4IUCS

Crystal structure of an o2-tolerant [nife]-hydrogenase from ralstonia eutropha in its as-isolated form - oxidized state 2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
265
structure length
265
Chain Sequence
PRTPVLWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAAAGHQAEAILEEIMTKYKGNYILAVEGNPPLNQDGMSCIIGGRPFIEQLKYVAKDAKAIISWGSCASWGCVQAAKPNPTQATPVHKVITDKPIIKVPGCPPIAEVMTGVITYMLTFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQFVEEWDDESARKGFCLYKMGCKGPTTYNACSTTRWNEGTSFPIQSGHGCIGCSEDGFWDKGSFYDRLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversible [4Fe-3S] cluster morphing in an O2-tolerant [NiFe] hydrogenase.
pubmed doi rcsb
source organism Ralstonia eutropha
molecule tags Oxidoreductase
molecule keywords Uptake hydrogenase large subunit
total genus 78
structure length 265
sequence length 265
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2013-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4iucS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4iucS02
1WUJS 1UBMS 2WPNA 5JSUA 1YQ9A 4TTTS 3ZEAA 1H2RS 4UCQA 5ADUS 3UQYS 3CURA 4GD3Q 1UBKS 4OMFG 5JSKA 5D51S 1UBUS 1CC1S 3ZE9A 1UBHS 3CUSA 4IUCS 1WUIS 5JSYA 4KL8S 1UBOS 4U9HS 1WULS 3MYRA 4UCWA 4URHA 3ZE8A 3AYZB 4IUBS 1E3DA 3ZE6A 5A4FS 5JRDS 1YQWA 4UQPA 4UEWA 5JT1A 2FRVA 1H2AS 1YRQA 3AYXB 1UBRS 4UD6A 1WUKS 5JSHA 4KO4S 3H3XA 3USCS 4KN9S 3USES 4UD2A 4U9IS 4UCXA 3ZE7A 5A4MS 4UQLA 3RGWS 4UPVA 1UBLS 4UPEA 1FRVA 4IUDS 4UEQA 1UBTS 4UE2A 5A4IS 1WUHS 4C3OB 4UE3S 4UE6A 4CI0B 4KO2S 1UBJS 1FRFS 4KO1S 4KO3S
chains in the Genus database with same CATH superfamily
2C42A 3E03A 3B13B 1JLHA 3LNTA 2JF0A 2ZB3A 1QHEA 4J07A 3EPHA 1MQSA 4CM3A 3MRXA 1SUEA 5AKIA 1IG0A 1TYAE 1N2IA 2E6UX 3UHOA 3F8WA 4MP8A 1NWHA 4WK2B 3FPFA 2JEYA 4L76A 1N2CE 1XMXA 2W2XA 4M53A 3S28A 3D8SA 3JQ7A 4V02A 3VV2A 3X1XA 2HLPA 2H1OA 1N1MA 4LBWA 4OUDA 4QODA 1ZMRA 5AOBA 1HTWA 1T5LA 3A9UA 1SZDA 1P4RA 3ORFA 4HNAA 3B9QA 5CH3A 4P3KA 3G17A 3GYGA 2Q29A 1GN8A 4BDTA 3I9LA 4WZAE 3UJNA 1WEHA 2DKNA 3IURA 3I3OA 4E1BA 1M73E 4PCLA 3UGQA 4Z54A 3VU9A 1SOWA 4IVQA 1D3AA 2CXUA 2OBNA 4N40A 1I94B 4C7OA 1GLVA 1SXJD 2QRKA 3OOWA 1IMJA 1XDZA 3PEUA 4KQMA 4U02A 4V24A 4F04A 3IT0A 2JW5A 1LQ2A 2GR9A 4L4YA 5T8KA 2A4MA 2YXNA 5A9TA 3H99A 1IPFA 4HGPA 2WJJA 5AI6A 3I2GA 2ZRFA 4DJAA 2OBYA 3MTGA 3VR2D 4BVFA 5CB4B 3I9V1 3GJXC 5IEJA 2B7LA 4L4UA 5TC4A 1AK1A 3LVRE 5LWQA 4RHFA 4LZZA 5ALDA 2MT9A 2BTQA 5EPOA 3UXEA 1S96A 5I3CA 2IFTA 2PDAA 3DMHA 3H5WA 3RU3A 3ELUA 1JH9A 4CKYA 1P1CA 1N2CA 1Z4NA 1ODSA 1W0JD 5HZHA 3GUUA 3SQLA 1QK3A 1CYDA 2CJPA 2FQ1A 3QE9Y 2IIBA 1J2YA 3T4EA 1VJTA 1S8NA 2PO5A 3R5XA 4KQHA 3MD0A 5JNTA 5EPUA 5KNBH 4FHFA 4O63O 1S3SA 1KH3A 4PFKA 4TXLA 1P2TA 5JRDS 4EDHA 4DQXA 3NBZC 2HB6A 2J6CA 1KI7A 3CNOA 821PA 3OE7D 1RIIA 3W79A 3JQ8B 2R11A 5JALA 1FW6A 1UJCA 2A4KA 1QV9A 4OAQA 4Q47A 3AV3A 2O0JA 4DLLA 1G55A 3FMOB 1Y5RA 2O0KA 3ANMA 2WLSA 1VPLA 4NCXA 2W83A 5AW6A 2GM9A 2QMHA 4HB4A 1I10A 1IATA 4RZUA 3WYAA 5GINE 4KREA 4XZ3A 2OCGA 2WLTA 3U6KA 2ZYIA 2W4QA 1G18A 3G9TA 1EZ4A 5B36A 1PQYA 2PZGA 1PBTA 2ZSHA 3CSUA 3QE4A 1AZTA 1PNOA 2XRFA 1SVLA 3BMOA 3F5DA 4L4SA 2GJ4A 1KDOA 4NH0A 4YI5A 1FYXA 3SLGA 2X7XA 2XQGA 2FR1A 4NHOA 4TKMA 4ND1A 1GPYA 1ZK4A 5HS6A 1X70A 3K96A 1R6AA 1PT8A 1I1QB 1PR3A 4K6KA 4M8SA 3BXHA 5JAQA 3O7MA 2H2GA 5DLEA 3U80A 1TZJA 5L7TA 4C6TB 2E2WA 1X3LA 4GPZA 4WI1A 3BGDA 4V3CA 2WSYB 5DT2A 1KWGA 4PGAA 2J3HA 4KFSA 3ZXUB 1PFKA 4L73A 3SZUA 4JR0A 3Q7SA 3UOAB 1XZPA 1L9KA 4G5RA 4QU9A 3A1EA 2RGNA 5BUCA 1NVUQ 1XL1A 4RS3A 2XCOA 1EK1A 2ZXEA 3BGVA 2NTYC 5EZSA 3QEMB 3WMWA 1X1SA 2E4UA 4UUNA 1NJFA 1KK1A 3DCYA 4BMXA 3HJHA 1W49A 4EUFA 7ADHA 3WGZA 3D5TA 5G4KB 2HWKA 1AN0A 3C41J 2OC4A 4OOFA 3H05A 4QNMA 3IBFA 1CVIA 4M99A 3A0RB 2CCJA 3E9NA 3P27A 4FFOA 4R9VA 4MRVA 2IW3A 4TLBA 4Y2HA 2Q8NA 3VVMA 1RZVA 1VP3A 4L95C 1OGYA 1RKUA 1ULSA 2OO3A 3IVGA 1IZ9A 3GWGA 4RKEA 4RTNA 4RJLA 4G9EA 1F0KA 1WMBA 3Q41A 1P4GA 1YB7A 2R96A 3PI6A 4AJEA 2YASA 2ZS7A 1E6KA 1GGJA 3IKLA 1XNHA 1J0BA 5BT9A 2G3YA 1VJGA 3NHLA 3GBPA 1SMKA 3SZMA 3PQ5A 2ECKA 3OMLA 5LKRA 5JMPA 3Q7IA 3QP9A 3HUDA 1BQEA 3DLAA 1U9YA 2A0XA 2R1TB 3BX1A 4D02A 1R5NA 4EK9A 1AKMA 2KJQA 4ECEA 4RQUA 1JJAA 3DR5A 2IEIA 2BGKA 5TQVA 1TZMA 3S99A 3VAAA 4CV0A 2HPHA 4XTRA 3BEOA 3EXHC 2ZQYA 4NMXB 3HM9A 1F8YA 1MGPA 1MQAA 1FMCA 3KM0A 3DEKA 2X77A 4NICA 1W44A 4N18A 4PONA 4DMKA 2GZRA 4PIPA 2NUTB 4X66B 2M6KA 3AEZA 4G36A 1IB0A 3QE3A 3SNHA 1XMIA 3FFXA 3HCBA 5BWNA 1XHLA 3HCOA 3TLKA 3WNQA 1FRZA 1C8LA 1Y98A 3K9FC 4ACBA 4F8YA 4JLOA 4P4NA 2RH4A 4TTRA 1UFRA 2QN2A 2V4ZA 1NPTO 5HQJA 2X2PA 4JMLA 4RLQA 1FQWA 4F2HA 3C3EA 1PX0A 1QFXA 1Q3KA 5CH5A 1XVIA 3TSCA 4D9BA 4U4AA 4MKFA 1CY7A 2FUKA 4ENVA 4ZK6A 3I2JA 1YBAA 4WRRA 1PTJA 3AFHA 4ER6A 2AKYA 1NJSA 3WL3A 4FYHA 5IVKA 1NMEA 4B2LA 3JVIA 3Q2IA 4N39A 5EGNA 5KNDH 2IH4A 1GITA 1FYWA 2BV3A 1R0WA 4IDQA 2UXDB 5BSGA 3REOA 1TNDA 3OPNA 1C7EA 2BAGA 4FEYA 3FWHA 3BMCB 1PFQA 1LI4A 3NP7A 1SVSA 3RTBA 1GRVA 1V9CA 2R00C 5AQ1A 4ND4A 3RW9A 3X2FA 3QYJA 4MJ3A 1DC6A 1G41A 2OORA 1AGXA 3FB4A 3PITA 3TBFA 3WMXA 3IOMA 2VN8A 1C4KA 2DETA 2EFDB 3A9WA 3FI0A 5AVZA 221PA 3LKZA 5LCXA 4TVOA 5ALHA 1TJ3A 1QR6A 1M5TA 