIA 1HLPA 1DHTA 4U6QA 4BNJA 2H9IA 4B8WA 1Z45A 3RU7A 1Y1PA 4BO7A 3DOOA 4GL4A 2PZLA 2HMWA 3GDGA 4YT2A 2P9GA 2ZQYA 3BXXA 3QW2A 1OC2A 1J5PA 2PD4A 3IC5A 2PH3A 4BNZA 3QVOA 4ND4A 2OP1A 1PU2A 5JC1A 3JQ9A 3DDNA 5ITWA 4E5PA 1JW9B 1KERA 4PRLA 2A9FA 3PXXA 1QKIA 4YJGA 1PJ3A 4ZQHA 4CQLA 1ULSA 1T26A 3EW7A 3UUWA 4Q3BA 4CQMB 4D3DA 2BHLA 3TZ6A 4XGNA 4CQMD 5G0UA 4HBGA 4R3NA 3JQ8B 3IUSA 3WDSA 4OMUA 3VKUA 4DYVA 4QECA 2TMDA 1NPTO 1GD1O 2IYPA 4DREA 2ZYDA 4XRGA 3ENNA 5G0WA 5GZ3A 2JD0A 1I01A 1U1IA 3RJ5A 4IGEA 5GY7A 2W4QA 3PJFA 1P74A 2BD0A 1CQIA 3A28A 4S3MA 2EGGA 3L6EA 1DHRA 3UF0A 2R00A 3T4XA 3WGHA 4R69A 4KUGA 4OL9A 4EBFA 1X7GA 1PEDA 1YBMA 3KZVA 3VPGA 2PNFA 5F3RA 4EI2A 2FRDA 1PX0A 2YFHA 4G5HA 1KEUA 2JFFA 2WEKA 8LDHA 1LLDA 3FWZA 3RFVA 4GX1A 3HDYA 3KO8A 3VPXA 4E2YA 4NH4A 1NQAO 4YYZA 3HFGA 3CIFA 1PJSA 1DC6A 3PHIA 3WR5A 4OO3A 3ZU2A 2GYYA 3Q6IA 4NMHA 2JCVA 3LLSA 2VRCA 4XJSA 2VYVA 5I9LA 2D2IA 3HADA 2VRCD 4OJNA 1U4OA 2VYVD 4E32A 3QVXA 4KWHA 5TGDA 1YL7A 5DBIA 1H9AA 1O8CA 1W0CA 4A10A 4BNLA 2JD2A 2Y99A 4EJMA 1VI2A 1VJ0A 4CV1A 3BHJA 4EUFA 3VPSA 4I9HA 3LF1A 2HK8A 1NX6A 4I5EA 5KJEA 3TDKA 4CODB 1IB6A 1YQDA 1LTHR 4FN4A 3GEGA 4L73A 3GLQA 2XAAA 3RC1A 1U28A 5JMPA 4FDAA 1R4NB 2I66A 4Z0PA 1HRDA 1WZIA 4J90A 2HMTA 3DEYX 3IQDB 3VHRA 2OORA 3RVDA 2E82A 4CMIB 1ENOA 2DKNA 5IN5A 2G1UA 2Y67A 3QWBA 4XDYA 4OM8A 4RF2A 3TFQA 5JS6A 5L7WA 2Q4BA 4WJZA 1DIRA 5I9NA 3LT4A 4XYLA 5CFZA 2H5LA 3JD0A 1U7TA 1GR0A 1BHSA 3E9MA 1DLJA 1ZCJA 3PK0A 2I65A 4ZRNA 4BKOA 2FZWA 1YE3A 1KC1A 1ZIDA 4O5OA 3ZV4A 3I9OA 5THKA 3QP9A 1D3AA 1NXQA 3B1KA 3EVNA 3WYEA 3AFNA 3M1AA 1OAAA 1F8FA 3IKVA 3M6IA 3ROQA 5ICMA 1VM6A 1EUDA 4M89A 4B8ZA 3H5RA 5G0VA 3HNPA 1Z7BA 4IDCA 4Y6SA 2EEZA 4WLFA 1U4SA 4YACA 3QWHA 1TA4A 4CLHA 4IIVA 3JQ9C 4BUCA 4J9UE 3I6IA 1E7YA 4IDFA 3JQ7B 4OSPA 3DHEA 3GVIA 2Y1CA 3PIIA 1T2AA 3DFZA 4LCEA 4O0LA 2GN4A 3GOHA 2A4KA 5C7OO 2ZK7A 1CETA 3DOJA 3CZMA 2X1HA 2X0NA 3N74A 2AE2A 4TSKA 2I5PO 4BNXA 3S55A 4TRMA 3R3JA 3WTCA 3U09A 3X2FA 3CKYA 1NASA 3KHUA 4E2ZA 3H6KA 3DAGA 3F5QA 1QSGA 4ALMA 3JD3A 1C1XA 1HE3A 2J5QA 4RQUA 4IDBA 1XQ1A 4B4OA 1QV7A 4FJ0A 4GQAA 4UEKA 3DZKA 4IY1A 1EFKA 3R6DA 1E3WA 4LVCA 4MP3A 2VWGA 3BMOB 4QTZA 1XHLA 1PJ2A 4OXKA 4UREA 4Y67A 5TLSA 5LC1A 3PDJA 3H8VA 1U3VA 4XJTA 1ZBQA 2CD9A 4YDRA 3ANMA 4CMKA 2ILTA 4DPKA 4DGSA 4K6CA 4GBJA 4XB2A 2O50A 4DBZA 5DP2A 3F5SA 5HA5A 4FCCA 4OQZA 1LU9A 2DBQA 5H83A 1LXCA 4PLYA 4RVGA 4WPGA 4XQEA 1G0NA 2GN6A 2OFPA 4YJFB 3INTA 2WSBA 4R41A 3TN7A 1E3SA 5FI5A 1RPNA 1C1DA 1GQYA 1IOLA 1H6CA 3TNLA 1ZO8A 5DNAA 3AU9A 3H7AA 4Y9DA 2GZ1A 1T24A 3KUXA 1QYVA 1GCUA 1YOVB 2OP0A 4MINA 5JCJA 1N92A 4DBVO 2AA3A 4R68A 4IJVA 1ZVMA 3NJ4A 1DBVO 3QA9A 1J49A 2Y1OA 4K26A 1NVMB 4I5FA 4A7PA 5KNLA 2JJYA 2G76A 1R4MA 2IZ1A 4NBWA 5IFLA 3SC6A 3JYQA 1GYPA 1NHWA 2PY6A 1EUZA 1A5ZA 3S2EA 4BQRA 3OSUA 3ADPA 4CM4B 3SJUA 1XA0A 1IHXA 4P4GA 1IZ9A 4YJHA 3ZGYA 4B7CA 1GZ4A 2GZ2A 3EGOA 4ZICA 4WEQA 4C4OA 2X0JA 2LDBA 2QRJA 4HFJA 3VTZA 5G4KB 3D1LA 1CDOA 1LJ8A 2O3SA 1GZ3A 4E21A 1ZJYA 1B0AA 2AE1A 3GHHA 2AEMA 1WWKA 3R0IA 1GCOA 3WX0A 1O6ZA 3UH1A 4C7JA 1XQ6A 3FHLA 1TT5A 4E5NA 3DBRB 1SB9A 4OHUA 5JBIA 1X1EA 5A5FA 1NHGA 2D0IA 3QRWA 1EK6A 2NVUB 4GPD1 4J2HA 3E9QA 3BTUA 3UVEA 2B83A 2DVMA 3OJLA 2FR8A 3F4BA 4AJJA 3GG2A 3KEQA 1JA9A 3UOGA 5ENDA 3W8EA 5KVSA 3W4IA 1GV0A 5L51A 4R51A 3BMNB 4EITA 4XX0A 4CMGA 2WD8A 1PJQA 1JVSA 3TOZA 