4IUBS

Crystal structure of an o2-tolerant [nife]-hydrogenase from ralstonia eutropha in its as-isolated form - oxidized state 1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
264
Chain Sequence
PRTPVLWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAAAGHQAEAILEEIMTKYKGNYILAVEGNPPLNQDGMSCIIGGRPFIEQLKYVAKDAKAIISWGSCASWGCVQAAKPNPTQATPVHKVITDKPIIKVPGCPPIAEVMTGVITYMLTFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQFVEEWDDESARKGFCLYKMGCKGPTTYNACSTTRWNEGTSFPIQSGHGCIGCSEDGFWDKGSFYDRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversible [4Fe-3S] cluster morphing in an O2-tolerant [NiFe] hydrogenase.
pubmed doi rcsb
source organism Ralstonia eutropha
molecule tags Oxidoreductase
molecule keywords Uptake hydrogenase large subunit
total genus 80
structure length 264
sequence length 264
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2013-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4iubS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4iubS02
4U9IS 4UPVA 3USCS 5JSHA 4UE6A 4UQPA 4TTTS 3H3XA 4KN9S 5A4FS 4KO3S 4KO4S 3ZE9A 4CI0B 4UPEA 1UBUS 4UE2A 4IUCS 4IUBS 3ZEAA 1YQ9A 4KL8S 1YQWA 4UD2A 4GD3Q 4UEQA 5A4IS 2FRVA 5JT1A 1WULS 4IUDS 1YRQA 1UBHS 4KO1S 5JRDS 1E3DA 3CURA 1WUHS 4UD6A 5ADUS 3ZE8A 1UBOS 1WUKS 1WUJS 1CC1S 1UBKS 4URHA 1UBRS 1UBTS 5JSYA 3ZE7A 1H2RS 1H2AS 4UCXA 1WUIS 1FRFS 3CUSA 4UCQA 1UBJS 4UEWA 1FRVA 5D51S 3RGWS 5A4MS 4OMFG 5JSKA 3UQYS 4C3OB 3AYZB 5JSUA 2WPNA 1UBMS 1UBLS 4U9HS 3AYXB 4KO2S 4UE3S 4UCWA 3USES 3MYRA 4UQLA 3ZE6A
chains in the Genus database with same CATH superfamily
2AB0A 1VHWA 1O5IA 5JBIA 4KN8A 1NLUA 3R20A 1N33B 1GPWB 1GNLA 1BX1A 4I50B 3ROXA 1J2RA 3HKBA 4BO7A 3KKPA 1UCFA 1WHSB 2Z30A 4F4DA 3Q11A 3P2EA 3LDHA 2Z43A 3C1OA 4P3PA 3H4MA 4YHBA 5JAMA 3K0AB 3K15A 4U3JA 1O9GA 2FR8A 1B2RA 2GNOA 1BU5A 4PO3X 1NNSA 2FPIB 2LCFA 5FO1A 1EHCA 1NQ5A 4MMXB 2XYVA 1GNPA 1MX9A 7ABPA 2EFYA 4K46A 5HILA 4G1FA 3PNLA 3RROA 2Z6VA 1V37A 4XQGA 4K8RB 3U37A 2FFHA 2RHGB 1J22A 4IMIB 2XE7A 4X3PA 5DT2A 4OAPA 2Y8EA 2XMDA 4GM0A 1W7AA 3CF6R 5FT9A 1YBFA 1P0IA 3ZTTA 1DIGA 1XPUA 3DQPA 3OY7A 4GQAA 5KU7A 1IN7A 2BFAA 2VDRB 4X1YA 5J23A 1SG0A 2K2WA 4GX1A 1J0DA 1CR4A 1JIXA 1Z7YA 2FE4A 2XUHA 4FYVA 1CUVA 2X2FA 4KQIA 5CPBA 3H6GA 4HYEA 5FHQA 3TJRA 4BJ5A 3DL2A 2SKCA 1N2BA 1XZHA 1ZNYA 3CH7A 4DDWA 5DLDA 4BQEA 3D3NA 3BWYA 3VYWA 2B6HA 4W1RA 1RQNA 4JUIA 1LNZA 1S4MA 2WKQA 1DX9A 1FUIA 2NPOA 4ZOBA 1OW3B 2EARA 1HRDA 2HJGA 2BFPA 2XYPA 3C3KA 2ZS9A 3LRPA 1Y5RA 1U0NA 3C14C 2PKRA 3AIIA 2RAFA 4PZYA 1FF9A 3A3PA 1Z2OX 3Q7PA 4P31A 5HVNA 4X7RA 1E9VA 3JVDA 3EEBA 5BWCA 2XNDA 2F7SA 1DT5A 1Y8RA 2BDTA 4J3FA 2W6JD 3I9V6 1G16A 5ALOA 3BGIA 3AEXA 1FTGA 2GBCA 5CK4A 1ZCBA 5IAAA 2Y1CA 4L5IA 4REQA 4HDNA 2XUIA 5EKSA 5HF5A 4DYVA 1G8MA 3S1SA 3LH5A 2BGKA 3GJTA 3OPMA 4WXMA 1V1RA 5F1YA 4CLRB 5FPTA 3E9DA 3PQ8A 3MIIA 4OYHA 3T7IA 5GP1A 2JFXA 1AOXA 2ACKA 3SIXA 5GMOA 1ML4A 3KEOA 3NG1A 1Z08A 3H11A 1WDKA 4PPGA 4DDUA 4JLUA 2QVZX 4N7MA 5HSGA 1TCUA 4DANA 1Q7RA 2QLJA 3PUZA 4EGQA 2A5FA 4C0WA 2X4LA 1JIVA 2WWWA 3ZK8A 4BPRA 1EWTA 2B8WA 4IDFA 4IVRA 1DL5A 4J7UA 4AF8A 3CQ9A 2C2XA 1WQ1R 1XI2A 4CVNA 5IAOA 3SS9X 2CBZA 1NOKA 2R2AA 1TM4E 3ILHA 4UUOA 3G59A 3ZN2A 5EJIA 5BVHA 2PUFA 2NPFA 1BE0A 3CSSA 4C4OA 2MINA 1WXDA 1GGEA 3UFXA 1MDFA 2A57A 5DEIA 3KQQA 4O59O 3VDNB 4W5JA 3DVAA 1Q95A 1WY7A 3FY4A 4O5OA 1T3GA 2QN9A 3GJ6A 3L43A 3PC2A 5FLEX 1MAVA 3WLKX 4EGFA 2OCXA 4EARA 2FMTA 3CUYA 1Q17A 1W19A 2XUFA 3EFBA 1ZVMA 2WILA 1AGNA 4BMDA 1HL7A 3L7IA 4WLFA 1OLSA 1HE1C 3G0BA 3UWMA 4BVLA 5FIUA 3FVQA 3WIEA 3ZVLA 4M1OA 1YQQA 1EDOA 1WAMA 3GFVA 5DHPA 2OP0A 5LXTB 5BVHB 3RVLA 3IEVA 2IZOA 3X1ZA 2CY0A 4KV7A 2IEBA 3AP1A 4JLNA 1B8VA 2I6TA 2DFTA 3GP3A 4ZVSA 1W0JD 1TI7A 1H6BA 1KBQA 3IHKA 4GNRA 4ESHA 1RPZA 4C7OB 3DQZA 2H1CA 3WL4A 1OFGA 2C2BA 2NU6A 4OQMA 2Q7DA 1LGYA 1L4EA 5FUQA 4B76A 1EUDA 2NVUB 1XTJA 4OREX 2ECQA 3A3OA 4Q03A 3VU0A 3ZE9A 2HNKA 3N2KA 4LZPA 1TEXA 3AFOA 3L6BA 1VHTA 4KPYA 4HMPA 4NZPA 5JS6A 4J3NA 5TARA 4DRXA 4QASA 2PA0A 4PYQA 3LYAA 5DV9A 1E9DA 1G2QA 2REQB 3RODA 3V4SA 1ABEA 4JUCA 1SA0A 1UINA 3LDUA 3KS9A 2XAAA 4MKHA 4LSGA 4LDZA 1P80A 2JLXA 1NF9A 1E5XA 3QHAA 3GNTA 1EP3B 3M9WA 1K08A 4IVNA 4MRRA 4GE3A 1PFQA 3ZGOA 1Q1QA 3GLFA 1J5EB 4QGHA 5AH0A 2H65A 3GJ4A 2O05A 5IC6A 3T7RA 2R7MA 5KKCA 1GCUA 3ORFA 4ZHQF 1TIKA 2JD1A 3H65A 4E09A 4YDSA 3QP9A 2Z2YA 5EXDA 2WTEA 3CZ5A 1U0TA 3F3YA 3ISVA 4EOGA 5A02A 5FD8A 2XA2A 2MT9A 3LD9A 3QFSA 4GQIA 1MO6A 3MRXA 3N5KA 3VR4H 2PRSA 4URZR 1JG2A 1UBCA 1QKKA 1TT5B 5BSFA 3UK2A 2JAUA 4UBNA 3RAEC 4PLPA 2ODEA 4RETA 1QXSA 3E8XA 5E8RA 3S6JA 4EGSA 1ZD5A 5JMOA 1IWPB 5ES4B 1EA7A 1FFAA 3OIDA 1SK8A 1NQUA 1T0IA 2W2OA 4IIJB 2UKDA 1R6BX 4EB3A 2ZJZA 4JP8A 5DHRA 1LVGA 3JV7A 5P21A 3CBGA 5JEDA 1XNQB 1MO5A 3IUJA 5M7EA 1BXZA 1U1FA 3HDYA 2J3QA 3BRQA 2BKLA 1F2UA 3ND7A 2X0RA 4JOSA 4FEEA 3T7TA 1F48A 2HLPA 4EA7A 1M8KA 2QP4A 2LBPA 4WQMA 2A3RA 4I81A 1P4AA 2Q46A 2IZZA 4XX1A 3RIEA 3EVBA 3UOAB 3VUEA 3PNYA 1W4CA 3AHIA 3RF6A 2E4UA 3UJBA 1FNSA 4QO7A 4XGQA 2IIVA 1AM4D 3R7SA 1NUAA 2PRZA 4R1PA 4NJEB 2XGMA 2OL4A 2AX3A 2XB9A 3I0MA 6CHYA 2P5YA 3FFAA 1C3LA 3C8ZA 4LGCA 3UF0A 2I0FA 1G60A 1VSTA 