4ITUA

Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s-hpcdh) bound to s-hpc and nadh
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
253
structure length
253
Chain Sequence
NRLKNEVIAITGGGAGIGLAIASAALREGAKVALIDLDQGLAERSAAMLSTGGAVAKGFGADVTKAADITAAITSAEQTIGSLTGLVNNAGIAGFGSVHDADAAAWDRIMAVNVTGTFLASKAALAGMLERHKGTIVNFGSVAGLVGIPTMAAYCAAKGAIVNLTRQMAADYSGRGVRVNAVCPGTVTSTGMGQQLLGSDTSPEVQARRLAKYPIGRFGTPEDIAEAVIFLLSDQAAFVTGAAFAVDGGMTAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of S-HPCDH reveal determinants of stereospecificity for R- and S-hydroxypropyl-coenzyme M dehydrogenases.
pubmed doi rcsb
source organism Xanthobacter autotrophicus
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
total genus 90
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ituA00
3I6IA 3HDHA 1U3TA 1NQAO 2B4RO 3G1TA 3RAJA 1LSUA 1JU9A 1GL3A 4YWJA 5L95A 3KLMX 5BSGA 1A7AA 1EZ4A 1FDUA 2UYYA 2WTBA 1PTJA 1ENZA 1HSOA 1P0FA 4GX2A 1H6AA 1SO8A 4RQUA 3HDQA 3PHLA 3QWIA 1N5DA 1SZJG 5DBFA 5KTKA 3VZPA 3FBGA 4M49A 1H6CA 4MOWA 1DHTA 3F5SA 2DVMA 3AK4A 5JDIC 2Q4BA 5JO0A 1V35A 2YUTA 3EHEA 4U6QA 4FJ0A 3ENNA 5A4DA 4GX1A 4NBVA 3BMNB 3H5AA 4XWYA 3DZGA 3E82A 2Q4EA 2RBEA 4EUHA 2X4GA 3IUPA 1X7DA 2UUOA 1P33A 4Y9DA 2G82A 1JDJA 4R68A 4O6VA 3PYXA 2A35A 3FPLA 1NXQA 4J91A 2AG8A 1R4NB 4DWVA 1AUPA 3ZI0A 5KJ6A 4J1TA 1GUZA 2RIRA 1N1GA 3JQ9A 2HSDA 4CM8A 1B16A 1U4SA 4R3NA 1IHXA 1I3NA 3LK7A 1B3BA 3SJ7A 2YJZA 3OHSX 3F6YA 4BO6A 3AU9A 2CDAA 5JW6A 2O3QA 1X15A 4CV0A 4AJLA 4H16A 1HE4A 1OOEA 5J23A 1VI2A 1ZK1A 4Z3DA 5JDCC 4NU5A 1UH5A 2ZTVA 5K9ZA 4DQUA 1VKNA 4J1QA 2YFHA 4XR4A 5CG2A 4TVOA 3PGJA 5DP1A 1NPTO 4HX5A 1QYXA 3G1UA 3JQBA 2NVUB 4RL6A 4BB5A 4ZQGA 5ILGA 3PHHA 4LSWA 1DLIA 2HU2A 1WW8A 3OJLA 1HDRA 1JVBA 2HMWA 3KXDA 1HYGA 3OJOA 2GD1O 3HE3A 5A5FA 2EP5A 4GSKA 3KRTA 1NAIA 4OOFA 3HN2A 2O3TA 1KY4A 5CDGA 2Z5LA 2AEJA 3I6QA 2VWGA 4IS2A 1T2DA 4MVJI 3RD5A 4BV8A 1BDBA 5HS4A 4CM7A 5DT9A 3QWHA 2CD9A 4E30A 4EJ0A 4GGPA 4EITA 4TSKA 4RF3A 3WFIA 3QWBA 1P1KA 4XJSA 5ICMA 2QW8A 3OBBA 3GEDA 3NT2A 3AU8A 2VTEA 2VWHA 2DBVO 3MJCA 3ZU4A 2IEBA 2GN4A 1F8FA 2YQ4A 4MJLA 5EMHA 1IB6A 2PFGA 5JS6A 5EL0A 3QVOA 2E6UX 3EYWA 3KYCA 3DB2A 3OH8A 3MWDB 3COSA 3DOCA 4ZU3A 2Y0CA 4FFRA 2NVWA 1XGKA 3VH3A 1I10A 3GG9A 4PVCA 1KS9A 5JCJA 1OAAA 1P9LA 2JFHA 4AFNA 1GDHA 1IPFA 3GPIA 4CLHA 1D4FA 3L6EA 4A10A 3DBVO 1JAXA 1M66A 4MVJD 1EDOA 1PZFA 1XDWA 4J7UA 3VDRA 4E3ZA 1NHWA 4IQ8A 3KEQA 5EN4A 2H5LA 4IDBA 1GCUA 5K0ZA 3JQ7B 1KC1A 4RZIA 1EUCA 1BVRA 5IN5A 1PZHA 1SNYA 3P7MA 4JGBA 5HTOA 1RYEA 3OEWA 4BIIA 4CMCA 1YRLA 3HHPA 4CM8B 1H2BA 4J4TA 3TZ6A 1R4MA 1MV8A 1YOVB 2H9IA 4II3A 3GVHA 5JCJD 4IXTA 1NWHA 4JJIA 3I9JA 2P5YA 1XCBA 2CNBA 4L9RA 3W4IA 3SLKA 4QO7A 2VHXA 2DFDA 1B2LA 1PGOA 1SB8A 3W8FA 5ENVA 4W99A 3RCBA 1SOWA 3UUWA 4GX5A 5JSFA 1U3VA 2J8ZA 5L45A 2ZB4A 3S2EA 3JV7A 1EE2A 3HZZA 1GYQA 1D1SA 4OAQA 3QVTA 3A1NA 1AHHA 5C7LO 1PGPA 4A03A 2I3GA 4CM4B 4N5MA 1FXSA 3TSCA 2AE1A 4PG7A 1ZVMA 4QEDA 2ILTA 3PHJA 4FSHA 1BW9B 4MKZA 3ZWAA 2P4QA 5JO9A 1E3WA 4UUMA 2O2YA 1V8BA 3AOGA 4YRBA 5L51A 1P31A 4CL8A 1ULSA 3WGTA 2YY7A 1VM6A 4WUVA 2AA3A 2YHUA 2ZYDA 4H15A 2SCUA 4R16A 1ZJYA 3OIGA 3E9MA 2Y1CA 4J9VA 3O4RA 3ZNOA 1BDMA 2FZEA 5A9SB 1RYDA 2JAHA 4NJMB 2NLOA 2VHVA 1LUAA 2X6TA 2Y66A 3EK2A 3WS7A 2CVZA 3QIVA 4YAGA 1PL7A 2VRCA 4GAEA 4WLUA 3NJ4A 2GGSA 4O59O 3BZUA 3AUAA 3LT4A 4YRDA 3H2SA 1LLQA 3H9GA 1NQOA 1NWCA 4FFLA 4UULA 2FR0A 5B4UA 2Q45A 3GEMA 2F1KA 1FK8A 1T2AA 3I52A 4CLOA 2ET6A 1C1XB 2FR1A 3AW9A 4R1UA 3L4SO 4KP7A 3OFSA 1QG6A 5AXAA 4BNFA 3C24A 2C0CA 5TSDA 4A27A 3O38A 3JYQA 3PIIA 1B26A 2JFFA 3I83A 3MTGA 5IDXA 5EERA 6LDHA 4BQPA 5JDCA 2R00A 1EEHA 2PKRA 3ANLA 1U3WA 2GERA 5DOZA 3NV9A 1AGNA 1MG0A 4HUJA 2BF7A 1YDWA 4QQRA 4R1SA 3PGXA 4G2NA 3U62A 3FRJA 2HJRA 3GT0A 1SPXA 3U49A 5BT9A 4DVJA 3GHHA 4RCVA 3RBVA 3UF0A 3QVSA 3S2IA 4K28A 4PN3A 1IZ0A 1SC6A 1OC4A 5JLAA 1RM0A 3R3SA 1J5PA 4WLFA 4UUPA 4RLHA 1PS0A 2VQ3A 3E48A 4OQYA 3EVTA 5H82A 1HE3A 1O8CA 2E82A 1HF3A 4JCOA 4K9DA 4AJHA 2VWPA 3ONDA 1QSGA 5T57A 4CL3A 2YDXA 1UP4A 2I9PA 3K6JA 3NTOA 3ETDA 3FWZA 1S6YA 4RPHA 2EERA 3SBOA 2C5EA 2PA3A 4JNKA 4MPDA 3TL2A 1I30A 1I3KA 2LDXA 2NVBA 4OGWA 1PJ2A 5IXYA 5L40A 5EESA 3PI7A 3ONFA 1Z74A 5KIAA 4BNMA 1DAPA 4ND4A 4RF2A 3VPGA 2G1UA 2HMVA 4WLOA 1R0SA 1CYDA 4IDEA 4P4GA 2HQ1A 3T4XA 3VZRA 4D43A 4ZVVA 1WVGA 2PZMA 4W4TA 3M2TA 5U9CA 2H1SA 2YV1A 3BMCB 1LX6A 3FNGA 5DDIP 5A5EA 5A3VA 1DC6A 3B1FA 5HRUA 4IINA 2O48X 1Q7BA 2J3JA 4RVFA 1ORRA 1RKXA 3G49A 2Z1NA 4TZKA 2HK9A 1KEPA 2C07A 1DIBA 4RDIA 1WZIA 1C3VA 4WKGA 1PX0A 4LVUA 4LN1A 4BNIA 3AOEA 2A92A 3ONEA 4J3FA 5C7IO 5BNTA 1GD1O 2WWRA 3GRPA 5FFFA 4BNYA 5IN4A 9LDBA 2PH5A 1LLDA 1C1DB 1XWFA 2WD7B 3E03A 4R4JA 4XB1A 5JCXA 4JX8A 3UCFA 1BMDA 2Y0EA 3ITDA 2DLDA 1ONNA 4U7WA 3GAZA 1EUDA 1GADO 1DAOA 3DHYA 2GF2A 1BWSA 1QKIA 3JQGB 4F6CA 3IAHA 1YBVA 4NPCA 3AM5A 4KTTE 1HT0A 2UV8A 2C59A 4J9UE 1HEUA 3WNVA 2Y1DA 1GPDG 4RF5A 3F1LA 4H3VA 2YDYA 3I4CA 3JCZA 1I32A 2C29D 3ASUA 5HA5A 3W1VA 4GX0A 4BNZA 4TMFA 4XZ3A 4OM8A 1Z73A 2PGLA 3D4OA 4R9RA 4Z6KA 4PLGA 1E77A 5CPBA 4BNVA 1NPYA 4PG4A 4DQVA 3T7EA 2O7QA 2PD4A 3GNSA 3JSAA 4ND5A 3QRWA 3INRA 