4LMPA 4RPKA 5ES3A 5FEUA 1CIVA 2JKVA 2DBVO 4FQ8A 4J6FA 5CEJA 1O89A 3LC2O 4ESOA 2BMAA 2ET6A 3T4EA 1WZEA 4IS3A 4KZPA 2QYSA 3DC2A 4URFA 1A4IA 2GPTA 4WCFA 4E0BA 1YGYA 2FZEA 1CEQA 1E1MA 2EP5A 2BELA 3ITDA 5ICSA 5JNLA 1XR3A 4LISA 5KJ6A 3R3SA 1HE2A 4JQCA 4OQYA 4U0JA 5A3JA 4RV9A 1GQQA 1YB4A 4ZRMA 1ZNQO 2A92A 3VH2A 3MOIA 1NM5A 2OXIA 2NWQA 4BB5A 5L9AA 1AXGA 3OIFA 3G79A 1YS4A 5B37A 1E1NA 1GUYA 1UDAA 3AUUA 3L6DA 3U9LA 3LF2A 4YAGA 1TXGA 2YV2A 2X5KO 3KYBA 4WEOA 3GVCA 3KLMX 3G1TA 1DIBA 4Z3KA 4RVSA 4J4HA 3GZNA 5IG2A 3PJEA 4AJNA 5B4TA 3ORFA 4R9SA 1A9ZA 3TRIA 2NTNA 1A27A 1N9GB 2CVZA 1SZJG 3AM4A 3LQFA 2O3RA 3NDRA 1Y8RA 5I9MA 3WLEA 7ADHA 1HKUA 2YUTA 4MVJF 2IEBA 4H7PA 4PLCA 1F8GA 3C7CB 1UXGA 4HV4A 4GMGA 3WGTA 2ZIZA 4O1MA 4NNJA 2ZB3A 4B3IA 3JQDA 4QUKA 2HKIA 1K0UA 2GDZA 2Q46A 4JNKA 4Z3DA 3W1VA 1GY8A 4CM6A 3OM9A 1IPEA 5A5EA 4Y8VA 1YH3A 5DDIP 3CEAA 4GWKA 4BVAA 2DQ4A 3KXDA 2BKAA 3W6UA 3DO5A 3QLJA 2V65A 1K5HA 4CLOA 2IODA 5TT1A 5JW6A 2Q45A 3DB2A 2I3AA 1N7HA 1ZEMA 2B36A 5T8KA 4RZIA 3OBBA 1BMDA 3ICPA 2AQIA 3RUIA 1M75A 2V6GA 4YVFA 3U4DA 2VWHA 3DL2A 3KLPX 3JCZA 4EW6A 3IDSA 4YB8A 4BMNA 3KSDO 4XYGA 4GVXA 3DFUA 2I67A 3TSCA 4WCDA 3WJ7A 3KYCA 5KKAA 1JN0A 3QQPA 3H3FA 3GFBA 3QV1A 2OBNA 5L3ZA 3RUDA 2YJZA 1M6WA 4J7UA 4RPHA 2IEDA 3FTPA 9LDBA 4I5GA 3FSRA 3H2SA 4OXNA 5AXDA 5MDHA 4RVDA 4D44A 1KC3A 2GSDA 5K6AA 3FNGA 2OGUA 1YBAA 4R1TA 3ROPA 1BVRA 2Y1DA 3PQEA 3ZHBA 5CDSA 1E6UA 4J1TA 5AOVA 1MFZA 4UUOA 3ZWCA 2D3TA 1KETA 4BGEA 3OA0A 3WGZA 1EQUA 4FR5A 2DTDA 3MJCA 4IMRA 1KVQA 1BDMA 2YZ7A 1IULA 3Q9UA 1FF9A 3GG9A 3DBVO 3B1JA 2FY8A 2OHXA 3IP1A 2JCYA 4N5LA 4CR7A 2B69A 3WGYA 3H2ZA 1W4ZA 4BO8A 2Q2QA 4NBVA 4BHTA 4JCOA 3DBLB 4MVJD 1ZK1A 1EFLA 4DC0A 4RQTA 3GNTA 1ISMA 1R0KA 4KUHA 1OOEA 1EE2A 2NU7A 3QWAA 1I5RA 3FR7A 4FFNA 4XYMA 4BNVA 5MGBA 2VHVA 1V0JA 5KTKA 1NWCA 2Y1EA 4TVOA 1T2DA 4UEJA 3QSGA 1KVTA 1T1SA 4HKTA 4M54A 5BSFA 2EW2A 2B5VA 3H9GA 2P5UA 5FYDA 2P9CA 4KTTE 4WKGA 4TZTA 4YA6A 1BXGA 3ZNQA 3HDHA 1P1IA 3PTZA 4KOAA 3GY0A 2VWPA 4TZKA 4JGBA 3W4KA 5JYDA 1JWBB 3IJRA 2Q99A 4IQ0A 1JAYA 4FJ1A 4A5OA 1AE1A 4B4UA 2BFAA 2VN8A 2VUTA 5EINA 4E30A 2X7HA 1R15A 2DU8A 3A14A 3AFMA 4N5MA 3HN2A 3OECA 5EESA 5JDCA 2HUNA 1K6JA 4IZHA 1XU7A 4AJ1A 5C37A 4QQRA 1ADGA 3RFXA 4IMPA 3VH3A 1DSSG 4M86A 1NR7A 1C0KA 1H9BA 2BRUA 1SNYA 4LW8A 1F12A 3HE3A 4Z0TA 1BRMA 3B1FA 2YHIB 2EXXA 2IRWA 3RIHA 3E6AA 4FFMA 4ZU3A 1Z6ZA 4E33A 2O7QA 2ZATA 4I5DA 4JIGA 4RGBA 1LI4A 5T8KC 1I2ZA 1G0OA 4U6SA 3PHHA 1HYHA 2GERA 4IQ8A 4GKBA 1N8KA 4IJUA 3WTBA 1ZMOA 2G82A 1C0LA 3KV3O 1GEEA 4IZIA 4ZQEA 2W2LA 3IL2A 9LDTA 5CP8A 3UW3A 5TQVA 1DFHA 2CY0A 2W2LD 1VLLA 2CF6A 1YJQA 4XIJA 1HXHA 1UXKA 2OZPA 3I9NA 4Y98A 3PPIA 4HY3A 2OBYA 3AUAA 2AW5A 1UR5A 1KOLA 1P1RA 1EEHA 2W2KA 4DXHA 3M2PA 4WLOA 3DXFA 2PKRA 4DUPA 1T4DA 4ZQBA 1NQ5A 1EBFA 4CM9D 3CTMA 2WYVA 3BTOA 5G2OA 4Q3NA 1RYDA 4FC7A 1KEVA 1RJWA 2B0JA 3GT0A 3OQBA 3PFWO 2D5AA 3RUCA 4BL5A 4ZJUA 1VL6A 3DZFA 3TL2A 2FSVA 1TI7A 4NFHA 2OUIA 2PZKA 4ZQFA 4Z9FA 2PGDA 3UCEA 2AG5A 3EZLA 4BO3A 3ADOA 1DOHA 3VOSA 4IGFA 1E7MA 1L7EA 4HFRA 4W99A 2YHUA 3F4LA 1IHYA 5BSHA 1W73A 1Y8QB 2RCYA 1DFIA 1X7HA 2Y0EA 3JQAA 4BS9A 1JKJA 1VSUA 2EW8A 4R1NA 1I3KA 2GR9A 4EUHA 1KYQA 2EKLA 3ANNA 3N58A 3MJEA 4J4TA 3ZNOA 3HWRA 4MVJE 4AJPA 1Q0LA 1CF2O 1BW9A 2JD1A 3K31A 5ADHA 3JQCA 1ENZA 2HCTA 3NT5A 4BNMA 2NV6A 1C0PA 3EVTA 3AY3A 3SLKA 1XSEA 