3ENQA 4L51A 4D3ZA 4Y2YA 1IBCA 3KVRA 1ZGBA 2D3TA 1QRTA 3ABQB 4EGJA 2BTQB 4F1WA 2DY0A 2PWBA 1UK8A 1W4LA 4HOYA 2HA0A 1P7ZA 3OBBA 3JPYA 4KDCA 4WNIA 1R1DA 2ZCUA 2ZGVA 3LPCA 4L8GA 5HK9A 2QD3A 3T9BA 4HEJA 5DYYA 4Z6KA 1YJBA 4D9CA 5CDFA 2J9ZB 5EP2A 4B83A 2C3UA 5DHTA 4GC5A 4QT4A 1YKSA 2CHFA 4CMJA 1P7WA 3DR3A 3W9SA 5CB4B 4QRHA 5LBUA 3IAM1 4IYJA 2M32A 1R00A 1CY6A 1DC3A 2JVJA 2PANA 3WQQA 2GAAA 2AFIB 2DR3A 1RLMA 4UNPA 3OOYA 1UC8A 4HWPA 1Q1ZA 4FW9A 4J1TC 5FLYA 3WKEA 1JAHA 2XB6A 2BEVA 4OKSA 1ZRSA 4JP2A 4DM7A 4XLZA 4FI3F 1RSZA 2VDMB 3NTOA 4Z3KA 2HHAA 3G85A 2BMJA 2FPMA 2YVLA 2IPOA 2G4LA 2H11A 2IXAA 2J7KA 2ZI5A 3CGGA 4HZUA 3VGPA 4CF7A 2ID9A 3EGXB 3UMMA 2ONCA 5FNVA 3AP3A 3GFGA 1XEXA 2G1JA 4NNOA 1JX6A 1NOJA 3FLAA 4PWZA 5BSGA 4FGJA 1NV8A 2FZKA 3O9VA 1HDYA 1YKGA 2WF5A 2D2VA 3EXIA 3QEMB 3W6ZA 2PZEA 1W25A 1B2LA 1M0WA 3EQZA 3ROZA 1OXVA 4M9CA 2XGOA 1J97A 1RYNA 1H5NA 3H1GA 3M6VA 1SRRA 1W76A 4TS3A 5IP5A 1C7FA 1ZJ6A 3FPAA 3RAJA 3WXMA 5A03A 3I5YA 3EIOA 3THSA 1S2MA 1YIAA 1Y5LA 2OD2A 3V8BA 3QW2A 4FEAA 2C04A 1J49A 2QMQA 3WHPA 3AESA 3WRVA 1QV9A 1F0PA 4HDCA 1SVWA 3P2YA 1Z6QA 1LEHA 2YDXA 2C31A 4K9RA 4KDFA 1GKUB 1XEXB 3SQDA 1JEYB 3AKCA 3IR6A 4JQYA 4DARA 3G88A 2ZB2A 3AGPA 4RCZA 2IXEA 5J58A 3GVCA 1YVPA 3ONWA 4R2XA 4DF3A 4IOJA 1CS4C 1E1QD 4LDJA 4CGZA 3QE0A 5FTLA 1Q16A 4COKA 4WUVA 4C0QC 2ZYIA 3C3YA 1BE8A 3QBDA 4URUR 1QC5A 3EWNA 2C7RA 2G36A 2FQWA 1F60A 4L2IA 4EG7A 5CA0F 3NBUA 1KAQA 1PSDA 2QZ9A 4L0QA 3DZGA 1CJMA 3ICOA 4L3WA 4R41A 1PR0A 1NPYA 1AA6A 4Z51A 2CVHA 1KYXA 1S9DA 1U2RA 3HYSA 3R9KA 3SF0A 2PSJA 1VHLA 4AXXA 4IGEA 4DAEA 1YASA 4ESEA 5JC1A 1Z8FA 3TR6A 2C58A 3VHRA 1HDZA 3NUGA 4DSNA 2AW3A 5C46F 3HWX1 2EYQA 4DCPA 1HG0A 4I19A 5HTKA 4QREA 1AMUA 1YJQA 3NEAA 4X44A 1VJRA 3BXHA 3EQ8A 1RLIA 4BB6A 1VLZA 4D9IA 4UTXA 3F6YA 4GOKA 4XTRA 3EXAA 3X2SA 3THYB 3LT4A 4QXRA 2DBYA 5ERYA 4LF8B 3ZD8A 3ZE2B 2OWEA 5C35A 1AT1A 2LKCA 3BULA 3UOGA 1GWNA 1JWLA 1M8GA 3RVBA 1UDAA 1OYOA 1D2CA 1YRQA 1LWOA 1YB6A 4FMPA 1N6OA 1EBBA 4TZKA 1KERA 1NTRA 3U9SA 2FJ0A 5CYOA 1F14A 3R7WB 3QXSA 3F2IA 3GZNB 4YQZA 2WSBA 5JXJA 1K1EA 4B7ZA 2VSQA 3KR2A 1YZGA 4C89A 4FFPA 4BYMA 2BTOA 3OE7D 3ER8A 2XVAA 4OUDA 3KOXA 1Y5IA 5TV2A 5T7BA 2J3EA 2FSVC 1W5BA 4MV0A 1E7YA 5BWBA 3H8WA 2DBZA 1GNTA 1NVXQ 4OSPA 4YLYA 3PDWA 3VR1A 5J1SB 4AJEA 3U7HB 1Z18A 1YGPA 3MAJA 2P90A 3LKDA 4Q19A 4MR7B 4BZWA 5ER9A 1N6KA 5ALQA 1G5IA 3RTCA 1GILA 1E6KA 5BNIA 4CQMB 4EW2A 1OX4A 4HRXA 1MAUA 3D4BA 3OWOA 1E9AA 4ZAFA 3GDFA 3TLXA 1BS9A 2O2IA 3DZHA 1CQJA 3BTSA 3E1SA 3QIVA 2PX4A 3V4ZA 1YB1A 4EF5A 4ZYWA 5JROA 4FEGA 4Z49A 3DUWA 1MXHA 1O0CA 3PUWA 2XOKA 1KQOA 4LTMA 2SKEA 5AM0A 2BN4A 5ABPA 5MN4A 3BL6A 2Z6QA 5HOQA 2Q3CA 1G291 3CVJA 3K2BA 3WYEA 3O3OB 3R6GA 3K92A 1L9XA 1RACA 1NSYA 3MYRA 1NNEA 5IVKA 5E9WA 2G76A 2BMAA 1PZNA 3AV0B 4WBNA 3RW9A 3GLIB 4R0VA 4Q3EA 2HAEA 2MDTA 3BMCB 1JVNA 3N8IA 1U9YA 2BR3A 1PGOA 2KWIA 3FYUC 4NBUA 1Z8NA 1CQIA 1W2GA 1YRYE 4HH3C 4J0DA 5C4MA 1RKUA 5CYPA 4FB5A 3ECSA 2FG5A 3WYBA 3F6RA 4RTPA 3LPNA 5J40A 5EQFA 1S2GA 2A6PA 1R8JA 3OPNA 1IZZA 3OPYI 4L4SA 4OQZA 3RWMB 4AO6A 3L6EA 5IN4A 5LC1A 1Y48E 3IULA 3C3EA 4K1XA 1XQ9A 5FADA 3Q72A 3RH0A 5JARA 3OPXA 2FGKA 3M0EA 4DT1B 1MABB 1JW9B 3CM0A 1JLMA 5BRAA 2WJAA 4BQFA 3UJ9A 4PAWA 3BZWA 5TIIA 4IIGA 3D7SA 1TEHA 3URMA 3BRWA 1XLUA 4Y6QA 5FJIA 1U3CA 5B3JC 3EVNA 2BF7A 4Z4CA 1U1GA 3GV0A 3LNCA 5CM8B 1CRZA 4UASA 4GPZA 1F4VA 4UJ3A 4NYMR 3ZE8A 7MHTA 1YI1A 3N75A 4IVPA 4F8YA 5KX5F 1UOOA 1EJ6A 3EIWA 4GMKA 4Q47A 3GLSA 5FWXB 3HXOA 2J31A 4C29A 1VDZA 1JIQA 3FDIA 1M83A 5ICGA 3ANXA 3KXPA 5F7ZA 4H7KA 5IG2A 3QVGA 3CUTA 1T0HB 3FRHA 3M3PA 2P4UA 2RHLA 4HTFA 3V7NA 1U9CA 4IDOA 4B47A 1XCJA 3G17A 2PGIA 2XYRA 2I3ZA 2H2GA 3ES9A 2XYGA 2ZRCA 1UC9A 1XD8A 2Q27A 4H3SA 3IXQA 4QOGA 5B58C 1GPAA 1AQIA 4J1TA 4EENA 2G5PA 4HWRA 1IHXA 5KYXB 1WVIA 2VSXA 3JQ7A 1KJZA 3PTLA 2DE0X 1L0BA 2VSOA 1XCPA 2QTFA 4D8VA 2WJWA 3TG8A 3CEHA 3G7NA 3TIFA 3ZI7A 5K5EA 3W5VA 1I7LA 3R6LA 3TR5A 5A6VA 2UUBB 2UZAA 3F0TA 2FNAA 2X6TA 1XDBA 3MSCA 3E0XA 4NH0A 3KP1A 2ZRJA 2H4HA 5IT5A 4QYIB 2COUA 3HJGA 5LOVA 4EYOA 4Q1DA 2V1XA 4HJRA 1TM1E 3I05A 5HF9A 2WABA 3RDPA 2IXGA 4FKZA 2J6HA 2JAHA 1UPUA 4R84A 3WBKA 2WAAA 4AZ3B 4B85A 2WG2A 4WZBB 3COJA 3TTWA 4K05A 1ISSA 4ILEA 3THXA 4QZVA 1MKYA 2F4VB 4HQRA 3OUTA 1QM5A 1UAGA 2AZDA 5B53A 2ZUEA 2O8BB 3RIMA 1KJWA 3FUVA 3DBIA 1JDSA 1T4CA 4MAFA 4UULA 4AUEA 4JEIA 2PLFA 4NNPA 5BV0A 4C30A 3S3TA 4RDIA 1B00A 3NYIA 5H68A 1KJ8A 3G9XA 5JSZA 1UK9A 3DVRX 1E0AA 1PR6A 4YONB 4XD7A 4DYDA 4UZEA 2V0CA 1ACLA 2RHBA 3CH6A 5DB4A 5DTEA 5TQJA 4XUCA 1H05A 2JL1A 4U7JA 4F2HA 2I2XB 2O8DB 4J0QA 3T5MA 4YUWA 4RZ2A 5GM1A 2VDNB 3TNLA 1YVEI 3CLRC 4HH1A 2PH5A 3IP5A 3IAM6 1CUSA 5EZYB 3GDOA 4MYDA 3SZUA 4WUTA 3TLAA 3VHXA 1D5WA 2VHCA 3FD8A 3MWDA 4MW9A 4A0HA 4EO4A 3O8RA 1NM5A 1LX6A 2I78A 1MH9A 3DS8A 2C2KA 4WN9A 2XECA 3K4PA 3ESBA 1K3FA 3I6BA 3PFNA 1KVRA 1A27A 2POQX 3IR5A 3JPWA 2ZBQA 3ICCA 3L0SA 1DKMA 1FYDA 3ER6A 1N6NA 1ODTC 3A7EA 3EDMA 3RBVA 1JSLA 2VZ9A 3MYYA 4CCYB 4MH0R 1JNYA 2BHRA 4CL8A 5K05A 2V7UA 4GBMA 4K6OA 3KQHA 1R6DA 3TTXA 1SHTX 2Z2KA 4JR2A 1RAEA 1UDBA 4MQEA 2O8DA 2XCSB 3OLYA 5EIOA 2IUUA 3ZVNA 2VJNA 1UFVA 1VG8A 4MVJP 4KGXA 5JTUA 1KEUA 3RHTA 1UXOA 1A9XB 