3INGA 1VLLA 5K6AC 2JHFA 3ADPA 2WYVA 4JJFA 5JY6A 1J4AA 3RBZA 4B4VA 2O7SA 1JTVA 4WCDA 5HWSA 3U4DA 4BO3A 3PZRA 4FCCA 1Z6ZA 3EGOA 4QO8A 5HBRA 3Q3CA 1PJSA 1U4OA 3BMQA 1DC5A 1ZMOA 1ONOA 5A03A 2PZJA 1G0OA 3VPSA 3X2FA 4J4HA 3SC4A 4URFA 4B7XA 3ZHBA 3WNQA 1FMCA 4LCEA 3MOGA 3GRKA 4QSMA 1OFGA 2JD1A 3CINA 5TJHA 1NVGA 5JPIA 4DGSA 3I4FA 1XQ6A 3ZWVA 1GQYA 3T4EA 1PU2A 1QYDA 5C3MA 1DOHA 3GNQA 4NFHA 3RC9A 5IF3A 1VE9A 5F3RA 3R6DA 1NYTA 1A71A 2VZ8A 4G81A 4XYEA 2BD0A 4AJJA 4E21A 4PLFA 4D0RA 1VJTA 2D59A 4Z9FA 3JQBC 3IMFA 3VAZA 5HS6A 2GZ2A 4U0KA 3TFQA 4CMIA 2XXBA 4FW8A 2AMFA 4KMSA 1ZK0A 4Y6SA 4C7KA 4EI2A 3G17A 2VYVA 4CQLB 3DEYX 1KIFA 1PZEA 1IHYA 2HUNA 3EVNA 1UDBA 1LQUA 1PS8A 4UREA 2EEZA 1ZEJA 4KQXA 4RO0A 3V2UA 3GAFA 1IY8A 1UXIA 1UAGA 3R1IA 3ZV4A 5TGDA 3JQFA 2X5JO 3Q9UA 3DMTA 3ENKA 5A02A 1A72A 1VL6A 4RDHA 1ZIDA 4QECA 4E13A 3P2OA 4DC1A 3TL3A 1Z7BA 2DU8A 1DRUA 1E3IA 4BKRA 2J3KA 2OGUA 3TQHA 4CM5A 1H6DA 1SBYA 3ZH2A 2AQ8A 4RVUA 3DBRA 3FN4A 3WDSA 1P0CA 1YQGA 2BH9A 2Q2WA 4MP3A 2VYVD 3GOHA 4RLSA 1J0XO 3CH6A 1TA4A 1MFZA 3DL2A 5U4QA 1MA0A 3GGGA 3TDKA 3BTVA 5JNLA 1K3TA 1Z45A 1UXGA 3HFGA 1ADFA 4YTEA 4HFJA 4Q39A 3ROKA 4E6PA 4UVHA 1WP4A 3GY0A 3L6DA 1VC2A 3R0IA 3WIEA 2WSBA 4XR9A 2Y99A 4BNTA 5ILOA 1DLJA 4J0FA 2AW5A 3LT1A 1PS9A 1PGNA 5H81A 5L7YA 4PIVA 4RPKA 3HN7A 7MDHA 4PFJA 1QYVA 1ZUD1 2DTXA 4KUHA 1HKUA 3DR3A 4RZHA 3H8VA 3UHAA 2GRAA 1P1FA 3OP4A 5C37A 1O95A 1Q7CA 5T6BA 1Y1PA 4Q3NA 4PLWA 4D44A 2ZQZA 1NFRA 4FD3A 4Z9YA 1W6UA 1UXJA 2X0IA 3V5NA 2C2YA 1I36A 3HSKA 4JN6B 5JMPA 5DBGA 4D3SA 1VL8A 4ZRMA 4A73A 3I3OA 3DO5A 1BXGA 1CWUA 2CMDA 2NUAA 4I08A 4L8VA 4TZTA 1P45A 4CLOB 2VUUA 3WIDA 1X14A 2FSSA 3MEQA 1QYCA 1BXKA 2PGDA 4J43A 1ID1A 1H2HA 5IDQA 3GGOA 2EXXA 5ITWA 2VOJA 2D3TA 5G0UA 2CUKA 2D2IA 3IJPA 4DPKA 3GZ4A 1IUKA 5TS3A 2ZJ0A 1GR0A 4MVJH 1T4BA 1E3WB 4DLAA 1PJLA 4FQ8A 1WAMA 1LDGA 2PR2A 2DPGA 3WR5A 3TWOA 2CVQA 2YZ7A 2DBRA 4LCJA 4I5DA 1YQXA 2BFAA 1E6UA 5BNIA 2WE8A 3NDIA 3B70A 3S8MA 2VZ0A 3OF2A 1ZJZA 1KVTA 5IAAA 1ZK4A 5I9MA 3RUAA 1PQWA 4PCVA 4B3IA 2QIOA 1E7RA 4BO8A 4Q9NA 5B37A 3RI3A 5TJ9A 3ZW8A 3RC1A 2B5WA 3AY7A 2GLXA 4LRSB 4D3DA 1NTOA 3O03A 3UOGA 2AQIA 2ZTUA 1I01A 1B15A 3WX0A 1YXMA 2Z95A 3QQPA 5G4LA 2A94A 2OFPA 3BA1A 3GN2A 3LT0A 4XCVA 3NRCA 4YJDA 5I7EA 2NU6A 5KVCA 2Y1EA 4BO2A 3MJEA 1X13A 4WLNA 4CM6A 1GUYA 2B4QA 4BB6A 2DKNA 2FWMX 3K30A 4J2OA 4M55A 1YWGO 3KEOA 1F12A 4ALNA 3BTSA 4IPTA 1M6WA 5L4LA 3LQFA 1I2ZA 3QJ5A 8ADHA 2HK7A 1SAYA 3VPHA 2O3SA 3NDRA 4KUGA 1BW9A 1RM4A 1XHLA 2Q49A 5C5IA 1LDBA 4IIVA 4OXKA 1U2GA 1P44A 1ENPA 4XB2A 3MCVA 1IL0A 3NTRA 3UGKA 4D41A 1VL0A 3CXRA 4ND1A 1Z75A 5KVSA 1R0KA 3W4JA 1MX3A 1NP3A 2AQKA 2P9CA 2Q46A 3E9QA 1PWXA 4R5HA 5COAA 3I23A 5DF1A 1PJ4A 2CDBA 4IQ0A 4YJGB 1PL6A 5EQDA 1O89A 1Q0HA 4MIOA 5KJFA 3Q11A 2RHRA 3BHJA 4WGGA 4IDFA 3ZWWA 4OXNA 4GPD1 4JQCA 5FI3A 1QXSA 3K92A 2QQ5A 4OKNA 1BXGB 4QTZA 2HRBA 1E5QA 3AOEC 3GMDA 3ZWBA 4XA8A 3PVZA 3UW3A 3JQGA 3B6ZA 4FGSA 5B4VA 3FPCA 3N74A 3RC2A 5JAIA 1KVSA 3WICA 5GMOA 4WNIA 3F3SA 3ZHXA 2I65A 4BL5A 5DP2A 3GUYA 4UUNA 2W2LA 5DCWA 3K2BA 3DBHB 3IJRA 4B3JA 5CDTA 3V2GA 2O4UX 1HZZA 4WJZA 3QP9A 5KCZA 4U8GA 3VH4A 4ILKA 5G0WA 3H6KA 5JE8A 4BGEA 5BSFA 4YR9A 3GR6A 1EVJA 3BMOA 3GVPA 3TFOA 1WWKA 3PDUA 4OKIA 4F45A 1K6JA 1E3JA 3GK3A 5L7WA 2NQTA 1VPDA 2O4CA 3M1LA 5I8ZA 3L07A 1XR3A 1SMKA 2PY6A 3GH3A 2ZB8A 4ALKA 3E5RA 4DIOA 4A0SA 2CDCA 1WZEA 2GN9A 3H9JA 2OOSA 4AJKA 2C54A 3V1UA 1GPJA 2P5UA 4PLPA 2W2LD 1ZK3A 1JKIA 3NJ8A 4L4RA 3NAQA 4BS9A 4YPOA 2NU9A 1IYZA 4CM1A 4FC6A 4XD2A 3VPFA 5EINA 4D0SA 4PG8A 3PLNA 1ONPA 3O8QA 1JLLA 2NADA 3DTTA 4TVBA 1UDAA 3BHIA 1CEQA 3U0BA 3DZHA 3ZHZA 4N7RA 1DC3A 1HSZA 1K2WA 1E3SA 4Q3EA 3STHA 3DZKA 1NR7A 5ENDA 1JA9A 3NUGA 4DPLA 4RORA 2Q3EA 1HWYA 1L1FA 4BKQA 1MG5A 2J5RA 1QRRA 4CV3A 1XA0A 2QRJA 3H4VA 1B7GO 3JQFC 2E4AA 3QY9A 4J1NA 1DJNA 3WTCA 4NBUA 1HETA 5FI5A 2W2KA 2B36A 1Y5MA 1M67A 5THKA 2UUPA 1Y8RB 3TF5A 1YONA 1S7CA 4YQZA 4EJMA 1T25A 3PWSA 1SEVA 1C0IA 4BGUA 1EK6A 4GMGA 4IDAA 1T1RA 4I5FA 2E48A 3QV1A 4IZIA 4E5YA 1DFGA 1NPDA 4OJNA 2X86A 4CUJA 4YA6A 3P2YA 4BMSA 3A9WA 4IXWA 5LC1A 1YS4A 3BXXA 4IJUA 2OL4A 3R3JA 4HP8A 4XDZA 1FJHA 2IDZA 3JQ7A 1L7EA 4KWIA 4N18A 2NTVA 4ZJUA 2I99A 2TMGA 4YT8A 3JQ9C 4HFRA 3QE3A 2R2GA 2YW9A 1C1DA 5B1YA 1KYQA 4DIFA 2CZCA 1IPEA 2PWZA 1Y81A 1Z7EA 3NKLA 1SEPA 4ZQBA 3ZNNA 4BUCA 1I8TA 1ZSVA 4DMMA 1DO8A 3TRIA 4CJXA 3DMYA 1I5RA 4DL9A 4QX6A 3GLQA 2VYNA 3UN1A 2X7HA 4FGWA 1JQBA 3JD2A 4N5LA 2BRUA 1JW9B 4RGBA 5T64A 1V0JA 2IYPA 3IDSA 1U8FO 2V6FA 3PQFA 3U4IA 1XIVA 2W4QA 4I9UA 4ZD6A 4MP8A 2BELA 4NFSA 1PZGA 1ZW1A 2EJVA 3MJTA 3WJ7A 5MDHA 3GHYA 3O9ZA 4YJFA 3ICPA 5IXSA 3BIOA 5JC1A 4WCFC 1F17A 1CF2O 1GFSA 2WYWA 3MWEB 3FD8A 4FFPA 4NI5A 4NJOA 1LQTA 2HRZA 4KUEA 2JCVA 2WE7A 4CMHA 1XU7A 3PJFA 3RKUA 3ETEA 5JAQA 4RF4A 2FN7A 2D4AA 1DB3A 3O8QB 1WMBA 4XYMA 4FOOA 1NR1A 2EF1A 3U4HA 3E18A 2P9GA 4GVXA 2I6TA 4MIEA 4YB8A 3V1YA 3WGGA 4GBJA 2EGGA 4PZCA 5JAZA 1EQ2A 4XKJA 1DEHA 3GG2A 4Y6PA 1UDCA 3D5TA 2BFPA 5JC8A 4XQ9A 1F14A 1R4MB 1YOVA 4EJ6A 1DPGA 3OJ0A 3IP3A 4FIZA 1ADCA 1E6EA 4IGFA 4TROA 4BMNA 1KEVA 1NQTA 1WDMA 1HLDA 1E0DA 1A4UA 4WASA 5CDYA 2B0JA 2NWQA 2DC1A 1E1NA 1T1SA 5IDWA 