3H6GA 4C2TA 4FXOA 1Z4JA 3VR6D 1RWPA 2ZJYA 4UHCA 1G8MA 3FLMA 2H63A 3JQAD 1X7DA 1AQUA 1BEZA 4OTZA 2ATVA 5MFZA 1LDEA 2AD1A 2COKA 4XJSA 3FFBA 3I8OA 3GI1A 3ZHXA 5IX8A 3F5SA 5EIFA 3WDKA 3LH5A 3N39C 1Z4OA 1DQYA 2A84A 2OCIA 2OY0A 3ZVLA 1ORTA 2B20A 3EGWA 4L72A 1KFKB 2YBDA 2QUAA 4FN5A 2E9SA 2YY5A 4ZA2A 5HF9A 3WWPA 4CG3A 2RKBA 1HT3A 1T8RA 2IKQA 2V6FA 1ZLYA 3V48A 2REOA 1L6IA 3OFVA 3QG1A 2WWHA 3IHLA 5KSZA 1X1RA 1Q1BA 3C3DA 3REFA 1T0JB 1DSSG 1SQ6A 1GFIA 1VKZA 1YVDA 4LYHA 4EMSA 1FDUA 3OVMA 1ZR4A 1EXNA 4F91B 3IVMA 5DYWA 3F5FA 4M9SA 5LP1A 2FFAA 3Q8WA 4U6NA 3REQB 4DA6A 2CLMB 4QJ5A 1Y8RB 3KXIA 2RCNA 3PHIA 4AKSA 5TR9A 3IVCA 1MPXA 3NAQA 3ZXYA 4B3HA 5L3QB 2CUZA 3TTYA 1JBKA 5AVOA 1LLQA 1KY4A 1IZ8A 3WGYA 4AN1A 3MBOA 4Y98A 3ZCVA 4NH4A 1JKJA 1GRQA 1H6AA 2AQHA 5JSUA 1QRDA 1QTQA 3IJRA 2NNWB 4YV2A 3DAOA 3T1NA 1Y8QB 4BVGA 1FNNA 1IBMB 3C6YA 2RHLA 1GSAA 1YRAA 3OSZA 3WLHA 2EYUA 3VUEA 5C52B 1YWGO 1ZGGA 1K5GA 4XYGA 1DG1G 4KNYA 4L07A 3JQ8A 4R1OA 5HM6A 3SYTA 2B36A 5JAOA 5DOVA 4RTRA 1SA0A 1WJGA 2GCEA 1R12A 3E82A 3GP5A 3PIRA 1W88A 2Q4RA 3FCEA 5KHLB 2DFVA 2GK6A 3PQ8A 3F1KA 2I6FA 1ZMXA 2V9CA 3JQDA 3OZXA 4YBRA 2CLLB 4RABA 5FJJA 4MYRA 1QYIA 3EXHB 3D8UA 3R9XB 4GRIA 4NCJA 5JQGA 4TTTS 3DBRB 4OQXA 2A33A 5BRNA 1PE0A 3K53A 5JS1A 3WGHA 5HIMA 4E5MA 2NTNA 5LB4A 3ZIAD 3RS5A 2G08A 4K9PA 2YJ5A 5CDYA 1NP6A 5T4EA 5BSWA 3BC1A 2O7RA 3L02A 2JFUA 3LUBA 5DBEX 4QOFA 4ZZ2A 4ARAA 4EZIA 2GAIA 1R4AA 3QM1A 2OV2A 4B3BA 2GZHA 3OICA 1E9AA 1ZJZA 5EA2A 4D8VA 5FUBA 5D3KA 5FXMA 2GHIA 1BE0A 1Q1NA 5J2UB 2JJQA 1JDZA 1MOQA 2I3ZA 4BVHA 4IHQA 2ZR8A 4B8YA 4NOKA 4Y6GB 4GMGA 5D00A 5DN6A 3WLNA 4BWGA 5AKYA 4XIJA 4KQFA 3CT6A 3BL6A 4OBEA 4MB6A 1GZDA 2F43B 2NO5A 3LXUX 1PZHA 2PTHA 2AR0A 3KWLA 1NN3A 3TDNA 1Z47A 1AJEA 2BE7A 4MV6A 3HU3A 3IIEA 3TCNA 5EERA 3QUSA 4UBMA 2WD7B 4DA7A 1K06A 2VSFA 4HHEA 5JSHA 1T8UA 3KYCB 2CLDX 4BLTA 1R5OA 3X1JA 3DEAA 2HSJA 5JNSA 5AXDA 2VRCA 3KO8A 5E1BA 2WMYA 5ED0A 2W6ID 2ZRJA 5CG1A 2OD9A 3T1YB 9LDBA 1FDWA 4IJKA 3GIWA 4YRSA 4L9AA 1UDRA 4Y8VA 1KR2A 3E9EA 2YVKA 4FYXA 1YIOA 1NY5A 3WMFA 4E14A 4OMFG 3G2JA 1NVVQ 4B4DA 2ZR9A 1A5AB 2NO7A 4L8WB 4OXRA 5DMXA 2RBGA 1E9DA 1BWPA 2F9LA 2P9JA 5IDXA 2EX0A 4K9MA 4URXR 1T2NA 4NCIA 4MGEA 3VZCA 3NNSA 3W9BA 3VVBA 4WXRA 1A9TA 1IOWA 2Y4NA 4ZOAA 4Z1OA 1KEWA 1JILA 1DQZA 1MO4A 1WLYA 5KSYA 1XHEA 2ZWPA 4MROA 3EZYA 5DPMA 3QPCA 3C6MA 1RKBA 1WXEA 2CV0A 2BFBA 4ZAYA 2G1UA 4AUNA 3VR3D 4R84A 3HDJA 3LLSA 5LZ9A 4FOTA 2HT1A 1O95D 3KJXA 3M4JA 4GZLA 2AEFA 4K5QA 5DSXA 4F3KA 4EGQA 2BGIA 7REQB 4HNSA 2HQOA 5K0TA 5LIRA 2C59A 3S5JA 1EIZA 3LRPA 2OXCA 2IBSA 1XZFA 5ES3A 2W6CX 2D6FA 1IPEA 3I76A 1KFJB 1SIOA 5GV7A 3RU9A 4NE9A 3V2UA 1XEFA 3PVSA 4KIUA 3S3TA 3AM3A 1H0HA 2JLBA 2D0OB 1HGXA 1EUDA 3I53A 4WZAB 3A8TA 4DQ0A 4L8FA 3L3BA 2RHBA 3PSHA 2WJAA 3FTCA 4FBLA 5BURA 4NCNA 4LSMA 2YJ4A 1Q77A 3E7WA 1FW8A 2OSVA 2FY8A 4LYFA 5EHIA 4K6OA 3ZWBA 2VDVE 4C22A 2Z09A 4DIKA 2GF0A 3BN3A 1HV8A 3V4VB 5JANA 2OBMA 3JRWA 5GOTA 3ZE9A 2P62A 3OE4A 1U3CA 4P4UA 3KQPA 4PSKA 1B73A 4V0SA 3T5PA 1QIFA 1RTTA 1YC5A 2OAGA 5F35A 4D98A 4TZ6A 1IZ7A 1UUFA 5C1DA 1C1DA 1E3IA 1UP6A 2GYYA 2O23A 2OKCA 3R3UA 2I76A 1S2GA 1SC4A 1X0VA 2AMFA 4Q7LA 4QUDA 1VL5A 2OHJA 2REBA 4I9NA 1PS8A 2WJVA 3QX8A 3DE4X 3TLAA 5FLXA 1RPNA 1RPTA 4L50A 1H85A 3RFCA 5KKAA 2PBRA 3AILA 5J2TF 4B3SB 2WF9A 4OK5A 1WLSA 4CFZA 5ADUS 3DS8A 4CEHA 4DXAA 1X19A 2WDPA 2VT7A 2Q2NA 2CGEA 1HURA 3QTTA 2Q7DA 3U3JA 1R4MB 4AN4A 2I5PO 5A62A 3HHEA 3R6GA 3ZJVA 1UPCA 1M2VA 3DBLB 3FCXA 5EYPB 1RI1A 3KFLA 4R6WA 2ZSAA 3O8QA 4WA8A 3VR5H 1MRNA 1FMFA 3KEFA 4AJOA 1JG2A 3NHFA 4X7RA 1EDBA 3L8MA 1V2HE 2GNAA 5L3QA 1P7YA 4KPYA 1AQ6A 1J5PA 3I01M 2VLIA 4YCAA 2OGTA 1CUGA 5K20A 1PZMA 4DCVA 4KO2S 5K7SA 4G4SO 3B60A 4IQGA 1WVMA 4NOMA 1K8RA 5FWYB 3A7EA 2YYZA 2PBFA 3BIXA 4BUCA 4DZTA 1D9XA 2XKBA 3WC4A 4IG9A 4AY5A 3ACCA 1YKGA 1BQ4A 1NDQA 2FPRA 2H57A 2POCA 3H5RA 4TKLA 1F17A 1A5ZA 5AOAA 1R0YA 1GVNB 1PD1A 1WSWA 1SUWA 5LOVA 4MV1A 4AG5A 1QH0A 4G1UC 3RDPA 1SXJE 1EVZA 1X1DA 3UPDA 2OFPA 3IVAA 1VCOA 1XPUA 1NVBA 2FPIB 4TT3A 2BUBA 3OQ1A 2X8BA 4Q5IA 3UKDA 5J40A 4H15A 4EFDA 5J2TA 2PKQP 3EDRA 3NWPA 1WZ2A 4CKBA 2O19A 1VXOA 2VXCA 3HRHA 1T2CA 4ZI2A 2GNOA 3CRZA 4NP6A 1EFCA 3CA8A 8OHMA 1WXQA 5BR1A 1TKCA 3UNXA 1Q5PA 3VVCA 2GPAA 2X41A 1SVIA 1RM5A 2B4TO 2G36A 3L49A 5HCIA 2AIRA 3WGLA 1I7PA 4ZYXA 4HY3A 4MOWA 1UODA 2IXFA 2EF0A 4NAHA 5JI3E 4LXUA 1FE8A 1DOAA 1RLIA 1ZK0A 2Z5FA 1JDBC 4KGVA 5I9MA 8LDHA 1O5IA 1L1EA 1TD1A 3Q15C 4ZGGA 3FTEA 2R6HA 4V0LA 2IBMA 4FB5A 1A7KA 1T2UA 1USVA 4D2IA 5BOSB 2O6LA 2XUJA 5EKUA 1VE6A 1KKLA 4CMEA 5DNYB 1Y3DE 2D1QA 2YICA 1JKMA 1RAHA 4GSLA 2X6QA 4DYDA 3S2SA 2WTBA 3I6MA 3RSQA 1M5RA 2ZBQA 2RC6A 4JJIA 5CCBA 3PZRA 4BFYA 3TQHA 1B8VA 1Y3FE 3IOCA 3IELA 4NVRA 1XD9A 2QB5A 1JJVA 1TM5E 4OV6B 1XTBA 3ROMA 4AWAA 4CF5A 5DB4A 2BZSA 1NMXA 3DCIA 4CL8A 1GSHA 4OHXA 4MEBA 1QO9A 2W98A 1EA7A 4AW9A 1AK9A 2ON6A 4KIWA 1T0BA 5JDCC 1FSGA 1SC9A 3H0KA 1I51A 2NU7B 3ZCRA 4U2DA 1ZX1A 4HUQA 3K73O 1HQYE 3K1AB 5T6BA 1EDEA 2VRWA 4UVIA 1GGKA 1OZAA 4WKGA 2QZJA 3AM5A 1N0UA 4CMBA 4EFNA 1MRZA 1YDEA 3HA3A 1FYEA 4YMSA 3N2YA 3Q0EA 4I5IA 3TMYA 2XKKA 1Z2DA 3QSYA 4OGKA 5CLJA 4CV2A 3B48A 4DMLA 3U4DA 5KYYA 3X2EA 2P2LA 1A4RA 