4MLZA 5I9BA 3UJCA 3M83A 1CVRA 2O20A 2JLSA 5CVTA 3BX1A 3NBXX 4OGKA 4OXKA 1U1EA 3W4KA 1ULUA 5FXMA 4XJTA 5IBRA 2WPDA 1C9KA 4PIMA 1WS6A 3K0CC 3A6FA 2ZANA 3ZD7A 2OBMA 2ZR0A 1B73A 2A0XA 2D8AA 3ZWAA 1YUMA 4DN6A 4FLMA 4OBWA 2WE7A 4Y1RA 1G5TA 1GPH1 3A9RA 3R4CA 3RNLA 1I2MA 3ANSA 4P84A 3KQKA 3P0IA 3FVWA 4KBYA 4BKRA 2JANA 5CT4A 1OZ0A 3ND8A 4IIYA 4XKJA 3H84A 1TU0A 5CFLA 3I1YA 3PQFA 5DASA 4BV2A 3DCYA 2COEA 2G4VA 4OQEA 3R0XA 4LQLA 3RIGA 2O3UA 4Q6WA 1KS9A 3FOEC 5KO2A 4MO9A 4GYKA 1XZLA 4NDAA 4ZC8A 3ZWXA 3KOUA 3KYCA 3LM8A 3LQ2A 4MYCA 4L08A 4L9RA 4R1NA 3E6AA 1PEKE 1ZIDA 2P4EA 3PXCX 4AXBA 2CW5A 5HE9A 3UM9A 4PNPA 3UJNA 1QIEA 2O23A 2MMCA 4X9XA 4CTOA 2AMYA 3F2VA 4E2XA 3AVTA 3NO4A 4G09A 1VBMA 4QICA 2DPGA 1UWCA 1WJGA 3AT1A 2XLBA 4QATA 5CFZA 1KJQA 1X1RA 3F71A 3OZEA 3CFYA 4TKLA 1YJXA 2FOIA 1QGAA 1RM0A 3BA6A 3HCDA 2HCFA 4AKSA 4M1YA 2NV2B 4YRAA 2C9MA 2DTXA 3BE8A 3OZGA 5AVOA 1OB5A 3RADC 1LSUA 4R8MA 3AVUA 3DOFA 2AQKA 3OCUA 4RFSA 5L3QA 3RUIA 4IHQA 1PYOA 1JFFA 1GAQA 4OA8A 3OE7A 4A0RA 4DNQA 2QD4A 3SBXA 2OCAA 1V1JA 2G63A 3AHEA 4GECA 1KOLA 9ATCA 4JOBA 3PZRA 2G1KA 1VB3A 3Q8KA 2WVGA 5JHGB 4GFDA 3TBKA 4NQZA 3JD0A 3GJ0A 1CF4A 3CEPB 1SC1A 2EWVA 3QE4A 2PYZA 4YAJA 4KPFC 3IEXA 4G85A 3DXFA 4KPUB 1ISRA 3BRSA 4GR4A 1PT5A 5AVTA 1KZ7B 2P2ZA 3C6XA 2FAXA 1TAUA 3H5WA 2G77B 4YMWA 3WLSA 3F9RA 3B2EA 1QX3A 4OHKA 2OB1A 4NZZA 2GB4A 5DISB 1E3DA 4J9VA 5BN5B 1E2LA 3FLBA 5BV7A 3E18A 3L49A 5JADA 1ZX1A 1RZUA 1SIOA 1T5OA 2Z8YM 3LK6A 1RAFA 1RAAA 2PMDA 4WCFA 4EFKA 1EZ1A 1L5YA 4W1PA 3AEZA 1RQPA 2VUIB 3OLCX 2X0FA 3TTTA 1ZR4A 1C9NA 3BYZA 5GJWC 1FVHA 2FCRA 5DN9A 1ZEMA 2ZUFA 4CU2A 4JCOA 2JLZA 1KA9H 1LK0A 1VA4A 1YR6A 1ZU4A 2ZE5A 3AM3A 3FHCB 3MERA 4OOFA 4OU4A 4QO8A 4CR7A 4JKOA 4BRSA 1EG7A 4KVAA 5EHXA 4Y30A 2PCJA 1G7CA 1PQPA 3HV0A 2D06A 2J9FB 4EECA 3K1AB 3DV2A 3Q8WA 3KK0A 4K9DA 4WFJA 1QLWA 2VYCA 1R2QA 1EG2A 3MCAA 4B6GA 2RK3A 3C98A 2EBWA 2FZEA 2G09A 3SF8A 4GX5A 4XGRA 1ZYUA 2FZGA 3FTDA 2NYVA 3OCWA 1V8ZA 2V8OA 3MM4A 4HDNB 4OJQA 2C2HA 2CK3D 2VPYA 4FZVA 2GCOA 4MPJA 4QVKA 1GGHA 1TB4A 3RUEA 3TRDA 2W6QA 1IUOA 4EG8A 2PPLA 3T3IA 4QNMA 1KO4A 5IVHA 5ESXA 3OT1A 2WNHA 4KUGA 4YP0A 5E7MA 2XWSA 2VWGA 4KIGA 2JFHA 4IV5A 5IDYA 3EBPA 4KQHA 3SQMA 1B76A 5NLLA 2C98A 2QDKA 3DLIA 3E84A 2NXCA 4NJMB 3EPRA 5FQNA 3ZU6A 4YRLA 3LKVA 4Q4AB 3T35A 2VSYA 4CCSA 3G1TA 2Q5LA 4RKEA 1BFKA 1XZDA 2CNNA 2WBLC 3DZCA 3JSXA 2C83A 5AVJA 4EYSA 5K4AA 1BXGB 4N8DA 3EZGA 3JQFA 1NFQA 3TNJA 3S81A 1OLUA 2H4ZA 4GOJA 5JAZA 2ONYA 2Y66A 4OK3A 1GM5A 1LNQA 4URYR 3NV9A 2Y99A 4RVHA 1POXA 4Z0TA 1P75A 3U3RA 4BFSA 4I8DA 2QRJA 1AUPA 1F1JA 5EZ6B 1RZ3A 5L6MB 5FOXA 1E69A 1FVXA 1HTBA 8LDHA 3IQFA 1N7IA 4FHFA 2BYTA 1SO8A 4GICA 2CFSA 3LBIA 1A72A 4FDUA 1PJSA 3T3EA 4B71A 2JI9A 5IRCD 3ADKA 5EE5B 4YGYA 4ER6A 4TV9A 5H9WA 2E2WA 3FUCA 3Q2OA 2GF2A 2RONA 3F8SA 3NBKA 1ZJWA 3VI3B 1MA0A 2OCPA 2ZJAA 3KPUA 4RJ2A 2PFKA 4MHOA 1M6NA 3ONDA 2OAQ1 4FFSA 4FDMA 4GI3A 3TQFA 4TUYB 1U80A 1LI7A 4QBHA 5COQA 4P38A 3LC0A 5HQTA 1JMYA 1FJHA 3K5PA 1QAQA 3TQIA 3WO0A 1N2CB 3CR3C 4KOEC 4ZI3A 3B1WA 4BO6A 3W6OA 3GF4A 4F8JA 4Q9AA 2Q1TA 2YDYA 4DQKA 1HDCA 3QY0A 1TFUA 1BW9B 3EA5A 3VH3A 4KQWA 4WEQA 1ECPA 3UK6A 2QPLA 4EG6A 4EJSA 4C4PA 4E1VA 3PSAA 1G4HA 1RMQA 3K6RA 1QV6A 2RD2A 4MRMB 4KYTA 1IONA 3OOJA 1N2GA 3ADDA 2OZLB 1TJ5A 5DU2A 1E1RD 3GLKA 4PYLA 4LDQA 2XR1A 3PX7A 2NUAB 2PSEA 3S28A 1YCFA 3FDFA 3KSDO 4C03A 3TOXA 3BGVA 4LYGA 1JQ5A 1Z83A 5AW1A 5GVSA 2DC1A 3GFBA 4C20A 4DLPA 3GIWA 1UUFA 2HW8A 3K1YA 3NBMA 2ZYGA 2Z4SA 4PIVA 3OLVA 4WLOA 3HVKA 5BQ5A 1G6HA 5CPFA 4LFCB 4RDXA 4RJKA 3DEKA 4HAZA 4MS4A 4YVFA 1P7VA 3N6XA 1W88A 1VI6A 1A7AA 1FOEB 1XCGB 2VYFA 2D2IA 1XC7A 3C4VA 2XJ9A 3RU9A 3ZVRA 3OQJA 2QU7A 1HY3A 1XDGA 1CY1A 2A1UB 4A2WA 4TWIA 3KWMA 3MWEA 2ZJOA 5DHAA 1LS1A 2ERCA 1JECA 4DSTA 1P19A 4ECAA 4A73A 1MB9A 4XIIA 2QTWB 4IIDA 1PR2A 3L84A 5CGQB 2PDAA 3E8MA 3QX9A 5IZ4A 3NM6B 4YRPA 1DKUA 2XNDD 3AERA 4KQ2A 4I1OA 2WU0A 1LB1B 3ZBQA 5KYKA 2FF7A 1AD2A 2V7XA 4Y6RA 1YAHA 3ZOKA 1BNCA 1O3YA 3OKFA 1JR2A 3TOZA 4LJLA 2PGNA 2D2FA 1YBMA 4TVKA 1C7JA 1CE8B 2VHEA 4AMUA 5JH7B 1U94A 2II6A 3ELWA 4DLSA 1I1HA 1TK2A 1CJCA 3QLTA 4FHGA 2JLVA 1JR4A 4C0BA 1EDEA 1I14A 1YVRA 1Y4SA 2BFFB 2QNBA 3L0IB 3MTGA 4GKBA 4YC7A 3GEIA 4BTLA 1R5OA 2NPIA 3GVIA 2JHCA 4RXTA 3GUZA 1E7RA 3ZXYA 1QORA 4ZT7A 1QE0A 2G7ZA 3B9QA 5FRDA 1R6TA 2JGFA 2IWRA 2O8BA 2ADMA 4QTUB 2J3JA 3MTAA 5K8TA 4DLXA 1E9EA 1FMTA 3DVQX 1B93A 1X7ZA 3GRVA 4LPSA 5K6RA 1E9RA 4JXJA 8OHMA 5DX8A 3WYCA 4CKXA 2C7BA 1SUSA 2C4VA 1J0XO 1O7JA 5ICEA 1U0BB 4IJQA 4Z0HO 1VYUA 4BWFB 1JSRA 4GMHA 1QCCA 1CQZA 1DWUA 2IZ1A 1PWXA 2QPOA 1M5TA 3I52A 1E96A 3A4IA 4G5XA 2JGIA 4IKOA 4UJ5A 1KI3A 1WV0A 4JI0B 2YXDA 3P9CA 1TT5A 4M0MA 2FQYA 2RGCA 1WF6A 3V9AA 1RDFA 1XRSB 2EU8A 3DH0A 1U3VA 4HZIA 3EH1A 1C8KA 4FMDB 1O57A 1D4OA 2B5WA 4MRNA 1WY5A 2IS2A 1SOVA 2NU9A 2EJVA 3E5NA 4MGIR 5DDIP 3BEOA 1OILA 2DFNA 4FHZA 3AIOA 4E46A 3WGIA 2QLFA 3CINA 3IESA 4INJA 3ETGA 3GLHA 4BEVA 2BAGA 3O93A 5A4FS 5C0OE 5HE8A 2H3EA 4NHOA 4FCCA 1QRSA 4RX1A 3T4PA 1HTTA 3NM4A 4B1FA 2C20A 4D7AA 3NWEA 4R8LA 1KP3A 4IQ4A 4JI3B 3RSHA 1Q7BA 4P8RA 3SHWA 5AJZA 3G7UA 3LLCA 2EZ4A 1E7WA 4PG8A 4PFQA 1XHFA 3I8SA 4LZJA 1P9LA 4WZAB 1GZ3A 5HKKA 