3ZWXA 2VHWA 1JKJA 2GO1A 4XYGA 1EUZA 4LVCA 5B12A 2A9FA 2UAGA 4MKXA 3PTZA 1NX6A 1P74A 1GAEO 1KVQA 4AJ2A 1PJ3A 4L73A 4W7IA 1Y9EA 3Q2IA 4Z0HO 3KYDB 5THQA 1ZO8A 2H63A 4H7PA 3RFVA 3U3XA 3L77A 1JN0A 4PG6A 4KDFA 4CMIB 3EUWA 4MKRA 3JD4A 2PD3A 3GN1A 3RFXA 4L4SA 5TX7A 1Y8QB 3EY4A 5I7SA 3IUSA 3H9EO 4DYDA 5U1PA 2FR8A 2FPGA 2OZPA 4OL9A 5L53A 1YO6A 2DBQA 2ZYAA 4AJ4A 3MJVA 3KSUA 4HV4A 2GZ3A 1KC3A 3HQ4O 1YB1A 2H6EA 4ZN6A 2AHRA 3EZLA 1HDGO 4DQXA 5B4TA 4J4BA 3BTUA 4ALMA 4J49A 1X0VA 2W98A 4LGVA 4CR6A 5KJ1A 1CJCA 1DIHA 1I33A 4NIMA 4E12A 3RVDA 2GSDA 3H9QA 1C0KA 1Y6JA 4OMUA 3U09A 3OJEA 4B4OA 4OH1A 4ZA2A 3DFUA 1JKFA 3C1OA 3FI9A 1B14A 3GZNA 3UXYA 3VVBA 4F3YA 4RVGA 3LC2O 4TRRA 1PGJA 1NAHA 3S55A 1U5AA 1UXKA 4ZQHA 1DRWA 3LLVA 2FOIA 2OP1A 4KTVE 4L76A 1RPNA 3IKVA 3KOUA 3L9WA 1WPQA 1VJ1A 2Y68A 1K0UA 2GUGA 1MXHA 1GUFA 3HG7A 1CQJA 1JAYA 4UVDA 3ANMA 1KERA 2VOEA 3ROMA 2O3RA 1N2SA 3VKUA 4M1QA 2HMUA 1DC4A 1HLPA 2ZTMA 5TF4A 4U6SA 4I1IA 2X9VA 3M6IA 1B8UA 1DFIA 4LRTB 4BNWA 2PKQP 4GL4A 3CMMA 5TRTA 4XRGA 1YB5A 3GFGA 3K96A 4CLXA 1ZSNA 4QT0A 4ITUA 3WSWA 4JXKA 2G0TA 3NGLA 2NSDA 3PWZA 3ZV5A 1N7HA 4I5GA 3OIDA 1I3MA 4W9NA 2FPIA 3PDJA 4M86A 3GMSA 4BVAA 1YBMA 4FJ2A 2P2SA 1RM5A 3DZBA 4PZEA 2EG9A 3P5SA 1HYEA 3P19A 2RCYA 1B8VA 1XLTA 4XEHA 1GZ6A 1YB4A 5IZCC 5DULA 4RJTA 5IZ4A 3RUCA 1NM5A 3DTYA 4OO3A 3NT5A 4NU6A 5TIIA 1A5ZA 2DT5A 3ZHYA 2Y1GA 4J0EA 4N5NA 4CR8A 4K6FA 4YAJA 4CM4A 3ZWPA 4E2ZA 1NVMB 2OP0A 4DYVA 1R37A 1E3LA 4DXHA 1N7GA 2IE0A 3SLGA 1ISMA 2IEDA 3IL2A 1CETA 3WJAA 4PLTA 2PKQO 5BQFA 4R41A 4FS3A 4BO1A 4YDRA 3ZDFA 4GLOA 1NQ5A 1FF9A 1AXEA 3GC6A 3DBLB 5IZCA 4OSPA 4P38A 3JQDA 1Z82A 3ITKA 2HMSA 3LF2A 1Y8QA 4NG5A 2Y1FA 3U9LA 2V65A 2OO5A 3H3JA 2VYND 4ALJA 4DBZA 4R3WA 3E8XA 4TRNA 3CIFA 3ZCXA 3AM4A 2Y1OA 1CIVA 1MC5A 1BG6A 4G5HA 4GWGA 2X22A 3F5QA 1N1EA 1ZZEA 3FHLA 3GZNB 1EQUA 1WDLA 4BNJA 4A7PA 5G2OA 4O1MA 5CDSA 4ZHSA 2YHIA 3JQAA 4J90A 5TT1A 2IXBA 3JD0A 4WOKA 1EK5A 1B8PA 1N92A 5CEJA 4CMGA 1KBZA 2OXIA 2GZ1A 4P4NA 4R01A 4DREA 5BSHA 3KBOA 2X0JA 2B69A 3WWYA 1WDKA 3WYEA 3TJRA 3CKYA 2PLAA 3NDJA 3VPXA 3SJUA 3WGIA 1CQIA 5EIOA 3ZWYA 3L4BA 2WMDA 4W7HA 5FYDA 3AI2A 4RV9A 2OUIA 4JP3A 4ONEA 3Q2KA 1EVZA 1X0XA 3ORFA 1E7WA 5IJZA 4M89A 3LVFO 4W82A 4E32A 3A28A 3K9QO 2EWMA 4HKTA 4Z9XA 2BGMA 1C14A 3UH1A 5IFLA 1JVSA 3K2EA 2OMEA 3DAGA 3OJFA 2FPPA 5F1KA 4RPGA 2DPHA 2VN8A 1EMDA 2Q1WA 1K6XA 1QR6A 2Q1UA 3W8DA 2IZ1A 2V6MA 3PYMA 1PR3A 2QG4A 4Q3DA 1E7YA 1H6BA 3WTBA 2AEMA 2UVDA 5EQFA 4MIYA 1E1KA 4EGFA 4F6LA 3VH1A 4MP6A 5JY1A 3HUDA 1LC0A 4CR7A 1TXGA 1IZ9A 2YHIB 1YQDA 3I9OA 5AXCA 3WGQA 1HRDA 3A06A 3WGOA 3D7LA 3H65A 4YCAA 3CPSA 2JJYA 1Q2XA 3GUCA 1JWBB 1RWBA 2Y0DA 3TPCA 3F47A 3B1KA 5DNAA 4FBGA 1E3EA 5IG2A 1B0AA 2VT3A 1YJ8A 3QVXA 2UDPA 4NR0A 4P22A 2B5VA 4HXYA 1WNTA 2VZ9A 4IMPA 3B20A 2FHSA 3H5RA 2RH4A 2X8LA 3PK0A 3VDQA 3HDYA 2P68A 5L4NA 3I5MA 4L0QA 4BNKA 2P4HX 3MJ4A 3C7DB 3RC7A 3TZKA 2VRBA 2NTNA 1ZFNA 3QWAA 4XYBA 2EW8A 1PJTA 1HDCA 2OBYA 1ISGA 2LDBA 4HNHA 2NV6A 3AY6A 1GEEA 1AN9A 4FB5A 4NJMA 3E6AA 4UEOA 3WSVA 4XQGA 2HAEA 3FTNA 2VHYA 3KUXA 1PWZA 4EEZA 1X1TA 4EBFA 5BSEA 1NASA 3F46A 4NNJA 4N54A 3CZRA 4FFNA 3KLPX 3NTQA 1H94A 4BNLA 4FJ1A 1E7QA 2BI8A 3C1TA 2AQHA 3AFNA 5DCYA 4HNGA 1O94A 5G0VA 1D7OA 3EDMA 4FOSA 3TNLA 3DZJA 3LYLA 3PJEA 3BHMA 3H5NA 1BRMA 4XGNA 4NZ9A 4DTIA 3AUTA 1GYRA 1HZJA 1W8DA 1BTOA 1HTBA 1XSEA 3SX2A 1LSSA 4GSLA 2J6IA 4MO2A 2GDZA 3ZWOA 2HK8A 4EYEA 4WEQA 4W6ZA 5CDUA 1ZCJA 2NM0A 2I3AA 4YT2A 2IZZA 4I5EA 1SCUA 4HFMA 3CTMA 1ML3A 3AJRA 1G6KA 4B8WA 4OIMA 1ADGA 1N9GA 4WK6A 1ENOA 4BO9A 5L7TA 6ADHA 2ZCUA 3BTOA 1DIRA 3GDGA 2DBZA 3W8EA 1LA2A 1PJQA 3PQEA 4NBWA 3F1KA 1P1JA 4YACA 1A9ZA 1XG5A 2EIHA 4Q3AA 3OMLA 3RUEA 3DMTC 3OQ6A 4TQGA 2ZYGA 3DZIA 3AWDA 5TT0A 3WLEA 3WQSB 3KVOA 1UZMA 4CMAA 3VTFA 4IDCA 5F5LA 3RUFA 2DTEA 2JAPA 2XAAA 2O50A 4RVDA 1TVEA 3OA2A 2IZ0A 3GF4A 3TN7A 3LU1A 1V6AA 2YFQA 3E1KA 4YAEA 1E6WA 4TWRA 1UP6A 5EJ2A 4AJ1A 4BNXA 1EFKA 1YL5A 4GKVA 4B3HA 4OQZA 4E31A 3PIDA 4ND2A 3LDHA 2Y67A 4WPGA 3FR8A 1DJQA 5I7FA 1CERA 4XGIA 2XXJA 1D3AA 4EW6A 4MVJE 2OBNA 3RJ9A 3CE6A 4CUZA 3BMCA 1LTHR 3FNHA 3KV3O 3KTDA 4RVSA 4HADA 3RBXA 4DC0A 3ZWMA 1YL7A 2D5CA 4IIUA 4Q3BA 4CQMB 5G0TA 4UVIA 3NGXA 4KWHA 1Y5RA 5C7OO 1QYWA 1GZ4A 5CFZA 4FPXA 1H9AA 1F8GA 1GTMA 4E5KA 1HE2A 1PJCA 3B1JA 3IC5A 3H2ZA 4E4YA 3DXFA 4C4OA 4GMFA 3RFTA 4B7CA 4BNUA 5KJCA 1TT5B 1YGYA 1ENYA 2JD0A 2ZIZA 4EZBA 4EUFA 4GQAA 3AI3A 4IJVA 4AG3A 1YDEA 2DM6A 2HLPA 3GGPA 1D1TA 3ETGA 3DBRB 3T7CA 1PIWA 5CHEA 1GQ2A 5CAEA 4AJIA 1TB4A 3GA0A 5JMWA 2QYTA 4FN4A 4YAIA 3D1LA 4FC7A 1K6IA 4UAGA 5FF9A 1ISIA 1BHSA 1M76A 3JTMA 3QWFA 4XRRA 3WFJA 1XQ1A 2PTGA 1GYPA 5GZ3A 1UR5A 5G0SA 1LEHA 1UUFA 4Z3KA 3IS3A 2EGHA 4BOYA 4PZDA 3ICCA 4XQCA 3OEYA 4Z0TA 3FR7A 4AVYA 3C8MA 4J2HA 2I5PO 4YQYA 5CEFA 1V9LA 4ID9A 4K6CA 2BLLA 5T67A 5JFOA 5A05A 2EKPA 3VKVA 4S3MA 3ADOA 2P9EA 4AL4A 1PQPA 1J6UA 2Q2VA 3DHEA 1VRWA 4TKMA 4CODB 1X1EA 1XKQA 1LNQA 5F1OA 4O0LA 3I1JA 1C0PA 1R6DA 4X54A 8LDHA 4OYRA 4YT5A 1UAYA 2BFOA 2Q2QA 2EJWA 1BVUA 3KB6A 4GWKA 3SEFA 2VHZA 2HCTA 3RUDA 1NVTA 3BMQB 3ON5A 3WXBA 2D8AA 5A9SA 3ZV6A 1GU7A 3GVIA 5L3ZA 1GV1A 2JFGA 3ZWNA 1U2DA 4ZICA 2C7VA 2PZKA 