1B26A 1ZN9A 3B1JA 1E3DA 5EXSA 1FS5A 2Q3LA 3WJAA 2OBBA 3V97A 1B8UA 3X2SA 1BC5A 3F9CA 1DRUA 1GSOA 2I8LA 2R8YA 1OFUA 2OGZA 4BJHB 1VGRA 3A2LA 3VPXA 3DSRA 2OE2A 1OYWA 1TQ4A 2II6A 1Z6TA 2PFKA 3W7VA 4DBVO 4BNIA 1TM3E 4LJ6A 2XKAA 4O8CA 4Q7MB 3T9BA 1RHQA 2PVSA 4FDMA 1HTBA 1D0VA 2ZI9A 2ZYSA 2QD1A 5AW5A 2Q0QA 1JHOA 4EA7A 3JQFC 3B9RA 3LQRA 5D01A 5KC9A 4K3VA 4GYWA 3VUFA 3NATA 3S2ZA 1ANKA 2XNHA 5L3SA 1OFIA 2X0IA 3AZQA 3E9QA 4FZJA 3HEMA 1Q7TA 5F3DA 3TG2A 3SKXA 2WZDA 2O52A 5FL7D 2RI6A 3M6XA 3B20A 4L8YA 5K2OA 1KR5A 1CJTC 3D2LA 3IUSA 3QI7A 2B0CA 1Y34E 1G42A 1LPPA 1CDDA 5CT9A 3ZWDA 5DYIA 2DWQA 2YL2A 2XSZA 1E3SA 4TV8F 1J0CA 1ZRMA 4CR6A 4F3NA 2Q27A 4GOOD 4Y7CA 3H7AA 3HYTA 5EUQB 4D8XA 1P81A 3G8CA 3OEHD 4C2AA 1D7OA 3Q5GA 4KQWA 5HWSA 5ALTA 4HXEB 5TX7A 5DSTA 4N65A 1OWOA 3C24A 4YA6A 4A8HA 1QWSA 3M6IA 5D84A 4CL3A 2XA2A 3GT4A 5EJFA 1X7WB 1PV2A 5K3AA 5FUQA 3ERCA 4HF7A 4P33A 2DR0A 3OJCA 4QWWA 4QOSA 4W5TA 3AVPA 3PEWA 3N87A 2XDQA 4F8JA 1QGUB 4HQNA 3RHSA 3W5JA 3AF1A 4KSYA 4U0KA 1M1YA 2N1BA 3GQBB 4K7JA 4B6QA 5A4JA 2ZT8A 5IM4A 3D3KA 3U1TA 3ENZA 1CZLA 1Q2UA 4MIEA 4UU7A 4PHCA 2VOEA 2IIQA 3A14A 2D62A 2JI4A 2WWWA 4GVLA 4LISA 3AR9A 1K92A 4DB4A 3M6MD 1VLJA 1QV7A 3TNDA 2CT8A 1JPNA 2B92A 3W5BA 3ZE2B 5AIBA 4YXFA 1ZH2A 1PFYA 2CVQA 1XR3A 2IZ6A 2DEUA 3VU0A 4B9EA 1N8SA 3GDHA 3U37A 4DCUA 2YNMD 2Y1FA 2QE7D 1KQ3A 1NJ1A 3FDZB 4DMGA 4YFYA 5K4GA 1RMTA 4QDJA 2WUGA 3FHTA 1EE2A 4TUYF 4CT5A 1E62A 2EERA 3RBVA 3UT0A 3RYFA 2A1UB 4GMXA 2IWHA 2QLNA 1XYGA 1NRXA 1Q44A 3DEJA 2WIAA 4UM5A 1W75A 4V0MA 3WKBA 3HP4A 1UP4A 1VJ0A 2FEPA 1OH6A 1TUEA 2I7TA 3DDOA 5GVSA 621PA 3TF5A 1OREA 4Z7QB 4J4HA 2O3UA 4GMKA 1Z15A 2PGAA 1JJ7A 1GCIA 4O2AA 1YVEI 2H9AA 4MUFA 4NFHA 4CLRB 5JFTA 2QTHA 3V4SA 4AP6A 4Y0NA 4MGHA 1E5LA 1GNSA 3LDGA 1AHHA 4PSDA 1I6KA 1YKSA 4QOEA 1FU7A 2CMGA 1U7OA 2GNPA 3JYNA 3DKVA 5IN5A 2C7QA 1ETHA 2QK4A 4MR8B 3T7EA 1W36B 3RT9A 1DOZA 2OV1A 1P4JA 2NZVG 2V9PA 2X2OA 9LDTA 5L4SA 4AJHA 5AR1A 5JZVA 1ZBDA 3JYHA 4L8VA 1NVEA 2HUNA 3SZRA 4QUKA 2P68A 2JI6A 2R68A 3PC3A 4OHRA 4MLDA 2ZIWB 5B7NA 4C03A 1QHNA 3ILSA 3UMVA 4JLWA 3QW2A 5IW8A 3PQ6A 4A1OA 4RE6A 1LX7A 1KO7A 1DHRA 2JS7A 4Z9YA 3V34A 1Z74A 3RF6A 2VJQA 1E92A 2DVMA 4MVJI 5IAOA 1WB4A 3JARA 3W05A 3BCHA 1WNFA 4KYVA 3RS3A 3WHKA 5BVGA 2V7QD 4WK6A 1ZI8A 1QAQA 4B74A 1NW5A 1SQSA 2IPOA 2IYNA 4PAMA 5EL0A 2VBCA 2XCQA 4CNQA 2I54A 5DYYA 1E7RA 3ESDA 2BFCB 4HWOA 3ZWMA 2OCXA 4ZZ3A 4D9KA 1TPZA 1XP5A 1NLYA 2HADA 2WWGA 1YZQA 2XQFA 4FGZA 5BW8A 2WYVA 3DOIA 3U9TA 2QMZA 3ZE0B 2B6NA 1HETA 1D1PA 2X2EA 3C14C 5JVDF 4CQLA 2KX7A 2N3ZA 4PGHA 5JFOA 2ZRHA 2YFQA 4LS3A 2WM8A 4F06A 4HNQA 4YVFA 2F4VB 3GAZA 2QL5A 1Z68A 1GDDA 2D2FA 4IDDA 5CFPA 3KQNA 2BGNA 2E18A 1V5GA 3ONNA 4C2UA 5EY5B 2YY6A 3COWA 4YTEA 1UT5A 2F3SA 1SKMA 5JE8A 1TZBA 1G3IA 1CR2A 1W73A 1OZFA 4PCAA 5E4TA 3L8HA 4CDNA 5I4BA 3EY4A 2RGWA 1RP7A 4ALIA 1KDRA 2XADA 1ZVKA 1AUPA 3L7IA 4GI7A 4NE7A 4EGSA 1RYMA 1N34B 1IK6A 1UAYA 4ZARA 4AS2A 2O7SA 4UE3S 2Q5FA 4JB0A 2EDCA 5F9MA 4NOJA 2J4FA 1MG5A 3LVBA 2XJ9A 2VTVA 1C0PA 4JYMA 2XUHA 1Q7CA 3MG9A 5I7SA 1Q1ZA 2B1GA 4RL6A 3UJHA 2GM5A 2QJOA 4ERNA 5JWRA 2FN3A 3ST7A 1G6HA 3BJZA 1N1GA 3URKA 1RAEA 4A8TA 3VNVA 1EM6A 2D4AA 5ARCA 5HUJA 3ZXSA 2KS6A 1HLGA 4BNUA 2RK4A 1PL0A 1CVLA 2QTCA 1P0QA 1KDTA 3KQKA 3EZ7A 3IOEA 4MLPA 5M04A 3ENKA 3OPYB 5KYUA 5BR7A 2GWHA 1HL3A 1B3BA 4US2R 3EF3A 4DIMA 4CETA 1RU3A 2W58A 1NQAO 2CXOA 3M1AA 2VJMB 2H2IA 4R7ZA 5JW6A 2AYZA 3FLEA 3O6VA 4IIJA 3ZTWA 4EP1A 4GZ3A 4WZ6A 1O6BA 1PNQA 1N0VC 1BIFA 2RGDA 3QUCA 4DVJA 2E7ZA 2H16A 2H1SA 2PN1A 3AOGA 4HGOA 1M1NA 3ZZ0A 2G80A 3CURA 5G0SA 2AEMA 2QTRA 4MCAA 5LB2A 3M81A 1ZM4A 3ASZA 4G5QA 4TV8B 2M6LA 3U3RA 6PFKA 3LT2A 1E2LA 1E8NA 1HI9A 1W5EA 3OSUA 1L4NA 4Z9XA 5I9IA 1RYBA 3HFRA 5JJCA 2J48A 1L1FA 4Y2VA 4UNRA 4AZ0A 2BDUA 1O9HA 4CHGA 1OCEA 1CUWA 4ESOA 1XD8A 4QHSA 1QB7A 5DXFA 4UD2A 2C8JA 1EVKA 2OXFA 3ZOKA 2IZZA 4TXMA 4FE7A 4UHEA 1H65A 2MSWA 2P4EA 5DM60 2QN8A 2V9ZA 1PK7A 3DZBA 2H11A 2FOIA 2DKOA 1JG4A 4P3YA 4KO4S 4P0PB 5FBQB 4R8MA 5FI5A 3ASYA 3D7RA 4LK2A 5KCMA 3DV2A 2Q3CA 2WB4A 3BE4A 5J43A 4L02A 5AUNB 3JQGB 2B2NA 4R98A 1BA2A 1DEOA 1ZMBA 3LFUA 4Q9IA 3QYFA 1UPUA 1YR3A 2PT7A 5EMNA 2GA8A 4RA9A 4DQDA 3RT7A 1JLLB 1S5PA 4P80A 4E2ZA 4ANFA 1JSZA 4EKYA 1A95A 1WUKS 3EF1A 4CIBA 3P9IA 3FOFC 3WYFA 1UXKA 5I3ZA 1KZGB 4HG2A 2FHPA 2X0RA 4MQMA 4HMPA 4OBXA 5KNLA 1DJPA 2AN5A 2C4NA 1XTZA 1U65A 1U11A 5JCJA 1R3DA 5HMMA 5K5EA 1D07A 1AUOA 1XPRA 3KT0A 3LZ6A 2ID4A 2IUFA 4LXHA 2J0SA 1D04A 1G8HA 3K94A 1BVUA 2Y71A 3JX9A 4MS3A 5J4LA 1M75A 2YUTA 4G0MA 3FB1A 1EH5A 1Z6AA 3H9JA 3LDFA 1ELOA 1E1MA 2CNWA 3WA6A 1SG9A 4GKKB 4CKEA 3DWEX 4TWJA 1E18A 2VWHA 1FP4A 3FYCA 5TPWB 4OHBA 3LBYA 4MW9A 3U7HB 4LY9A 3T3HA 4BMOB 4BX2A 3BMCA 2OFXA 1DIHA 4DWVA 2AC4A 2VDLB 3ZHRA 2VDJA 5FIUA 1YZNA 4ICIA 4P34A 3F4BA 2LIPA 2Q50A 4LRTB 1GADO 1NUSA 2WA2A 3TW0A 3FPJA 2QX9A 5K2MA 3F5QA 4HN9A 4YAGA 3WO1A 1JSLA 4GYKA 1X8JA 2VP6A 1TVCA 2C03A 4O2AB 4EZBA 5JASA 3EX7C 4BRZA 3HBLA 5E7MA 1G20A 3EG9A 2NV0A 4G26A 3K9QO 1FQKA 3KVYA 5K4AA 5EJMA 1UR5A 1B41A 1RJWA 2GKOA 3K09A 4PC1A 1GPUA 4O2LA 2WSBA 3ZWQA 1MP0A 1JTFA 4CLEA 4RIFA 2ZIAA 1GDTA 1HZJA 5E9JA 1EEHA 4D9JA 2ZT7A 3BFVA 4BBAA 4DANA 3KJHA 4U2BA 