4GPTA 4MQBA 5B1SA 2UXBB 2B83A 1J2EA 1XZNA 2VJKA 3I6QA 3OCVA 4JR1A 1THGA 1JLLA 4O2AF 4TXHA 2MCFA 5FOWA 4F72A 3CONA 4F4FA 4RPKA 3JASA 1NVKA 5JD6A 1FDOA 1HLGA 2WJPA 2JCYA 3FZGA 3GEMA 4YS6A 5E6UB 3VBCA 1KO5A 3IKJA 1E5QA 4ZDWA 2HNAA 5HZHA 2Q8NA 4DIBA 1NT4A 4WXRA 3ELYA 3R1IA 1OBVA 3QYJA 4NHEA 5IWAB 3ZJYA 1V3QE 4NFLA 3KU4A 3EQ6A 2OFFA 4MIEA 1MB2A 4ZOLB 3TW0A 3F6CA 3ZWDA 3LWNA 2OPBA 3C1AA 3WX0A 5JYCA 2E87A 2CUTA 4Q7KA 4C76A 2ZG6A 3BXOA 3R0IA 1DBIA 1MMFB 4YCMA 2P6PA 2HO4A 2YJ3A 5A6SB 3D6AA 2FRDA 3DZIA 3URKA 1N3IA 4FFRA 1VXOA 1BYUA 3HCRA 4XAQA 1JEAA 4ICIA 3NATA 1C3JA 3GLGE 5FUMA 4RIIA 4RLQA 4XDHA 1HLPA 4BDSA 1QG4A 4BAUA 1XCLA 2C95A 3IPAA 4PHFA 4X7PA 4MVXA 5GJVC 2EKBA 3RD5A 4F12A 5FCDA 5TXGA 1KDVA 2Z8YA 3M9XA 2O4UX 4ZVPA 1PNQA 4YLEA 3HEAA 2ZETA 2R1VA 4DILA 3HCFA 3D6MA 5JJBA 3HP4A 5UKDA 1M2WA 3QG5A 3NHFA 4D43A 1F1BA 1QRAA 1ZJJA 5IDXA 3IV9A 5LLSA 2X5NA 4AYXA 3IOEA 1I7DA 1K0FA 2XNSA 6YASA 1XJQA 1XO1A 2HUNA 3GFFA 4ZI7A 1DEAA 4WNCA 4KN6A 1QFYA 1W96A 3K31A 3E23A 2C4HA 5DNAA 1UBNA 1DKNA 3V7YA 4D6YA 2ORIA 1EWKA 3MELA 2AN9A 5HKLA 4PQEA 1DQRA 4BAGA 4D9MA 2FPKA 4MVJE 4RIHA 1NR7A 1CPYA 2I65A 2YYSA 4R9RA 4WH0A 2SHKA 3HB0A 4TS9A 4O4IB 1DOHA 1W9MA 3LT2A 2O3TA 4O2BF 3LLMA 1EVZA 4J49A 1QKIA 2H63A 2UYOA 1NHWA 2O14A 2C03A 5DM0A 4ZWNA 3WWEA 1QGYA 3SNHA 1UM8A 3C45A 3F9IA 1OLOA 5H80A 2WIBA 2PMCA 1K7XB 2FLWA 1U2QA 4E5PA 2HLHA 2Q5FA 1MAWA 3K7EA 5IN5A 3KR9A 1I30A 3I8XA 4G9BA 4Q18A 1OZGA 2EF1A 3VH2A 4OG2A 4ALJA 3A4YA 3UAYA 3L7YA 5AK4A 1RVV1 2VP4A 1XG5A 3D8NA 4D74A 4C3OB 2M2IA 3RTAA 1ZH6A 4C6TB 4DTCA 4C01A 1PR4A 2JCSA 3AXSA 3HA3A 3E82A 4IMRA 3RC2A 1WSWA 2NQ8A 3DEFA 1E0DA 3QHPA 4BNGA 1K66A 1OF1A 2JS7A 2P4SA 3X2EA 1ZGAA 4O1IA 1A9PA 2P27A 1NU6A 2QXYA 3QMMA 4IXTA 4I5GA 4I3HA 1K6EA 2I3BA 2G8LA 2Z83A 4IH4A 5JATA 2PGOA 2QN7A 5ECYA 5LDGA 5JECA 5F5NA 1BJKA 4L5JA 2XH8A 3RF7A 3W8DA 4A6EA 3OOHA 1JV2B 3IO5A 4RA9B 2ZUSA 4GOMD 1CQJB 1EVJA 5C1PA 5JR3A 3CT4A 4LE1A 3ND6A 3OA2A 4QTXA 5IK2D 1YHZA 5CB6A 4EW3A 3M49A 4KO2S 1SKUA 1W0CA 1FZQA 5LYJF 3AWIA 3G0GA 4Y9DA 4A7PA 3IMGA 4M1WA 4UM5A 2VPXA 2NXWA 1UJCA 2P2LA 4QUAA 3PFCA 4LVOA 2XOKD 2XHZA 5K3AA 2PFSA 4Y2JA 1RZRD 3IAFA 4IUBS 1QTRA 3ZIDA 4JBYA 1A9TA 4PZZA 5K45A 3CX7A 2IYSA 2PH7A 5DGIA 5IVPA 1ZCAA 1MGPA 1FFCA 2B20A 4MVJA 4PWYA 4RAOA 1IHYA 1J8FA 5EJAA 1UEIA 1OWPA 1ZM7A 2FY8A 1SZPA 2RSLA 2QUAA 4P5PA 3R7WA 3T5BA 1D09A 1N1GA 4KSYA 1BVRA 4ZARA 4TL8A 3A6DA 4Z54A 1M6YA 4JL8A 3SCZA 3RTEA 2Q4TA 1MFZA 4R9SA 1C7IA 3VVCA 2R6FA 2K2QB 4CDMA 4E4YA 5KOHA 2DX7A 4DQXA 3HXQA 2RI6A 4MB0A 2D0DA 4P3OA 1ADYA 1OJ7A 3BC1A 4WASA 1ZVQA 5I4CA 4JP3A 2XEXA 4B75A 1MA3A 1NZDA 5C1IA 2OYRA 1V8FA 3A3YA 1J42A 1P2TA 3BH6A 3K72B 3ZY6A 3NDBB 3S44A 4QSMA 3FYSA 3SPXA 4MW1A 1TQHA 3PXUA 5H0IA 5L40A 4D79A 1TUIA 3DLBA 2J07A 1P3JA 4IYRA 2IY7A 1NI4B 4ZQIA 3JQDA 5MF6A 3PBKA 3JZIA 5KYGA 1ITZA 3FPEA 3QU4A 3KQOA 4RHEA 2P6NA 5DSZA 2QTZA 3EULA 4BVFA 1ZMOA 4OCZA 3LCCA 4DA9A 1MX1A 2X5KO 5DKFA 2XVZA 1EBUA 1GR0A 2OGWA 2WIGA 3W79A 1GARA 3D7LA 1NRIA 3JQRA 4QUIA 3GRYA 5DCLA 5ALSA 1MCZA 4ER0A 1KAMA 4OXNA 1L4BA 3AR5A 4PSCA 1TEVA 4LC1A 2JARA 3R3YA 3R4VA 5CT6A 2A1TR 4GKJB 5AKXA 1E2IA 3UXYA 4KXMA 4QGFA 3W6PA 4EZEA 4C2TA 2J3HA 2JCGA 4RLSA 1ODLA 1CZLA 2W43A 5FTMA 2FFAA 1USVA 1GPYA 2V7WA 5DM1A 2RBKA 2ZRBA 1HNNA 2PZ8A 1U3UA 3II6X 5IW8A 5E3IA 5MHTA 5DTRA 1ZIYA 1Q5PA 4R2IA 5DTQA 2HN9A 4DDKA 3BGOS 4QOHA 4K88A 1AX9A 5KHLB 2NUPB 1U8ZA 3LIIA 3HDHA 3LPDA 4I5IA 1IZ9A 4KIJA 4MUAA 3QY9A 2XQVA 2GYUA 3P2JA 3THOA 3ZJ5A 4IG9A 3NWBA 3TVTA 2C2MA 4Q4JA 4E30A 4BWYA 5GGYA 1AMOA 4NAUA 3UO8B 4MQFB 4YRCA 2AKEA 1YMVA 4IGFA 4XB6B 1Z28A 4N39A 4W9MC 1YVUA 1WMBA 2CDAA 3INNA 5DBEX 2IE0A 4B3HA 2IYFA 2VTDA 2PJZA 3DVSX 1IH8A 5TMPA 3IDAA 1ZJ5A 4AI6A 1TM5E 1K27A 2OC4A 3ZCRA 1S02A 5JXWA 3IQGX 4OI1A 1R3UA 4BCCA 2I99A 3OFSA 4KB5A 5A5GA 2XXAA 1L7OA 4GPIB 3LBFA 2WD7A 3AW9A 3BMQB 4I4NA 4UEWA 4D3XA 3WA6A 3NYRA 3CVVA 3KX2A 2ZROA 3W4JA 2HF7A 2IF2A 3AF1A 3KPYA 1RPAA 4RY0A 1XCMA 2W2KB 2Q3DA 3HJNA 4J0HA 3QBTA 2ZTUA 4BC1A 4YIHA 3MJRA 3AF3A 1C4KA 1NF8A 3KL4A 4HFMA 3KOOA 5BUCA 4G2TA 4PPFA 3L4EA 2AZ4A 4QDOA 2PSFA 4IGIA 4E33A 1DQZA 1KZ1A 4HQFA 4TVOA 4YJHB 3RT9A 2XWJI 2V45A 4MP6A 4N7RA 1OVMA 1T5HX 1EIWA 3UN1A 1CUEA 1RIFA 5ADVA 2P2DA 2FK7A 1RJFA 1H0HA 3MG9A 1CXZA 1WXIA 2CMFA 1X94A 2K5UA 3ONEA 4LJ6A 4DCTA 5DLEA 3OQIA 3WWZA 4ESOA 3WQHA 4YRMA 1NLMA 2NVWA 3N28A 3O1IC 3QXHA 5IU6A 4CUZA 5DI3B 1TO1E 4CLOA 4M8SA 3TLMA 5B3LA 4Z1MD 2JPDA 1ZI6A 1QVAA 2GILA 4FFOA 4W6QA 4JZKA 1SXJB 3U7FB 2PV0A 1IZ0A 3EASA 4LJ5A 4KUHA 2VBCA 2NO5A 2H1HA 2VH1A 4R4JA 3OD5A 3GX1A 1V39A 5KJFA 5L7TA 6PFKA 4NBSA 1DX6A 1T3HA 1R0SA 3V3TA 3GU3A 4OLAA 2VT7A 3OZAA 4KVGA 5AK0A 4TS1A 5FOQA 1C81A 2VK8A 5BR8B 2HDHA 5AKGA 3E5HA 4IJVA 4TV8B 4AZVA 4MWZA 1NLFA 4HUQB 4LHYA 1Q1BA 2VP5A 3H9UA 3TPFA 4EX7A 2CT8A 2W2TA 3DMTA 3LBYA 1MFPA 3AIKA 3E1GA 2VCYA 5LQSA 5CK5A 4GLJA 1AC5A 2EZ8A 2QBYA 5ALPA 4MAAA 3DTNA 2H59A 2Q8QA 4CM3A 2GDZA 1LLDA 2FG6C 5I8WA 2C57A 2X2EA 3L4JA 2OORC 1OU0A 1D2GA 3GUCA 4J29A 2GFQA 4RZ3A 4YPFA 3DAGA 3MCVA 3EUAA 3P1JA 1ZSNA 1SKBA 4QHSA 3ZDQA 5A5FA 1R0YA 1MOQA 1MR3F 1QF7A 2TSYB 4NATA 3GP5A 1TGYA 4P53A 1GP2A 2QX9A 4MKFA 4OSOA 4RPCA 1GGVA 1M1YE 1YCHA 