4IUFA

Crystal structure of human tdp-43 rrm1 domain in complex with a single-stranded dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of TDP-43 RRM1-DNA complex reveals the specific recognition for UG- and TG-rich nucleic acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator/dna
molecule keywords TAR DNA-binding protein 43
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iufA00
1K9MT 1YJ9S 2M8HA 4QPTA 2DISA 1VBXA 2J8AA 5DDPC 1WG5A 3CF5Q 2OTJS 3UCGA 3VALA 1WF2A 5DDOC 1SXLA 2RS8A 3U1MA 2ZJPQ 2DK2A 2AYBA 2XB2D 1HA1A 5BJRA 4LMZA 3OW2R 3MD3A 2MQPA 1QVGR 1VQKS 1NO8A 1QVFR 5CXTA 3CULA 2V94A 2MXYA 3J7YU 5DM7Q 2XS7A 1M1KT 2U1AA 1OIAA 3UCZP 2AD9A 1R8HA 1U1NA 1X5PA 2MZRA 2JWNA 1VC6A 2HYIB 1ZZFA 2DNQA 2DHGA 2O3DA 2MZ1A 3RW6A 4ERDA 2NLWA 3J7ZT 3S7RA 3VAMA 5GAHU 4OZ0A 2RU3A 3EX7B 2CQ3A 3LQVA 3UWTA 2RNEA 2Q79A 2CPYA 3IWNC 3V4MA 1WF0A 4F26A 2N3LA 1VQPS 3BS9A 5CA5A 2EVZA 2LEBA 1X4HA 5H1SV 3P5TL 2I38A 2M2BA 5D78A 1KD1T 3CCSS 2HGNA 2LYVA 2FY1A 3VAJA 2MY8A 2RQ4A 5LJ3Y 1YJWS 1FO1A 1UW4A 2WBRA 3ZZZA 2DGOA 5JVGQ 2DHAA 1X0FA 1WEYA 3VAHA 2BZ2A 1H2TZ 2I2YA 3CC7S 3G8SA 3G96A 2OJ3A 1YWXA 2YWKA 2XS5A 1YHQS 1BY9A 2KM8B 2HZCA 1N88A 5GAEU 1VQ4S 1VQ6S 2JVRA 4BS2A 1H6KX 1N52B 3BO3A 2KVIA 2ADCA 2GO9A 2F3JA 2DB1A 2YH0A 1WG1A 3P6YC 3US5A 2K3KA 3N9UC 2KU7A 1WWHA 1U1QA 1Q7YT 2CPHA 3CC2S 1K8AT 1DZ5A 3G9CA 4FXWA 4CIOA 4WKRA 1M5OC 4TLQA 1SJ3P 1FNXH 1L3KA 2LKZA 3FEYB 1K73T 1OO0B 2AYMA 1U6FA 2E44A 2RUGA 2DNRA 4F02A 5IM0A 4CH1A 2DITA 1U1MA 5JVHQ 5LXYA 2DNZA 2ZJQQ 3CD6S 4YUDA 2KRRA 4UY8T 2UP1A 1WEZA 3MXHP 2CQ4A 2M9KA 1FT8A 3VAIA 2L9WA 5DETA 3VAGA 2EK1A 3U1LA 2MZSA 3DXBA 2PE8A 2CQPA 1N8RT 4IUFA 3NNAA 2DNNA 1X4BA 2MKSA 1X4AA 1X4EA 5CYJA 4CH0S 2X1AA 2LECA 2QA4S 2CQ1A 1UAWA 2LA4A 1RK8A 4WIIA 2MQOA 3I56S 2CQDA 1SJRA 2OSQA 3DLLQ 3SDEB 2CJKA 2DNGA 2XNRA 3CCLS 4Y00A 2OSRA 4OZ1A 3CMES 1X4CA 1D9AA 3P49B 2MYFA 3TYTA 2MMYA 4Z2XA 2MZJA 4WFAQ 1WI8A 2DGSA 1YJNS 2VODA 3HHNB 3CCVS 3MURP 2NZ4A 2AYGA 5LJ5Y 2J0QD 1WF1A 1Q81T 