1MB9A 5IPFA 5KKCA 3JS5A 4RKWA 5TV2A 2OXIA 3ZHZA 4E12A 2ZUFA 4QD3A 1Y89A 3PQCA 4QTXA 5JSFA 1TLLA 2C4VA 3CH6A 4WWHA 1QRUA 1PDOA 2X8JB 1PCXA 3IUBA 2R6AA 4KO1S 3WLRA 4TVSA 2W90A 3PL1A 5LM3A 4JI1B 3AF2A 1QORA 3QXHA 2AKAB 2ZBFA 3E22B 2CDRA 4LQLA 4P86A 2MYNA 1Q21A 3E35A 3I04M 2H3HA 1HXHA 1E7QA 1V8PA 3PXBA 4U0JA 1IWBB 3KKKA 4J76A 1KJZA 1RJEA 2MINA 1JHAA 1GPMA 2TYSB 4L4ZA 4HC4A 3UGKA 5K99A 1M6NA 1WTCA 2QLMA 1Z6XA 4N0EA 4OI0A 3G7SA 1ML3A 1JFFA 2V0CA 1NNSA 1Y0BA 3A9TA 2P41A 2ANBA 3B53X 3JPYA 1HY3A 3W8FA 3HNRA 3WFJA 5DASA 5A5DA 3A25A 1VE1A 1B14A 1CUXA 3QVKA 1J0DA 1SQFA 2AK2A 1DMRA 2P5TB 2ZUVA 2RDMA 2V4UA 4QYTA 2FJ0A 3JASB 1XUOA 2P6UA 4FE3A 2RC5A 2AGVA 4YMTA 4QVGA 5AHWA 1WW2A 3WNVA 2AJTA 2WIDA 1VSUA 1FS4A 4G85A 1AQLA 4PV7A 5DBHX 1EBBA 1SXGA 4P2BA 3DZJA 4JI7B 2OUIA 3WYBA 4LJ7A 4H1UA 2C4TA 4UBNA 2PR7A 3WGUA 2BBOA 1BXKA 2OK7A 3KFVA 1EUYA 3MAJA 1HLFA 5FOTA 1E3MA 2XW6A 1XF1A 3G7NA 3QXCA 1J0EA 4MXDA 2XUPA 4ZMBA 1XBTA 4DM4A 3W78A 2DQYA 4MYSA 2OCDA 2ZAGA 1XRNA 4FFSA 2O14A 3D3QA 3NOQA 2BFFA 3A4IA 4PG6A 1TYDE 3RK0A 1C14A 3ROKA 2HFKA 2PUHA 3IO5A 3L6OO 3OOYA 4IIBA 3OP1A 4L7QA 3VISA 5AWFC 3VPDA 1E6CA 3I6ZA 2RGUA 3JWPA 1AB6A 2B8WA 3OFNA 4HAXA 3H2GA 4LDNA 3OT5A 1CJKC 2CKDA 2B7CA 3OX3A 1XMVA 3JQAA 5HMLA 2MYPA 4DLZA 1WB6A 4IIUA 5J5CA 2QORA 4PYNA 4J0DA 4DOMA 3TUJC 4HSEA 1EG7A 3HCPA 1Y5LA 3DJFA 3NH6A 4L9WA 3I9KA 3HKEA 5D6NA 4ZI7A 3ZDCA 2WU4A 3E2MA 1NM5A 4EKGA 4FCWA 1DJNA 2JVIA 4M83A 3B8HA 5EXPA 2IK8A 5BUZA 2XIQA 3H0CA 4X1OA 4TT8A 1Y80A 5EKDA 3CR8A 3OZRA 5JJLA 2EXXA 2ISSD 5HRCA 1FDOA 1O6FA 1GGHA 3C3CA 4E6PA 5LPNA 3T3NA 1XRLA 1RLJA 3ETNA 3FHOA 4XIIA 1QDEA 3CVXA 2V0NA 1KQPA 5F1KA 1KDPA 1V8ZA 5F9HA 2GN6A 1U2ZA 4MYUA 5FTKA 1T1IA 1YJ8A 4MEAA 4WXMA 3G59A 2P69A 1T9ZA 4G86A 4KQ1A 4BX9A 1N1DA 2A9OA 3A70A 3RRXA 3HEAA 4AECA 2W2PA 5LL6P 4RZXA 4X95A 5ER6A 2HYIC 1A9OA 5HM8A 1H5QA 3BCRA 1U0BB 2A5YB 3FF4A 1II8A 2ZJ5A 2ZLBA 1CQZA 1JJFA 4NULA 1W36C 2DYKA 1MJNA 3IQIX 2QZPA 3JZDA 1BYIA 4LMBA 3LC7O 1G0OA 4QPJC 4DSUA 2XXAB 1R8XA 1DE0A 3KUDA 3BSYA 1GNVA 1Y4AE 3BRCA 4NU6A 4OQQA 3RG8A 5JBQA 2RHDA 3LJKA 1VYUA 3L7DA 5JXIA 1DKNA 2Q6KA 5A1TA 3U44B 1E1CA 1KA9H 1LSUA 4N0QA 4C7JA 2OLJA 4K8RB 5JOQA 2AYXA 2IV2X 2V74B 1UJMA 4YJ2F 5A7FA 4F3YA 2P6MA 4JLSA 3T52A 2D1YA 4B79A 1QHYA 2HFJA 4RA9B 4GWKA 3SBOA 5ARDA 2DT5A 2VHJA 4HDQB 1GA4A 1JXAA 3V32A 2ZJ8A 1K8ZB 5IASA 3UWMA 3DV0B 4YP9A 3FUVA 2P9YA 2V6JA 3WZ2A 2QQFA 1OKKA 4N6GA 2ZRPA 3RWMB 2AMVA 2ZAOA 3G82C 1UMCB 2F9FA 2J6BA 1K75A 2F8LA 4N3CA 3MOSA 5BNZA 3BDVA 1UC8A 3KP1A 3LUJA 2MTBA 4GSYA 4OSEA 5JMTA 3QXXA 1HA3A 3KZNA 4HGYA 1YQGA 3JZIA 4KTVE 1PD0A 1EGMB 2ZYAA 2B0JA 4QYMA 1ZD1A 3MWEA 2ZREA 2GASA 3PSAA 4RC9A 3HYCA 1YS4A 4GQAA 1T8WA 3B52X 3BMOB 1M1YE 1V11A 2QX6A 3E7XA 5DGCA 1IG3A 1TCBA 3FFAA 3WXBA 4EKDA 5BSFA 5LFAA 4P58A 4DR6B 3EAGA 1VL8A 3E8MA 3GT0A 4RZ2A 4YP6A 2DKFA 1L5KA 4HDRA 3OIGA 3PFIA 1XNJA 1RBMA 2AR9A 3OU6A 5BV2P 3TZLA 1J5EB 3P8ZA 4P0TA 3DBHB 2PXAA 4INPA 2J0UB 1FX0A 3FGPA 1KJ9A 1CQJB 1QH8A 4EY7A 2VI5A 3KCNA 4UJ3A 4KKVA 3MWKA 3TQTA 4ZQCB 1P4HA 1QVZA 2OOKA 1P8JA 2QQEA 4Q16A 2GA9A 2HPAA 1W48A 2P40A 2QM3A 2ZPUA 2QL6A 4BJ3A 3KG2A 1MV5A 4UVHA 3JAMA 1QFMA 2C0QA 2XCIA 4MO2A 1JVBA 4IWXA 4UUBA 2YQZA 4BQSA 2WP0A 2GB4A 3P2MA 1KQFA 2UYQA 4AJPA 1ISFA 3FI9A 4M55A 1ISIA 3H18A 4POAA 4Y6PA 1R74A 3G2LA 1UBKS 3IHTA 2MYUA 4PBSA 2GXQA 2WFAA 1IH8A 3BH0A 5I7RA 4QM7A 3GPIA 2JH8A 2PL9A 1TADA 2PBLA 1IJEA 3HDGA 1N8NA 3MLAA 2N47A 3IO3A 3BRWA 3PQDA 4MKIA 3MS7A 3FKQA 3GEHA 2JGMA 5AW1A 2A14A 2XTZA 3HDQA 3K0SA 3TRHA 2BVNA 4GU5A 4KR2A 2ZITA 2Y1GA 3ZE1B 2W2QA 1MDBA 2ET6A 1OAOC 2BEVB 1ZN2A 2LZ0A 4BKUA 2HRRA 4IEEA 1WOYA 5TQJA 4CLXA 1VECA 3V1LA 2CE7A 2WFLA 2PNJA 4Q4CA 4XA8A 3BFXA 2VCEA 1RI4A 3PTLA 3JV7A 1OV6A 3LUFA 4QUIA 4XX0A 1TJPB 1P1IA 4B8WA 3LOUA 1U8AA 2Q1TA 3CF2A 1JECA 2VOJA 2PH1A 4FJ0A 4UFNA 5CT4A 5DWDA 1S3IA 4M1SA 5JO9A 4OI1A 3THYA 2XA9A 4V0RA 2O9JA 3DHNA 3EZ9A 3T4XA 2A1TR 3CX4A 1JLMA 1V8DA 1Z9BA 3G7UA 4TLDA 3UJ9A 3ESXA 4EF6A 4G1CA 3NOXA 1Q20A 4UHFA 4LCBA 4D9MA 2HWWA 1K7FB 3ME5A 3NO4A 4G5YA 1IQ0A 4CLOB 2P6RA 3O83A 3PHBE 1FIUA 2FRDA 2QTFA 3ELDA 3MCTA 1Y4UA 3D3NA 1MB0A 5AW3A 1HZZA 2ODNA 2OVBA 1L5WA 1TC2A 3A4LA 4CIWA 2ZS8A 3RG2A 4OSPA 1UBNA 3R6TA 1TK9A 2VJYA 3RO7A 4EJ0A 1EP2B 1HE4A 3A04A 2VK8A 5LOVB 3IE1A 2OCPA 2W4IA 3R3XA 4LDRA 2Q5CA 4C08A 4ZO9A 9ABPA 2CUTA 1UJ4A 2QR3A 3VSBA 2FWMX 4R9RA 4P36A 5HOEA 1K8YB 3V3TA 1PZEA 1NZJA 2VQDA 1DTWA 1F2DA 3BSWA 3FNRA 1XDSA 2VAPA 3K2BA 3PXCX 1XO1A 2IQIA 4HPWA 2AE1A 5EGSA 4P4LA 3V8PA 1P72A 5DNUA 4IGKA 3WL4A 3OUUA 3OPYI 3HLTA 2ZWVA 4WNAA 3P2IA 4ZI7F 1UL1X 2PXHA 2PZFA 5DIFA 1LWNA 3NMUF 2MDTA 3T7IA 2GDZA 3PKIA 2AS0A 4W5OA 3HU2A 1MH1A 2NN3C 5FWNA 4OUKX 4K8OA 2PXXA 1FXWF 1KO1A 1X7HA 4JBYA 4MI1A 4DTIA 4LYJA 1SHUX 5I7FA 1PEAA 2P67A 3PT5A 3OQMA 4EEKA 5A9SA 3DDSA 2PKCA 5JZSA 4WLUA 3VGPA 1QSGA 1NPDA 4HXGA 2G09A 4OGWA 1X8LA 5EHNA 3MCVA 1I6WA 2X5XA 3K0CC 3O8OB 4FYMA 3WIDA 3H4VA 3KTFA 2OV8A 1DT5A 2VPQA 3EZNA 4GWGA 1BE6A 4NYIQ 3EXG1 4GI3A 4QEKA 3CRRA 4FT4A 4QWMA 5WRFA 3R7DA 4W5RA 2ZJOA 1OFTA 1GCAA 4BUJA 4IEIA 4YMGA 2H8GA 2MJLA 4X1IB 4NMHA 4TUYA 5GONF 2XX3A 3FWNA 3EW9A 3VZPA 3ZW8A 5IBCA 5JCOC 4RTPA 5AKZA 2O8DA 4YMLA 