4NDNE 1N8KA 2O3JA 5ER9A 5JYEA 3EZYA 3S2FA 1G1AA 4IY1A 3PJGA 1ZXLA 3HJAA 1DXYA 1EVYA 3ZZNA 2YV3A 2WYUA 5ITVA 3M2PA 1O6ZA 3FCOA 3NT4A 3HFSA 1U7HA 2BI7A 4XX0A 4LMRA 5JAMA 4YAKA 4PG5A 2G17A 4ZGWA 4D46A 4U5QA 1T2CA 1K5HA 1RM3A 3PYLA 3MOIA 1C0LA 3RROA 3FWNA 1A7KA 3KYBA 3ZNQA 5KNLA 4R1NA 4OXYA 4RPJA 3HWRA 7ADHA 3H7AA 3Q1LA 5TNXA 1XU9A 3FSRA 3PHIA 4MVJF 3F4BA 1GV0A 4Y67A 3PXXA 4BKOA 5DCUA 1YH3A 3DONA 3FF4A 1MFPA 3E5MA 1DHRA 1KETA 4BO5A 3K8ZA 2Q50A 3V2HA 1ZEMA 3BMOB 3JQAD 2GYYA 4BGIA 4E2XA 3F4LA 3RQSA 5MGBA 1MP0A 4LK3A 3WGHA 1HDYA 3G3EA 2J3IA 5KKAA 1WMAA 4QFCA 1EBUA 3OM9A 3JQEA 4CM9A 2IRWA 4BO0A 3EAGA 1I0ZA 4RPLA 3I9KA 1MUUA 3C1AA 3I9MA 5TC4A 4XYLA 3ST7A 4J6FA 3E9NA 4FR5A 3CZMA 3ZV3A 5I9NA 2JL1A 1U7TA 4GKBA 2XOXA 4NBRA 1E1LA 1AXGA 1X7GA 2EV9A 2IYOA 3FBTA 3OQ1A 2B37A 4JBIA 3NEPX 2VWQA 2AG5A 2V6BA 4HY3A 2HKIA 2WM3A 1U5CA 1E92A 5JXWA 3WLFA 4FFOA 1FDSA 3X2EA 4ALIA 5LDHA 2VUSA 4MVJP 2B35A 4DMLA 1PQUA 3GPDG 3EMKA 1P3DA 3AUSA 1DIAA 2GNAA 2X1HA 3JD3A 3D4NA 3ZU5A 5JDIA 4B79A 3DFZA 3AY3A 3MZ0A 1FDVA 1LSJA 3GQVA 4IDGA 4AICA 4CV2A 1DIGA 2BGKA 2POQX 5FWNA 2EW2A 3WG9A 1VKOA 3RU9A 4MINA 2VUTA 4NQZA 3U5TA 4NHEA 3V8BA 4ALLA 3GNTA 5DZSA 1NNUA 2J3HA 4L4XA 2NTJA 1GQQA 1E7MA 1P1IA 4DPMA 2O23A 4J16A 1MXFA 4R5MA 1LRKA 1L7DA 1TT5A 2GN6A 5KVVA 2ZKLA 1I24A 4EUEA 3KO8A 3PZBA 2FSVA 4F46A 1ZSYA 3WWZA 2QZ9A 4UEKA 1SOVA 4O5OA 4BGVA 1KY5A 1TEHA 2PZLA 4AJPA 3TOXA 1OC2A 1D8AA 4YJFB 2VT2A 4JBGA 1VSUA 4BQRA 2DAPA 3JQ6A 3K73O 2DTDA 3WYBA 2ZQYA 5GZ1A 1QP8A 3UKOA 1O9BA 1DDOA 4YJHA 2NVUA 1Y9AA 3DDNA 4A26A 2C20A 5L9AA 1R12A 2BFMA 4Y98A 4WOJA 4D3FA 2FRDA 3L4BC 4JIGA 3VZSA 3A4VA 3Q6IA 4GGOA 2O3UA 3IIEA 1Q0QA 1OMOA 2G76A 2BGLA 2E37A 3TZCA 4DBVO 5A9RA 3RU7A 1W0CA 3I9LA 3N58A 3VC7A 1PGQA 4E5MA 1EDZA 1PEDA 4WECA 3UAGA 3ZWCA 5AYVA 4UEJA 1VJ0A 2OORA 3PJDA 3L9XA 4ESOA 2Q1SA 1N9GB 1GZ3A 1U3UA 2EHDA 2PD6A 3ABIA 2YYYA 2B4TO 5HM8A 1QV6A 1TT7A 4IGEA 5JBIA 5I7VA 4IS3A 4XQEA 1HYHA 1PL8A 1NHGA 4G65A 4XIYA 3WMWA 3L0DA 5G4KA 2FZWA 1BGVA 3N7UA 1QLHA 3GVXA 3GEGA 3IP1A 3M1AA 3KM0A 4PRKA 1FDWA 1UJMA 2HDHA 2Q99A 3DBLA 4WNCA 3DHNA 4LW8A 1CRWG 4DIBA 2Q1TA 4TKLA 2Z1MA 1NBOA 2C2XA 4DA9A 4HFNA 1XEAA 5COQA 2DFVA 3DC2A 5I8WA 1R66A 3JQ8A 5K6AA 1EFLA 4GI2A 4ND3A 1UXHA 4Z0PA 3LT2A 4QXMA 3A14A 4TRJA 3V1TC 3G0OA 2VCYA 3DQPA 3CEAA 3LZ6A 3ZN2A 3GFBA 1LDNA 2PH3A 3H9UA 3S2GA 1GY8A 2R6JA 1YL6A 3OICA 3WBBA 1OZAA 2CF5A 3QVWA 4JROA 4BO7A 2XF8A 1HXHA 1HDOA 2W2KB 3LF1A 3RJ5A 3PEFA 1M75A 4J7CA 3D4PA 1GCOA 3WGYA 4YBZA 2ZATA 5A04A 4JJGA 2C82A 5GZ6A 1V3TA 3TOZA 3LSYA 4QFDA 2C5AA 2ZJ1A 4B4WA 1B3RA 2AEFA 2EP7A 1BXZA 2R00C 3WQRA 2JD2A 4B4UA 1MC4A 3ZU2A 2GN8A 3BMNA 3Q0EA 4NH4A 2WD8A 1AE1A 3QSGA 3SXPA 5KWEA 1VSVA 5CP8A 4INAA 2QRLA 3JYNA 3O26A 1LU9A 2X9GA 4O63O 4R51A 4YXFA 1WXDA 3OQBA 5A1TA 1XYGA 1P1HA 3INTA 3FTPA 4D79A 4PVDA 3QLJA 5FEUA 1E7SA 4UVEA 4KDEA 3ANNA 4CUKA 3JD1A 1LSOA 4NK4A 5IDYA 2JCXA 3FNFA 1T24A 2TMDA 1W73A 1PR9A 3W4KA 5A9TA 4NFYA 1LJ8A 2CY0A 5KKCA 4CM9D 3AUUA 2ZTLA 2FP4A 1T2EA 3K31A 1LBEA 3SVTA 3SC6A 4II2A 4BKPA 4IJWA 5GY7A 5CG1A 1J49A 2A4KA 4KOAA 5CEEA 4IDDA 5JYDA 3CUKA 3KETA 2V7PA 2X0RA 4LISA 2VRCD 3RIHA 3KHUA 5I9LA 2NQ8A 1E5LA 2I66A 3AFMA 3OA0A 1U28A 4GVLA 5EPOA 1YE3A 4E5NA 1A27A 5AXBA 1LDMA 1I2CA 4IQGA 1TLTA 4U0JA 1DBVO 1NFFA 4JP2A 1UP7A 4B7UA 4PLCA 5F5NA 3C85A 4L74A 4Y6RA 4A2CA 4ZQFA 5AOVA 5DN9A 5CPFA 2BHLA 3D3EA 1MGOA 1LLUA 1YBAA 3PHGA 4LSMA 4ZQEA 1HDZA 4DLBA 3HADA 2NACA 1MLDA 4AJOA 2Y93A 3JQCA 4YRAA 2ZCVA 2NNLD 4OHUA 3CMCO 1O0SA 3ZNPA 5A06A 2NU8A 4J7XA 3JYLA 1ISFA 3PFFA 1ARZA 2G5CA 3DOOA 4GLLA 5H83A 1W4ZA 2J5KA 4WEOA 1JWAB 4TRMA 4IM7A 1ZKMA 1ISHA 1KEUA 3WQQA 2HO5A 2PV7A 2PGJA 1LI4A 5KVQA 3KZVA 1QV7A 2QRKA 2DQ4A 4UUOA 1E1MA 2JHGA 3WOHA 3ULKA 4CQLA 4MDHA 4E33A 2XPCA 4FFMA 4IJKA 4CMEA 3KYCB 3VH2A 4B8ZA 4CV1A 5T8KC 1IOLA 1OI7A 3PLRA 3KSZO 1X7HA 4E0BA 4P4LA 3ZU3A 1K89A 4K1LA 3IQDB 4BMVA 1BSVA 4QUKA 3HNPA 5DOVA 5AXDA 3UICA 4JK3A 4PLVA 2BKAA 4ROSA 1U1IA 1ISJA 1HL3A 1I2BA 3VTZA 4ZRNA 3VZQA 1HE5A 2JCYA 2J5QA 3G79A 3WMXA 2D1YA 2QYSA 1H9BA 1ZNQO 2CSUA 2WDZA 2CVOA 3PWKA 3CSDA 3AM3A 4NMHA 2D0IA 1FDTA 2OHXA 1T26A 3RUIA 3BAZA 1T2FA 4Q3CA 2DUWA 1KVRA 1Q7GA 2RAFA 2X23A 4E2WA 2X58A 4IBOA 1V3VA 2PNFA 3JQ8B 4WE3A 3EW7A 1UZLA 1EBFA 1LLCA 2VTDA 3PFWO 4MVJA 3S1LA 1MB4A 2QX7A 3ASVA 1LDEA 2CFCA 5F1PA 4BNGA 3GDFA 1YJQA 2X0NA 4CM3A 5AQ1A 2AXQA 4DRYA 4I8XA 3UCEA 2WEKA 4R9SA 2Y05A 3MTJA 4PLZA 1ZXBA 3DZFA 1T4DA 2AE2A 2I67A 5T5QA 4YYZA 1DFHA 4IZHA 1UZNA 2FMUA 3TZHA 4EEXA 4M54A 3NYWA 5LDGA 3KSDO 4YVFA 5BR7A 1A4IA 1KEWA 2I76A 1F06A 1QLJA 2NU7A 2O2SA 1YVEI 3K5PA 5ES3A 1NFQA 3ZGYA 3OETA 4BHTA 3ZW9A 4OOEA 1Y8RA 2P91A 2BMAA 3RSHA 3LC1O 4J1SA 4BV9A 3C3XA 4OSOA 3VVCA 5KOIA 1M2WA 3I9NA 4K26A 3AI1A 4E2YA 2JKVA 3IOYA 4FDAA 4CMEC 4CMBA 4P8RA 2IXAA 1DRVA 4CMKA 3WGZA 4XIJA 5LCXA 4XGKA 2E49A 4IUYA 3RUHA 2ZB3A 5F21A 3D0OA 4IMRA 3HB4X 3ROPA 4BNNA 4C7JA 2ZB7A 1Y7TA 1H0KA 1TI7A 1OBFO 1AHIA 3L6OO 1DSSG 3DAPA 3MJSA 4XDYA 4HWKA 3DAFA 1QORA 2W8ZA 2ZK7A 1LRJA 4YT4A 3VOSA 4CLDA 3H3FA 1KVUA 3TZQA 5T8KA 3OIFA 2CF6A 3C7CB 2VNAA 3OECA 1HDXA 1RJWA 3OSUA 4EDFA 1I3LA 3D5QA 2EKQA 4D7AA 3D3WA 4WCFA 5L4SA 