2H5IA 3C15C 1TA0A 2Q3JA 4ECEA 4AO7A 1ZM2A 2GTIA 1QDEA 1G8YA 1TL7C 3FA2A 5H02A 1DAMA 2KYRA 2R7AA 3A06A 3E7FA 1HYBA 1UBMS 2KS6A 5CM9C 4BN4A 5A9SA 4E5UA 3BJRA 5KSYA 3DOOA 4BKUA 1D0SA 3OAAD 1P7CA 3ROEA 1E32A 1TXGA 3OF5A 4H1UA 5J4KA 4M1SA 4NSNA 1X1CA 3ESQA 1N92A 3WRXC 2KPOA 2QTHA 4RESA 3ZVMA 4LHEA 2CL6X 2GD0A 3AQ4A 4E5KA 1WR8A 3ZHRA 2IBSA 5FBKA 3ROPA 2ODTX 2BF4A 1BCRB 5JTTA 1Q6ZA 4DLZA 2PZAA 4TTQA 4HG2A 2OHIA 4PS1A 1JR3D 3WV4A 4BO0A 4GC9A 4LPKA 4UNIA 1P1JA 4W1SA 3H13A 4FHDA 5EI5A 2F43B 1Y8QA 4FOSA 4FYPA 4K9QA 3OJOA 5FPQA 4EW6A 2NG1A 3E05A 2O8FA 5DBHX 4ND3A 4BNDA 5HKBA 5DSTA 4A8JA 1G8FA 1P74A 3GDHA 1GZUA 2IPLA 2I4IA 5LA6F 2X8WA 3K3PA 1MG0A 4MEAA 1XAHA 4PGFA 4BC0A 3KNZA 3LFTA 5FOSA 5HCIA 4M0UA 2XD9A 3FROA 2I66A 5TSDA 4BP1A 3UPUA 2E4YA 3RABA 1SHZA 3ZI4A 3ZS8A 3TQOA 4ZA2A 4A8TA 1H2BA 2NVOA 1EP2B 1MJNA 2KQUA 4ZCRA 3GAZA 3W78A 3WDMA 4A0FA 3L93A 4BE4A 3RU3A 4C04A 2VT3A 3ICVA 1Z4JA 1VKJA 1OBHA 5FTNA 4IJ5A 4BFCA 3FPJA 4QUKA 2R1VB 4JC8A 5CMLA 2BGGA 4LECA 5CITA 3HVJA 2GKSA 2OTCA 2YV1A 3IQIX 3KEFA 4LYJA 4FDTA 2VQ6A 2LCQA 1HNZB 1K92A 4K03A 4AZWA 1E4EB 1EUZA 1CDEA 3IA2A 2VTKA 2GZ3A 5EA2A 3LLUA 1K86A 4ZRNA 2B7LA 4NBWA 4GLOA 3PYXA 2PR7A 4K2AA 4OP3A 4XQ0A 2W2VA 1A3CA 2VQSA 2FH5B 1YR9A 4GWLA 1Q7EA 3UB3A 2QMUA 1QIDA 1YZQA 3RUDA 1CQPA 4H7IA 2A8YA 4CF6A 2P79A 4OI4A 4B09A 3VR2A 3HE3A 1QGZA 4IIHA 4OQ4A 1QZZA 3CRVA 3PYMA 4KWEA 3Q6IA 1JHAA 1BCSB 3GW8A 3L0OA 4G01B 5LBIA 4B8ZA 3SEZA 1AGRA 1B7GO 4C87A 4KHPB 1V8BA 2EFCB 1A69A 2IUSA 4S1TA 5NULA 1JHOA 3HBNA 3K0KA 4BVKA 4C0JA 4HAUA 4FB4A 2WTXA 2GHIA 4L0DA 5BMOA 2DH5A 2EG5A 3OM9A 2NP7A 1GZ7A 3H1AA 5KJ1A 2CVPA 1MF7A 3RG8A 1ZN8A 1WXHA 4UTRA 2X9LA 5CDTA 4OKIA 3LBHA 4PNZA 5BW8A 3MCWA 2XRZA 1I3KA 1LPBB 1GGNA 2WI8A 4QOSA 2D7DA 1NURA 1SAYA 2GVNA 5J2UB 4BO4A 1A5ZA 3R3WA 1BQ3A 3FUXA 1ZBDA 2VR1A 3VYSB 2QW0X 4R2LA 2UUPA 5DLYA 1IWOA 1MUUA 2ZYTX 4HXYA 2R5NA 5K8VA 3GLVA 2ASEA 3CO0S 2VIIA 5ADUS 1QGDA 4IXDA 2BFEA 3S40A 1ML3A 3KG2A 4AP5A 5IXYA 3K70C 2IS6A 4Q4HB 1QGOA 3IJ5A 1ZJYA 1I36A 2RBGA 2DQSA 4EHJA 2GM3A 4X00A 3PFHA 3FDXA 4V38A 2H5EA 4ARBA 5IABA 2OUKA 3H2KA 3IT1A 4I55A 4B2PA 4GNKA 5HJ2A 2QJRA 1UODA 5A7HA 2WB4A 3DEAA 3SHTA 3QNWA 5KX5A 4BMSA 2G8NA 3IGFA 3KLOA 5EFOA 1ZGHA 2CXOA 4ZO4A 2FWNA 2VAMA 1FL9A 2WF7A 3BXGA 1DBRA 2AG1A 1C8LA 1KETA 2P77A 5HFJA 2ZT7A 3ZLBA 2EKQA 1SELA 3NH6A 4HHEA 2H8GA 1STOA 4KLCA 3I0NA 2E4ZA 4MINA 3EQ9A 2UXDB 3FNHA 1K9VF 3NU1A 7REQB 3SC3A 2JVKA 3O3MB 4CKCB 1HYEA 2EJTA 4M0PA 4QGGA 1FUUA 4M55A 1U2GC 1ZO8A 2I7TA 1U0FA 2JLRA 3SE7A 3QXJA 3SYTA 3NBYC 4L2IB 4GQBA 4Z8YA 3I2YX 4AYWA 1C8BA 4JNCA 2HHCA 4G8DA 3HXLA 3HSSA 5CTAA 3KHSA 3ABZA 1JEDA 3GGSA 4HCJA 5K8JB 1KJNA 1AKWA 3K4QA 3JTEA 2JLCA 4WESB 1Q12A 3ZY4A 4AIIA 1E20A 3TRIA 4Q9HA 3FCAA 4BX3A 2PKQP 5HTOA 2CVOA 1BVUA 1SXJD 1IJBA 1YAJA 1L7MA 1UM9A 2I7CA 1ZZGA 1F3LA 1GQOA 1SHJA 3LBAA 1NATA 1N7JA 1AKTA 5AKHA 3D3EA 3K70D 2P4HX 4HK4A 1HDRA 4DSZA 4F2PA 3IRUA 4FQ5A 3TECE 5ARDA 4GOND 2KLHA 3DMNA 3KKZA 2F64A 4HQ6A 3EZ6A 2GBIA 3N8HA 1ZONA 4G07A 4YH1A 3HBFA 1PK8A 1J21A 3HRKA 5B12A 4LN1A 3JARA 4DL9A 4HNUA 2BE7A 5K0BA 2W83A 3VMFA 4AMZA 1JZQA 2CNBA 4N0EA 1UADA 4INZA 2B82A 4GRAA 3FWKA 1N8NA 2JIZD 1HZZC 4U4AA 2VZ8A 5F7XA 1I6KA 1KU6A 4PAOA 4ZGBA 2VS1A 1Z6AA 4BBPA 1N5IA 3ZY5A 2H2DA 4LZAA 1EVKA 5REQA 5TGDA 2N47A 1ZD9A 4L74A 2Y6VA 1XYVA 1A9SA 2DWUA 2D5BA 4IUDS 1ZN2A 5FL7D 1T6BY 1NW8A 3PNBA 3VR4A 4BHTA 3S8EA 3PWKA 3CGWA 1ECJA 4F93B 2YVAA 5IYZB 4NOKA 3OT4A 4OFBA 1TVMA 2WDPA 3AESB 3U5TA 1I10A 4OJKA 4C1BA 3MBKA 4IY1A 4BNWA 4HO1X 1G41A 3KYCB 2JZNA 3LUPA 2DQKA 5KEIA 4GGPA 5F9HA 4S05A 3BL8A 3QLJA 1N1EA 2Y1DA 4OLFA 1L8AA 2E55A 4IR7A 3PXXA 1U0LA 3LA6A 5E9JA 4IIXA 3L4KA 1XLTA 3E3NA 3G9QA 2TYSB 3GEHA 3R09A 4LJSA 2I91A 4DCNA 5IJ0A 5CW2A 1BHJA 2IDZA 2ILTA 3ACBA 3LOPA 2WZDA 2V1UA 1YACA 2B98A 4YI3A 3EC1A 2NOAA 3NGMA 3ZE7A 2DUNA 4GOLD 2D54A 2DQ4A 3LQQA 5AQEA 2PX8A 4DG5A 3CZQA 1JXMA 4HH0A 1T1RA 3OECA 5GWXA 2ERXA 3W2IA 2BHNA 3STVA 1VKRA 2VPPA 4IJUA 2JJQA 1E8DA 1S1MA 2B36A 2BFCB 4PE5B 1BEZA 4R40A 2A67A 2DKOA 3P19A 5B6JA 4J16C 4TWAA 4AK9A 3SDSA 1E3WA 2HQOA 2XIQA 2FLVA 2A78A 1NYLA 2PUTA 4I5DA 3STUA 5HZKA 2OMKA 3WIVA 3FHTA 4TGLA 1UKVY 3K94A 4P08A 4Z2YA 4AKHA 1U8AA 4MGEA 121PA 2IHZA 1TVCA 4OI2A 3B1VA 1XHEA 1EXNA 1NVUQ 3H0EA 3GFTA 4BPBA 2AG0A 1LZLA 2K7FA 4MIOA 4X65B 2JBHA 2XE6A 4JVNA 4ERNA 1AV6A 5LOVB 3LBNA 4C7JA 1H3EA 3DCIA 3IB3A 4KITB 1FB5A 3O4VA 4NU5A 5F1OA 4E3WA 3VPDA 3IAHA 3PC8A 1S96A 4G65A 4ISCA 5E4YA 1YE3A 3FX2A 1L8OA 3SKXA 5C9ZA 1JH9A 3SEAA 2FEAA 2O8CB 3ON5A 3AEQB 1Z5VA 4YJGB 5C32A 1XNGA 1YZVA 1O97D 2PKWA 4IF4A 3R0VA 4QD3A 5CAEB 1RCTE 2UAGA 3PQ2A 4UATA 2JJMA 3L4SO 3QVGB 4FMCB 3R74A 3UCXA 4I4TB 4AUKA 3QEBZ 2DHCA 2FR8C 1W34A 5LJLA 1Y37A 1I5EA 4MI9A 1DTSA 4IQFA 2Y0CA 4G56A 4Y7CA 3LF2A 2MOKA 2QNRA 5EJEA 2CHQA 5IM4A 1PX0A 1P9WA 1XKQA 3LUJA 4LXQA 4MKXA 4LISA 5EUCA 4PX9A 4CEIB 1G1AA 4R5HA 4CV3A 9LDBA 5D3ZA 5AW5A 4UXIA 4PYKA 4C4ZA 1R9GA 4K1LA 1J8YF 3HFJA 1U5BB 2WRZA 1UXKA 1SKQA 3DWFA 2UDPA 4RD2A 3FOCA 2CXPA 3X1YA 2AC4A 1M7GA 3OZXA 5F4ZA 2YICA 4GL2A 3DLPX 2YHIB 2MSLA 2IW3A 2W8BB 2VBFA 5K2MA 4CQMD 1T8UA 1NUPA 1A5AB 4B5LA 4M49A 1UR5A 1G5HA 3E4CA 1ZRHA 1GHTA 8MHTA 