1ONBA 4P53A 3V8BA 3VAYA 2CF5A 1GNQA 2XH8A 2QLBA 1HDOA 1GDHA 2A9PA 1Y8RA 1BH2A 2JIMA 2PIAA 1WD5A 3BBPA 3CLTD 3L9WA 5AVUA 2CD7A 1B3RA 1YIAA 1V43A 1JPVA 2FZGA 2H06A 13PKA 1AN9A 4JL8A 2FZCA 1DC5A 4PLTA 1PZFA 4Q4HB 2O8EA 2QU8A 3DP9A 4YI3A 4QTTB 4LMPA 4D43A 4LNUB 3N5CA 1LZLA 4MKZA 5CR9A 2ZUTA 1NONA 2XOKD 2ZUSA 4KXLA 1SBTA 4S2EA 4TLLB 4MUHA 4Z1MA 5C5EA 3FXAA 1JA1A 3K4HA 4V1CA 2IUEA 5HCNA 2P75A 4Q1BA 1E1CB 1RDFA 4Q7KA 4C0QC 4CR8A 5K0SA 3L0OA 1NMSA 1FVXA 1VYTA 1KMHA 3ZY5A 2O6HA 3GCDA 3ZY6A 1KMNA 4D8UA 2ZUEA 1P61B 4NESA 4MPJA 2H18A 1H69A 3DMRA 1PVVA 4D4JA 2FRDC 3NR2A 4KIJA 2P1ZA 5REQB 2BE9A 3DHEA 2O5VA 3L8CA 3WIBA 3QEBZ 3BK2A 2VTEA 2ORIA 5JSYA 4NDNE 4E46A 5EHGA 5L3RA 3PJFA 5KVQA 1E2QA 1TMOA 4S2UA 4J16C 2F8TA 4A23A 1GNPA 3NVDA 1YRWA 3UK2A 3WB1A 1LXCA 5AIAA 3L7CA 2X5JO 4PLGA 1H0SA 4D41A 3FPBA 2GN8A 2VL7A 2GPTA 4KN9S 4BBZA 4FS8A 3QV2A 1ADGA 2AZMA 1J07A 1ZWLA 1O0CA 3SICE 1N8TA 4TV9B 2EX1A 4M9QA 1BFDA 3UV6A 3QWFA 3KEGA 3KAJA 2F1JA 4O2RA 2L2QA 2D5IA 2JKZA 2AYYA 2VHYA 3KZOA 2ZRAA 1B93A 1C3OA 4LNHA 4ZPXA 1IEQA 4BMYA 3T3PB 4GKJB 1JBEA 1B43A 1MXFA 1YBFA 2N75A 4AURA 4QC2A 4D42A 2K6GA 2PPVA 3NYIA 2OV4A 5L3SB 3IEVA 2DFPA 1YT5A 5AJHA 3T9EA 4CODB 1VRVA 1TEHA 1XKTA 4GOXA 1UANA 3O8LA 3PFKA 4W6ZA 4B3XA 2J33A 4Q7QA 4MA4A 4H7JA 4YP1A 4HDNA 3O1LA 1MIOB 4PX9A 2I2XB 1F4LA 4R51A 4TMTA 2O0MA 2QG6A 2QEQA 3QYPA 4B7CA 3KKNA 5G4LA 3D2BA 2ID9A 4WINA 4QFMA 3RRBA 5LZ4A 5HUHA 3S81A 3MUEA 5DI3B 2JLVA 1MTZA 1VHWA 1Z4PX 2QY6A 4DJEC 3DBVO 4EQ6B 3N0XA 4PNHA 3NQ41 3GJRA 4IV5A 2YX1A 1P33A 2AR7A 1V16B 3T7CA 2HZBA 3D1LA 2A94A 2I34A 2VXYA 1JBQA 4S24A 4ZIRA 3E05A 4YR9A 4EL5A 4RTOA 3DEHA 3AR7A 4M0EA 3RSLA 3T1OA 2BFWA 4WJKB 2GILA 4DTCA 3IBTA 5K3EA 2GCOA 2QW8A 3JALA 3V55A 4QYSA 4NOLA 2H4XA 2PT9A 2O1EA 3CF4G 3PX3A 3HLYA 4DR2B 1P44A 1RJDA 4HZUB 1K0UA 1MDFA 1XTJA 3PNMA 5I7AA 1YQWA 1GARA 2VDOB 2AJDA 3RVNA 2P9TA 3IMFA 1QQ6A 3CXUA 1G6OA 4PPYA 4KNVA 1FA9A 4J1QA 4B31A 2Y0PA 4Y1FA 5BYJA 1E59A 4D7AA 4H60A 4H7IA 4N8DA 3W3ZB 1DO0A 4WQMA 1FU8A 4KJXA 1A27A 4H7DA 1AHNA 3GXOA 1R0SA 4U7TB 4IH4A 1OXTA 1USUA 4OB6A 1L5NA 1US8A 1Q3HA 1YA8A 2WM3A 2BOVA 1ONPA 4QARA 3P0HA 1WUTA 1ZXXA 4KRXA 3AJRA 4BLVA 4KEAA 4QHYA 3E7PA 1XXHE 5H7XA 1I01A 1YE8A 5FORA 1LV7A 3UMCA 1Y6GA 4L16A 5FQNA 1VDZA 3RVDA 4C7VA 2GYUA 4DNOA 1JS1X 4BN4A 1YVUA 3TM5A 1P2DA 1UOPA 3VVLA 2PZMA 4CG2A 3LF2A 5GM1A 1Z07A 2WVJA 3AKEA 1OI3A 3I42A 4C89A 3I4FA 5B12A 5IJ9B 2XAAA 4YRJA 2GHRA 4M0PA 4M46A 1GG9A 2BFEB 4ML3A 2Y0EA 4YPVA 4N48A 1P80A 1FFBA 5FA6A 4KE9A 2VYFA 3GGCA 3MJ4A 3SEQA 4Z6KA 2C9BA 1Z18A 1ZVQA 5CVDA 2I3DA 2O5RA 2XKJE 3GAFA 1VZ3A 4YXWD 4BVAA 4X41A 1WPXA 3BF7A 4J43A 4GOJA 4RD3A 4M8NE 3PI7A 2PRYA 5C8YA 1XJ0A 3VR1A 4ER3A 1GQRA 2VTBB 1L4EA 2IKSA 1I0LA 5CVEA 1U8ZA 1ESZA 5KC8A 2F17A 1TU3A 4JLPA 1S8FA 4DIBA 5BWOA 1P1FA 2XTAA 4PLVA 1W5FA 3CZRA 3DWFA 4ZT2A 3WRWA 2QAGB 2RHRA 4DW8A 3TLGA 2PS0A 4IIFA 3SR3A 3WFIA 1Q92A 2B21A 3S1AA 4M98A 4EG8A 5IK2D 2HT6A 2EP8A 2GJ8A 3TSOA 1QGUA 2VK4A 3KEMA 2YMMA 4LTDA 2JFOA 1NQUA 1ZEJA 1FYVA 2C9ZA 1YMUA 1BHQ1 5JECA 1C9EA 3RS7A 1ZQ9A 4YCCA 1U0EA 1EVYA 3D7MA 1V3QE 2Z9DA 3EZLA 3L84A 4TGLA 1CEEA 2OQVA 2WT4A 4ND6A 3ZGLA 1JAXA 1Y3HA 5TGDA 2JFXA 2YMPA 2QN6A 3MWFA 1NVWQ 5EJIA 1J1UA 2CVOA 3FWYA 3AKDA 4ZWNA 1F12A 2C2MA 2OO5C 2P79A 5JRJA 1KZ7B 4QQ8A 1EK6A 2AMJA 2C5GA 3OPXA 4HRAA 1CG6A 4RH0A 2AF3C 3A4MA 3A2NA 3RVPA 1IEVA 2EJVA 3LXXA 2FUEA 1KIMA 2J5RA 1AV7A 3WNCA 4E33A 4NJEB 5LWHA 4QBTA 3RF7A 5L9AA 2FFRA 4XASA 2WVGA 5C80A 1XMJA 2JGIA 1FNBA 2JKVA 3C3BA 3DTVB 3OLXA 4RK0A 1YS2X 3JVUA 4G3XA 4GGMX 1I4TD 2AOWA 2JIPA 1UOEA 4DGQA 2Z1MA 3Q3VA 2GOYA 5B1IA 1H8HD 3DTVD 3LYLA 2ZI6A 3IULA 3I1IA 4IJ6A 2BFAA 4C1BA 1FFXA 2ONZA 4AD8A 4EMUA 3B7PA 3IALA 3DOCA 4IO0A 3PD7A 1ZH8A 2QP9X 3L7KA 3CC8A 4S1VA 4E4RA 4GLOA 4RV5A 5KU1A 1FFSA 2CL0X 1A9YA 3LUKA 4X8HA 1IRIA 1RRKA 3VYTB 3KJNA 1H05A 2MSKA 3BKWA 4NAVA 1W36D 4LPSA 1AC5A 3PRHA 1KMHB 4P54A 5T6MA 4HZIA 5B6PA 1E2KA 3DOJA 3FPLA 5FTWA 4CI9A 4DL9A 5KNDA 3U16A 3NBUA 4UHKA 2I2FA 2JANA 1Y8AA 2EIHA 5K03A 3IEPA 2KB0A 1I36A 4FGJA 4HNAB 1S2MA 5G1PA 2YWGA 4AY4A 3VKGA 5AW2A 2XGGA 1EFTA 2V1XA 2HA4A 1T2DA 3EY9A 3NCHA 1QH9A 1W76A 3SDBA 3LBNA 1Q3TA 2ZAIA 3LCUA 4WAUA 3ZQKA 3GGGA 1ZH0A 5DU2A 1TIPA 3FNIA 5JXGA 2RAUA 4DUZB 3RC2A 2AMLA 3PPYA 3VO2A 2GVNA 1P75A 3C3WA 5H0IA 1PT5A 2XDAA 3X3HA 4YDHB 1M1NB 1DI0A 3HTXA 2VHVA 3KB2A 1BYUA 3A28A 3AEQA 1U98A 2PUTA 2JCSA 2O2ZA 4CDGA 3LPNA 2QZ4A 1K88A 2CJXA 4GP6A 2ALJA 2G9UA 4B6SA 3K7EA 1W47A 5BWBA 1DAPA 3QFFA 4ZHQB 1XMSA 2CFRA 2B5VA 1U9CA 1WDLA 3EPPA 2D2VA 1QOQB 3GEDA 5FOSA 3SHWA 3W2TA 1MIOA 1U2TA 4I8XA 2XRYA 3MWGA 3NXSA 4H0NA 3EA5A 3RIXA 3QE0A 4F60A 5JPDA 1L4UA 3JD3A 4I55F 5G41A 2WQ6A 2XB6A 2BEUA 3EQZA 4OHZA 2DBVO 1M72A 1YK0A 2ZJ2A 3QNMA 4F6LA 4TN5A 4IUDS 1XA0A 4KPGA 3TIIA 2J4CA 4KQJA 4R2JA 4X85A 3ENQA 1NW4A 5JCPA 2E85A 4DRXA 4ZJUA 2CMKA 2D0PB 2XGMA 4YJDA 3PGA1 1LLCA 4DWWA 1QZXA 3MTJA 4CF7A 2CXHA 2RGYA 3DPSA 4JK3A 4QGGA 4XEUA 2GCOB 1E77A 2FAXA 2GXSA 2VNJA 2VAWA 2WJ4A 3PKZA 4MW1A 1P5FA 4PZZA 3WX0A 1NU6A 2R5NA 1C3VA 4ZD6A 5DN9A 2DBZA 2SECE 3TOVA 5ENDA 4JBWA 3R3HA 1ZJJA 3HN7A 1LRKA 4RL4A 4A7PA 3EWSA 4KV7A 4ID3A 3UYLA 1DUSA 3IV9A 4ZOLF 1FTSA 2O57A 