2YQ5A 3UFXA 3WYCA 2W90A 3EC7A 1F0YA 3UVEA 4S1VA 5TQVA 2GR9A 1Q0LA 2WD7A 4YJGA 4PLYA 4NBTA 3U4CA 4W9NC 4LMPA 4RVHA 4WLEA 4AJEA 4R1TA 3DWFA 2RHCA 1PSDA 4R54A 4JBHA 3RASA 1KOLA 2QZZA 5G4KB 3C7AA 1LRLA 1LXCA 1YKFA 2B83A 1LDYA 3NX4A 3PRJA 4YEDA 3VHRA 4CLRB 3QA9A 4D42A 1WLYA 2FY8A 1ADBA 3LLSA 4KZPA 4UVGA 4WLVA 4BNHA 1R0LA 4PRLA 3JYOA 2C7GA 4E5PA 4I9NA 4AJNA 2D5AA 1EE9A 4YJHB 5TLSA 3W6UA 4D45A 3GDOA 3GVCA 2PK3A 1LC3A 4CMJA 9LDTA 2X9NA 3F9IA 4R69A 1SB9A 3DBHA 4GH5A 3UCXA 3RKRA 1P1RA 1PJBA 4BKUA 1H93A 3PP8A 5ICSA 4CQMA 5BNFA 1A9YA 1U9JA 1U8XX 3JQAB 1ZMTA 2HMTA 1QMGA 3WBFA 2VNSA 1ZH8A 3QW2A 4MVJM 4MVJG 2RH8A 5DBIA 1G0NA 1C1XA 3D3WB 4WCFB 4KQWA 4JLWA 4RQTA 4CPDA 3WB9A 3BYZA 4M8SA 2GASA 2V6GA 4I9HA 2QHXA 3JYPA 1CDOA 2F00A 1ZBQA 3QHAA 1IE3A 3KYDA 1ULUA 3W6ZA 1XELA 1P77A 3HB5X 4A5OA 4BO4A 2DUUA 4PLHA 4L75A 2GCGA 2HJSA 3PPIA 4DUPA 4CLRA 3Q9NA 3DOJA 1R15A 3HDJA 3LC7O 3FNEA 1ZK2A 4M87A 4XJTA 4NK5A 5COBA 3RWBA 4CQMD 2YV2A 1R4NA 1GEGA 3IKTA 1V3UA 1EVIA 2EKLA 2GPTA 1Q1NA 5A3JA 3ROQA 1R16A 2X5KO 3PQDA 4CLEA 2IODA 4DLLA 1O5IA 1IULA 1H5QA 4Y8VA 5ER6A 3D64A 2X5OA 5ADHA 2WJPA 4PGFA 5AVOA 1M6HA 5KJEA 4HBGA
chains in the Genus database with same CATH superfamily
5AKLA 3E23A 4OMFG 2PS3A 2B4RO 3W2GA 1MOPA 3G1TA 4X61A 3RAJA 2WOJA 3FAZA 4IFTA 3OTGA 1XEWX 4B6RA 1Z34A 4TVSA 4TLEA 4OQPA 4P34A 3NOQA 1ZM9A 4EX7A 1MPTA 2WTBA 2FVYA 3BWXA 3IA2A 3KB1A 1NN0A 2ROQA 3DCNA 1PTJA 4DAOA 3VKGA 3BRSA 1HSOA 2ZYTX 5F4ZA 2GK4A 4UHJA 4JVNA 2HCFA 1QH8A 4Q01A 4XDHA 2NP6A 1SZJG 4WESB 1EP9A 3PBKA 2V7VA 2FP3A 5EJ9A 3FBGA 4M49A 1XZCA 1ACLA 1CVLA 5GJWC 5HNKA 3L1VA 1ETHA 1JZSA 3AK4A 5JLJA 4LYJA 2NYAA 5JO0A 1NJ8A 4AO7A 3EHEA 3KZOA 4H1WA 1DBIA 2FW1A 3FCEA 1VKJA 3MOSA 4HNRA 5L3QA 5A4DA 3EFHA 3H5AA 5DHFA 3QGMA 2SKEA 1TJ5A 2RBEA 2X4GA 1X7DA 4X1KB 1KHHA 3PNQA 5A3SA 1RT9A 1FSGA 2XA1A 2BP7B 4YPFA 4G0UA 1V8DA 1EDEA 2HLNA 1JDJA 3QTLA 2HB6A 1L3IA 3HP4A 1HNWB 3PYXA 2AXPA 3UOAB 2IHKA 3FPLA 1SGWA 1RLOA 2AG8A 1JLLB 4IP0A 3ZGLA 1DQRA 4DWVA 5KJ6A 1QVRA 3QX7A 5ALIA 5DW0A 3VM6A 1HY3A 1UPAA 3ZVRA 4DV2B 1T6YA 2C4MA 4UCQA 4L8WB 2F3QA 4O1HA 1IHXA 3JRWA 4R3NA 4B46A 5EVJA 4B3FX 3BMXA 4LJAA 4Y2XA 3OHSX 3TIFA 3F6YA 5EUBA 3QU2A 2CDAA 2O3QA 1DX9A 1X15A 4K8RB 4CV0A 3LUPA 1U1CA 3LKZA 1TM2A 3ZCSA 2A9QA 4QXPA 1G16A 3H1TA 1SUEA 1XL1A 3R9XB 3C3MA 4UMFA 1KYVA 3AF4A 3K2QA 3OJCA 1C9MA 3PFCA 2ZTVA 4CEIA 4BZPA 5K9ZA 1W5FA 3VUFA 2YFHA 2C2BA 3FJ1A 4XR4A 3ZE2B 2YWXA 4TVOA 4ARZA 3RVKA 3CUTA 3OEEA 3TDNA 2RC5A 3ID6C 2WZDA 3G1UA 4HX5A 1JAZA 1XZHA 3MQFA 2XMCA 1XZDA 3WNBA 8AT1A 3GLHE 5ILGA 2AB0A 4P33A 2BGIA 1Z28A 3G7UA 1JLRA 2HDOA 3P2KA 3HJTA 3MWLA 2WAMA 1DINA 3E70C 2GD1O 3EXG2 3KE9A 3D2BA 4F9FA 4NU8X 1ECGA 3MGBA 1P0QA 2CJXA 4XXHA 1P8AA 3Q7PA 1XXLA 3KRTA 4V0ME 4OOFA 3I0ZA 5EIWA 3RGGA 4HAUA 3SYKA 4EQ6A 1WR8A 2GCOA 4EMSA 3O7WA 4EFKA 4MB6A 5BR1A 5CIWA 2VWGA 3PKJA 3PPYA 4IS2A 3VDNB 4D4MA 3ZGXA 1IONA 1PV1A 2OZEA 4B6SA 2NQ2C 3OQNA 3K9GA 4CIAA 2CMHA 2P8SA 2R11A 4ZOLB 1IG3A 4L5JA 1A88A 1J2EA 4UXHA 2UYQA 4X93A 3SNHA 2G0AA 2CD9A 4CM7A 4YLYA 3QNMA 4XUDA 1W48A 5IYZF 4EJ0A 1L7VC 5FV7A 1T5TA 4GGPA 5KWIA 2C2GA 2V9CA 4OB7A 1WD5A 3WFIA 4WRRA 1W34A 4S35A 3G8AA 1RR6A 2QW8A 3OBBA 3NT2A 1IEXA 4OHKA 2VTEA 4S24A 3SFVA 2VWHA 4K2HA 4N0PA 2BCEA 1E2JA 5DNUA 1RXWA 2IEBA 1WQ1R 1LI5A 1RXIA 3PLAE 3DVSX 2PFGA 3MJHA 4OUKX 1JIJA 1B8NA 1NV8A 4N39A 1VHTA 1XXHA 3UT6A 5JS6A 2GXAA 1X19A 2J67A 4R8MA 1QPZA 1AK1A 3O74A 3USCS 2HCJB 4BQIA 5BN5B 1NVFA 1UMKA 4PYRA 2HC9A 4G5OA 2V9ZA 3DOCA 3K0SA 2Y0CA 1KK0A 4MV8A 5KQSA 1VIAA 2WAXA 4HDSA 3RVNA 3V1KA 3IHTA 4RM3A 1OGIA 4U3JB 5IBRA 3JQPA 5KTPA 2EDCA 2CV1A 4RD2A 2WKQA 5EWJA 2NT4A 2BAGA 2OHHA 2J0UA 4HX9A 2VTKA 1DOZA 4BDTA 4FMCB 3LTNC 1AF7A 4IIXA 3RAEC 2B0CA 3IRVA 4PSDA 4X9XA 1RS0A 5KU1A 2D5LA 3LUHA 5AMXA 1H1LA 1M66A 2PH7A 2XV1A 3BB1A 4MVJD 1FLDA 4KV9A 2G08A 1FX0A 1P4HA 4QOEA 4B17A 5F7XA 3KPVA 4GOMD 4OQFA 4MRMA 2CKMA 4NAUA 1K92A 4FBMA 1AB6A 4UBLA 5K7SA 3NDBB 2WFAA 1AKVA 2QAJA 2ZE6A 3H5WA 4JC0A 1N2HA 4TTAA 4ZZ1A 3JQ7B 3JX9A 2YOFA 5F76A 4ABTA 4H6XA 4WKBA 4OF4A 1HO3A 2VJDA 3GOQA 2P9QA 1Y48E 1PZHA 3P7MA 4JGBA 1RYEA 1XZNA 3RYCA 2FH5B 2J7PD 2PRYA 3OEWA 5JHHB 1IHUA 1YRLA 3PD7A 1VJCA 5IVKA 3S2YA 3ZGOA 4EI9A 4J4TA 2IYUA 1SC9A 4K2AA 5D5QA 1JDBC 4HRXA 4ZYLA 5BPFA 1ZS9A 3L8YA 2QRPA 3NHRA 3PT9A 3GVHA 4JJIA 4Y1RA 2DH6A 1BXRA 4L9RA 2O19A 1Z5WA 4R6XA 1JG1A 4S2UA 5ERYA 3KOXA 4ZYYA 1AN0A 4FDVA 3EF0A 4ANFA 4EFMA 2V7TA 1UT6A 1JG3A 2X6QA 3O47A 1ZDMA 1Y42X 2R7NA 3O73A 4UFNA 4BLUA 3KQNA 1SVLA 3V80A 3AJAA 4LDNA 4MVWA 2XA2A 4PX9A 4DDKA 4EG1A 2IUYA 1KSHA 4DJFC 4CM4B 5BN3B 4N5MA 5ERXA 3D59A 2ORYA 1RXYA 1FW8A 2Q6IA 4PE5B 1AQJA 4JLPA 4OQ4A 1YAHA 1HDEA 1BW9B 4G1CA 4C5AA 2P2ZA 4WZAA 3RYHA 5ADWA 1H8HA 1E3WA 4U02A 2O2YA 1V8BA 4A91A 4YRBA 5CB4B 3BREA 4ZPJA 3PA8A 2PT9A 1VM6A 5DE3A 2OGZA 2FMXA 4PU0A 4S0ZA 2OHVA 1XX6A 1EXWA 5E6SA 1UWCA 3JATA 2ONZA 1LFDB 1NMXA 4Z4QA 2QTAA 2YX1A 3ZNOA 1TO2E 1RYDA 1RMYA 2NLOA 1FMJA 1LUAA 4UM9D 1NJ6A 3ZJ4A 1NMYA 3A0RB 3D3NA 4QUDA 4GAEA 1R3DA 2HLDA 2LKCA 1JZTA 2GGSA 3MXTA 5DYNA 3ZI4A 3ABQB 3DLBA 2R6HA 3LT4A 5JJCA 1ZMRA 2WAYA 1PL0A 3CSSA 3JYHA 3LCJA 4UULA 3IILA 3DDOA 1OYVA 