1HYEA 1ZK3A 2Q3EA 1P1HA 2QX7A 4Q9NA 4BO0A 3TOXA 3E5MA 3NTQA 4MOWA 3F3SA 3ZWBA 2RH8A 1N7GA 2Q2WA 2RHCA 3WGQA 3TPCA 1MP0A 4JROA 2AEFA 1VKOA 3WQSB 5CDGA 7MDHA 3D3WB 2P2SA 1QYWA 3DAPA 3V2GA 3AM3A 2O4CA 4F6CA 4R3WA 5JDCC 1GPDG 4N18A 1CQJA 3OQ6A 2DFDA 1WDLA 3AY6A 3JQGA 3PFFA 3WFIA 1RM0A 5TNXA 2Z5LA 4ALLA 4NBUA 1K6IA 1NWHA 3Q1LA 4ND2A 1QMGA 3HZZA 4HX5A 2DC1A 2Z95A 2A94A 2O48X 3OP4A 4L9RA 5A05A 3IUPA 3MCVA 1WDKA 4R01A 5TJHA 4ALIA 4XDZA 4CM1A 4NJMA 3EC7A 4GMFA 4J16A 4QFDA 5A04A 1U5CA 3DZBA 5CPBA 5AVOA 4DWVA 4CJXA 1T2FA 4E31A 3G1UA 1E7QA 3GMSA 4YRAA 2J3KA 3GR6A 1PJBA 4Q3DA 1IL0A 4ZA2A 3GAFA 4L76A 2WJPA 4BNUA 4FGSA 3LT1A 3VZQA 5KWEA 1EUCA 1LRKA 4OOFA 3UICA 4AJOA 4GH5A 5IN4A 3V5NA 4BNKA 2X22A 3NDJA 3UKOA
chains in the Genus database with same CATH superfamily
1F3OA 2D2EA 2H3EA 4UVGA 1JR2A 2EKPA 2NSHA 3EIEA 5CYGA 1YJCA 5KS2A 1JG2A 3THXB 2ZUEA 3AHHA 2ZZNA 3RDPA 3WLLA 2FB9A 5DNUA 1PR9A 1LA2A 4Q1FA 5K3FB 2Y05A 1R8XA 3U6BA 2P62A 1QAOA 3EWSA 2BUCA 4NONA 1XVVA 5UKDA 1MDBA 3INGA 5ALNA 3RHSA 5L7TA 1BCSB 4GMXA 2ZRDA 1UBCA 5I45A 2QORA 5K01A 3SBOA 4Q3KA 5KYWB 4KN6A 2QZ9A 2B5WA 2QJTA 1MAUA 1UQUA 4A0SA 1WY7A 1VI6A 1DRWA 4HWKA 4LRWA 2A57A 5IJ9A 2WSSD 3FCEA 3RKSA 5BSGA 3CN7A 4FT4A 2PUDA 4RPIA 3HUEA 4R98A 1YZQA 1TJNA 2EGUA 1WV1A 4JS0A 4KBYA 4W7HA 1DBQA 1X15A 4LOJA 3THOA 2DB3A 2FF7A 4C29A 1BXZA 1EWTA 3RRYA 4UZFA 1CIPA 3B6IA 3ZZNA 2FSPA 1DQRA 2VAXA 3K35A 4C7BA 2W7TA 2OMEA 3X2EA 1RFLA 2C7GA 2ZJ6A 5IBQA 3VHLB 4AUKA 1NW3A 5A4IS 1LGYA 1SBZA 1XRPA 1N4AA 2W2TA 3TAXA 1JR4A 5KSOA 3MSCA 3BZUA 3EF3A 2ZUTA 1KARA 3U4GA 3PKJA 3VH4A 1HSZA 2X0DA 4FFBA 2O1SA 3RRMA 3W6OA 1HDZA 1JQBA 2ID4A 3MERA 3SFTA 1JKMA 2JIBA 3E5RA 2P5YA 2YX1A 2WICA 2IXFA 4FN5A 1E5XA 2ZRGA 2CHEA 1Z6XA 2I1WA 2GRJA 3A1NA 3IUYA 1KIFA 4L5JA 1ODJA 3S70A 3C15C 3V46A 2YDXA 3OJOA 1F6DA 2NACA 2I1QA 5E9WA 5FIUA 4LWPA 3UHAA 2JI9A 1RWMA 2GMWA 4JYMA 4N3BA 2WF9A 4MZXA 3KAPA 3M83A 1DLIA 3L0ZA 3DOUA 3KKQA 2WWIA 3MTAA 4ALKA 2BFCA 4ZP1A 3VOTA 5LWHA 3EY9A 2NUTA 3IIJA 1Z74A 2GN9A 5SZIA 3T3IA 4JBXA 1FMFA 3LWDA 1XXHB 4FEAA 3HV2A 3K1AA 1SBNE 3LZCA 1YI0A 5IAAA 1C4XA 2WE8A 1N5MA 1BDJA 4DV6B 2B4AA 1UH5A 3AT1A 1C81A 4BB0A 3RYTC 3D5TA 3FNFA 3VJKA 2MSKA 5D3QA 4CTNA 4IX1A 3LCCA 3VV2A 1XCJA 2PVSA 3D31A 3VOBA 1Z5PA 3N2GA 2HK7A 2HJVA 4EO4A 3RK0A 1U0TA 1U7HA 1AZSC 2YWRA 2O4UX 4A2CA 1UAAA 2H7VA 4XFKA 3L7KA 3BN3A 4XE5A 1R4NA 4D6YA 2BDTA 3DR3A 3RYCA 4NE2A 1UZLA 1U3UA 2MHCA 3FBTA 4H7HA 4IVPA 5HE9A 3SVZA 1Z07A 1UK9A 3D3JA 4LUCA 4YWJA 1OBOA 4C6SA 2REBA 1KAOA 4E5YA 3L01A 4OLJA 5TQ2B 1FSSA 5K51A 3WIBA 1L4KA 2HJRA 2G1AA 1BE8A 2GPJA 1CUVA 5B3LA 2W42A 4KBFA 1W2GA 1QIMA 1Y1KE 3EGDA 5CPFA 3R7LA 3UHOA 2OO7A 3ZGXA 2NIPA 4J7XA 4BASA 1B26A 1D09A 4S1NA 3HS3A 4NJEB 2WJWA 2WWXA 1YRAA 2C0QA 1RXEA 1VB5A 3DXXA 1H8EA 3RS0A 3W9BA 2ZYGA 3KVOA 3TG8A 2X0RA 4PR3A 4ZXFA 5H5JA 2E0IA 2WINI 4NAHA 1WMBA 2DLDA 4M3NA 4Q03A 1KSGA 4EJ6A 5BQ3A 5J4KA 1QCYA 3H2IA 1F06A 3MLAA 3DE4X 4BLTA 3LCJA 3WK9A 1P9WA 1RYYA 1VZ3A 4B0PA 4DUGD 1Q57A 1QIEA 4H7IA 5A9RA 3R7NA 1LDYA 3THYA 2P68A 3PNLA 2PX8A 1T8WA 4W5HA 2K87A 4ZVVA 2DKFA 1P7YA 4EYSA 3LBFA 2EJWA 1RQNA 2XWPA 4EPVA 3BWEA 5K99A 2IH4A 3GN2A 2BFPA 2BGKA 3NNDA 3WLFA 3E2MA 3LPLA 3LUFA 3EPHA 1PHPA 1KZHA 3LWNA 2BPOA 3BWMA 1IDN1 2B20A 2G5PA 4B33A 3DEZA 3Q87B 5DSXA 3U3RA 2Q8QA 1RXUA 5C8YF 2O2HA 2YZNA 2CNWD 2VCEA 4MPDA 5GIOE 1FDIA 