2E9SA 3W3AD 2QN3A 2VA9A 2XBLA 3OP1A 4HWGA 4JCCA 4IWXA 4PCVA 5LP6F 4W5OA 1FSFA 5AW0A 2CDCA 1NKVA 2J59A 4L75A 5CXUA 4YFYA 4NWIA 4MYTA 1LLQA 1ZOOA 2V6IA 3CZ4A 5FI0B 2CFRA 1RI3A 1H4QA 2ZVPX 5KQGA 1BDMA 3NIBA 4FGKA 2PYIA 3GGPA 3HWWA 2C4TA 2JFQA 3H5TA 3WMGA 3S2ZA 1TUBA 2PRKA 3O4JA 2J5BA 1X8LA 3ZH2A 3D2CA 4WZBE 3HJRA 3ILXA 1KK1A 2F43A 1I0IA 1ZOSA 2Z4TA 4I6EA 5TF4A 3ZIAD 3MOGA 1AK9A 3HB7A 4D8TA 1ZHOA 2QP3A 4FI3C 3NGXA 2R84A 4NZYA 2W6CX 4XFKA 2G9NA 1SOMA 4J1SA 1DO0A 1DG1G 1R8YA 3KJNA 1Y7TA 1YULA 3CT6A 3LKZA 3O90A 5EMLA 5KYYA 3WP1B 4EF4A 1M2NA 4JEUA 4AULA 4IIVA 3UUWA 3MTJA 1VI2A 2I7VA 5KHAA 3V2HA 1MEOA 1O95C 4MUHA 4O33A 3VBEA 2EKLA 1KPGA 1YL7A 1Y98A 4BGUA 2NZVG 2B4TO 3M81A 3NAGA 4NENB 1ND6A 4YJFA 1FZTA 5CFQA 3M3HA 3P9KA 1ZMRA 2JLUA 4OXIA 4WN3A 1LW7A 5DE3A 2IPNA 2QUKA 1G6OA 4X3CA 1M33A 2JIRA 2YC2C 2V7QD 1Z0FA 4A6DA 4D4GA 4EY7A 3ZNOA 5JCJD 3IT3A 1R6VA 1EM6A 1RM5A 2IHBA 4D6XA 5K09A 1GUBA 2GN0A 5EP4A 4CLEA 3H3JA 5I7EA 1E1CB 1REQB 3UHAA 4RLHA 1GT91 4MV3A 1NX6A 5HKKD 4MS3B 4N6NA 2J6IA 4KWTA 2Y0EA 1ESNA 1Z15A 2HU5A 2G9UA 2WJIA 3L6CA 5A4DA 1UQTA 1DXOA 1LUAA 2IEGA 2NVBA 3EXG1 3P9PA 1FXSA 5TPWB 1E6UA 3S99A 5C7OO 2B37A 1Z74A 3VO8A 3T1YB 2ORYA 3FTEA 1NIPA 1LVUA 5BNZA 5LLDA 5JEEA 2P7HA 2ZE7A 1C0IA 3GN1A 1C41A 1I4LD 2C9ZA 3KBBA 1JSZA 1EFUA 3CXUA 3G79A 3TB6A 5HBGA 2WT8A 1NQXA 1U1CA 2HWXA 3WFZA 1DJQA 3PGJA 4BO8A 3C6MA 5CX1B 4ZI7B 4RQBA 3TSYA 2ZJ3A 2IX9A 3VJMA 3W9UA 4QSHA 3KDSE 1DIOB 4ALKA 1RXCA 2ONKA 2NU7A 1UJ5A 2CXNA 4ES6A 2Y1FA 3BCSA 3RANA 3SM9A 1L5NA 3HN7A 1CUCA 2VP3A 5CYGA 5EGNA 2GJSA 1JE0A 2LIVA 1D03A 3KR1A 3U7QB 5B1DA 2P6RA 1CEEA 4D0GA 4W99A 1KMHB 1UPAA 4PTLA 2ZM6B 3QXCA 2PX0A 3FSRA 4N12A 1XXHA 1E1QA 3IBGA 4GWKA 1CHNA 4XR4A 4ND6A 2VKTA 3NYWA 5H59A 1J5XA 2XITA 4QL3A 3VVLA 4BDTA 3KETA 1M0EA 4MVJG 4LXUA 1EX1A 3KXKA 1DTWA 3S7TA 2HK6A 2XF8A 4BRUA 5LQKA 3FCSB 3NP9A 1U3FA 1B8OA 2DBQA 3HC7A 1JFFB 1AQUA 1HYHA 1V16B 1YI8A 3BH0A 2ISCA 2O57A 5E0KB 2O9JA 3EY4A 4J16A 3U4CA 4C4SA 2B1QA 1RWKA 4P54A 4B8WA 5JH7A 3Q8XB 5K3FB 3LI2A 4DIFA 2HSZA 1HQKA 3R0ZA 4L22A 2TMYA 1Y63A 4ME6A 3I3OA 3RLFA 2EL7A 2IYQA 1JVBA 3F7MA 2XODA 3L0DA 4FZ5A 4L0MA 5LWQA 2IS1A 1BWPA 1DWQA 3A9CA 4CIWA 5SZKB 3DBRA 1YA8A 2FUG6 5ALEA 3PCRB 2I8CA 2PEYA 3CNOA 4FGLA 2FLKA 1UFRA 2R62A 2W2MA 4JU9A 1UZMA 4LOAA 3A04A 4EY3A 1VRVA 1PJBA 2YZGA 3G2MA 3SBDA 1HR0B 1YR8A 3T38A 5JBNA 2BMFA 2LUOA 5BR4A 2GF0A 2C5EA 2O8EA 1OFUX 1GFSA 1YT5A 3A7DA 3GDWA 1W4ZA 4N18A 4WKCA 5AKEA 3ZKWA 1ZCZA 3MWKA 4L4RA 5L3ZA 4LS3A 2WFAA 3IQEA 4DE5A 1CUUA 1WUYA 1RTTA 3A70A 2ATCA 2GOYA 2BI8A 3L7OA 1KJYA 3N2IA 5LQAA 5EOVA 1DPFA 1C9YA 1YNOA 1Y9ZA 1NA5A 3H7IA 4XWKA 2QDXA 2GCEA 2GCIA 3GIDA 5EKUA 2RGGA 1O8BA 3K53A 2BEKA 1B15A 1JQKA 1JBEA 2C96A 1P9OA 3D2BA 1YQGA 4Q82A 4U2EA 2F8LA 3SQOA 3GRCA 1FMJA 1IU9A 1NAIA 3BMOB 3TGPA 2DVMA 3LYLA 2P30A 4KPEC 3VKVA 3OIGA 1W8DA 2H0AA 4WPGA 3ETLA 5ITWA 2JFBA 3GD5A 3VZSA 4Y0NA 3SD7A 5HUJA 3I2IA 1A8IA 3CHYA 4PHCA 3LAWA 3RTBA 2HEGA 2BTQA 5EWMB 4M88A 4JLWA 2J3KA 2NUPA 2PUJA 2UVDA 5GONB 5IULC 2Y27A 4RACA 4ZXPA 1HQYE 3V1YA 5E1OA 3W5AA 3NYQA 5F7JA 2H2FA 4BLQA 4CKEA 5CEJA 4PSUA 4P0QB 3WMEA 3K6SB 4RD3A 2ZKLA 3BVPA 1TMGE 3V7WA 2OK8A 3BIJA 2YWJA 3EVDA 4AC9A 4EUFA 1N32B 4UD6A 3C8UA 2W37A 2XZTA 2YFHA 5CLLA 4QXPA 1XDDA 1ZNZA 3I2HA 1G3MA 2O0JA 2ZJ1A 3E2MA 4MJXA 4BOYA 5JZ9A 3LKBA 5EIXA 3NHUA 1KI7A 2PIAA 4RQUA 4CKCA 4GBJA 2JJ2A 4ZV7A 7AT1A 1Z2AA 4NESA 1C0LA 1B1CA 2GEBA 3KFXA 3LA8A 4NAVA 5C80A 3FNBA 3ORRA 3V32A 1U28C 5K4HA 1HWYA 3KU1A 4REMA 3GY0A 2UZ3A 2VXBA 1YS7A 2C5FA 1T3SA 1WPRA 3TQHA 1IQUA 1HURA 2YVKA 4ZJZA 3LE8A 4DMLA 2FPLA 1XRRA 1DEKA 4ZCTA 2IZ0A 4QXOA 2R6DA 4GDMA 2I76A 2RCNA 3GRRA 1ODCA 2CWWA 5D8DA 2DYKA 1CJTC 3WFIA 2FRVA 3DFMA 4F3NA 2PUBA 4HDMB 3GXBA 4NMWA 1P3Y1 2OYSA 3C3DA 1KPIA 3FZYA 4JGBA 1QH0A 3JW8A 3C6BA 3SZGA 4B2YA 2JZOA 3WLMA 2NQ2C 1Y8AA 3W2FA 3CUVA 5EHNA 3CMMA 4PC1A 1E0JA 1V96A 2AYXA 2J5RA 1DFIA 1WW3A 2ZRNA 3FDZA 3GA7A 3OWHA 4V0ME 1GXSB 4KYIB 4YJ3B 2VBIA 2QQEA 3DTYA 4BMNA 3BXZA 1SXHA 2ZWVA 4IDAA 3OO1A 5LIPA 1UT8A 1CZRA 4PICA 2G04A 1IK6A 2RIPA 3NX4A 4J1QA 1S8AA 3KHKA 1K5PA 3C6ZA 5EMJA 3V4LA 5B4UA 4K6MA 3GG2A 2BGNA 2GBLA 2QQFA 1KH3A 5TVGA 2XTAA 4FYIA 4HAVA 2XDYA 3GJ5A 3TBHA 4NTZA 2LDXA 3N53A 1ZD3A 3RBAA 5JNUA 3L1VA 2QRGA 4N47A 1BGVA 4CYMA 1RPJA 2QW1A 3U48A 2X6QA 4KAXA 3K9WA 4KFTA 4G0OA 1TGVA 1PUIA 2YIJA 3I34X 1L4GA 4O02B 4ENPA 4RTJA 4K6CA 1CFZA 1U3WA 1J1UA 4W5HA 1CP2A 1M1XB 4ZVKA 4DV4B 3FB4A 3FMIA 4NCJA 5E6SB 2N75A 4N0QA 3A1TA 4FGSA 5A1JA 2I2FA 2VTBA 4ESVA 1FRZA 1Y33E 1RYEA 3CV3A 2NZUG 1XCBA 1SC9A 4TLCA 2CDRA 2Q6OA 1N9GB 2IH5A 3SX2A 5EQDA 3GRFA 4MGKR 4PHHA 3SMVA 4FBMA 5TVKA 1R8SA 2CCJA 3PXBA 1R4NB 2Z5VA 3PNVA 3BBPA 2F9FA 1XUOA 4JJ6A 2HJRA 5YASA 4ZYZA 4H7DA 3DHNA 4B43A 5IXJA 1ZUHA 1A1VA 2QAGA 1AB6A 2GCPA 2VRWA 3PL5A 4LJ8A 4UNSA 4XTCS 1C2YA 3LCVB 3LZCA 3OAAA 1L4KA 4MWTA 2NVUA 4B6EA 4C5CA 2RGDA 4IDBA 1I4EB 4GF5A 3ROMA 2HGZA 3WNCA 3K0HA 4TM8A 5COBA 5MDHA 4EKNB 1GGKA 1BEEA 2BC9A 4NS1A 2D1FA 2Y9MB 5LLTA 2JA2A 4IICA 5CCEA 2JEYA 1M8PA 2EX0A 4M1TA 3GCWA 2QI9F 1JB9A 1I80A 2JGKA 4M46A 4QGSA 3SOPA 2BM1A 4XWYA 5FLXA 4CLRA 1IJFA 4ZGGA 2YOHA 3PVZA 4L8FA 3DE3X 3I3SR 4OMDA 4PFSA 4GP7A 