1ORVA 2Q45A 2RGNA 3MD9A 3OPQA 3G23A 3OWOA 1FK8A 1JEEA 2Q27A 4HAIA 4F56A 3RAPR 4TKZA 4IVPA 2VF7A 3NP9A 2FR1A 1PQ4A 1SOUA 2AG6A 4BJ1A 5GJCA 4DJ5X 2BUBA 2C8KA 2RGUA 1V5WA 1E5VA 1GKYA 4KP7A 4BNFA 5E3HA 2IPAB 1XQYA 3L84A 2Q8NA 3O38A 2LZ0A 1FTGA 5ICCA 3W9SA 5EERA 2QXTA 4B47A 5IDXA 5K3SA 2GTIA 2R00A 3KPUA 1KZ4A 1YE5A 2NXJA 4R1SA 4HUJA 2BKUA 2JIZA 3C5VA 1OV4A 4M0DA 3PGXA 4DLTA 1YFJA 2PKXA 3G2KA 2CXPA 4JEUA 5A6SB 2HJRA 1ZITA 1SPXA 2PWPA 2VPIA 5CT8A 3CX6A 4DJAA 5I8PA 3GHHA 4RCVA 5ELXA 1N57A 4P3OA 4CETA 5JI3E 3G5UA 3MINB 3QVSA 3S2IA 4BVBA 3FFTA 1IZ0A 4HVAA 5IYZA 3D6FA 1J0AA 1FUKA 4B3GA 5I47A 2HU7A 1RM0A 3D4LA 3C6KA 3E4DA 3NETA 2QN9A 3R3SA 4AZ3B 3M83A 2XNCA 4UUPA 1PS0A 8ABPA 4CYMA 3TIVA 4EHFA 1WZNA 4PNEA 4HVCA 3LG2A 4YRLA 3UGJA 4PINA 5IP5A 2Z8YM 1SXIA 1XN4A 1Z25A 2B8NA 1L1RA 5LMNB 1QSGA 1COWD 1LJLA 2A0FA 1RLUA 2CLMB 3K6JA 3NO4A 3NTOA 5CGZA 5B1YA 1ZBDA 2C5EA 4DDUA 1XKXA 2WTMA 2CXUA 3AKCA 1M0TA 4I5IA 2LDXA 4MPDA 1EJ6A 1OFVA 4NZPA 3T5CA 2GZHA 3VSAA 5LIRA 2VQ6A 3U7GA 4KLRA 3IIJA 2ZPUA 4JOSA 3UH0A 2IS2A 4S1WA 4O08A 1KZ7B 2NN3C 3NH9A 2Z0MA 1BCRA 1R0CA 3WGNA 2WICA 5FL3A 1R0SA 3D6JA 4IDEA 4RK0A 4P4GA 1CY6A 2R6FA 4N48A 3T4XA 2ODEA 4D43A 5E1MA 2GJ8A 1FRNA 4JR2A 3X1YA 1I7PA 1WVGA 2PZMA 4W4TA 3AUFA 3O84A 3EF1A 3CNOA 3OM8A 3THWA 3THXA 2GYUA 3FW1A 1NKSA 3FNGA 2BHRA 5F3WB 5CB4F 4RVFA 2C8VA 3P0FA 3MYRA 2OK8A 3CQ9A 1RKXA 2WD9A 3G49A 2GEJA 2Z1NA 3A8TA 4TZKA 3E84A 2H0RA 3KU1A 1KEPA 2C07A 5G40A 1DIBA 4G4JA 1V96A 5LZ2A 4EGQA 1WZIA 4WKGA 4NZZA 1PX0A 3DA8A 4NZMA 1S2GA 3TRFA 3WJ2A 1AO0A 5BOVA 2RCNA 1S0UA 2YXDA 2D1RA 4OHMA 1A2QA 5EKSA 4B09A 5J4KA 5C7IO 2IYNA 3IBFA 5FFFA 5IN4A 3TRHA 3ZXYA 3BSSA 1L9XA 1P29A 2Z5VA 1FNMA 1DE0A 1SA0B 1C1DB 1U8AA 1DKNA 1XWFA 2VK2A 4GIBA 3I8SA 4PPYA 4R4JA 4IHJA 4D0NA 4IQ4A 2YV5A 2FW6A 3ITDA 2BBTA 2ZSJA 3THSA 1ONNA 1RI4A 1CZKA 4DQKA 1AZTA 1V16A 4UHBA 3ZTWA 4AURA 1UL1X 3RC8A 2I2XB 4HLUA 1GGVA 2VTBB 1D6NA 2PJZA 3LRXA 1WP9A 4KQFA 1BWSA 1NA5A 5IVIA 5K2OA 4F6CA 5K51A 4F2DA 1M5RA 1X70A 3AM5A 3HEMA 4KTTE 2PMCA 1W93A 2EBHX 2QP9X 2ZJ8A 2OYRA 2YL2A 2LIPA 3RLFA 2C59A 2ZU6A 4J9UE 3NANA 1SD1A 1TZKA 3HA5A 4YRKA 1OXXK 2BEWB 4RF5A 3KT6A 4URVR 1QBKC 3I4CA 2YINC 1I32A 1VP9A 2C29D 4BNZA 3DXXA 4BBAA 1USVA 1C41A 3AB3A 5D51S 1JDSA 1OPRA 2PZEA 4URHA 4XZ3A 4EG3A 4UTPA 5B3LA 1THZA 3DMFA 3EYAA 3C6ZA 3C2QA 3THRA 3GNSA 2G7ZA 3FYUB 2PNJA 3MM4A 3LD9A 4ND5A 5DX1A 1UJCA 5KZMB 3BD7A 1L7XA 3INRA 3F2IA 4V0MA 1VLLA 4R8VA 1U6KA 2J6HA 3CZCA 4GGMX 4YRNA 4ZVUA 4R2HA 3TFWA 1NVUQ 4B4VA 4HNQA 1UDXA 1BD4A 1UFQA 4PCAA 4R7ZA 1AS0A 4G63A 4BO3A 4FCCA 1IN6A 1Q0RA 5ESRA 2N3ZA 4ZOLA 4N49A 3IPAA 3ZHQA 2CCKA 3EGOA 3LH5A 3KD2A 3L8GA 1PG5A 2C7QA 4OI0A 3NC4A 4LJ5A 4XWWA 1ZMOA 1ONOA 3FVVA 5DRYA 1VGVA 1IBMB 1G0OA 3VPSA 4OJYA 4BWVA 4B7XA 2WJGA 1KF0A 4DJDC 1ULHA 3GRKA 5CJPA 1FB5A 2Y1XA 2CYCA 1KGDA 2OM6A 2ZEJA 5TJHA 2UU9B 2WHPB 4G2TA 3H2YA 3F8WA 4ZAFA 3L4JA 2FN8A 3K9CA 3PGMA 3OIYA 3L8ZA 3IEIA 1UPXA 1UBNA 1CUEA 1F5NA 3KAQA 1VE9A 1MN6A 2ALJA 1IB0A 1VG0B 2QRZA 1T0IA 1L4HA 1SVOA 1TYBE 4P36A 5F3RA 4BTLA 2D7DA 3MAGA 1CLEA 1SBIA 3LUAA 4PLFA 2XB4A 1P17A 4LDPA 4D0RA 5AW0A 1E2FA 3H2BA 1F9EA 4Z4IA 1XZQA 3KSAC 5HS6A 3WFZA 3EUAA 2XXBA 4BVGA 2R3SA 1G291 2HTEA 1JR3D 4PGHA 1B73A 3WHKA 3KVVA 4B48A 4EI2A 2DF8A 3OE7D 3G17A 4RPCA 1HQCA 3EHDA 4U6NA 3N3BC 1OX6A 4LIPD 3DEYX 2HUNA 1IHYA 2FPGB 1U1EA 3ZC3A 1CUJA 1UDBA 1N5IA 1LQUA 4FHFA 4Q4DA 4DR4B 3KKEA 4UREA 2WVJA 4KQXA 2NZVG 3N0RA 4POOA 2AJLI 4ZCTA 1NT2A 5J2UA 3GJ7A 3R1IA 1SBQA 1Q5PA 3VNUA 2X5JO 1II9A 3Q9UA 4D8UA 3OCZA 4NWIA 4EK9A 2W42A 3W90A 4MYDA 1V11B 5DLYA 3GGDA 1V25A 3ACBA 3FOCA 4CKYA 3CGWA 5FH9A 1RWOA 1G1MA 2OCGA 2PZFA 3WKDA 2AX3A 2FFQA 5IM5A 4F72A 2LBPA 4RHUA 1AX9A 1Y6RA 2DU8A 4CCSA 2UYCA 2ISQA 2M2IA 1DRUA 2UZ3A 4HXGA 4BLRA 4UFPA 1E0AA 1NJ1A 3T5MA 1G8AA 2F4NA 3UATA 3HXQA 3FN4A 5CFNA 1K97A 5ETJA 4F4DA 2YYSA 1YQGA 1Q16A 4MP3A 4GP7A 2YC2C 2X77A 3QY0A 4GDMA 3GLFE 2X3YA 3X43A 1IY9A 4EFDA 1MA0A 2N75A 3GZTB 4MVYA 1Q14A 1Z45A 1UXGA 3G5LA 1ADFA 3IP7A 1QOPB 5AQEA 1E2HA 1U1GA 1NW4A 3WIEA 1E94E 2BVNA 5K6TA 4LF6B 1U90A 2W2VA 4ZT3A 2Y99A 4DG5A 2FPRA 2B3DA 1CUVA 5A4JA 3LT1A 2IXTA 5J1TB 1PGNA 4GRAA 5L7YA 1N0VC 2PUBA 1D1PA 3U61B 4RPKA 3ABRB 5KVAA 2ZJ5A 3HN7A 7MDHA 2EU8A 1D07A 2I6XA 3DMNA 1YR9A 1ZUD1 4NENB 4PSVA 4RZHA 1AK2A 1ZOLA 4QYIB 5AHWA 2P4SA 2FFHA 2GRAA 3S40A 1TK9A 1O95A 3KPJA 1T8TA 3HDTA 3RVMA 2E4YA 1Z8DA 3G9TA 3PEVA 4PAQA 1W6UA 3V5NA 1B93A 4MQ4A 1OW3B 3NQ41 3C8DA 1OX4A 4LDRA 2VPWA 3ORSA 2WHPA 5JECA 1HDIA 4FYPA 1ZUNB 3RLIA 1NM5C 5CIQA 1M0WA 3A9SA 1Q84A 2IE8A 1BXGA 1CWUA 2YFKA 4WI1A 4I08A 1VI6A 3Q8WA 3RHSA 3C7KA 5J40A 4KUHA 3KOMA 4RMGA 2JVIA 1P45A 3ETCA 4Q1EA 5HDQA 3SICE 4CLOB 4I50F 1Z6TA 4AN0A 3MEQA 4RK6A 2ZE7A 9MHTA 1QYCA 4RMIA 4H4CA 2AV6A 2EWWA 4BTEA 3IXMA 4QAQA 5BN3A 1HLFA 4IG9A 1Z07A 3JRNA 3GGOA 2C78A 3SDZA 2FN3A 2EXXA 1AKRA 4Y7DA 5ITWA 2D3TA 5G0UA 2CUKA 1P6XA 2EYQA 5FWYA 2JAOA 2VAXA 1UJ6A 3GD5A 4JT4A 1N33B 1Q7EA 2GXUA 1GR0A 2ZJ0A 1T4BA 3D31A 4R31A 5EUQB 5DASA 1E5TA 1KFEB 1WAMA 4MEBA 3WYNA 2VSYA 3GFOA 3UW1A 3WR5A 1U31A 2VYFA 1DKLA 1R6VA 1VLQA 2CVQA 4LCJA 2PMFA 1QIDA 3EGXB 1OH8A 3N53A 1Z5VA 2VZ0A 5EFZA 