4UAUA 3T35A 5BR7A 3WHLA 3GNSA 1XDBA 3ZXXA 1SBQA 3F47A 5ERGB 5BN5B 3S8YA 2IZOA 1W94A 1H65A 4OXYA 1ULTA 3KAJA 3H4MA 1Z2NX 5TGZA 1XZKA 3LUCA 5JVDA 3ZCXA 1IONA 3JWPA 5JSHA 2Q1UA 4HDNA 3MJHA 4FNGA 2VP6A 4I3FA 3JAMA 3W0LB 4EL0A 3OQOA 4QDXA 3KJNA 1G20A 4IL5A 4J0HA 1LC3A 1LS1A 3JWEA 4IDAA 1CR6A 2PRSA 1CJTC 1XRSB 3I6ZA 3TD2A 2QB5A 3OJ0A 5FFMA 4D43A 3ASYA 3LBNA 4UQLA 4MDEA 1M7GA 3Q10A 4A27A 4BBPA 4RNDB 3WYGA 2Y2UA 4WI1A 1WCIA 4F6RB 4LBZA 1ZLXA 2VUUA 1YD7A 3IAAA 2VDWB 4LK3A 5ES4B 3ZE8A 5GM1A 3PPVA 1H8HD 4DDWA 3PGVA 1DKQA 1L5KA 2YYZA 5IK2D 3G0OA 1ONPA 2C2OA 2MT9A 5CD9A 3M3PA 3F6EX 1CY7A 1N2SA 1Z5WA 1XZBA 1C5KA 1Z0ZA 2PL1A 1N2BA 2TMKA 2ZBFA 4IDOA 4E22A 1FK8A 2E21A 5HOQA 2VHEA 5E9AA 4DLNA 5KCZA 1IYZA 1JLKA 2JJMA 5LUAA 4NEGA 3RS5A 3O1JC 3OPYB 2QG4A 2Z2ZA 4F4JA 2HU2A 5L95A 4YJFA 1KRXA 2HWKA 1UUFA 2F3RA 3RUHA 3Q98A 1T6XA 2HRCA 4FI3F 2XXAB 3U4MA 5FDFA 1Z9BA 4B6SA 3IEMA 2CHGA 2IEZA 2H6EA 3ZN2A 5CDUA 2JEZA 2NG1A 1ZIXA 2V5AA 5DOVA 4EGAA 1JLLB 2HXSA 1NF3A 1P4SA 2ZBEA 3MWFA 4FYVA 3WZ2A 2XE7A 3K1YA 4GZMA 1R16A 1YS9A 3GVPA 1RHQA 1B2LA 1D2MA 1JDJA 2PAAA 1X70A 2P8SA 1D8AA 3CNQS 1K7CA 4IO0A 1XD2B 1QO0D 4G8BA 1HG1A 3N8NA 3W1EA 5DCYA 1QH8B 4Y6QA 1HDOA 1XRLA 2HU7A 3OE1A 2BFEB 1A97A 3UV7A 4LJ9A 1NXPA 2BGRA 2O8VA 3UAZA 4K9RA 3X1YA 4A9AA 4ESHA 3EXHA 1WKBA 2GAJA 4BMPB 4CIXA 3VNUA 2KSQA 3QUBA 4QJIA 2M1ZA 1CR0A 3NHFA 1M1NB 3IP6A 1LVHA 1SOWA 3AR6A 3SE0A 4I19A 1K63A 3VAAA 5AHWA 4ZDKA 1AG9A 1RKVA 2FOIA 4KK3A 3UHFA 4FINA 4MB6A 3O3MB 2HNBA 4X62B 1BDIA 4EVRA 4BLRA 1PK7A 4OGFA 1Q16A 3NYQA 2GH1A 4P1ZA 5DEOA 5EXPA 1V1RB 4XX0B 3ZVKA 3CUEF 3UUFA 2BM1A 2IYVA 1S4MA 4CEJB 1LPPA 5L8VA 5ARCA 1ZEJA 5EYPB 4PE5B 2R0QC 3EGIA 2FW9A 3RWBA 4D79A 1T9DA 4MUEA 3AW8A 2VPYA 3G89A 2XVMA 1RJFA 1CZHA 3U0VA 4CKCA 1KYVA 1R50A 2I54A 2GTPA 4HDRA 5L7YA 4TLCA 4GOOD 4P36A 3TM4A 2QX8A 2P79A 2KQUA 1SHUX 5LJIA 1T36B 1QPZA 3IHWA 4RVFA 1A2KC 3KT0A 4TV8A 2D8AA 3EW9A 2X1VA 5TS3A 3WK6A 2C7VA 1RRCA 2ODQA 3BMNA 3ELYA 1UINA 3D02A 5F7JA 3EGVA 1NE7A 3G49A 4AN1A 4ZK6A 1B15A 5BSVA 3SR4A 2NQTA 1Y98A 5ESDA 4KDFA 1KZ9A 5JNUA 1ZI6A 2P4HX 2PLFA 4L74A 4HRAA 4IDGA 4BX0A 4M87A 1O6CA 5DV9A 4CUZA 3GT7A 2QRKA 4DCUA 1PLKA 4IGIA 1ZM2A 1K89A 4US1R 2A30A 3KKZA 5H9WA 1E2HA 4TS1A 1N1GA 3EB9A 3I6QA 4KR9A 1DWQA 3RJTA 1W59A 4XWGA 5KYGA 3I53A 3Q9LA 2A5JA 1TTPB 2CDAA 5DYWA 1E3IA 1M0SA 2EX0A 4AB1A 4YO8A 4J7AA 1LDMA 4UTRA 5J23A 5HRUA 3GP8A 2NTEA 4PVCA 3IS3A 1MC5A 2XBMA 3GUZA 2PO5A 1FNCA 1FB5A 1AKEA 1VFPA 2R85A 3AGQA 3PRYA 1MH9A 4FHCA 4PG8A 2PUCA 3ORSA 4IP0A 5IYZA 1CJCA 1RI5A 5TQ0A 1L5NA 2ZULA 3BMCB 1SD5A 4A6DA 3ZU5A 1RJEA 1KS2A 2ODBA 3H83A 1M76A 3NC0C 4G84A 1FSPA 1RD4A 4AMGA 1UXHA 2VUSA 2GN1A 4UATA 2J8ZA 3KV1A 5DI9A 4ZVKA 2IXAA 2I7DA 3MJRA 4MA0A 1SKMA 3RCBA 2BGGA 2QV7A 5FF9A 4RIEA 5TXGA 2J30A 3FZQA 4B6OA 1FC0A 1TLTA 2OZKA 2P6MA 2NADA 3BFKA 3JSXA 1OCEA 3AR7A 4JKYA 5JALA 1TTTA 3GDFA 3LQKA 4JL5A 5JANA 1J99A 3L9XA 5FPTA 2EERA 2GUGA 3CZRA 4JJIA 4C07A 1OPXA 1PFQA 1SEPA 1VIYA 1LV7A 4QARA 1QP4A 4Q9JA 2R62A 3JYNA 2JAOA 3W3AA 4B6PA 4C01A 3GJ8A 3DVLA 2GFIA 3K96A 5ITVA 1QFJA 1VBFA 1YJXA 4TUYF 2VF8A 3VNSA 3UJHA 2IT1A 1P6QA 5F2OA 5DGTA 4HUQA 4Z54A 3AI1A 1I9CA 4YV7A 2FW1A 4QTUB 3D0OA 1Z7EA 1ZJ4A 1TVEA 2GN0A 2PRJA 3VBCA 2IE8A 4QDKA 4Z7QB 2Q62A 2GETA 4C1NA 3TAHA 3I61A 3A6JA 5IS2A 1NQUA 2Q7OE 4M8SA 3SSAA 3G2KA 4NJOA 5BURA 4CT4B 5J4HA 