5D3QA 4ZC1A 3HVKA 5DYNA 1ZOIA 3L5KA 3O9MA 3W5DA 4F4HA 2RJ3A 5AOCA 4CM4A 3FD8A 4AUKA 1Z83A 4PAOA 4LRSB 3N8HA 2ODTX 2BMAA 3KD3A 2R4QA 3Q8XB 3WLFA 5LC1A 3OCUA 1QF9A 3DULA 3SEAA 4JI6B 2BTEA 5EXXA 3IIJA 1IY9A 1JMVA 1TAQA 3C7TA 1T9AA 1CV2A 2FVYA 2E37A 3EDQA 3EWIA 4RVGA 4FSDA 1CY0A 1H6CA 2YNMC 2CLEB 3TX2A 4I8IA 2RAFA 2X9NA 1BW9B 2CZQA 5AVTA 3GQVA 4BGDA 2JFPA 4AU1A 4HRVA 1BROA 4YRAA 2XE6A 1N25A 2F3QA 2I6GA 4U8HA 4HYYA 1A7AA 4UMFA 3K9GA 4XR4A 1IPHA 3NFYA 3GNSA 3EQ2A 5BY2A 4IIEA 3NBMA 4XVCA 4MKXA 5L4NA 1UXHA 1OLUB 4L75A 4C20A 3L0CA 5KYGA 3TQIA 3GPCA 1CUSA 1RFGE 1G21E 1G5QA 1YHNA 1OYOA 1QC5A 3AERA 1JFSA 1SVKA 1COWA 1WY5A 3WMEA 3ZGXA 1CUVA 3KR1A 5C3MA 1NVVR 2BJVA 2I22A 1MCZA 3AR4A 3NVAA 3BB4A 4QJ4A 1QVWA 3U3MA 4RZSA 1JI3A 4JY7A 3OT1B 3ZN2A 4R5MA 3LYUA 4ZOLB 3ER8A 5L53A 1Y5NA 1JEEA 4J29A 4PAWA 5JWHA 5GIPE 2ZWAA 4PW0A 4FGSA 4TMWA 3PQ4A 4WBNF 1BMFA 2GHTA 1ULBA 4G0YA 2YRWA 1JEOA 2GZ3A 3B7GA 2CHEA 1X1TA 2DP4E 1N2ZA 2PSEA 2QD4A 1HDIA 2V7TA 2X1LA 3H9QA 3I6IA 4X0EA 5EE3A 1ULTA 1CPYA 1XZCA 2L17A 5F3RA 3TIXB 5JCXA 1KXJA 4OU4A 2VDWB 1PQWA 3FJYA 1MFZA 1B76A 2OCYC 3H75A 5EMKA 1ISGA 1QOPB 4BIMA 4KDEA 4RTLA 2FPPB 5K3FA 3TIGA 4QPNA 5IT0A 1Z4LA 2IZ7A 3BMQA 1V3TA 1O4VA 1IIRA 5C53B 7REQA 3BSFA 1JFTA 4RY9A 4PYKA 4XTCS 3C8MA 4KWIA 4IZHA 4U2KA 1J9GA 3NHKA 1UBRS 4BP9A 1ACMA 2DH6A 1YRLA 1QQAA 1KAGA 1WZNA 2NACA 2JAQA 5A4MS 4RENA 4JH0A 1MV8A 5HF6A 7GPBA 5FAKA 3VKHA 4QUBA 3VU1A 4EHAA 3RC9A 1PJBA 3M1YA 3Q8LA 1E1QA 4AZVA 3TQQA 3R75A 2VJKA 3TTUA 3RJMA 1BOFA 2RKWA 2VSYA 3AF3A 3M3DA 3CZCA 3E5NA 5KU7A 1A69A 1C81A 4PAGA 2QE6A 3OI7A 4ATNA 4JB3A 4P2GA 2A78A 2YV4A 2I67A 2GF9A 3DEIA 3LSTA 3K1ZA 4CMIA 3FVWA 2RSLA 1DOHA 2NX2A 3AFGA 1GRNA 3WQHA 4ECAA 1V1RB 5FH9A 5KWJA 3EZGA 3OZEA 4AX4A 2W4MA 2Z9CA 2FQYA 1EZ1A 4IDOA 4WW0A 4H3KB 4BNMA 4Q3KA 3I8XA 2HHAA 2AW5A 2ACEA 2A35A 1KEKA 4ZEWA 2QOEA 4BKQA 1S2NA 1HDRA 1KTVA 3IMKA 2QVYX 1FU4A 2HDNB 2C0CA 2YFKA 2YC2C 1DQSA 2QR5A 3L06A 3PDIA 3W0LB 2DLCX 4HX9A 4TRJA 5LLSA 1HT0A 3UYKA 4CIDA 5AVXA 1WETA 1SXJB 2YHAA 1XSEA 1Z5ZA 2YIVX 3VBCA 3AXTA 4K1XA 4DSZA 1U2SA 3IQGX 5AKXA 1RBZA 3BERA 1QM5A 1EUCB 1VP9A 4R7TA 1NV8A 2YWDA 4RGYA 4Q39A 3RROA 2VDPB 1HK7A 1ABEA 1LPBB 3EFOB 3IAHA 4J03A 3F3SA 1N8KA 2WF6A 3FOWA 3KLNA 3PRJA 3DO8A 1B6TA 3LUCA 5DTJA 1C4WA 4CF4A 4EY4A 4TN1A 1JLSA 2X3UA 3MJTA 2YOFA 2PSDA 4LHXA 5IDVA 4D4LA 5ADHA 3ZH9B 2H1IA 1C9JA 4HNRA 1C9KA 2G6BA 4FXPA 2IYAA 4KE6A 1M34A 3F3MA 1RRFA 1BRTA 1TK3A 2AQKA 1XCBA 2O0HA 3ENNA 2FEKA 2AJ8A 1TVEA 3K6JA 5I4CA 1NVGA 1L4KA 2E4WA 2V7BA 8MHTA 4G41A 5DGTA 2VPIA 4IDNA 5EKTA 3PX7A 4BLRA 1EQ2A 4I5EA 4QU8A 2O8CA 1ZOPA 2I71A 4MLCA 4BO8A 5LJLA 2L18A 5FJIA 2I55A 3SE7A 3TMKA 2WE7A 2GGSA 2C2HA 3FUCA 1PKEA 3CNBA 4H08A 4MVYA 2XNCA 4ZTBA 4AO7A 3WLJA 2BGUA 5BUQA 4CQNA 1D5WA 4N0DA 5GIOE 1ZH4A 3KLMX 4U00A 3V5NA 2KHZA 3DOUA 3N7AA 4PRZA 2PRKA 1TMGE 4X84A 4LRXA 6CHYA 4JYZA 3PR2B 4O4IF 2ERXA 4EH1A 3QKRB 4UASA 1S4MA 2QW1A 4KMOA 5BN4B 3TJRA 1KEVA 1NYRA 2X13A 3NNNA 3H1TA 3LGSA 3HFSA 1LCIA 5HIJA 3ZS9A 2GEKA 4JC5A 2WA1A 5CJPA 5CT5A 4IDHA 1A9XA 1E64A 5CHYA 1G5PA 2EW8A 1I7SB 4GT1A 5BSEA 2WU1A 3T95A 1AQNA 2ZJBA 2UYGA 4HX5A 2WI8A 2PSHA 2JPDA 1P9WA 1E5DA 3T9FA 2RHTA 4X8LA 3L6CA 1K7SN 5F64A 3TTWA 2RG1A 2GYVA 2VCHA 1CR1A 2EFEB 2YYAA 1Z8NA 3OLQA 1KOLA 3FHJA 1DJOA 2HA0A 2OAP1 3QYAA 3EMVA 5A04A 1QP4A 1BG6A 4YLGA 4RVCA 1B00A 1PN3A 3CPHA 4QRIA 3GLIA 1G1MA 4D4GA 1UMDA 3K8QA 1DNPA 1F5NA 3AESA 2XUDA 3PZBA 4RZHA 4UAGA 4XDGA 2CC2A 3ELWA 3ZWAA 1F8FA 1W34A 1NR5A 3MTEA 3U4GA 4G5GA 3G6KA 4BLQA 1ZSVA 4YHBA 5CW1A 1RSZA 1XJ5A 5HG0A 3T61A 3PNVA 3QUTA 3L93A 1ONNA 5TMPA 4EYGA 2D7CA 1N3BA 2O3JA 2ZJZA 2VAMA 3CTMA 4GEKA 5KYUB 4RF4A 1EFRA 4DYVA 5BSRA 2ZTMA 4MTLA 4LSGA 3JTEA 3RC8A 4J0JA 1SHJA 4W82A 2XE4A 4JDUA 1K4MA 3WQSB 2R79A 1B0ZA 2RK3A 4MIOA 4B3CA 5B3LA 1EWRA 4EI7A 3THSA 4JUFA 4RWZA 1EVIA 3Q8KA 2BPOA 1N2HA 2VF5X 3WGKA 1MRSA 1U1DA 4YAUA 1PFUA 1SN7A 4AZTA 4EEXA 2QROA 3WWCA 3AZPA 4M22A 5J23A 1MX5A 3QKSA 2WD7A 4B09A 1IXRC 1I8TA 1CHNA 4NCBA 1AZSC 2GZSA 2A57A 5LUAA 2EP7A 3M6WA 3CXRA 1DFHA 1SRQA 3W1WA 2XMQA 4KRYA 4B81A 2D4HA 2C9YA 5HJEA 4LUCA 1WP4A 2WF5A 2WNSA 3GYBA 2EKBA 3MJDA 1GGVA 1ZGJA 1VGVA 1WD7A 4J7XA 4ZVOA 3J7TA 3ZQ6A 4TYYA 4RDHA 3FSGA 1QE3A 5JZMA 3ABZA 1IHOA 4QDZA 3LQ4A 4PHHA 1ECLA 2CUNA 4QPPA 3BTSA 3DV0A 3AQ4A 1AG9A 4FBMA 4GKAA 4UDOA 4QT4A 2IYQA 2CL5A 1G8JA 2NYUA 3EDOA 1B4DA 1O1YA 3UC9A 3ZWWA 4C0LA 5HTOA 4WK0B 2GXUA 1KZ4A 3QY0A 5ESXA 3TUZC 4HBGA 1MOZA 1AY0A 1REQB 4JASB 1NVXQ 5FA8A 2CVPA 4EHIA 5LBIA 1FRQA 2FPPA 3QVVA 3GD7A 2WOJA 4JHLA 4L0DA 5DWQA 4OHMA 3BBLA 3GVHA 3DBRA 2Z8XA 4U7WA 4JI4B 1XAHA 2VATA 2C8KA 2ZYHA 1CQWA 4PO3X 2RB5A 4ZRDA 2QIOA 1TPYA 2HJVA 1IBSA 4I66A 2R9VA 2HWXA 4P38A 2PHZA 3F46A 2I4NA 3A4YA 5IP5A 1CIPA 3HR4A 5ALKA 2Z4RA 1L7DA 1SVWA 4E30A 1GTRA 5ALQA 3GDWA 4A0RA 5F7ZA 2VTKA 3AOEC 2DUNA 1E3QA 1QAMA 2IXAA 4PIVA 3R9IA 4YT5A 1J21A 2JRCA 2ZK7A 5COQA 1PJAA 1W5TA 4RHTA 4Z7NB 4RYLA 2VHTA 3MELA 3ZWXA 5BRAA 4BATA 3GV0A 5IXYA 4WJZA 1IAVA 1F60A 4HWKA 4XDZA 2GAJA 1DWPA 4RV4A 3TZKA 3C97A 3AP1A 3QBJA 1WHSB 1R2QA 3UMJA 3VTZA 4XWKA 4QBKA 1Q0HA 3AF4A 3ETCA 2XXJA 2EVWX 4P5PA 5LMCA 4MW0A 2G5PA 1CERA 1GZVA 3B3JA 3AHGA 1RLUA 