3CCRS 5DM6Q 2F9DA 1U2FA 2N82B 4U67Q 3G8TA 1Q86T 5ITHA 2DNHA 3B4MA 1VQ7S 5GADU 1M5PC 1WHYA 1H2UX 3Q2SC 2X1GA 1ZH5A 1VC0A 2DH8A 1YTYA 1KQSR 2X1FA 3R1LA 1X4FA 1M5VC 1WG4A 3K0JA 2M8DB 1YITS 1KC8T 1URNA 1R8PA 3CCMS 1WEXA 2D9PA 2MKJA 2MGZB 5HL7Q 4LIRA 2MKIA 1X5OA 3VF0B 3MOJB 1B7FA 2MZQA 1RKJA 2MY7A 3MD1A 2QEXS 1A7GE 2FC8A 1U1OA 1AUDA 2EK6A 2CQBA 1H2VZ 1PO6A 1DHMA 2DGVA 1S79A 4C0OC 4ZKAA 5IQQA 1U1LA 1JJHA 2E5GA 2CPEA 3PIOQ 1WHXA 4UQTA 3NMRA 2DH9A 2JRSA 2ERRA 2KFYA 1VQOS 2KN4A 1F9FA 2MGZA 2XNQA 2DH7A 1W2BR 2KXNB 2MJNA 3PIPQ 4EGLA 2KG1A 4V19X 1VQNS 2CQIA 4RU2A 2FPHX 2M7SA 1G2EA 1WTBA 4YB1P 2KT5A 5GMKa 1OPIA 2DNYA 2DNKA 2AYEA 3H2UB 3SMZA 3S8SA 2RRAA 2M0GB 1CVJA 1O0PA 3NS5A 1U1KA 1XN9A 2LA6A 5FJ4A 4TU9A 1FJEB 5LSOA 1FHTA 1NU4A 1VC5A 2G1DA 1PGZA 2BOPA 2QFJA 3CCES 1Q82T 1HD1A 2CPIA 5EN1A 5MLCV 2RQCA 1OWXA 2ZJRQ 2G0CA 5HO4A 2ADBA 1WI6A 2FC9A 1X5TA 2CQ2A 1UFWA 3MDFA 2HVZA 2M88A 2DIUA 3CCJS 3EGNA 1WHVA 4PR6A 3VAFA 1HD0A 2B0GA 2M52A 3VAKA 5GVQA 2DGUA 4A8XA 4QU7A 1P27B 4WFBQ 3SXLA 1VQMS 3D2WA 2RRBA 3THTA 2LEAA 3R27A 2CQCA 5LSLA 1YI2S 1M5KC 3P3DA 1SJQA 2GHPA 3G6ES 3CTRA 4C7QA 3BEGB 2X1BA 2DNPA 2M70A 2N3OA 4IOAQ 1VQ8S 3BO2A 4YOEA 1U1PA 2KI2A 1NJIT 2KHCA 3S01A 2F9JA 3NS6A 2DHXA 2CQHA 2XSFA 1VQ5S 4ED5A 4W90B 2KRBA 1SJ4P 3UE2A 1HL6A 2LMIA 3NNCA 2LQ5A 3S6EA 2PEHA 2MQNA 3THPA 2CQ0A 3MUVP 3CCQS 2VOOA 2LCWA 3UCUP 2D3OR 1U1RA 1VBYA 3ULHA 2L41A 4WCEQ 2KXHA 5D77A 3CXCR 2SXLA 1FJCA 1QM9A 2MKHA 4M5DB 1P1TA 5DDRC 3CUNA 2J0SD 2E5JA 2RS2A 1VQ9S 2FHOB 2U2FA 4PRFA 2M4MA 2KXFA 2MQLA 3UD4P 3TP2A 2MHNA 3L3CA 1X4GA 1SJFA 5LXRA 2JVOA 1UP1A 2G4BA 4WF9Q 2DNOA 3MUTP 1S72S 3MI7X 2KH9A 1D8ZA 2DGQA 5IM0B 4LJMA 3JB9k 1VQLS 4Y0FA 2DNMA 2MPUA 4IO9Q 1M90T 2XS2A 3R1HA 1DRZA 2CPXA 2J76E 3MUMP 3HI9A 2RT3A 4C4WA 1X5SA 4QU6A 2KM8C 2CQGA 2MJUA 1ZZNA 2A3JA 2MKKA 3TO8A 2KG0A 2JX2A 1X4DA 4FXVA 3G71S 4PKDB 2E5HA 4P6QA 1DBDA 2E5IA 2MQMA 2CPDA 2MKCA 2MZTA 2MSSA 2RVJA 5IFMA 3RW7A 2DGTA 3B4DA 1WELA 2DIVA 3FEXB 2L08A 2YTCA 3CMAS 3CCUS 