3ETEA 4YBZA 1KJ9A 1QB8A 1VYHA 1TQ8A 3C3PA 3EXHC 4DV5B 3SLGA 4WINA 4AN4A 5KMGA 4GICA 4EVIA 3ONEA 2NTVA 2DZDA 1POWA 1UEIA 3D4NA 5J40A 2H51A 1KF0A 1ABFA 5B7NA 5BW8A 1TPYA 1GZSA 1AKTA 1YQQA 3AY0A 1PNRA 1QG0A 3BE6A 3VJMA 2JLWA 4JI3B 3AUSA 2PH7A 5JG7A 4F46A 3DDSA 4RJIA 3HNRA 5T57A 3DHYA 4WK0B 3P9XA 1OYWA 1T9ZA 2NGRA 2VYNA 3O6VA 3LL4A 3ZXYA 4DIMA 4CG0A 3SDZA 2YFKA 5DIZA 5HM8A 1AN9A 3M49A 5FPSA 3WIUA 1VL0A 3RS2A 4Q82A 1KQGA 2M32A 1XUOA 2H57A 2O8NA 2OOSA 3TB4A 4D41A 2QZ4A 3T3PB 1BX1A 1XMJA 4IVQA 3R0ZA 1VRVA 3BWBA 3FM9A 4UU8A 1UC4B 2IXTA 2VZ0A 4E51A 4ZYTA 1M34A 4JBGA 1MJGM 1ADYA 1W76A 2PS3A 4QLAA 5DPMA 1S9DA 5I4BA 5LJLA 3A4LA 2H92A 2YV5A 2PU5A 2I4OA 3AVPA 1GKLA 1OJLA 3NDBB 5FTWA 1XU9A 3I0NA 2RHGB 2X77A 1XD9A 1XQ9A 2QTAA 1V7PC 2XNDD 4NCJA 4DV2B 4UKDA 3PNYA 2G4VA 3W2GA 4L3VA 1PTKA 1T10A 1II8A 2BF4A 3G5TA 1M7BA 2NXWA 5HG0A 3VMFA 2PWYA 1ZA1A 1MW8X 5JNRA 4PWYA 2OHFA 4TYWA 1ZAKA 4IW3B 1MDFA 2ANCA 3QKUA 1PGPA 3RK4A 3O4IA 2R8XA 2N46A 3ICQB 2W11A 4K6OA 2VL7A 4MIKA 1FSZA 5K5EA 1YQUA 3G0GA 3DWGA 1S2OA 4G25A 4RYDA 5CAEA 1RWOA 3C5EA 2R6R1 5AVQA 1ORVA 1RI1A 3FR8A 3GJQA 1YDFA 3NGMA 3KIPA 1QH1A 4MKHA 2QX9A 3PD0A 4TXNA 5DNVA 3U0BA 4DMHA 4DLLA 5ITZB 2Z8YA 1EWKA 2Z8XA 1DJLA 4II2A 1E3EA 5DT2A 1PFVA 1WQ1R 1PCXA 1W29A 3NHYA 4Y3UA 1K7FB 2QMUA 3HKCB 3ZV5A 2I4LA 2P75A 2VPQA 4DY6A 2PRKA 2QRZA 3K9GA 4E5KA 3PQDA 5EIBD 4D3ZA 3I5UA 4FSDA 1E1RD 2VDQB 5IC5A 1NJ6A 3A6DA 4RY0A 5HQTA 2BBOA 1MNAA 2Y4OA 1PS8A 1WAMA 1XZAA 2QMOA 1KAHA 1SO8A 3EDQA 3FZEA 3ZBQA 2DUWA 2OILA 3KBOA 3LA8A 3PI6A 4CUKA 2G5CA 4ZEOA 1XFDA 2D74A 2O2SA 3T3HA 5BSEA 1KVSA 5A3SA 1Q7CA 4O63O 5JRJA 1UPFA 4DQUA 1AGXA 4KQ2A 1OBCA 1DKRA 1EJ6A 2V4ZA 1R0RE 1T4BA 4A8JB 3JD4A 5KEIA 1OFIA 4HH0A 3HB5X 1E9DA 2PE5A 1ISIA 3X2SA 2CE7A 2POCA 2RJNA 2VDOB 2XYPA 2YHIA 4OP2A 2OMKA 4YJ2B 2H17A 3IE1A 4DMKA 1FX0A 3KK0A 4WLEA 1I7QB 1C1HA 5MN5A 1SUAA 1WCXA 1X6VA 3MBOA 4MW0A 1ETUA 5CG2A 3G7NA 1QQ7A 1T6YA 1YXMA 1PJRA 2HV9A 2GPWA 1L5LA 3ZHVA 1OH8A 2EHJA 2CMKA 4C0HA 1AZTA 4OB8A 1K8ZB 2C9MA 4IF6A 4BPBA 2GA9A 5HK8A 3FF4A 2W22A 3NOVA 2XCTB 4EFNA 4ZDIA 1M8GA 4MRAA 3WLRA 4D0LB 5J9FA 4Q12A 2I62A 1M1UA 2CGEA 4DLYA 3QVGB 3WWZA 1I0IA 1JDZA 3HCAA 1GEGA 1MRNA 2VJAA 3OE7A 4QAJA 4ARZB 2BBSA 5EJ6A 1NVUQ 1H6BA 1ODFA 3QJGA 1I4DD 1FDWA 1XC7A 2XMBA 1YZGA 3T99A 2K7ZA 1E1CA 1FY2A 1IE3A 3R1IA 5B7PA 1GZ6A 1QIIA 3HUDA 4JX9A 2R6AA 4RBNA 3I64A 1IZ7A 3RAPR 1NVWQ 4XSHA 5HKKA 5AXCA 5CA1B 3RREA 2A8YA 4HNAA 1A9PA 3RVQA 5JDIC 4LTNA 4G1VA 4NZ9A 4HNUA 3AUTA 2A1TS 4DCOA 5LN1A 2E37A 1AH2A 1E9EA 1M8JA 2VNJA 1OHHD 3ZLUA 2E2WA 3ENWA 2W00A 3HU3A 3JQFA 1EDEA 4JEHA 1K7SN 1GRCA 3IB6A 2GLXA 3AIIA 3QW4B 5JZSA 2PFSA 1AUOA 1B1CA 1Y3CE 3KTOA 3LQ1A 3DTVD 4MGZR 3VX3A 4AW9A 5DLYA 3HXOA 4MUAA 1SRRA 5SYNA 1GZHB 2VJOA 3CR7A 4WFJA 4L0CA 3T5TA 2O23A 5FBQB 3ANYB 2IS4A 4RKWA 5FADA 5BUZA 3G8AA 4WBXC 2PZGA 3V1NA 3MJSA 4MV3A 3EWIA 2RK3A 1X7ZB 1SOMA 1Z82A 2CDBA 4MGIR 5EWMA 1SUEA 3MOGA 3T7IA 2H2HA 4N9QA 4L9WA 1OYYA 3NB0A 1KDVA 2E87A 1UMCB 4AY4A 5HYVA 1KEPA 1E96A 1II0A 4HAZA 3R3XA 5I7UA 3LSTA 2D1YA 3OURA 5JXGA 1N1EA 3AKZA 1QOQB 4MV0A 2OHGA 3K0FA 3OWHA 1NV9A 3AF2A 3GGPA 1KZ6A 1WD5A 3R8CA 1LW6E 2R8RA 2AMJA 1AKQA 1OIXA 2BEJA 2XMPA 3VI3B 3SVTA 4RK6A 2PT9A 1IJBA 3BPSA 4K9QA 3GP3A 2GRUA 5E8RA 2LR0A 3NDIA 3H11B 4LY6A 3L5KA 3FGNA 4G0VA 1NF8A 4JUIA 2E48A 3D8BA 3BT7A 2DCMA 4OBBA 3M1IA 