3CRVA 3L7IA 1KVTA 4EKDA 3EGIA 1ZK4A 1IJKA 1VL5A 4M1YA 3KZ1E 1NRIA 3A2LA 4FZVA 4Z4HA 4XAQA 1E7RA 4NEGA 2YVKA 3KJEA 4TMWA 4NOJA 3T4UA 5TJ9A 4NH0A 4LHYA 4JY7A 5ECYA 1M6VA 4GS5A 2J0UB 3OE1A 5SY6A 3ZQKA 4D3DA 2XQFA 3LRPA 4B3SB 2XDQB 4MDYA 2GTPA 2RHTA 1PQYA 3O03A 1TQ4A 2ETVA 1I01A 3KKPA 2UVQA 2CC2A 3BWYA 4TSRA 4DLZA 3HI4A 2HGZA 4KX5A 2Z95A 3QQPA 1NXVA 3GN2A 4XCVA 4IFIA 5KKNB 1S2DA 2VVTA 2NU6A 4I55A 4C3VA 2H2DA 2FG6C 2WJ6A 1MB0A 2Y0PA 1OFHA 5JVDF 2FWIA 1KP3A 3DV9A 1XEXB 1YRBA 3CF6R 1QMPA 1YIDA 2XIJA 3IQGX 3JAKA 3N39C 3D7MA 1IZ8A 3K30A 4NYJR 4PHTA 3RGWS 4CDMA 5CXXA 1YWGO 4O1IA 4ALNA 1RKUA 3LVQE 4REQA 1Y6QA 3LQFA 1I2ZA 3QJ5A 3ANSA 8ADHA 3G2JA 3NDRA 4XLLA 4PO9A 3SFTA 2JI6A 5ITZA 5AIAA 3V6LA 1A77A 2QRUA 2PIAA 1RM4A 3G02A 3KPWA 2AN5A 5FUWA 1LDBA 4IIVA 2W2QA 4LZPA 4F04A 2QF7A 1JSLA 1P4JA 2XA9A 4XB2A 4OHFA 1MEJA 5C9ZA 2DMRA 5DHRA 1J23A 2L18A 3R7BA 1W9MA 3D43A 3EEOA 4PS0A 3RE1A 1FNSA 4IDPA 1GL9B 4GD3Q 4C0WA 1Z75A 4PNZA 3T0FA 3GLIA 1TE2A 3AKZA 5AHOA 1W85B 3MRSA 2CXNA 3E9QA 4I7EA 2O7NA 1NVVR 1UBLS 3ODPA 5COAA 1TTQB 3P0EA 4DCNA 1YJXA 1KAMA 2J0EA 4YJGB 3AYXB 3BFXA 3B53X 1P9RA 3IQFA 3P8ZA 5DI3B 4ER0A 1KJNA 3C6YA 4GRIA 4ZOLF 3BHJA 1X2BA 4HAZA 3VNSA 2F1IA 3G0GA 1K8ZB 3CVJA 4OXNA 1H1TA 4RJ2A 1QXSA 3GIDA 4ZOBA 2VTVA 4ZREA 3AFGA 1TA9A 3JVVA 5BQOA 5JWHA 1NI4B 4ER5A 1D1QA 4QTZA 4QHSA 5AWFC 1HX7A 5GV8A 4GYJA 2MSEB 3GMDA 5TMEA 4ETNA 3UW3A 3JQGA 2KPOA 8ATCA 2V3CC 4K05A 1XLTC 1D6MA 1E8NA 1C9NA 1KVSA 3DMHA 3WICA 2QPAA 5CITA 2O0JA 3A9TA 3AHFA 4M7WA 5JFGA 1GAJA 3ZHXA 2I65A 2ZVQX 4B6QA 2JIRA 1VCMA 3EXFB 3GUYA 2C5FA 1W0JD 3F2VA 4M8KA 1JFSA 2D4HA 4Z4FA 4E2FA 2DFNA 1WULS 1AUOA 1XEWY 4CIYA 2G9NA 2EBUA 5IS2A 3UUEA 1XYYA 3BJEA 3CCCA 3EXG1 3SDBA 1RTKA 1HZZA 4WJZA 4PAMA 4X1OA 2AHOA 1VZ3A 4RH1A 5KCZA 1TUGA 4U8GA 4XJVA 3VH4A 2H16A 2IV7A 5G0WA 3ND5A 1HYQA 1E4EA 5DN6D 3NMUF 1OGJA 3NEJA 2P30A 1A4RA 5LP6B 4YR9A 3VJLA 1J90A 2RFLA 3GVPA 1F3LA 1WWKA 2COKA 3G8BA 3MUEA 4ISBA 3VO2A 3IH5A 1JU3A 4ETIA 4BWGA 1ODSA 1RYFA 1N1DA 4X8LA 2O4CA 2CUZA 4ZQCB 3HU3A 4QOGA 3ITEA 4DHEA 1H65A 2VBCA 2HPVA 2ZB8A 1SR8A 2JFPA 1R8QA 2XHZA 3D81A 5DM0A 4A0SA 3B3JA 1WZEA 2PSJA 1GQSA 2WJVA 3H9JA 1M72A 2XTAA 3E7WA 1I7NA 2QAIA 2IYXA 4MRPA 1NQWA 1TQ8A 5I4CA 4A0HA 3T3DA 4B6EA 1I6WA 2Y1LA 1EX1A 4UPEA 1G5RA 3NEYA 4CDNA 4CTOA 1IYZA 1E2NA 3PNPA 3EN0A 3OSZA 2AFVA 4FC6A 2IEAA 4OYLA 3LUBA 1FVOA 1ZVKA 3FDZA 4FU0A 4LTDA 3GIWA 3W2EA 1U0NA 3DV0B 3SZMA 1JSCA 4MLCA 4LWZA 4PG8A 4QT4A 4LYHA 2E4XA 3ZVMA 2EZTA 4H7DA 2NADA 1H3FA 4PHHA 4FKZA 4TVBA 2ONJA 1CJUC 1P5HA 1RHMA 2O7RA 2VQDA 3CUYA 4Q93A 1G38A 5FUVA 3AEQA 2J7KA 4D4KA 5EGNA 4UOQA 2BFWA 1HSZA 2RMKA 3RS9A 1CHNA 3DZKA 5KYGA 3T1QA 5IT0A 4HYEA 1YZFA 4DPLA 2EQ5A 2E4UA 3R23A 2H7CA 4FYJA 4G0YA 1M5UA 4L6CA 5E0OA 3RYIA 3UMSA 3HVRA 1RP7A 4N0QA 5LBUA 2ZBDA 1EFPB 1QRRA 1MRZA 2YASA 1XA0A 3HU2A 2IPLA 4J1NA 2I87A 3FNIA 3OKFA 4RUKA 4FZ5A 2HY7A 3II6X 3EFOB 2A9PA 5FI5A 2FUKA 3A6GA 2IDKA 4CF3A 1M67A 2F6RA 2UUPA 2H1FA 3LFHA 5F98A 3O4VA 2CDRA 4EARA 5IABA 1E20A 5IW8A 5CA1A 4I0WB 4YQZA 3LQYA 4HMQA 1F51E 1T25A 1NW8A 3PWSA 1SEVA 3VKFA 1NOKA 3I09A 1HNNA 3R0QA 3ZUPA 4A8JA 4EOGA 4JYPA 3PFNA 2IZ5A 2VJMA 1L5NA 1E64A 1JEAA 1T1RA 2OOKA 2ZRLA 4PHCA 2Z6QA 2E48A 2FF5A 2Q9CA 4W5NA 4X63A 5ESDA 1NPDA 3KJIA 1SQ0A 5F1YA 1EFRD 4B3CA 4CUJA 3BQ9A 4QG7A 1N9ZA 4YA6A 3M5CA 3TE7A 5F64A 1WMDA 1XA4A 5AJZA 2AMLA 2Z4RA 4IJUA 1G19A 1I9GA 4XDZA 1L7EA 2BEVA 3TTUA 3COPA 3ORYA 4JB3A 2I6SA 4ZJUA 2TMGA 1MKYA 1ODTC 3QU7A 4I6JA 4LHXA 5BQ5A 1QGAA 2VT7A 1L4GA 3PKIA 2Q7OE 1XVTA 1KO4A 4ILEA 1WXXA 4G5SA 3PFBA 4BASA 1WL8A 2JHAA 4PM4A 1RPZA 4H7KA 4J3NA 3NR2A 1T9GR 2PWZA 3PGLA 3STYA 2CBXA 4O4HF 4DCOA 4BUCA 5AVSA 4RD4A 4E46A 2YY5A 2JANA 1JIXA 3EGDA 1KZYC 3INYA 2QR3A 1I5RA 5CJJA 5EFOA 1Z8FA 1DJOA 1EUDB 1Q17A 4YJKA 4KRFA 3D6VA 3Q0TA 3NHKA 2HZ7A 1BO6A 2P2CA 1Z5ZA 5JAPA 4N5LA 1XMJA 3QPUA 3SHFA 1JW9B 2H1LA 2LWIA 2ON6A 1V0JA 3LQ4A 2IYPA 2ODNA 3ISTA 2F55A 1ZONA 1DCMA 3SSMA 3PQFA 1RRVA 3U4IA 2W4QA 4ZD6A 1KGSA 4NFSA 4DB2A 2D5IA 3MJTA 3ZJ5A 2OPBA 3N6VA 1PRYA 3QUBA 4OBBA 5HUJA 3I6BA 1AO3A 1GFSA 2IZOA 1DKMA 4N9QA 4F9GA 4LF7B 4BMZA 5EZSA 2WYWA 2BKVA 4HUQB 4NI5A 3OOSA 1WLSA 5M3BA 3FMGA 3PQCA 3EZ7A 4AKGA 2JCVA 4QPNA 1ESEA 3RKUA 1EQAA 2FN7A 5G41A 3ZY3A 1DB3A 2PRIA 2WRZA 4G25A 2Z2YA 1UBUS 3TNJA 4CL0A 5EC8A 2F8MA 2OAEA 3NHUA 5JAZA 4A16A 4Q1FA 4QUGA 1DEHA 4P54A 5I7AA 2HA5A 1U7OA 3D2CA 2AEEA 2R751 3IEUA 3FHCB 5EIBD 1FJXA 1TYZA 3IP3A 2YJ3A 4FIZA 4RSMA 4BZXA 4UDYX 1HR0B 1I14A 3ENVA 4RHXA 2H5EA 4AS3A 4ZVSA 1EM6A 3DWGA 3M4JA 3SS9X 2B9EA 5FPSA 4HDRB 1T1SA 3E3AA 3V9AA 5IDWA 1K9SA 1MMFB 1UPUA 4I4TA 4EUNA 4UOZA 2ZXFA 3S2UA 2A9FA 2QWXA 2UAGA 3L0ZA 4M1MA 5B6PA 1WKBA 3A32A 4FFBA 5J3JA 2JBAB 3SOPA 4Q4AB 4QIHA 2EDAA 5LOVA 2XVZA 3OESA 4ZO8A 3KDPA 5EE3A 1TD9A 3TL6A 3EXIA 2VDNB 3Q2IA 3FFXA 4C0XA 1T3TA 3AJ9A 3GLGE 4JLUA 2A58A 1UXOA 1ZO8A 1G4UR 3E22B 3X1KA 3ZK9A 1TVKB 3RFVA 5JMTA 4D8TA 5BVHB 5IF9A 1HTTA 4CMIB 2LUOA 1Q0SA 3NBQA 4MKRA 2OLEA 3JD4A 4QBHA 1J22A 2IKSA 1A8HA 4R0MA 1MX5A 1BN6A 3OAAA 4L4SA 4OHOA 2GFQA 3EY4A 4Q4JB 5I7SA 3IUSA 4TLCA 2IYYA 5U1PA 2FR8A 2A9RA 4KQ1A 2ZROA 3BN3A 2HCRA 3NTXA 5ELMA 3R7AA 2BMFA 