3IV6A 1CZNA 4YJFB 5H16A 1AKQA 4NBUA 4FB4A 2H54A 2FXVA 1OOEA 1SU8A 3CONA 1T43A 4JJ7A 2GCPA 4YS6A 2P9GA 3JQPA 3HB4X 1CY1A 5GQSA 4P1ZA 3I0ZA 3K9NA 4ARCA 4DYHA 3V6LA 3NEAA 1PJ2A 2H4WA 3OZUA 3N1UA 2IH2A 3UMRA 2ZJ1A 1VKRA 1Z45A 1ENPA 1BNCA 3BWCA 5BNIA 3V4FA 5GZ6A 2J9RA 3FF1A 4LDZA 3K8OE 2BGTA 4UD6A 5IFKA 3OZGA 5F5LA 3N53A 3SIRA 4CEHB 3D2CA 1FTWA 4I0WB 2H4FA 1P19A 1NBEA 1XQYA 3CNNA 4FHGA 3OJLA 3WRXA 2BFNA 2PMKA 1R9JA 3KHUA 3RUEA 2Z2YA 1W4RA 4LJYA 3EQ9A 3FOCA 3B1ZA 4I14A 4XPIB 3NRBA 3VO8A 2G06A 4DRYA 3C8DA 3OD5A 3Q5EA 1ZL0A 2MSNA 4TKVA 4ND3A 2NYVA 4MITA 1T8YA 1UJNA 3PJGA 4M9UA 2NIPA 4UXJA 4YONB 1DXYA 2XTMA 4LJ8A 1H4QA 3UUFA 2YJ3A 5IK2A 4EB6B 4HDMA 4EG1A 1WS6A 3NPAA 3M8KA 2VP2A 1A2OA 2H7YA 3IB3A 4IP0A 1RCUA 1SKYE 2PGDA 3FMVA 1G6Q1 2ZWOA 3EH2A 3FKJA 4HWSA 4KI0A 3PCXA 4L74A 1JLKA 2LBPA 1HE8B 3IV7A 3EGEA 2TMYA 4U2GA 3ZHBA 1GZ4A 3N2ZB 4DR7B 4OQNA 2QSYA 3O8DA 1TI7A 4LF5B 1ZSNA 4BZXA 2J9FA 2WWRA 4C4RA 4DIUA 4W7IA 3C48A 5I9NA 3GT3A 2CLKB 2ZIUB 1JEDA 1PHRA 2EFHB 4FQ7A 4OLHA 1WXHA 2BHLA 2AJCA 1C1YA 2WVHA 3AWDA 3N2KA 4YC7A 3UF0A 2C3PA 3L04A 2BZ0A 2XA1A 3PC4A 1RXWA 3VKFA 1E94E 3PWKA 2ZWMA 1I4EB 5DHTA 4YR7A 2QDXA 1NLMA 3DDUA 2VS1A 1RHKA 4FE4A 4I19A 3CUUA 5BORA 3KZVA 4BEJA 2C2ZA 2TRSB 2YS7A 1SXHA 1ZSYA 4LVUA 1TAGA 2KBEA 1AIPA 3M9LA 4D4IA 3RTCA 1XLTC 2WSIA 2QGFA 4Z9AA 4KSBA 4RJKA 4UZEA 3ROQA 3WL7A 4BN5A 4EPTA 2X9LA 5ECWA 3C4JA 5EVJA 3BZWA 2G17A 5TGZA 1MKYA 3TEFA 4E1AA 3SE0A 4BV8A 3TXXA 4J1SA 4IDEA 3M1LA 3HPQA 3VC3A 1C9DB 3R5SA 3VSCA 2JGAA 1JYEA 4KHZA 5T57A 5ELMA 5FWAA 1E3WB 3DM5A 3DE1X 3VYVA 1KPGA 2CNBA 3UQYS 5HS4A 3DL2A 2GVDC 1EINA 5DLDA 3LY5A 4IJQA 3VHRA 1U2QA 4QDXA 1EZZA 2GFQA 4HDKB 4DC1A 2BN4A 2XITA 2P11A 1A2QA 3PKJA 4Y67A 5H3CA 2QPOA 5AMXA 5A6VA 1CR6A 2O8VA 3KWJA 4LWPA 3BFPA 1IIBA 4ODIA 2BGWA 2IYVA 4R1LA 1B15A 3EDCA 2PD6A 2PM8A 4IDCA 3RYHA 4GG1A 4ZDJA 5D5HA 3D59A 3IQXA 4CDMA 1WPGA 3ZHTA 2X86A 2QRLA 3E0QA 1D2RA 1X7YA 3KPVA 4QRDA 1NKVA 1YU6A 3UXMA 3CMCO 1Z88A 4H77A 4UE6A 5GMOA 4ETMA 1JHVA 1TE2A 4HLQB 1OBFO 3GZNB 3AONB 1OH7A 1XK6A 4CMAA 2AN9A 3EXFB 3UG6A 3WNZA 3OFKA 3PYMA 2FFHA 2Q9AA 3MSXA 1H0RA 2NU7A 3WOHA 1L3CA 1NYQA 1IJBA 2YQ4A 4OBBA 1XJCA 3S2EA 2XGOA 7AT1A 4AKIA 2O2CA 2RAVA 1P39A 1NBME 4MVWA 3VV3A 5IZCC 5LD2B 1WF3A 5AVYA 2L19A 3PEFA 5AKGA 3QJYA 3LUAA 4U7JA 2L42A 1V39A 2JHCA 1M8FA 4L4XA 4DA4A 4NTZA 3FBTA 2GI4A 3KKMA 5CTAA 5AH0A 421PA 4YMUA 5DNCA 1V45E 2LW7A 1SUBA 3PFHA 1SBQA 5BNFA 1CJSA 2BELA 1OTHA 2CLHB 5FP0A 4DMFA 3K15A 4CEIA 1V6SA 3BULA 1UM8A 1RBQA 2FP4B 3X44A 1G7CA 1S3FA 1SCQA 2LCFA 2ZDGA 2PMBA 3ENWA 1J97A 4PU0A 2ZW9A 2WW8A 1N4AA 1T6NA 4TV8A 1ZISA 1I2ZA 1OAAA 2SCUA 5J5VA 2PT6A 1SCJA 2XT9A 4MMXB 1SEPA 3HGQA 4MR9A 4YP7A 4EO9A 1OBOA 3GAAA 3UWDA 4O8ZA 4FKMA 3GJYA 4W9RA 3IT2A 1O6ZA 1X7GA 1OWLA 2H7CA 1JV2B 1SOVA 1PQPA 2AFIE 4FGUA 5CB4F 1ZM7A 2PD4A 2OO5A 3F2VA 1EFUA 2FVXA 3LI2A 3O1JC 5FL3A 1F2TB 4C6RA 1JDSA 1I2MA 4JJFA 2WTXA 2N46A 3SI7A 4ARVA 1HEUA 5K01A 4QU0A 3A2MA 2VTBA 2ZVQX 4ZJPA 1FRNA 4WOBA 1NG9A 1FX0B 4P6VF 2ZCVA 4X91A 1NX9A 2DHDA 1T0IA 2GTHA 3LPLA 1H1DA 1IHDA 1K0FA 1YR7A 4HVLA 2VBIA 3I0NA 4BO1A 1OBVA 1LKZA 3GLGB 5BSHA 1UPAA 5EJ8A 1CF9A 3LUDA 4A8JC 4TTIA 3TI9A 1JGTA 4M1TA 4IJUA 4N9QA 3K70B 1KOGA 1TU4A 2V58A 5BPHA 2JDIA 2CEKA 3TTSA 2YXDA 1DCTA 2JCVA 1XNGA 4LQCA 3COYA 5AHKA 4NMLA 1WZEA 4K2AA 1WO8A 2WYUA 5EEGA 3VHXB 4CLDA 4I8DA 5GPBA 4I3GA 1JQLB 4HH1A 1AQIA 3U26A 4C0HA 1ZD8A 3LP6A 3SYMA 1Y48E 3I8SA 4R71A 1ZA1A 2WILA 3CN9A 3IUNA 4JUAA 1YRHA 3V2GA 3ICCA 3RLIA 2DE0X 3CUEF 2YHBA 2Q6IA 4O29A 5JLJA 1VMKA 1XCJA 2ZJ7A 1EFRD 4UBOA 2ZVDA 2HJWA 1IM2A 4Y2TA 3U7GA 2X5KO 3B5IA 3NTOA 4RH3A 3ZY4A 4LOLA 1JDUA 1CZKA 3P4XA 2BZGA 3MS2A 1HORA 4ZGBA 4JYAB 1TRKA 2RH5A 4XX0B 3I5AA 1AMOA 2XVYA 3ICVA 3N6RA 2WKSA 5KYXA 1L4FA 1N7HA 3EK2A 1ZNQO 3C5HA 1UQRA 3CE6A 4L08A 5A1JA 4V38A 3KWMA 4LXTA 1F0YA 5EJ5A 3SJUA 1T8SA 2IYTA 1TVKA 3NVMB 4M0FA 4RA6B 3EOZA 4XKJA 4OGFA 5AFSA 1KI4A 1XC7A 2MSLA 5BWMA 5AK0A 2AG8A 2V3WA 2OYRA 4AX8A 4QQKA 4RMGA 1T9GR 1Z4MA 4GP9A 3WA7A 3DJYA 4Q4LA 1ZW1A 3EGXB 2LIVA 3W6NA 4HNVA 2ZROA 4NBWA 6AT1A 3OM9A 2H3EA 1YQDA 5F98A 3NIFB 4MQ5A 4FR5A 3GAMA 3PCRB 4G8JA 1N6NA 1VA5A 1XG5A 2VRBA 1GZ3A 1N9GB 1PX2A 3B36A 2IEBA 5K3BA 1XCOA 3T12A 1Y63A 2IDMA 4OA5A 1GFWA 3ANYB 2H52A 2ZBVA 4BP3A 1F2VA 3QOYA 1DUVG 1GZHB 4U3JB 4WZBB 3VMMA 1AHPA 3EEIA 3AHIA 3CKKA 4POOA 2CXNA 2HC9A 3A58B 1U8XX 3IQEA 3P96A 4GKVA 3ZLTA 2DXIA 3U40A 1Q0LA 1OPXA 2X76A 4Q00A 1SQ5A 1VTKA 2WUEA 2LNDA 2VF8A 4EY5A 4UOZA 5CEFA 1EPUA 3V46A 4X8MA 3L8GA 5KTNA 1RRVA 4BLSA 4TSKA 3OQVA 1LDYA 1HC7A 1L7EA 3WJ2A 3P2KA 5H68A 3NBYC 4AUMA 2DWCA 1BU8A 3VX3A 4PYMA 3UENA 1KYTA 4IVRA 4CYMA 1PV4A 4BTVA 4BY9E 3N8NA 4J0HA 3QLUC 1ZNYA 2JGDB 5D2CA 5FHQA 4LY0A 3ZXIA 4ZJYA 4WHMA 1YL7A 2I7CA 3ROZA 4A16A 2XGJA 1DJMA 121PA 4JLMA 1HYGA 1A7JA 1GSIA 3CEMA 4JJ6A 1J8FA 4XUEA 3I9JA 1LNSA 1PQ4A 5FR1A 2WOOA 1AVTA 1UXOA 2YMQA 4GIBA 4A8PA 1OT3A 4XFKA 1K7EB 4F5DA 3JQBA 2H31A 3RVLA 4A6EA 4C0BA 1Z6GA 2CLFB 2XV1A 4XSVA 2R7MA 4BNVA 3GLHA 2OHHA 2Z2JA 3EGCA 3OOJA 3UJ3X 4KR3A 4XXHA 5CVTA 3OC6A 1NW8A 3HCRA 4JD5A 3EVZA 3OM1A 1UJ6A 1K6EA 5I8WA 3DKPA 3BHMA 3N0VA 3R3WA 4NSNA 3ZE7A 3FDZA 3F7TA 3IDQA 3KSMA 4FIZA 