5GAGU 3LPYA 4TU7A 2DO4A 4TU8A 1KOOA 3G4SS 2N7CA 3CC4S 1FJ7A 3ZZYA 2DNLA 2MB0B 4QQBA 1KOHA 2K8GA 2MSTA 2MQQA 3UD3P 2HGMA 4W92B 2VOPA 2VONA 2OTLS 1JMTA 4IOCQ 1JJ4A 2DO0A 1N54B 3CPWR 1VBZA 2YH1A 1YIJS 3EGZA 3H2VE 3BO4A 2CPZA 2HGLA 3IRWP 3I55S 1IQTA 4WFNQ 1JJ2R 3SDEA 2KYXA 4CQ1A 3Q2TC 1A9NB 2OIHA 3NNHA 5DDQC 2DGWA 2DGXA 2LXUA 2YKAA 4J5OA 2CPJA 2CPFA 2LXIA 1U6BA 1FXLA 2DHSA 2D9OA 4F25A 1WHWA
chains in the Genus database with same CATH superfamily
2BMBA 2JHEA 2YKMA 5E7OB 1VMBA 5FD1A 5KFUA 5A0YB 4C8LA 4W90B 1OMSA 3PX6A 2W2QP 1T9YA 2F5GA 3P4UB 2OEKA 2CDQA 1LWCA 2P6TA 3JSMA 1WG5A 1JLGA 1VJQA 2B9WA 3CF5Q 2DR8A 2G13A 3MM5A 5I3PA 3LWMA 3VALA 4HACA 1WUUA 1VRTB 4Y34A 1XC9A 5E3QA 3U1MA 2D3ZA 1C0UB 2HFZA 2DT9A 1TKXA 1V9OA 3EUNA 4IQMA 1RT3B 3WX4A 4HYKA 1IUJA 2HFOA 5L8RC 4RW4A 4EZ9A 3OW2R 1I51B 3RRKA 5LMUF 2ROEA 2WHOA 2MQPA 3HJFA 1VGYA 3K5PA 4DHVA 5GAHI 4N56A 1NJZA 1K0TA 3M8RA 5CABA 3TRGA 2JLEA 4KV8A 1BQMB 2E7VA 1VISA 5H9EJ 4ZJLA 3J7YU 4DG1A 4O3PA 1M1KT 5C2GA 4DFKA 1C0TA 1RLCL 3DYAA 3UCZP 3UN5A 2PD1A 3RAQA 4DDFA 4PUOA 1U1NA 1M5HA 1MMNA 1NSAA 1S77D 4ED0A 2DHGA 4ERDA 2NLWA 1D1UA 4YDXA 2DXDA 3VAMA 1HNWF 2G1HA 4X4NA 2RU3A 4I69A 5C2CA 2EFQA 3J7YI 1SIZA 3LQVA 4F04B 2C2EA 1E6YA 5AE3A 5B0DA 1CS4B 1NK9A 3M6VA 3RB0A 2VD3A 2OH2A 4BC9A 2UUCF 2V9WA 1S1WA 3IWNC 2ATCB 4OHWA 2EFVA 1X9SA 3DM2A 4JI5J 4DPWA 1WJ9A 4F26A 5AJ3F 3FVYA 2V69A 2ZBRA 4QIGA 2XQCA 3PKMA 5KFBA 3HVTA 4FS1A 1REVB 4W98A 2PO4A 2BANB 5IOLA 1KD1T 4K4YA 2LYVA 2HFNA 3CDAA 2FY1A 2IYIA 3FRZA 2AEMA 4Q0BB 3NGSA 4DZDA 4JBCA 1KFDA 1R31A 1RDRA 1IKYB 1OQ3A 2HBYB 2RQ4A 4KSEB 3DLEA 3FDSA 4DJBA 1X0FA 1AZSA 1WEYA 2V67A 4J90A 2DD8S 4LF7F 3C6TA 2FY8A 5F3ZA 2HNZA 1SB6A 2WRMA 4FF4A 2IM0A 2Q43A 1FD8A 4DPOA 4K4TA 1N88A 1SV5A 1Y5NB 2R4FA 4URSA 2AKWB 4ZVFA 1VQ4S 3CD7A 1OQ6A 2EFGA 5ADZA 4BS2A 2KVIA 3DLBA 1F1BB 3MMBA 3ZTPA 4ZCLA 2YWGA 2ZH7A 4QBUA 3RBDA 3R9LA 4DR3J 2H48B 2HHVA 2YH0A 4RZRA 3P6YC 1NKBA 1RCXB 1XMQJ 2R8KA 3MTJA 3TARA 2VFVA 2YQ0A 4HVZA 1Q7YT 4F7VA 5HP1B 3G9CA 