1G64A 2VTEA 2WVAA 4KITB 2GM9A 2AK3A 1G3UA 3DYVA 3K1ZA 5E95A 4PC7A 2GK3A 2OESA 1JB1A 1C3VA 1T0IA 3CEJA 3PUWA 1TJ3A 5EJFA 1T6NA 1XRRA 1JAIA 3BXZA 5TPZA 5JROA 2JGDA 1CBUA 4RM2A 1RZRD 1A9YA 1HY3A 3V42A 3AOGA 3WA7A 1Y7TA 3DMYA 1EA5A 4Q3AA 3D4PA 1PZNA 2AL7A 4WZAB 4NJMB 4W6QA 4RVNA 4RK0A 2NUBA 3T9EA 1A4XA 4D5GA 3TUJC 4MQFA 1BE1A 4INPA 5CT5A 5DTEA 4B3JA 4U9UA 1I7SB 2UXCB 4PRZA 3G0DA 4M76B 4P33A 4NY1A 4N5NA 2R65A 5GONB 3IHTA 5KYYA 4HGPA 1W0KD 5EMHA 1E2UA 2DWCA 3VHQA 3QVLA 2GPBA 3T12A 3WNBA 2YBEA 4OQFA 3LX8A 1HURA 3U2QA 1AV6A 3V3KA 3BGWA 4I36A 3VPHA 1F2TA 4N6GA 1E2MA 1UWKA 2CL5A 2J0SA 2FF5A 3HHPA 4NARA 4GM1A 1FBTA 4K87A 1KMIY 1TUBA 4WK4B 3TIGA 4DIKA 2PCLA 2AXNA 1CUIA 1MT0A 1MX5A 2PGOA 3WLPA 5DN6D 3KHKA 2PLNA 2IYEA 4IWYA 3IP9A 3RB8A 2ZUBA 3QJYA 4YRBA 4MWOA 4HPWA 3PE3A 4QM7A 2RE8A 2P9BA 2CUKA 1U4NA 1HYQA 1Z0DA 5AHKA 3ST7A 1E9SA 3QEAZ 3CHYA 1W36B 4JR0A 4EAAA 1SHTX 2WABA 1JKFA 3FCUB 1VB3A 1MB0A 4MEAA 1Z34A 2Y6UA 3SMQA 1H5NA 2AFVA 2XTAA 3JQ8A 1ONSA 3C97A 3IAS6 2A88A 4R5HA 2RAUA 1TLFA 5TVGA 1ECCA 4CPDA 3TSWA 2RC6A 2J32A 1E1KA 4BNHA 5T3UA 5K4HA 1Q17A 4OLAA 2G0TA 2PUVA 3EXIA 1J24A 3VKHA 1WU7A 1QAQA 3TPZA 2ERXA 4C7OA 4RK7A 3DCJA 4I4NA 4LE1A 3SHTA 1V3UA 4RHEA 2OBMA 2NZVG 3UENA 5E6UB 3WB0A 3IT2A 2ZJFA 2B1IA 4OX9B 3UG7A 4IUYA 4IKEA 2ZTHA 2XX3A 4PC2A 5MGNA 3WICA 4D26A 3HRIA 5C1DA 4GZ6A 4W9NC 3D81A 1HTTA 4P82A 4TZ0A 3JQFC 2PMWB 1EWVA 5DN9A 4EPXA 4IQ4A 1U2SA 2VXCA 5EE9A 1ODIA 5F4BA 4DJ5X 1ZW1A 2DPHA 2HMUA 1J1IA 1M6YA 1RLUA 5KPDA 3JATB 3CJTA 4ERXA 3TW0A 4MUJA 4GWGA 1DJQA 3OTQA 4BVJA 2B37A 4MV8A 3V80A 4BFYA 3QEMB 2CBGA 5HMLA 4C0KA 3BRWA 2JF0A 3NUZA 4L57A 2VJMB 5IF3A 3TL3A 4HAOA 3RNOA 1Z5ZA 1NVTA 2EF1A 1YMQA 2P6NA 2BISA 4GX5A 3M4XA 4Q39A 3FOEC 3AF3A 1XEWX 2IUYA 3NIWA 4K28A 1PQWA 2P1DA 2RIPA 4MRMA 4R2KA 3QM1A 3KUCA 4GLBA 1XZMA 2ZSUA 2WT4A 3BJZA 3HPRA 3QEOA 1P2UA 4U7GA 4HVTA 2JPDA 1M5TA 4A0HA 2NVOA 5HQ3A 3GD5A 3TEFA 2HQ1A 2BLLA 1MQ9A 4X1KA 3UAYA 2W93A 4JLOA 4G67A 3HBNA 3HJFA 1NVFA 2J0EA 2QL5A 3WMRA 1CYDA 1MO5A 5CBPB 4O2AF 3FPAA 4OJQA 4QJ4A 5KNBA 1AMOA 4X8OA 3EA0A 1JHMA 1XDGA 1DMSA 1YU6A 1DXOA 5JCPA 1ZXBA 3S4YA 5KZMB 4LMBA 4I1RA 5DXAA 2C8LA 1PZXA 4YRKA 1L7XA 2QQ5A 3BMQA 4U2EA 5HIKA 4DNPA 2L69A 5AK0A 1ZUNB 3EGXB 1UK8A 4HYTA 2JA1A 3JZIA 5FNVB 4CLXA 1FTNA 3AX6A 2J41A 3EOBI 1SURA 1I32A 3DNMA 2VXYA 1E9FA 1QQAA 1F0KA 2OE2A 2OXEA 1J07A 1KDPA 3H17A 4WX2B 3TSOA 4KFUA 4MDYA 5BN3B 2WSYB 5JCXA 5JO9A 1XRQA 4ECEA 2QL7A 5LXTF 4NAUA 3VGJA 4H7KA 1Y6FA 4A73A 2KWIA 4JLVA 2FVYA 1E32A 1WJGA 4IOLA 1K5PA 5COBA 1P9RA 4CMAA 2P2LA 4R81A 1BHJA 1P5ZB 5DKFA 1ISFA 1UPAA 2X2FA 1R64A 2O0KA 5IM4F 5DCUA 2QUKA 2Y3IA 3D7SA 4FD3A 4P2GA 1C1XB 3A37A 3FLAA 4RY9A 5I9SA 4B6RA 4UXIA 4BZXA 1A9OA 1SBYA 1T1GA 2N75A 3T3MB 3WIEA 2VJDA 4QSHA 5DIFA 2D1RA 4RAQA 2ZWOA 2FQ1A 1H5QA 1KQNA 2F8SA 1NN1A 4UDNA 5BSMA 1KAGA 2VJYA 3MTJA 3T41A 2XSZD 3SIRA 1Y3FE 1SU4A 3L18A 4H16A 2IOFA 3HO6A 4LE0A 4BLQA 1ECJA 2Y93A 2M9MA 1EK0A 2FZ4A 4HP8A 3ANXA 5BYJA 5JJIA 3FB1A 3LC1O 3LFUA 2BEUA 4RSGA 3T9CA 1Q21A 4X66B 3U3XA 1TT7A 3ASZA 3H5WA 3AUFA 3GU3A 1XOIA 4IDPA 3GXOA 4PPNA 1QP8A 1JR3A 3LQ2A 4OA5A 2FW0A 3BYZA 1OAOC 2QIPA 4OYHA 4KSCA 4LE2A 5C1IA 3KWJA 1MIOB 2P4QA 3B2EA 3GQBB 5K8UA 3AR5A 1HEIA 3M4JA 1L5SA 3O74A 2FHPA 1QHGA 1A4UA 4TWAA 4Y1RA 3R7WA 2VQFB 2VRBA 4X6UA 3VKGA 1GKUB 1E6MA 4MVWA 4P8RA 5CFLA 4GLJA 2BI8A 3OZVA 