4LHYA 4H3SA 4D79A 3I12A 1MJHA 5I7UA 4IKOA 1BQ3A 4AFNA 4KJZA 1XTUA 3K70C 5L6MB 4W7HA 4G0WA 4F3TA 3WSWA 3FYTA 4L1KA 1Z3CA 4HL6A 5IRCD 2QLTA 1H2RS 4RHUA 1X1QA 2CBZA 4QREA 1D7AA 3AJEA 2BM8A 2BT4A 5IJAA 4MRRA 4ZVSA 3VKUA 2OBFA 1X3SA 3EVDA 3JATB 4Y2SA 1JMYA 5H8WA 2XIJA 2DUMA 2PGJA 1AGNA 3OCVA 1C7JA 4ZT6A 3SIXA 3JD2A 1KO5A 3AB7A 1K68A 2PZJA 2QTZA 1I7LA 4ZCSA 4E5YA 4EBBA 3CSDA 3LHDA 5KNDD 5EIWA 1BOOA 4IEFB 1FTQA 3RUDA 5CB6A 4FW9A 2VPXA 3KX2A 1MA3A 4CEIB 3U9LA 2VIIA 4HFMA 2WU8A 5B57C 5C2JB 2D5AA 2FG7C 2FOXA 2Z04A 3FE2A 4O2AF 3CLUC 4JZYA 3UEOA 3I9FA 2FZKA 1OSNA 3OKPA 3Q40A 3TZQA 5J1TB 2PUAA 3FTDA 4C4ZA 1X7XA 2PPLA 2DERA 1E1NA 3D02A 1CNFA 3KJQA 2IYPA 1G8YA 2ETXA 5ALLA 2CJYA 2YXPX 3ZBTA 3QKWA 5KREA 2GEDA 1JR2A 5DSZA 1ZNXA 1NMYA 3E2PA 4YRZA 2QRJA 1AKUA 1ZJ6A 2Z95A 4RMIA 3KB8A 4M0CA 4DA0A 1E9VA 5ILGA 3TSZA 1HDXA 1PJ3A 5CLHA 2VQ3A 3E5RA 4WXHA 5FUYA 3W5SA 4G5OA 6ADHA 5HE9A 4ERXA 3VR5D 2BFCA 2FYTA 5KAMA 3W6PA 1NMQA 1Q0RA 4NV1A 1Y9DA 5IU6A 2ST1A 2MHCA 2JCGA 4DLVA 1NVAA 4ZYUA 2ZRMA 3OLYA 2G8NA 4GH5A 4LDAA 5LD2C 1E4EA 2CHUA 4FYVA 3WB0A 4J16A 3LCVB 5H81A 4ONEA 5C5IA 3CPJB 4UZSA 1BJRE 4W8GA 3H4MA 4XRGA 1X13A 4F12A 2AWOA 2E87A 2XODA 4L51A 1ST2A 2V3CC 2CFCA 4EHNA 2PUWA 3O8RA 2HCTA 3MB8A 3C7AA 2LVBA 4U7HA 1GYQA 3OZVA 4EJFA 3AKYA 2E48A 1GPKA 3AEUB 2QUJA 3SS9X 2ZP1A 4RZQA 3P9RA 2UXCB 2G4CA 1UDAA 4GNKA 4K9OA 4EW6A 1A0OA 5KWSA 2F1OA 4OQLA 1YUNA 3H1AA 1QWOA 2P4UA 3DUFA 4DC0A 1HG1A 4QTUB 3TMAA 3IKVA 5J3JA 2IY8A 3CIOA 4PYRA 2RE8A 3IAS6 1KGSA 3LQKA 3NAGA 1M76A 2ZUBA 3NGLA 1SQGA 1UPXA 4XB6B 5G3ZA 1Z0DA 5LUBA 3OG9A 4RXUA 5ALYA 2IPMA 1W581 2O3SA 5DXAA 3EHEA 5E7QA 4XWOA 4Q9NA 1KC3A 2J41A 1AQYA 2E1RA 2ZJ6A 3M7IA 3OESA 3OECA 2IYLD 3IQHX 4MV3A 5CHEA 4NYJQ 5IM5A 4EOGA 1EJ0A 4RPCA 4HDRB 4UULA 4E21A 2OZEA 5FADA 1CUHA 3KTOA 2JHPA 3E8SA 1Y1PA 2HSZA 3OIDA 1T1RA 1BW9A 4GWLA 1S9HA 1NQ5A 1V8FA 4LOIA 4D97A 5AVVA 3TIVA 2QXYA 2NP6A 1US8B 1KI6A 4L15A 5JMOA 1IHXA 1ZPDA 2BCJQ 1IZ0A 2Q21A 3EIQA 4REMA 2DR2A 1UPTA 3ES9A 1Q7GA 3ZLBA 4OGGA 4XGNA 4E3ZA 5BNWA 1XLVA 1SGWA 3FYUA 3SQNA 3VZRA 2BF4A 3EOBI 4XIFA 2ORVA 4RA6A 1YB6A 2R85A 1C8KA 1P7VA 3QFRA 4I9HA 4NEGA 3GDFA 4NPAA 1H9BA 4AWBA 4IL5A 3WGJA 1USWA 2WAMA 1LH0A 1NRWA 1RAFA 1A8SA 4DE5A 1BS1A 1WUIS 1YKFA 3PHJA 3KL4A 5DN6D 2H7XA 4S3MA 1PWXA 1G0NA 4FDAA 1UK9A 3BILA 4CQJA 4L27A 1QX4A 1HLPA 3MBIA 4F71A 3TAXA 4INZA 1OUMA 1PI3A 2HXGA 2H07A 2XUOA 4U9UA 1JDTA 5T4HA 2OM6A 1VB5A 3EXEB 4AKEA 6REQA 5JXJA 4O6VA 2DBRA 2QTAA 5LYJA 2E21A 2C7PA 1DC7A 3A4VA 1S1CA 3S6JA 2HMWA 2JLCA 2HQ1A 1E79D 1QHSA 4ILKA 1N2OA 4UCFA 1I4LD 2GLTA 3QXJA 3DW1X 4HWGA 1ZK2A 1JMKC 4U2FA 5EVCA 2HNKA 2TMKA 4YRBA 5T4BA 5EXTA 2JFHA 4PN7A 5F7OA 3LYHA 3TRKA 1ZUIA 4EI2A 5F2OA 5LZ5A 4MRPA 3KVRA 3JQGA 3MNFA 4EMBA 3SYRA 2KLHA 2V6GA 4WXPA 1MO2A 3UZUA 1AKEA 3PLRA 3O2JA 2OLEA 2XBLA 2ZB2A 3ED5A 3ZV6A 2V0GA 1HYQA 3NZEA 3R9WA 1XWWA 5FWXA 4O4HF 4RMJA 1BWRA 4G4IA 4M76B 2WWVD 1A5SB 1ZM9A 1VE5A 3DB1A 3OF3A 3GC6A 3QU2A 1U3GA 4R01A 4M0LA 3RYCB 4LWZA 4J6EA 3ZD7A 3GA7A 3LM8A 1UK8A 2GPWA 3HDVA 3OH8A 2GYWA 3QVGB 1CNMA 3K5PA 4J0EA 5FOQA 3K2IA 2BFOA 1PYGA 1EWKA 1NQVA 1XVAA 3GJ5A 2YJZA 2WUFA 2ZAYA 4JJAA 2QDKA 3TOXA 3K0FB 3QOFA 4G23A 1VJ1A 1JAHA 2HEGA 1R6VA 2JZCA 3GBVA 1ADFA 5KQLA 3HR8A 1DXOA 4FLFA 5TPWA 3ZDDA 2YCBA 1DTWB 3H19A 1N7GA 3NDJA 4JBHA 1I3KA 2FMIA 4QNNA 1AGPA 3DFIA 5C18A 4TSFD 2HU5A 1OYYA 1UZMA 4MP3A 4RLSA 1MG0A 1WDTA 4PR3A 4II2A 3VU8A 3DLBA 4OJQA 3FAZA 3M4NA 1D2NA 1MO5A 1YTUA 4MHOA 4P81A 2H5EA 1H2FA 1NDHA 3JATA 3VYRB 4AXXA 2XVMA 4WADA 2XMDA 4KQIA 1P6QA 4OUDB 1MQ8B 1F9AA 3K0CA 3GLQA 3SFTA 4AMVA 1WCWA 3S1SA 1CWUA 1PR2A 3AT1A 4LF4B 5J59A 1Z2CA 1E2FA 2MR6A 2VSXA 1EA5A 5A5FA 1KZ6A 1U8CB 2IITA 2V98A 3W8RA 1DTEA 3MGBA 4MUMA 4B35A 1AO3A 1OI7A 4EKEA 1OX6A 1NC1A 2CK3D 1QHIA 1RAIA 3JCZA 4IFEA 4YH1A 3N75A 3OHMA 3ZD8A 4YUZA 4JMPA 5K51A 1GUDA 3I2HA 1CJBA 2C07A 4WJLA 4MJXA 4BQEA 1JTEA 2ZJ0A 3ESCA 1TQDA 4XB2A 5CTJA 4HQKA 1C0EA 1SU4A 1WPQA 2X7JA 3JSAA 3QSGA 2Z3VA 1N77A 3TKAA 2EW1A 4UU8A 4UHDA 4Z9BA 1KS9A 3C8ZA 1D2CA 2DTDA 3ANTA 4HJRA 3RLFA 5IUNC 1P3DA 1F0NA 4UVEA 1R18A 1RYZA 2X22A 5D5QA 3V1KA 2YVAA 3GP3A 3AEQB 4ROTA 1G60A 1MN6A 2BH2A 1PZNA 3BJIC 3E0XA 1ZIOA 1SZPA 3EC2A 2EZTA 4JSTA 4FWTA 4LNUA 4O4JB 2ZKIA 3B1VA 4FYKA 4LK3A 5JH7F 2OXEA 3SJZA 4FHEA 3BD8A 2HSEA 3A1TA 3W5UA 2JIZA 5EWJB 3GFGA 2YZ2A 1QG0A 2IYUA 5C7IO 1QF7A 4ALJA 3QKRA 2YHIA 2V7WA 5FFMA 4BS9A 1SH7A 2ZYDA 2IEAA 4HGNA 3H9CA 3LCMA 3M5WA 1HR0B 4MPTA 1N0HA 1G2PA 3MMXA 1EWVA 3KLOA 4KPUA 3SZ3A 4C05A 4ETWA 5EAIA 1FDSA 3RNOA 1PHPA 1IWPB 3CB4A 3K2EA 4HQFA 4B3JA 2PGLA 2ZB8A 4Z4CA 1ETUA 1CS0B 1WRBA 1UJ2A 4LZPA 1IK4A 5EC8A 3B6EA 9GPBA 1L5FA 1B1AA 3GEMA 5CPFA 1KAEA 1MHPA 1SKUA 4GMHA 5BUSA 1LRLA 1VSTA 3R7WA 3MQFA 3ZJYA 5HILA 1ABBA 1XLTA 2LWIA 5HIAA 2NP7A 1TKBA 2HA5A 4NNJA 5LNK6 1Q1AA 5KO2A 2PMCA 4BO6A 4E5VA 1NI5A 3FMGA 4L4RA 4RD2A 3ZWVA 4LRQA 3IHWA 3MMNA 4YJ3F 3EUFA 5A0VA 3FGZA 1ZKMA 1VBKA 3CBQA 3TTXA 3KAPA 4WOCA 1QPGA 5L3ZA 4CMCA 3MAGA 3C4VA 4Z8YA 2EATA 2RJOA 4KDRA 2B9VA 4DLYA 3DEFA 4IF4A 1LTHR 3ZPXA 4PSVA 3CLUD 4BFCA 5CDGA 1DBWA 1FFGA 1H1LB 2FEAA 5EMMA 3CT4A 4MA0A 3LUHA 3T7JA 3LC0A 2OZKA 2XLCA 4GW3A 2JJ2A 4KG7A 3LTNC 1O94D