2QYGA 4O4GA 1CQNA 1B99A 2NYHA 4TLQA 2VFTA 3KUGA 1UVLA 5KFFA 1U6FA 5D15A 2E44A 2AMCB 2RUGA 4JV5F 2HNZB 5IXUA 2DNRA 2AJQA 2ZZMA 3H7HB 2BW2A 2W7AA 3MM6B 2UXDJ 4FXDA 5LXYA 2IFXA 4WU3A 4KTQA 2DNZA 3MEKA 2X3GA 4PWDB 1BQNB 4YMEA 4YUDA 3HD1A 5KG1A 2R2SA 3VQSA 1C0TB 2VPXB 4X84A 5BR8F 3MCOA 4JB8B 2J6TA 2B51A 1YBUA 1YBTA 1YGYA 2BOAA 2IRXA 3EMTA 3KYLA 4ECRA 4DU8A 1LW0B 5BYRA 4CO0A 1H0HB 1N8RT 1T05A 1N4LA 2DNNA 4LFBJ 4KFBA 4MK8A 1H74A 3W9JA 1X4AA 1X4EA 3I9ZA 3IBFB 1Q16B 4XDCA 3RGIA 3KLEA 3ADAC 5CYJA 3EYZA 2R2RA 1UTAA 2CQ1A 4XDDA 3BBBA 3ETOA 2XHCA 2Z30B 1AYEA 1YRTA 2CQDA 1E6YB 4ZMMA 1OY9A 1R27B 3FKBA 3SDEB 4LSNA 4N77A 5KG6A 1IWAA 1LFPA 5KFKA 1L3VA 1RBOB 2W7PA 4OI0A 1ZOTA 1B0PA 1H38A 2M3DA 2K2PA 3BKUA 1Z1ZA 3TZYA 4EBCA 2HHXA 1ACMB 1AFJA 3NWRA 4OYXA 2NR0A 3TYTA 1JQGA 2YNFB 2E9RX 3NL0A 3KK2B 2W8KA 5I3UB 2MMYA 4Z2XA 2XMKA 2RIJA 2FVRA 3MR7A 2MZJA 2ASDA 2C2RA 3KNAA 2WOMA 3CJKB 3O6QA 2DGSA 5HAOA 3SCKE 1SC4B 2YBVA 3CCVS 4GKKJ 5LJ5Y 3ETMA 5EHHA 2GVDB 1DJ0A 2ZVIA 3ENAA 3MEEA 3OJSA 2WSCC 1TELA 4M5KA 2RILA 4FNHA 2BE2B 2CFXA 2HFVA 4G1QA 3HT3A 4BWMA 2DNHA 1UA1A 1NB2A 2B5JA 2ZH8A 2RRNA 1UVJA 2OI2A 3CSKA 3H20A 2KZZA 3I4HX 4F36A 1TUVA 3KK1B 3Q2SC 2WB4A 1RT3A 5I42B 3MPWA 3K7RA 3UVJB 2JEIA 1MSWD 1U48A 2PIIA 3AB2B 3BN7A 4U95A 3AOBA 3V6KA 5IC6B 1DTQB 3K5OA 3R1LA 1X4FA 4DBQA 4QOTA 2YPYA 3VHQA 2BQ3A 2HMIB 3K0JA 4WXOA 2JFKA 2DEJA 1D09B 3N01A 4DEZA 2WAQD 2M8DB 1HBMB 2RUSA 1RT5A 1EP4A 1U0SA 2DKOB 3M8QB 5HBMA 1A0OB 2LP4A 2EKYA 1R8PA 3UDCA 4LR9A 3CJKA 3PVXA 3N5BA 3J81j 4I6WA 3CJSA 4A8WA 3BBCA 1Y3KA 2YKOA 3MF5A 1VOMA 2ZOMA 2HMIA 3DHWC 2FVQA 1NK8A 1SH2A 4X64F 3GIKA 4DQSA 2R8JA 3HHEA 4ILRA 2MZQA 2FLPA 1MW7A 4HL9A 2W4CA 3MD1A 4CO2A 2L9DA 3TUPA 5DGBA 3TW0A 1V6HA 3K5MA 1C1BA 2EK6A 4Z7CA 2UXBF 3HSDA 1VRQC 4OFZA 4OJHA 2UVRA 2DGVA 2WONB 4UOGA 1CS4A 3N0VA 1S79A 5U47A 3R5JB 4H54A 2XY6A 1JLAB 3IG1A 2AQ4A 1U1LA 4RBUA 1C4AA 2E5GA 4K2JA 3M2VA 1GMUA 3D3BJ 3CJ3A 4DFMA 3HVAA 2KT2A 3FEZA 3PR4A 3H0PA 1FDNA 2BJ9A 4C8NA 4X4VA 1G3OA 1FTCA 