2XT0A 1XVIA 3I5MA 3LCUA 4YAWA 5FFNA 1JBQA 2Z4RA 4PBTA 3L77A 2VF8A 4LXTA 4BLRA 3EXG2 4RFLA 3H87A 4BV9A 4UREA 4DXHA 3QX8A 2IYUA 3EVGA 3NRJA 2Q5JA 4IOKA 4HXEB 4L9WA 3RGWS 2E89A 3T1HB 1V9CA 3ZGVA 4CM8A 3HDGA 2X9VA 5JAPA 1Q3KA 5JNLA 3LY9A 3FWPA 3GNLA 2GXSA 4H9GA 1XA4A 4QPPA 5THQA 2PUAA 1Q7CA 5JS1A 1I2AA 4GPBA 5CEFA 2WTUA 1VFPA 3ZHTA 1ZL2A 3PPXA 5IUJC 1AHHA 3Q87B 2ETVA 3CZPA 4GM4A 4B6FA 1BRMA 4KI7A 1B23P 1GSOA 1O54A 4G5SA 3DEIA 2XUZA 3FOFC 1RYYA 4YRSA 1HXHA 4ACAA 1LC0A 1DLJA 4ODIA 5L8VA 3UWPA 1TTQB 4FMBB 1RNLA 3I1JA 2BBOA 4FUTA 4IIJA 4MX8A 4A8PA 4B6SA 5F9FA 2ZUTA 1ZI8A 2XGJA 4S1NA 3VOAA 3DG9A 3DPSA 4DNFA 4KFRA 5BXYA 1Z0SA 4PBSA 3PJDA 1RLOA 4EYGA 2AJLI 2VYND 4JI2B 2SCUB 3O0TA 1WTCA 2J0SA 1KNQA 3RTDA 4OX9B 2X76A 1RTKA 3HU5A 4UE3S 4UFNA 4ZOLA 5PNTA 2PS9A 4NYIQ 1SPXA 1I1OA 1V3UA 2SECE 1SUPA 1XYGA 5D6OA 1HKUA 2G25A 1U9ZA 2H17A 1EVYA 4RTMA 3C43A 4MVJM 4LDRA 4Q3AA 1X7XB 3B8HA 4GKAA 4PZEA 4FCTA 4MJ7A 2QV7A 4JT2A 4K9SA 5IJXA 3HB4X 1WE2A 2VJQA 4QNRA 5TR9A 5A3QA 1YHYA 4QELA 3S2SA 5KSPA 4ZD6A 1OXTA 3HQ4O 4B46A 1CR2A 3IBCA 2VZLA 3U9TA 1Z4LA 1C1YA 2NM0A 2FEOA 3U3ZA 3MGKA 4FHEA 3PPWA 3RT1A 5K0TA 2KX7A 5LN1A 4RQTA 3QUTA 5E8JA 3AYXB 5FR2A 1IC6A 1DE0A 4A8JB 3QWAA 2IEIA 4JGGA 4ZMBA 1Y89A 1ZOIA 1Z37A 2J3IA 1S8OA 2VLIA 3OE1A 4ZCLA 3GJYA 3OSUA 5B2ZA 3D6HA 3T9FA 2D4HA 2BZSA 1H1DA 3VZQA 3WWDA 2WOOA 2ZSEA 1XTUA 1WOYA 5DCWA 2E7ZA 4D45A 1VG1A 5K0CA 2X0KA 1T1SA 4NONA 1NR1A 2BKVA 1FDSA 4PNEA 1JLRA 2OGSA 2PZMA 3RC9A 2GJKA 5EZQA 4AVYA 1B4DA 2QG4A 1VYVA 4GEKA 5ERXA 5LNK1 1P81A 4KRXA 4G63A 1JTFA 5LQMA 2XKKA 1YTUA 1JVSA 2XWQA 1F51E 3A31A 3ASVA 3QA3E 3ICWA 5ESDA 1U28A 2WY2D 4UUQA 3HUFA 4AG3A 3LDFA 4B2LA 4HT3B 5L95A 5G0VA 3FGNA 3KXDA 3OJCA 1R0KA 4B6RA 4Z5XA 5EIHA 1DAIA 1GNSA 1P62B 1ZWLA 2R65A 1D07A 5AHRA 3PJEA 3SJUA 4A82A 3TTVA 5FWDA 1C3VA 16PKA 1TLLA 1NHGA 3IJPA 3MTIA 3T9DA 1KRHA 2PUEA 1G2PA 3ZDEA 2V5VA 1TVKB 3TLJA 4DWJA 1J2UA 2WIFA 3AHGA 4V02A 3LLVA 3U56A 2DFLA 1SR8A 1ZSVA 2KE5A 1B3BA 1M2EA 1X7ZB 2PSHA 3A8TA 2WIDA 3IV7A 3MLEA 4IHAA 2HXYA 4IV0A 1C5KA 2DUMA 4RKWA 3ZBUA 1QVWA 2R66A 4MHSA 4UCQA 4A2PA 2HJHA 2PL3A 1DAHA 3CN7A 1PJAA 1VIVA 4O8CA 4YMHA 4HGPA 5I9LA 5I9TA 5BY2A 1IY0A 2I7XA 5E6RB 1RHQA 3CCCA 1DG9A 1MC8A 2HMYB 2PZGA 4RIEA 4F6RB 3L7BA 2Z09A 1LY1A 3PUHA 4H3KB 3OF2A 1JSXA 1S0UA 1E2JA 3NT5A 4BU1A 3W6NA 2C7VA 2F90A 3PK0A 4IF6A 4JB3A 3MUOA 4PZPA 2BEWA 3DYIA 1E6LA 3K9BA 4D26A 4RY9A 5JXHA 4UEQA 1TVKA 1AGYA 2WD9A 1BA3A 1PYDA 3HJBA 1MOSA 2QL5A 1DIAA 1B6TA 2GAJA 3QUCA 4H4EA 1ILWA 3I9KA 4MYUA 3RVSA 3BWDD 3K05A 4WNYA 1SG6A 1SXJA 1SA0B 5CYFA 3SQNA 2EKDA 4PLGA 5D5PA 4MUFA 5KJEA 3UH0A 2QRQA 3HA2A 3GZ4A 3B48A 4MSUA 1XKTA 4AF7A 4F96A 3CKMA 1N6HA 3NEPX 3DL7A 3BAZA 1OWNA 3MTQA 3RRFA 3FWNA 3ZCPA 2CHVA 2RE8A 1FP4A 2JCBA 2Q2VA 5HJ7A 3WIDA 1JLKA 3TLCA 1GZ4A 3MWDB 4TWRA 5IXSA 1ZH4A 5AJXA 5JNWA 1T2VA 1M0TA 2WVJA 1CZKA 3QEJA 4FK8A 3W2GA 4EHFA 4YUYA 5A4IS 5KU1A 1QHFA 3DMRA 3VFDA 2QRVA 4XB1A 4E5YA 1BN6A 1XRMA 1Z4QA 4IJWA 4JYCA 1SQ5A 1TQDA 1ZGJA 1XMSA 3AEKA 1FLNA 2PUGA 1AF7A 1EGVB 4L50A 1OT3A 3GMSA 3HVRA 1VL1A 2P0AA 4AKIA 1SUDA 4MUKA 1E60A 4TL9A 3AVYA 4TVSA 5G3YA 3B9RA 1KP9A 2HJWA 4YV7A 2BMWA 4C07A 2FWAA 2WJ6A 1W36B 3ZJUA 3A11A 4KXQA 1V6CA 4V2UA 1JIUA 1JPVA 1X7WB 1XSEA 3CEJA 4MUYA 4I6JA 1U1IA 3R3SA 4PGHA 1AKUA 5FAKA 5FNVB 2AKAB 4MROA 1COWA 4H7JA 3S0JA 4K5QA 4ER5A 3L6UA 1NASA 3QLUC 4R81A 4B0PA 4D56A 2OAP1 1TU4A 5K0GA 1P5RA 3IP1A 2AMVA 3PQCA 5FA6A 1WSAA 4RTLA 3OTWA 1K75A 1YZFA 2XCQA 4CNQA 1WZEA 2EFJA 4GEGA 5J2TF 3EISA 1YZUA 1BDIA 1U0GA 4B3RB 1PJCA 1ZVKA 4F06A 4DFDA 4XSHA 2HA5A 2WFLB 4UDXX 4XOIA 3QTLA 3TQQA 4H7PA 4IJKA 1W85A 4J2OA 4D6PA 3RVMA 5L53A 2XBMA 4R1TA 3FMOB 2FRXA 3PQ6A 4GXTA 1ORHA 1ICIA 1BEUB 2WYWA 3HCPA 3NNNA 3SP1A 1Y1QA 4J8PA 2AF4C 2HDNB 1ECBA 1G59A 3BORA 1K5GA 3LFHA 3U09A 2AOTB 2FOXA 2RGNA 1IM2A 2LP4Y 1XEWX 1BFDA 1D8AA 4FE7A 3RS5A 2GZHA 4K6KA 3D1VA 3PQ5A 1UP7A 3HKCB 1XEFA 1Y6GA 4OMCA 3TPCA 1WXXA 6REQB 4OP2A 1AS2A 1NQAO 1SQ0A 1I2CA 1IRIA 3C7DB 1NZJA 3CWQA 1LH0A 3EEQA 3NORA 4JUAA 3IV6A 4PC7A 4RK1A 3NIDB 1ADGA 4DRZA 1OH8A 3PKIA 4QU9A 2TMGA 3VAYA 3FFXA 1QG0A 5KKNB 1GQYA 2NO0A 4MPDA 2R87A 2AFRA 4LGVA 3BFJA 5DNDA 5K0LA 4Q4LA 2OZLA 3A2KA 4NK5A 1IY8A 1X9GA 3JALB 2Y1XA 3NR2A 3PDUA 3V2GA 4D9HA 4KMMA 1JA0A 1V7QA 5A05A 1VZ2A 2UZIR 2B8NA 3Q8MA 3TXYA 5C37A 2JIMA 4G5OA 3EZLA 4UOQA 3L2OB 1PR3A 1YOBA 5D84A 3KJZA 4X7MA 2WYIA 2H51A 2XIJA 1KJIA 4D9FA 1SCQA 5JSYA 4B9AA 3M4ZA 1HRKA 1QQ7A 2P2YA 2O3JA 1H4SA 5G0WA 4ZT2A 2H00A 4KE6A 3VV3A 4Z1MA 3ZNPA 3WMRA 4KYUA 2I3DA 3B1JA 1VPTA 4ZEMA 3EOAI 3TWOA 3UMFA 3WRYA 1E8MA 5K8LA 4QODA 2WM9B 2R5WA 2Q6KA 3HJCA 3NQ41 5FF9A 1N78A 1ZK2A 4XPIB 4ZRDA 3LUGA 3I1IA 5AHWA 4F97A 3N8KA 4NBVA 2DKNA 3CJTA 1YSCA 4YT8A 1MX5A 1T6NA 3D3JA 3RVOA 3S5UA 5LMUB 3MMXA 1IBMB 2ONJA 2J3MA 1B0AA 2GKOA 2Z9BA 3PPIA 1SHUX 3TSWA 4FGUA 5FBVB 3AO0B 3HFSA 4EG5A 3DKIA 4N40A 1S3FA 1K06A 2C5AA 2YHIA 3DE4X 3LYUA 1EVIA 4TYWA 4LMAA 4F4UA 2AIRA 4JSTA 3GO4A 4WCFC 4FFLA 3D64A 2VUHB 3CUUA 4UM8B 4KJZA 1QZ3A 2GXUA 4AWAA 3Q0TA 3GARA 2RHTA 3OX1A 2NX2A 5DIFA 3O91A 3AG5A 5DSXA 5T4BA 2BFWA 3EE6A 4HQNA 3AR3A 3RFFA 4CGYA 1OMOA 2GCNA 3PDIB 4XIFA 3VU8A 5IPFA 4AECA 2Q5EA 