2OZPA 2P9BA 4OXQA 3RK0A 2EJUA 3VA7A 1U7PA 4HQLA 3IMCA 3S68A 5FO1A 1JE1A 2UZAA 4X7MA 3ZTYA 4HV4A 2GZ3A 1XTRA 4KJZA 1KC3A 4DBLC 2IU0A 3HQ4O 2H48A 2H6EA 1SKQA 4K3VA 4DQXA 1UKZA 1BE6A 5B4TA 5HIMA 1BVHA 2CXOA 1CY1A 4OCZA 4OJMX 4ALMA 4J49A 1X0VA 4LGVA 3HGQA 3I5XA 2ES4A 4E12A 2FOLA 3MTIA 3H9QA 1C0KA 4MZXA 1L3BA 4FDUA 4OMUA 2X0KA 3BL8A 4LNHA 1SXGA 4B4OA 1T29A 2VP6A 3LZCA 4KH0A 1B14A 1FC0A 5TMDA 2GPJA 4KQEA 5FPPA 2Q6TA 4BB9A 5HOEA 1PN3A 1MDBA 4TRRA 3KL4A 2QTCA 1A96A 3Q12A 1AZWA 1PGJA 2XTZA 3OX3A 4BV2A 2EC5A 3F73A 4ZAYA 3IJ5A 1GQOA 3NUZA 1WU7A 2XBUA 1UXKA 3MCZA 4MJ3A 3WB2A 2Z8XA 4YRGA 3AQIA 1Z7GA 3U40A 2OP1A 3BCHA 4JJZA 3MTDA 5FWDA 4B6FA 3RSQA 1S4QA 3IKVA 2VDWB 3KOUA 5AJXA 1CP3A 3Q7EA 3WV5A 2Y68A 4KREA 2GUGA 2C5GA 3R7LA 1AA9A 1MXHA 1YJAA 5JD4A 5I3CA 1CQJA 1G20E 1ZQ1A 2BKLA 4O4IB 2OE2A 2FEWB 3ANMA 3PXAA 3TMYA 1N2SA 1AD2A 4M1QA 4M60A 1KMHA 4WZZA 3GT3A 1HLPA 2SBTA 2BIFA 5TF4A 1Y8ZA 4U6SA 2AT1A 4HDNB 2X9VA 3M6IA 3SMVA 1EWVA 5F9MA 3SPXA 2PKQP 3BSYA 3DE1X 3CMMA 3CPJB 5TRTA 3P0IA 1PBTA 1YB5A 3BJMA 3R5XA 2IBTA 5EE1A 1ZSNA 1LPNA 1T91A 3GEEA 3MMPA 4ITUA 4J0GA 1IDOA 4KKXB 4ZXFA 2G0TA 4PW0A 4L4UA 3P5BA 3VV3A 1ZM2A 2LR0A 2NV0A 1I3MA 4W9NA 2HA6A 2X2PA 3PDJA 1NU8A 3NHWA 4PSCA 3U3OA 4BVAA 2QBYB 4G1BA 3ISVA 3CYFA 4FJ2A 6NULA 2ZAIA 1RCUA 1IY1A 1RM5A 3DZBA 3IKLA 5CA0A 2YJ5A 1V43A 1TKCA 2GHQA 5AI5A 3P5SA 2X7XA 1HYEA 3JZAA 3P19A 3R44A 4UBOA 1B8VA 3CKKA 3RIMA 5IKMA 4XEHA 1YQQA 5AM2A 3UKDA 1F8UA 2G9ZA 4MRVA 4DDWA 1CJSA 5LBTA 4RJTA 3V8PA 1T1EA 5IZ4A 5M29A 1ZJWA 3PJRA 4MRNA 4Y7CA 4NU6A 3FRHA 2PUEA 3DT9A 1SHJA 2WWIA 3PX7A 1Z4NA 1XALA 4N5NA 1WCV1 4K6FA 1JI0A 3H11A 3OFJA 2DUNA 5GP1A 4JLDA 1RAIA 1R37A 1FU4A 3P1JA 1IWOA 3LP6A 3W9UA 4Z1MD 3SLGA 2IEDA 3IL2A 1CETA 4IG4A 3WIVA 1XNHA 1U65A 3E22A 3GEPA 4FS3A 3ZDFA 4YUAA 1Z2EA 1QHXA 2VDOB 2J6BA 4R98A 5F52A 3ZE1B 2JFUA 2JW5A 4TUYF 3DBLB 1CCWA 3DDCA 3HVUA 4O4HB 1MAVA 1SCIA 1TMOA 4P3NA 5H4GA 3W5SA 2VXYA 5FFNA 1UBFA 3LXRA 2PSDA 2WF7A 3C6MA 4RXMA 2OO5A 3DYIA 3DCIA 1G2PA 3UWPA 4ALJA 5F23A 4GM0A 5IFKA 5DHAA 3KKMA 3UJAA 2HNBA 5T3YA 3E8XA 1DP4A 4WXMA 3PXGA 4EO4A 5JWRA 3K0HA 3ZCXA 1X86B 2Y1OA 6PFKA 3DHWC 4RACA 1Z4IA 1OXBB 2KE5A 4LBWA 2O5CA 2O2DA 4ON9A 3P9NA 1J2UA 5F4BA 4RTQA 2I4MA 2JBHA 1BHQ1 1OX4B 1FA9A 1UKAA 2YJ4A 3E7DA 1XZGA 3FHLA 4HB3A 4YO8A 1YZNA 3GZNB 4A0QA 4A7PA 3OTHA 1SU7A 2Z9CA 4TYYA 1QG2A 4ZHSA 2YHIA 3E8SA 1V1JA 4YQEA 5C31A 3U6BA 4ENTA 2IQ5A 3JD0A 3O2NA 1WXFA 1WE2A 5TXGA 1POXA 1B8PA 1KBZA 3OZGA 5BN5A 1JJ7A 3C15C 2WPNA 1W96A 4DREA 3NONA 3KJHA 1O0CA 4RZSA 3L0OA 2X0JA 2NO9A 3C5EA 2CVHA 3FETA 1TEXA 4MW2A 1YJBA 4B33A 3UV3A 3C3BA 3ELBA 2PLAA 2HN9A 3SJUA 4OBEA 3VC1A 1S3GA 3LBFA 4D98A 1G7TA 2RJ3A 5F2KA 2FFJA 4WNAB 2RGBA 1ESDA 3L4BA 3PITA 5E6RB 4W7HA 4ZMSA 5TGTA 1X87A 3FGZA 1W47A 2DFKB 4JP3A 1H2YA 3MTQA 4KFSA 1AKQA 3T7JA 1QQ6A 4W82A 1DDGA 4DCSA 4DR6B 3A28A 3UMMA 1EUQA 2B21A 4HKTA 4U7DA 3GJRA 4Z9XA 1C9DB 1L8OA 2Q3DA 1R9GA 1T9KA 1YGPA 3A1WA 4M8LA 1EWQA 1DRKA 3UH1A 1JVSA 3JRXA 1TKBA 4COKA 3KUCA 4OUDA 3EARA 3L7MA 3N6XA 3F6SA 4RPGA 4O4LB 1DJLA 3VR4H 2DPHA 4YDSA 2OY0A 2PPLA 4U7JA 4D92A 3S5UA 1K6XA 2VH1A 1FNDA 1JXAA 3A9CA 2QG4A 3DBIA 2R7MA 4QPJC 1UINA 4LJ4A 3WTBA 4DS3A 1NI4A 2O5VA 4L8GA 2BFDA 1L5OA 3HGTA 4IDQA 4MIYA 3CRW1 1Z4PX 1E1KA 5EQFA 3RRFA 4EGFA 5JS7A 2QTZA 3HUDA 2C9OA 1DBQA 1NKTA 4PC7A 3VHXB 4CR7A 1ZVJA 5FTLA 1GHTA 1YQDA 4NECA 3TSOA 1EHYA 1TVMA 3L7LA 1OCEA 3H65A 3HY4A 5KB3A 4BVKA 4F8YA 2I7XA 2A5YB 3BCRA 1SVWA 2PUCA 4ITRC 3G0HA 1T43A 1AZSC 1NR5A 1RWBA 3WLLA 3F9RA 1KMIY 3TPCA 4Y30A 4AMUA 1ORWA 1NIJA 3K1AB 2X8BA 1B0AA 3C0KA 2CCGA 3NCHA 5EJAA 3PXUA 2VHUA 4N6GA 5K09A 4C5CA 1SZDA 4HLQB 4HLNA 1JAHA 4HXYA 1WNTA 4WH0A 4IMPA 3B20A 4LHEA 3R20A 4O4HA 2FGJA 1ZW6A 3PK0A 4MV5A 2O52A 3GU3A 2YR0A 4WSOA 2ZI3A 3QX8A 1ZH2A 2AOTB 1FY2A 2O9JA 3TZKA 4EJSC 2MMCA 2QY9A 3N7AA 1IJEA 4IV5A 1LY1A 1M7BA 3B7WA 2Y3IA 3AF3A 5KPJA 4IIEA 1PJTA 4QJ4A 3UB3A 2OBYA 1ISGA 1ADYA 3WYGA 3WWCA 1Q12A 4ACAA 3C97A 1GEEA 4QYIA 1IPHA 4LDZA 4P2GA 3MIZA 4PYLA 4QUAA 4UEOA 5E9AA 3RVJA 3WSVA 1YFZA 4ZCRA 3KUXA 3DFIA 1Z88A 3DE6X 3TB6A 1KK1A 1V9CA 3KL2A 4EBFA 2AI1A 4L16A 4N4AA 2GAJA 4W5WA 5FO0A 1NW5A 3ND6A 3S2SA 3UGQA 1GKLA 2BMVA 5TE9A 3UK6A 3W3ZB 2FG5A 3U13A 1H94A 4BNLA 2WFMA 1T1IA 4JNCA 4LE1A 3AFNA 3GP5A 2O2XA 2PX0A 4HNGA 4JP1A 4R8KA 1NSFA 1O94A 3WBJA 3EDMA 4FOSA 1Y4AE 1JYFA 5JRDS 2OFXA 4NZ9A 5JNRA 1RWQA 3FSEA 2DECA 4WJKB 3AUTA 1HZJA 1UBHS 1V5IA 4P4SA 3AB7A 1IBLB 3GLUA 1XSEA 3SX2A 4J8PA 1Q7TA 1U0BB 2J6IA 1W0JA 2O8CB 3Q85A 1EHIA 5LDDC 2RE8A 3RW9A 5KDLA 5DHPA 1OU0A 1EDBA 3KR0A 5CDUA 5LZ4A 3SJCA 2APJA 2IS4A 2JK0A 5FUMA 2G5PA 2BR3A 1MVNA 2ECOA 2YZNA 3B8EA 3CEJA 4I4IA 5BOSB 4DBZA 4ENWA 1WCYA 5DN6A 2IPXA 3A9RA 3MERA 4OIMA 2C9CA 3EWIA 3N5CA 4ZVKA 5L7TA 1DTSA 2WIBA 2ZCUA 1R5JA 5SZKB 4XSHA 3GDGA 3M3HA 2ZBRA 3W8EA 1BFUA 1PJQA 3U3DA 4LE0A 3LOUA 1FBTA 4UBIA 5K99A 1X1DA 1P1JA 1A9ZA 4AU1A 1XG5A 3UAYA 4LBYA 2FDCA 2GQ0A 5EXEA 1Z18A 2MR6A 3WLEA 4Q03A 5GGXA 3UIEA 3KVOA 1UZMA 1UBRS 2HA7A 5KYXB 1SC1A 4H4EA 2O8EA 4C08A 4RV4A 3PRKE 3EOBI 1RQRA 2IU3A 2O50A 1FUEA 1XVUA 1ILWA 4R81A 5SY4A 1NMQA 5JXIA 1QF9A 1GZUA 4HDRA 2HPZA 2V55B 2YFQA 1QCZA