2FZKB 3NMRA 2OAUA 2UUCJ 2IVMA 4J9MA 2ERRA 2NYIA 1U49A 1FNMA 1ZAVA 4DCPB 4ZHRB 1KN6A 1RBLA 4IFVB 2BX6A 3PDNA 3RYLA 1FK9B 1RT1A 2XEXA 1IBKF 3BN4A 3SFUA 1ITPA 1FE0A 4FZVA 4DL6A 2PSZA 3HHDA 3T6BA 1JLBA 2EXUA 5D4NA 2M7SA 1RAEB 4YR2A 1TKZB 3C6TB 3GIIA 3H5XA 4R0JA 1J2VA 1IKWB 3A4TA 4YB1P 3I32A 1OPIA 3ILLA 2FZCB 1FD2A 5J2NA 1WC3A 5ETQA 2M5YA 4WKRA 1AA1B 2DNKA 3PX0A 3OV7A 2AJFE 3H2UB 3CDEA 4QYZJ 5IT9U 2CJYB 2IJFA 2F7VA 1UPPA 3CCTA 4X62J 1CVJA 2WVBA 5D4OA 1RP5A 3MR6A 1U1KA 3R2DJ 4NLVA 1XN9A 3G2XA 2LA6A 4PEOA 2R8IA 4NLOA 4DWIA 1XERA 4PYDA 4USJC 3JS9A 5A6PA 4F4KA 4NZ6A 1TTHB 2ACYA 5LM7E 1GXTA 3MEGA 3QT8A 4TY8B 3KOAA 2G1DA 1PSDA 4U9RA 3KK3B 2BOPA 1ZS6A 2ZHAA 1LWFB 4OX9F 5F3TA 5MLCV 2C28A 3ITHA 3TWZA 1BWVA 2F4VJ 1FFGB 1TQLA 2OO4A 3KK1A 1GXLA 4ZVHA 2NQPA 4EBDA 1C1CA 1Q7LB 1Q78A 5C24B 2XY5A 4DR3F 5HO4A 1CJVB 4A46A 3Q8SB 1WI6A 2XMAA 1LXJA 3I0RB 4ELUA 2NXEA 1EETB 1NDKA 2F8EX 4PQUA 4ECXA 4LVOP 1UFWA 2K06A 1IBMF 4ZCIA 4PAAA 5D0RA 4KPYA 4DR6J 1NSKL 2J9EA 4C8KA 1U2RA 2WBMA 3D28A 4Q43A 2WK4A 1NPPA 4LSLB 1FDBA 2M52A 4CDIA 3MM9A 3BQ0A 4CRJA 5KT6A 4DFPA 3VCDA 4QU7A 2VQEJ 4ECWA 1S76D 2AWZA 2AEJA 3DN9A 2W9BA 1YI2S 2ZBQA 1HNWJ 4RPFA 4NYOA 2GHPA 2GQQA 3BF4A 5F8MA 2JOQA 4F4ZA 1DQAA 1N5TA 4F3MA 3QIDA 4NXNJ 1UJ5A 2P2CB 3CTRA 4Z7YA 4TLRA 3BEGB 2E5LJ 2QE5A 2X1BA 4GC7A 1C1CB 4NL5A 2DNPA 3PTWA 1Q1KA 4FP9A 1JX4A 3SFGA 2YNIA 3HM9A 4JI1J 4G6VB 3HD2A 3TUZC 5CD4H 4R5PA 2XO7A 1HWUA 1IKVB 1F5BA 1VI7A 2AP6A 4NMLA 4QR1A 4Y2KA 2JC1A 3SIPB 5KFIA 2HHQA 2OPRB 2F9JA 2HQDA 4B9NA 2CQHA 2XSFA 2KJVA 5B09A 5KFJA 1U09A 2K3IA 4O44A 5ETKA 1Q4RA 1I5OB 3H98A 4OYOA 4KHPF 1RAIB 1RBAA 4ETXA 3ISND 3I4PA 1ZETA 2IA6A 2HIQA 1X31C 5E5NA 3NNCA 5HANA 1XQIA 5G0RA 2UUAF 2H4WB 1BHNA 2XO6A 2Z2LA 2VOOA 1FVQA 2A0FB 1HQEB 2BM0A 2RHSB 3MEDB 3BSOA 4DV1J 2D3OR 1QSSA 4LSZB 4BHQA 3KJVA 4RUBA 4YHHF 3MMAA 2KXHA 5D77A 3BZQA 5CQGA 4DUZJ 3BKFA 1EQMA 4M5DB 5DDRC 4B3MJ 1FJCA 3OPKA 2XG8A 3C8YA 2QSFA 1Y10A 4MKBA 4P73A 5K8MA 1SC6A 1B7YB 5GMDA 4AXIA 2RS2A 2WSEC 1IJFB 