1YTUA 1T2EA 4GSKA 3ZKWB 2J5XA 3LUJA 2WKSA 4L9SA 2B8EA 4U63A 2J9GA 2FWRA 3OJFA 5KX5B 5FAKA 1NG1A 2J59A 2AGVA 2I99A 2TS1A 3WDMA 3RRNA 1LFDB 1HDGO 3R23A 4CL2A 5TRTA 2ZXEA 3FRIA 3LPMA 2B6HA 2JFBA 4M37A 4R9RA 4ZAFA 4AZ0B 1M1YE 1H93A 4WESB 2QEQA 1K8RA 4AS3A 1C7FA 4M46A 1T6ZA 3EIHA 4BMOB 1E2LA 4XPIA 3HXTA 3QWIA 1UXJA 1X92A 2ZBQA 3IV9A 4BP3A 1JJAA 2J9FA 4OGLA 1XRNA 5KOJB 2WKPA 4M0KA 2B7CA 1GU7A 3IT0A 2W8ZA 2YNMC 4L8FA 1P81A 4AX4A 3V97A 3D2AA 1GILA 4ZV4A 4IJQA 4M38A 3AJEA 3EXFA 2G1JA 4IO1A 1ZDMA 3FDIA 3NWOA 1QANA 3Q3CA 1VCHA 1TQ2A 4WBNA 3DF9A 4BYGA 4X0EA 3BGIA 1OA1A 2H5JA 4KXUA 1JKXA 2HEGA 2GEFA 5J2UB 1AK2A 1NF9A 2DHRA 4GQIA 1OMOA 1EDZA 1VYVA 3I4CA 5HHTA 1US8B 1KZ7B 1JVNA 2D1QA 1KE1A 3AF4A 3DDWA 1Q95A 2VKTA 2QZZA 3VMMA 1Z8DA 1BD4A 3B9PA 4KGZA 1HSOA 4D8XA 1GTL1 1JMKC 4E5SA 1U7OA 1DCKA 4NXMB 2XQIA 3OETA 4MHTA 1GPMA 1Q91A 2HL6A 3DLBA 3I4FA 4HQNA 1I0LA 2CXPA 1T0HB 2BSXA 3ZDAA 3ZY2A 3DM9B 1P1JA 1CR2A 1TCAA 1ZR4A 2BI4A 5LYJB 3FUVA 1KHHA 4QODA 3B51X 1UIRA 2XVXA 3DBHB 1C7ZA 4OUDB 4AJIA 1EE1A 1B73A 1LSOA 1BEEA 3C7AA 5CH8A 1ADBA 1YDHA 5FBRB 1RHKA 3FPJA 4FHFA 1CS0B 4I7EA 2W8BB 3BTVA 5CLJA 3O8CA 1Q7GA 2UZAA 4S05A 1JIXA 3NHZA 1P0CA 3WRYA 1SEVA 2QMHA 3UAXA 2POQX 1OV4A 1V16B 5B58C 4I14A 3ZZMA 2PWZA 1QCDA 1A7JA 4WCFB 4MI6A 5IUNC 3BMXA 3BFJA 5EKDA 2VTBA 3RHTA 4IEFB 4PPYA 3TLEA 4PM4A 3KPYA 3DMTA 4F8JA 1O94A 2EX1A 1IQUA 1CRWG 3CLRD 1A9XB 4DSTA 3BS4A 4J0IA 1K3UB 1VE7A 1XAJA 3WC4A 4DRXB 1D5CA 4E07A 3FWHA 4DF3A 2QRLA 3MMXA 4BLPA 1QHNA 1MGOA 3AFHA 5EIOA 3WJAA 5KVVA 3G5AA 1VBKA 3L07A 5JYEA 3HCWA 4MV5A 4F9EA 4JJGA 1MTOA 4QNNA 2OQIA 3NAGA 1RACA 1HDYA 3PKIA 2QLJA 2YCLA 4RABA 3H3XA 4XDHA 3U1TA 2F2TA 1PR3A 4EJMA 2VZ9A 3LT2A 3ENVA 4BNDA 3OAAA 2B3DA 1G9SA 1NBME 1UFVA 3PX3A 4P4SA 2CZCA 1UAYA 2BI7A 1NC1A 2VA8A 2WYUA 2QNBA 3GLKA 4P5EA 3MT9A 4DTCA 3CVYA 4YO7A 1TAUA 1YKSA 5F9HA 1IOWA 1FDRA 1NVKA 5LUBA 1VLQA 1H1LB 5AW8A 1I51A 1M2OB 3HJCA 4H7EA 3V48A 1JR3E 4G5XA 2CYCA 5ARBA 3VNRA 4E13A 1VI5A 4N76A 1Z2EA 3VR5H 1FTYA 1O6BA 2LV8A 3OPYI 4X45A 1SY7A 1N33B 3B2QA 4Z8XA 1N77A 1VMEA 3SC2A 5CEFA 4FIZA 1Z75A 2WFLB 1UWCA 2B35A 3A6ZA 3OPNA 4GW3A 3RRFA 2HK6A 3K53A 3A06A 1CY4A 1GNPA 2ANBA 4NMXB 1Q7EA 1MX3A 3SHQA 3U80A 4CEIA 3IOEA 5ALXA 1Z3IX 1FP1D 1T1RA 1TE2A 2GXQA 4M21A 4XWYA 3H8JA 4BC0A 4EG0A 4WJLA 1CVIA 3OIWA 4CLOB 3JD2A 4DRZA 3A4MA 4RACA 5F5LA 3C4QA 4Z86A 2DECA 3ZGVA 2IHYA 4GRIA 1O7JA 2VAMA 1YS1X 3CLSD 1YL5A 2CSUA 2J3HA 4XVQA 3QE3A 3WNZA 4Y2PA 1Q1GA 1X80B 4OIMA 1KMMA 4LBVA 1I2BA 1LSUA 2H4YA 4HADA 1TFRA 1C3LA 4P6VF 5I7AA 4FU0A 5AW7A 1MTZA 2PMKA 3OZRA 4DVJA 3OM0A 1W2HA 2R6ZA 3VPDA 4JBHA 4EJ2A 1R0ZA 2GBCA 3K5WA 3FETA 5ED4A 5D01A 5C1OA 4G1CA 2HIGA 4GDMA 3HP1A 3MTBA 1GDHA 5FQOA 4QPJC 4JL6A 3TR5A 2QTLA 1DXYA 2ZM5A 1SVSA 1XJCA 4Z9XA 3GJ4A 1KYZA 1G5IA 3CZQA 4MMYB 2TMGA 1USUA 2I3BA 1TO2E 1K6XA 1KSFX 2WMOB 2FJPA 4B83A 4COKA 3ZY3A 2E5FA 3O8DA 2B8NA 4NBNA 3B53X 1U5AA 3PHLA 5TSDA 1P9OA 2IEAA 4R83A 4GP7A 1Z5UA 2VJPA 2PZMA 4PX9A 3L7IA 2FW6A 3RIGA 3H0KA 1DIHA 4R1UA 2Q1SA 3NFRA 4Q6WA 1KDTA 4DOMA 5I7EA 1SHZA 2WIJA 3CU5A 4AJEA 1Z08A 4Y6LA 5CVEA 1K27A 3OVMA 3QHAA 5FOQA 5LL6P 3JTEA 3TSZA 3TTSA 1J9EA 4DLAA 2JIQA 3LYUA 4U3JB 1T2NA 1D04A 3PE4A 3VR2A 4YCAA 3R9XA 4IDDA 4D6PA 1QO7A 1Q92A 1V6AA 1NOJA 4LV5B 2WUGA 4KVZA 2UZ1A 3FKJA 3N5KA 1WR8A 1S2MA 3ORQA 4FZJA 4HWRA 5ALMA 1J5EB 1X0VA 3PYMA 