1K2WA 1X74A 4S0ZA 4YCCA 4V2IA 4JYBA 4H7EA 4EI9A 3D4IA 2JK0A 3KB6A 4JP1A 1QHYA 1A88A 3TNFA 5HUQA 1VBNA 7YASA 2BSQA 1YMUA 3O1JC 2Y76A 3BF7A 1Z39A 3PNSA 4H08A 1NVVR 1GPDG 1X39A 4LCBA 4L0CA 2PLRA 3HR8A 4QVIA 4DXDA 3N76A 1D3AA 2UZ1A 3M4NA 4K3VA 4RUKA 1M2KA 3DGFC 4NCXA 4EG3A 5I51A 4A2CA 4E2FA 4KR6A 1LDGA 1TYAE 2IP4A 3H18A 3NHZA 4KGDA 3OZUA 4M1QA 4OLBA 1CY7A 7GPBA 1KI6B 2JEOA 2QYSA 3KM0A 3ME5A 4NPAA 3CNBA 2VT2A 2Z98A 3FHLA 2X9QA 1PLLA 3BMXA 3JYOA 3H5RA 4U00A 2VNIA 4F21A 2WTNA 3CRRA 3O7MA 4JEMA 1KVQA 4B4OA 3NIFB 3K0SA 1XTZA 4MV5A 2OXTA 3WYNA 1TUGA 4LOJA 3OUUA 3NC1C 3E9CA 3HR7A 4P3KA 4EMUA 4ZYXA 4M9XA 2NGRA 3LL4A 3OIWA 4UAGA 3STWA 1DUSA 2H1OA 3KSMA 2AR9A 3F1KA 3TZKA 5JD5A 5A0TA 1G38A 3IKLA 1SXJC 4HB0A 3GZNA 4RK7A 2BVNA 1XZCA 4HNRA 5JRZA 3EVZA 2QTVB 2WWVD 1QDUA 2RAPA 3ED1A 1IN8A 1HDXA 1MQAA 1OXMA 1M7HA 1SJ9A 2FX3A 2W6NA 4BNFA 1FX0B 4X45A 1J2YA 5IX8A 1B6RA 1IUNA 1I9GA 4K26A 1B1AA 2FWRA 5DM60 2UU9B 4FIDA 1IBSA 2ESRA 4UHDA 4CM5A 3D2LA 4B7AA 5LQRA 1YTLA 2C7GA 3GEEA 1SIBE 3H99A 4YT2A 3VR6A 3D02A 4DCGA 2GPSA 3TGLA 4BGEA 2HDOA 2ALJA 5IBPA 2BRUC 2C3MA 4UVGA 1P2UA 1Z5GA 3IAS6 3FNGA 3N74A 2IYAA 1YJAA 2QD1A 2JI6A 4CXMA 1EAMA 2QMYA 1MHPA 1U31A 4MRPA 4WZZA 3WMFA 1XZGA 5I9SA 3D9QX 1ZOPA 5C52B 2Q49A 4DLBA 3L01A 1FRVA 5KAMA 2AXNA 4QOIA 4ZVTA 2P9EA 3KJIA 1G42A 1YZKA 3CG0A 3SFTA 1JI0A 4EBBA 3IHTA 1H8HA 5D86A 3CO5A 1OZHA 5DHFA 2NMVA 4XVUA 1RM3A 3VC2A 3U5ZB 3V9PA 1DGQA 2XT6A 5KJCA 4P4NA 2IHNA 4ZQBA 1YUNA 4A2QA 4DUYB 3LC7O 3E2IA 4X63A 2H6EA 3RB8A 2IYEA 1IM5A 2QMOA 4URFA 1H23A 3AKEA 3OZVA 2O7QA 3VZPA 1GCGA 2CHGA 2ISSD 3A37A 4JJAA 3EAGA 1DVRA 1TQ4A 2H9AA 4E22A 4EJSC 4HWSA 1QF6A 5KNLA 3O9ZA 1H2AS 4QUJA 1UBJS 2CEKA 1Z56C 3C6KA 3H5OA 1E79A 1Z0UA 3KVNA 5EMHA 4YWJA 1RAHA 2VZEA 5AJUA 2P9ZA 3V97A 1OXBB 3W1WA 1YGYA 3AHCA 5ILQA 4LF5B 1ADCA 2O1WA 2P8JA 1XXHE 4ZTZB 2DWCA 2ZJ6A 2NZJA 2ZB4A 1RI5A 1E6WA 2QJTA 3QOYA 4NY1A 4Q9DA 4BNTA 1DS6A 4XYLA 1OVGA 4MPPA 1NP3A 4FFVA 3U19A 2AX4A 4LEIA 4AWXA 2VDQB 3IDZA 5H70A 1GPJA 1HDEA 1JEQB 4XPZA 4GMDA 1C4WA 3MWGA 3OF3A 3Q9UA 1IY1A 2Q1YA 2MHCA 3H05A 4ER7A 1DJLA 1I6MA 3O8NA 3OOEA 3IEIA 2YASA 4PLCA 1PZMA 1ICEA 5A9TA 3WWCA 1JG6A 2P9FA 3LLSA 4RHYA 4W8GA 3U3XA 4EW1A 3V6LA 3DBRB 5ICFA 1AK1A 1E1DA 3EF3A 3KZCA 3LCMA 4ARSA 1D7OA 2PRIA 4FGZA 5IM5A 3I53A 3BPSA 4I1YA 3EGEA 1NXPA 5BVGA 2Z04A 3E0QA 4WN9B 3TUJC 1C1XA 4KO4S 1EFPB 2R1TB 1CY4A 3LGSA 3K09C 5CR9A 2LWIA 2P3OA 2V9PA 4I9HA 5B1YA 1A9YA 2YWBA 2ZPAA 4CCYA 4I55B 2JBAA 3C3BA 5AXDA 3ZLVA 4KTVE 2P6MA 2QZSA 4C0KA 1EVQA 1TLTA 2QE6A 3F7NA 4U6NA 3WK5A 3OP4A 1HX7A 1O1YA 1VLVA 4KRGA 4XGNA 5SY4A 2ZW9A 5KCZA 3QE3A 1T5TA 3DAHA 1L5QA 3D8HA 3JQEA 2ZI6A 1I7SB 3UAZA 4KIFA 1NI3A 4Q3DA 4F38A 1IMJA 1FUYB 2Q29A 2WP0A 4MMYB 4UMFA 3A6KA 4C0SA 4HNHA 2NXJA 5C1BA 3K9GA 1SHLA 3V4RA 1ETUA 1FP6A 1P1RA 4I36A 5EUQB 3TKAA 3U1BA 4NZNA 3I5AA 1A82A 1MPXA 1ZHHA 3JVUA 4KCGA 4MCHA 2I2BA 4G0QA 2HF2A 1VRWA 3KUCA 4GVLA 1JU9A 1GRQA 4FJ1A 1YQEA 5C18A 5K3EA 3DDCA 5ER6A 2NNLD 1LPMA 2KW5A 2QRPA 4NE9A 2JIQA 2YNMA 4B44A 1JDNA 1F06A 2JLAA 1YS2X 2O0KA 2GN4A 3M5CA 4I8XA 1N3BA 1VE9A 4O4LF 4RS3A 3PD7A 5DGDA 1G8GA 3PPYA 1KRWA 2RHHA 1T26A 1ATZA 3MT7A 4HNQA 2AS0A 4A16A 3PUYA 2HKIA 2GBGA 5KTMA 2ODBA 4PS0A 1J9GA 4N5MA 1JQ3A 1F12A 5IKEA 2FP4A 2D1YA 1RP1A 1KR5A 1RWMA 4OJTA 3V55A 3DTVD 1X42A 1YWGO 1BG6A 2FN9A 3OX2A 1KU0A 4X71A 2VBGA 1CDDA 3FE2A 3ZCSA 2XDWA 5CIWA 4ENQA 3CNLA 4S2EA 2BSAA 4ISBA 1YQWA 1JAXA 1YZ3A 3VPSA 2EG9A 4F2GA 1L5LA 1A0OA 5C8ZA 5KX5B 3T6KA 3EDOA 4OYRA 2OV6A 3EIXA 4Q7LA 1N2XA 1YDGA 2E5WA 2RI0A 2V7GA 1B42A 1SZDA 4PAGA 2RHCA 4U6QA 3E53A 3HG7A 3K9HA 3KYDB 4YCSA 5D51S 3OQOA 5BWLA 3A36A 3AVQA 3JWPA 4Z9YA 4F3RA 1TZJA 1VE7A 4X91A 2F1OA 1OWOA 2YVUA 3T4EA 4NH4A 1IBLB 4JT8A 1X70A 3DOJA 2DZDA 4U9UA 3TJMA 3P2IA 1ZUD1 4DC0A 4E5DA 1PNRA 3Q3VA 1GGJA 3QNUA 2R6CA 4L73A 3EPJA 4X6LA 4A5OA 2Y67A 4R98A 3GFSA 1G2IA 2DTEA 1Y8ZA 5C4IA 2RFLA 3H6HA 4LNHA 5KYVA 4DJAA 5HF6A 3UAWA 1J0EA 1PDWA 3MSXA 1T8WA 4YPOA 2ATVA 5U1PA 1II8B 2PXHA 1LBHA 1T0UA 3K2EA 4NICA 5G0TA 1I01A 4HFRA 4NOJA 3IBYA 4ZAYA 1Q84A 1DKPA 1E8NA 2K87A 3HYTA 4XW2A 2VJCA 4WT7A 4BCDA 4WECA 2M6RA 4AT1A 3SC6A 1E2BA 3HXTA 3NTRA 4JJKA 5CVDA 5F78A 4NENA 3O4GA 3QBVA 2VDOB 1XA3A 4YJFB 4BQIA 1T36B 3LX8A 4KQJA 1XALA 3GXOA 4XZ3A 5IBCA 2QL7A 3WB9A 1RYHA 3DD5A 1D4ZA 3ZWOA 1IEWA 1U8TA 3GBSA 4Y1FA 1MW9X 4Q21A 4KREA 2IUFA 4FNAA 3CRW1 4OHWA 3UG7A 4MQMA 3DB1A 3CLRD 3OC6A 2BFBB 4CWAA 2P6UA 3KAQA 3M1IA 1IBKB 3DF9A 4NP6A 3REGA 1O6CA 3E9NA 1WDWB 3M6WA 5C81A 2BKEA 2HF8A 1Q74A 2OHFA 4IO0A 4XQCA 2ZTSA 3D5EA 3IEKA 3KSAC 1JEYA 1BGWA 4YRBA 2ZIWB 3MOSA 2WNSA 4HNAB 2OXFA 4XPIA 2XADA 3I2GA 5CX4A 5DBIA 5B55A 1QIFA 2OHHA 1PZFA 1QIKA 2OECA 1GPKA 3D6VA 3ER9A 3FVTA 1OAOC 3WZMA 5EZSA 4P0PB 2QVYX 1QFXA 3LP8A 4IHKA 1H2XA 4P32A 2BR5A 1L5FA 1N5KA 1GZDA 1ORRA 2PSDA 3C3CA 3GHHA 5E9AA 3COSA 4HB4A 4Q16A 1GKLA 1WKCA 4B8YA 3U1VA 3PKZA 5GZ6A 1LX7A 4E4TA 3TDKA 3SIPA 1W48A 4I50F 2Z1MA 2QA5A 5TT0A 3AP2A 1RKVA 2OSBA 1SOAA 3PRJA 1UBTS 1G8AA 3BHJA 2QYHA 3R7DA 4FE3A 3BBLA 4ZKEA 9LDTA 2Q45A 2O8CA 1SUCA 4BNLA 4MGYR 3CH5A 4Q1BA 4P4UA 1ENOA 1JALA 3D3WB 3AR6A 2YJ5A 3ZK9A 3ZHQA 2JFFA 3BSSA 3L1JA 3T0FA 4FWTA 2E5FA 3G2QA