1PYOB 3KHGA 2W2PP 3KLGB 4J9SA 2FLLA 3QATA 2R7TA 4ECTA 2C2MB 2M4MA 2MQLA 4Q45A 3UD4P 4JI0J 1RAHB 2HS4A 2EW9A 4DMZA 1HARA 3OL9A 2KZMA 5KTQA 5IWAJ 3Q86A 2B7CB 3HHLC 5DLFA 3SV4A 1NB7A 2NXNA 2JVOA 3W1YC 3NS7B 4YB5A 3OTCA 1RT4B 2NUUG 1GT8A 2YX7A 4YY3J 1H3DA 4F4XA 2R7VA 2LFVA 3UNGC 2NCKL 3HFVA 3HFKA 4ZPWR 4JI6J 1S72S 4UOFA 4DV5J 3NXZA 4F50A 2KH9A 4LQ9A 2DY9A 5IV4A 4LJMA 2ILZA 2CADA 2DVIA 2DNMA 2HS3A 5CZVA 1MNEA 4YHHJ 4FN5A 4NCGA 1M90T 1RISA 2UXCJ 2DEIA 2H5IB 3OD2A 3R1HA 1UW9A 2GAGC 4DQRA 1V5VA 2XYGB 3D3CJ 3GP9A 1IXKA 1UCNA 2OPPA 5KFYA 4U7UD 4C4WA 4JYAJ 2Y8WA 4IDKB 1XNQF 4QYZK 1ZZNA 2BJ8A 4LF5F 1FDDA 3MOZA 2KG0A 3DM2B 3RUBL 1X4DA 1SC1B 3NRBA 2Q6CA 4B08A 3M8SA 4ZIWA 4K4VA 3DRRA 1S6PB 1S1UA 3OFFA 3OXGA 2CAJA 2HHHJ 1DBDA 3L9ZA 2DTJA 3SQGB 4B02A 1NHVA 1N33F 1RXOB 1REVA 1HBMA 1QD1A 2MZTA 2MSSA 3N79A 1WC4A 2XMTA 3IO1A 4UUWA 4K50A 2RVJA 5KFSA 3H2LA 4WPAA 3D6TB 5KFLA 2I6WA 4RNOA 2BVZA 3FEXB 4CO4A 1MROA 1MG7A 1MU2A 3DGPA 4M1KA 4NLQA 5KG5A 1NSPA 1KTQA 1YQHA 4YB7A 1R89A 1RWMB 2F4FA 4ENOA 3R3TA 2ZH5A 2HQFA 4NXNF 3LPYA 3CB4A 4MYTA 4DV7J 3AY0A 1T8EA 5A8RB 2K1RA 1HBNB 2GZOA 2OHDA 3PKYA 5KFMA 3OL7A 2DPIA 2EEYA 3QAUA 4ZLJA 2WCXA 3KK2A 3CC4S 1PBAA 2AZ3A 1FJ7A 1ZM4A 2LVWA 3EPIA 1L3SA 4B3TF 2VG7A 3FMBA 4ZIVA 1S6QB 2DNLA 2DXEA 1RU1A 1FNOA 3ZZUA 4ZVGA 4QWEA 2HBRB 4QQBA 3PFEA 4N7TA 1VLOA 1S0VA 1RWKB 2EFPA 1QDUB 1U0HB 3P96A 3KLFB 3OTOF 3EPGA 2A10A 1P9QC 4HT7A 1WNEA 2VONA 2OTLS 5EWGA 4NLRA 3DRRB 2DO0A 1T9WA 4OYAA 1PJ5A 2YH1A 2VA3A 2B6AA 2XM3A 4LF7J 1YSJA 3KLIB 1YZ6A 4PXDA 2MLZA 3H2VE 2UZAA 4USKA 4DPYA 3MFHA 1LK5A 3EGZA 2NXUA 3W9IA 3TANA 5E3CA 3RRHA 4K8RA 5HMYA 3MCMA 4GVBA 5H9FK 2HRUA 4ZJOA 3FZBA 1S1XA 3OJUA 2V4RA 1F2GA 1FE4A 2D3UA 1IQTA 4ZVPB 1HBNA 4WFNQ 4OJ3A 2KYXA 2KDOA 1S9EA 3PW2A 1SH0A 5J2NB 2C2DA 5ETMA 1NPKA 4H4OA 5DDQC 5SZTA 3GSDA 2FHKA 4A8SA 1G4CA 2DGXA 1W7WA 2LXUA 4JV0A 3GCWP 2IBKA 1FKOA 4RW6B 4L72B 4DR1J 4ZK7M 4MFBB 1NSQA 2ZITA 1NXIA 5DQIA 4WZQA 4RBVA 3B6BA 1Z2ZA 2OPSB 1U6BA 2D9OA 4FF2A 1UMJA 2IM1A 