5I7VA 4UBNA 4LGVA 2J3JA 2JARA 5BY2A 1PWEA 1SBTA 1QS0A 4BKUA 1NL3A 4RO0A 1NF2A 3PCXA 1PEYA 4TVBA 2FR8C 5CG1A 8GPBA 1WF6A 4GXQA 4XD7A 4O02B 4DCPA 5CCXA 3OHPA 1HT3A 3TIIA 5BR8B 1PV2A 4U7FA 3HV0A 4LPKA 3HXPA 5FT9A 1UT6A 3D6AA 4Q4CA 3H2YA 1UF9A 4FE3A 5C7IO 2FPMA 1N34B 1Z5OA 4IXNA 1X0XA 1QPBA 2CLCX 4W7IA 4MGEA 1VSQA 3T0GA 3AKEA 1PFWA 3OPXA 3IVCA 4H7JA 4MWDA 4R5MA 2JAQA 5A5DA 4DPLA 2EWWA 1IXSB 4M8IA 3QBTA 1Z37A 2A9KA 3O82A 4TQAA 4XOIA 4EF5A 4DR5B 1YKFA 2JRLA 2HSDA 4UEOA 3LY8A 4HGQA 4Y6RA 2BGUA 1SXJC 1FOEB 1MV5A 1Y48E 3HJUA 2OCAA 3MJ4A 5AWFC 3DP9A 3S7ZA 1BXGB 1KR5A 3MRSA 3UMFA 4UHBA 3ZD8A 1DAIA 4M1MA 2GYVA 4TWRA 1P1KA 4MI3A 1JAHA 3LZDA 3SG0A 4Y2XA 4M1KA 4YH1A 3TNYA 3MWDB 3G0CA 4RFVA 3Q9SA 1XT6A 4HGRA 3X1JA 5E3HA 2X6TA 2RGGA 4ONEA 5B6JA 3CG4A 4XSVA 5BNWA 3IEXA 1NM5C 4HDKA 3L0CA 4R2IA 2AWNA 1WMDA 4CMHA 4BO5A 3IBTA 2ZZKA 2NPFA 1R5JA 4QHTA 3EIXA 4FGWA 4ZOBA 1IUKA 2R6HA 4FCTA 1DO0A 1OWNA 4I81A 4Q93A 2YQ5A 2X9NA 4MVCA 1ZITA 2GZHA 2REXB 4XWAA 4E14A 2C7BA 2XDQA 2ZZMA 4D9CA 4YPOA 2I3DA 1RPZA 4ZYLA 4I4TA 1YA8A 2JGJA 1K8YB 4KO8A 3HVJA 3N39C 5IDWA 1JFSA 3WE7A 3FHTA 1COWD 1W5EA 4AAYA 3M89A 1UP7A 4FPXA 1XEAA 1DX4A 1GGFA 3I3OA 1MA0A 2NO5A 3U56A 4RQAA 5EN4A 3LMKA 3GGJA 4PNEA 4UNNA 2C78A 1GR1A 4M1SA 1SC1A 2C99A 1NIJA 3BCUA 4LOKA 4ND5A 4PQGA 2ZSHA 5AJTA 5P21A 3W9SA 5KWJA 3B60A 5CCEA 3LBHA 4PZ9A 4HNSA 1K08A 1F4VA 1C30A 5CEEA 4R8VA 3UHPA 4ASUD 4PLZA 1G6Q1 4D3XA 3MS7A 4G8CA 1RWVA 2VH5R 3PIDA 4O4JA 4YK7A 2X42A 3ZDEA 4KV9A 1G7CA 1V8OA 2R84A 3K30A 4BO9A 1S8OA 4S1PA 1GL9B 3BXOA 1YMVA 1YVRA 1U9CA 1RTKA 3C7TA 3IBYA 3QMMA 4OD0A 5LVAA 2WTXA 3D7LA 2R3SA 4PRKA 3RD5A 2A78A 5I8WA 4CEHA 1VG8A 4Q9LA 1F3LA 2JGRA 3CUUA 2NO7A 3C4VA 1Y33E 3FNHA 4ADSG 4GLOA 4IIDA 2EC5A 4MVJI 5DW3A 4TRJA 3P2OA 2FLVA 3G8BA 2PSSA 4OI4A 2AW3A 2VQDA 2XMGA 3V8QA 1UT8A 3LLVA 4W5OA 1HNXB 1GGMA 3WKAA 4M9SA 4OYYA 4LAFA 2M6KA 1LK5A 5I47A 1EXVA 5HMMA 4L8LA 4DDMA 1MUUA 4DIEA 1CUHA 3CLTC 1H3EA 1EAMA 2JVKA 1NP6A 2X8LA 3E1KA 4YXWD 1X9GA 2VUHB 3FOAA 2F8LA 5GOTA 4CGYA 2JI8A 2NVWA 4GMKA 3PC4A 3D7KA 4PHGA 1SHKA 4LGCA 2DRIA 4RLQA 4ARBA 3A04A 1O5IA 3DT8A 1N4DA 3NLLA 4G0ZA 4MRRA 3ZXUB 1HDEA 1ZVVA 2ODPA 2XVAA 5B5SA 3WOHA 3K6SB 1U31A 5JE8A 3DBIA 3IV7A 2F8TA 1G8FA 3SF0A 2XLBA 3L8DA 3ZDRA 1L5ZA 3PYXA 4GE3A 4MTCA 1V37A 1XN4A 4NDNE 3WS7A 1NMXA 2I4TA 4MLZA 3V1TC 2JHGA 1SVWA 4MUNA 1RAHA 1S2IA 3EZGA 1D2RA 4LHZA 4TV9B 2QDKA 5ARDA 3T5PA 4X60A 3SVLA 1BW9B 3F2VA 1L6IA 1VE5A 4DYDA 2QD5A 4EY8A 1RP1A 3QHQA 4I1YA 4OGKA 5JAHA 3ZWWA 1U2DA 1ZK0A 2I1LA 3K0SA 5IAOA 2IV2X 1Y6ZA 2H2DA 2WMNB 3MJTA 4BX3A 1DC7A 1EIWA 1O2DA 3T6KA 1D0SA 1LWOA 1N5JA 3G2LA 1DDGA 2Y27A 1EHYA 1Y8QA 2VT2A 2YVKA 4LDPA 1QUEA 2XPCA 4YGXB 3HCCA 1ADCA 3L0YA 5KHAA 5FUQA 1MQ8B 1C29B 4F1KA 1B16A 3G2NA 4IUDS 1WCV1 1Z15A 3O2NA 5E1DA 3WBBA 4HT3B 4R1LA 1PL8A 1P0PA 2A9PA 4IINA 4NK4A 3VU9B 1HQYE 4I55F 1KAQA 3B9QA 2I55A 4QRHA 3PFBA 3ZD7A 3EAFA 2IXBA 2V4MA 4IOJA 3H4IA 1M8KA 2MSEB 3HO8A 3QLUA 4TMYA 4Y7CA 3CUKA 4KODA 5F1PA 3EBPA 3RSQA 5B6PA 2VHZA 2Y1XA 1YR1A 2JBAA 4RFLA 4CKEA 1XPUA 3H0EA 3PXCX 1J2YA 3IP7A 3QMVA 4C0AC 2H8KA 4OQ4A 5L3QA 1CJBA 3FPLA 4HLUA 3ILXA 5AOCA 4D5EA 1L5HB 1MJGA 3U17A 1Y81A 3T7RA 1DQYA 2Y9MB 1KQPA 3DB1A 1T5TA 4EYKA 1DO8A 3TLKA 3B1WA 5CLHA 3L1HA 3RARA 4CLDA 5THQA 1FDTA 5IVHA 4MR9A 1RZ3A 3T1YB 5BUCA 5KIAA 4TM7A 4JVOA 1FMTA 1GPBA 1N3LA 1GCAA 4RKYA