1K9MT 3TAPA 2CIMA 4RL1A 1SV5B 2M8HA 2CDRB 2V8VA 3EVMA 3KMSA 4J9NA 1ROFA 1HKAA 3KLEB 5FDLB 2O67A 5ETPA 5DDOC 4JI8J 2RQMA 1SXLA 3KWMA 2RS8A 2RD5C 3I5AA 5C24A 2ZJPQ 3FBBA 1NH8A 1QUPA 2DK2A 1WORA 2ZVSA 3I87A 4RW4B 1NCLA 3VZIA 1LNQA 3HHKA 1VBKA 4CT8A 4ID5B 3PRDA 4DN9A 4ZJQA 5HMXA 2YNHA 5KFDA 3JTOA 5CZXA 5GADI 1ZM9A 1Y00A 3V6HA 1QVGR 1S57A 2YKNB 1RKIA 3CULA 2D41A 4DZ6A 1P8GA 5E41A 3PO5A 4FF3A 4YR3A 2B4OA 1S0NA 2PFFB 5AE1A 6AT1B 2KJWA 3QJLA 2V4JB 2MXYA 2CVEA 3QLHB 5DM7Q 2XS7A 3NGRA 4ANDA 4O3OA 3IXQA 4RLEA 4O0NA 1U8SA 3OXFA 4M5DA 2QT7A 5IT0A 4B3RJ 3PZPA 4A8FA 4GKJJ 3C16B 2JWNA 3D7SB 3LGHA 1BC6A 3PX4A 2DJWA 2XTJP 3GJTB 2DNQA 5IZHA 1RT2B 3T1YJ 3RW6A 3M2VB 3R8YA 2Y3YA 4OYWA 1HBOA 3OFHA 3QO9A 1DLOA 1B3TA 3S7RA 4LFCJ 4OZ0A 1UWBB 1FX2A 2CQ3A 3LGMA 4MKVA 2YNIB 3A12A 5HATA 3UWTA 1RTIA 2H1YA 2Q1LA 1S1WB 2OP5A 3C6UA 3SZ2A 3HO1A 5KFTA 2VPYB 4USIA 2VICA 1M0SA 4ED3A 3M8QA 3V4MA 4I2QA 1WF0A 3R2CJ 1QTNB 1KNZA 5J2QB 1QAIA 1VQPS 3WZ0A 4WWSA 3BS9A 3DI6B 2EVZA 4NXMJ 3PW4A 5DG9A 1X4HA 3EVWA 3P5TL 2I38A 3DOMA 2M2BA 5KFXA 3UD5A 3J80Y 3CCSS 3GTYX 2Z4PA 4NMXA 4OI3A 3I0SB 3PRVA 2VF3A 2MY8A 2P9EA 3N6MA 4X4RA 4C0HA 1YJWS 1YRXA 1UW4A 5B0GA 1RWVB 3QJPA 3D5MA 2H5EA 2ZUGA 2DHAA 3CEDA 1FKOB 1FRJA 3ISZA 4RW6A 1KQKA 4WTOB 3G6VA 3VAHA 3V6DA 2I2YA 4CYUA 1IM6A 3G8SA 3EM1A 3MEGB 1YWXA 2B4VA 1XJWB 2V2QA 4TY8A 1UETA 2XS5A 1RT2A 4DX8H 1YHQS 1BY9A 2KM8B 2HZCA 2J0QD 1KQGB 1N0UA 4A8OA 4KGKA 5GAEU 1LW2A 4LF8J 2I5JB 3T1HF 1RHJB 2ZWOA 4QYRA 1S6PA 1H6KX 1N52B 4P2SA 1WSVA 3BO3A 3MHYA 3IS9B 1FRLA 2ADCA 2BA9A 4G1QB 3SBMA 2GO9A 3RRGA 3CE8A 2EBGA 2Z2YB 3R5CA 1HHTP 1WG1A 3I31A 3NCRA 2B8QA 2C3MA 3AFGA 1JKHA 2K3KA 3N9UC 4KGXB 4YN3B 3AD7C 3DLKA 5HI7A 2KFZA 3LP2A 1U1QA 1EB0A 2BM1A 4J9RA 2C2OB 5FLXU 4FXWA 1NEEA 3CT9A 1RAJA 3A8JA 4LRBA 5J2PB 4CIOA 3V6JA 4CLSA 3IAM9 1FK9A 3GE9A 1IN0A 4NLPA 2J7UA 1FNXH 1HW9A 3TEGA 3FEYB 1RYSA 1OO0B 2AYMA 2GIQA 3G86A 2ZNZA 7FDRA 4H4KA 2GQCA 1HMVA 2OD6A 1AXQA 3DDNA 3BV8A 3MR5A 1SJ1A 3PJWA 3GWCA 1B0TA 5HQLA 1U1MA 2HHTA 1ZPWX 1HPZA 3DRYA 5F9LA 4KIAA 1YJVA 2NXCA 1RACB 3TAMB 3SSRA 5HMWA 3CD6S 4UY8T 1TK0A 1WEZA 2YX4A 2HHWA 4IH6A 2CQ4A 4WE1A 3GIRA 2L9WA 4ZS6A 2E1RA 4C8OA 4NWBA 2BDPA 2PE8A 2CQPA 5HJYA 5HMZA 1HBUA 3DOLB 3NCQA 1NJWA 4IUFA 1NNDA 1SPBP 1S1TA 4NA3A 4QWCA 1M1GA 2OD4A 3S1TA 1TR0A 5KFQA 4EWTA 3LP1A 5IWAF 1LWEB 1NHKL 1N6QB 1AW0A 2QA4S 3C2PA 4A8KA 4C0BA 2IHR1 5K14B 2P5VA 3DRSA 4OZ2A 5DLGA 1RK8A 4WIIA 4Q2LA 3D1OA 4I0WA 3GIMA 4ECUA 2IYGA 2F63A 2DYAA 4RR5A 2Z8QA 2DNGA 1LFWA 3LAKA 2L9NA 2QYCA 3OL6A 1KTVA 4DCJB 4ECYA 2ATLA 2DPJA 2HEKA 2MQ8A 3NGDA 4HT5A 2LLZA 5J2QA 1HQEA 3T1YF 4ELTA 2NUHA 2J0WA 3JAMY 3DOKB 5F0UA 3M4XA 2VQFF 3P49B 4OIXA 2W2OP 1M5SA 4WP3A 3ISNC 2P6SA 2C2NA 4X66J 2QGFB 2KL8A 2J8SA 3M05A 3D1QA 1YJNS 3HHNB 3PYEA 4J9VA 3W2WA 4O0IA 4PWDA 2J6UA 2NZ4A 4OX8A 2AYGA 2B4UA 1WF1A 2V68A 2X7IA 4DV3F 2VHGA 4ECVA 1Q81T 2W8LA 4P72A 4OZLA 2F9DA 1XMOJ 1EIYB 2N82B 2PI4A 1YJ9S 2HZVA 3H25A 2E66A 5FDLA 4I56A 1OS5A 5ITHA 1CC7A 3LUYA 3E2EA 3GONA 1TAQA 3W65A 1PC4A 5GADU 4KPCA 3NBPA 5KFAA 5IT4A 2V2ZA 1UVIA 1VC0A 1G6BA 2PA8D 3SCIE 4ZPVR 1HHSA 2F1FA 3FUYA 5HLFA 1KQSR 1Y5LB 3SI8A 2KFNA 2LDIA 1WG4A 2D3O1 2IY5B 1GX5A 2JC0A 4E2FB 3M2RB 1KC8T 2GQ2A 1IKYA 3RZAA 1TL1B 2E1PA 2JH3A 3BBFA 4CLUA 2FJDB 3IAS9 3V5RA 3CCMS 1WEXA 3I6PA 5J1PA 4ELVA 4K2XA 2MKJA 2C2ZB 2MGZB 2J7KA 4LIRA 4RNFA 5K8NA 3GILA 2ZH6A 3EXYA 3NEKA 3MOJB 3QT7A 2RAQA 1B7FA 3WIVA 1GEHA 2HHPA 4BLGA 2LQ9A 1RKJA 2FJBB 5ETLA 3MM8A 1X7VA 4M8LA 2GIRA 4RW8B 2RF2B 1SQFA 2D69A 2OPQA 4U96A 2W9BB 4DSIA 3PJ9A 1CQMA 1N0VC 3AH6A 3BYRA 2WONA 5J1NA 1KQFB 1H2VZ 3KLHB 3Q8YA 4ZVQB 1XNQJ 1PBUA 3KG0A 2QL5B 3V4IB 4GKJF 2BW7A 3KLVA 4ZKAA 2IVFB 5E3AA 5J1EB 5KOXA 2QL9B 3PW5A 2GNKA 4P7TA 5B0CA 3LP1B 1JJHA 2HVEA 3DLJA 5C25A 3KG4A 3H4DA 3SCLE 4CO5A 2VPZB 1G1XA 2HQGA 3CDUA 1RAAB 1S48A 4KFBB 4R25A 4DS4A 2WVCA 4OYPA 2OELA 4I6AA 2DH9A 2QO3A 3IS9A 3T41A 5B7WA 4QIEA 1BMQB 1GNKA 2AV5A 4ZVTB 2AJ2A 3N6NA 2BE7D 3CJQA 4RBTA 4E98A 2MGZA 2AGQA 1L3TA 2ZD1B 3IR7B 2MJNA 1RJJA 2JFDA 4EFAC 5KFHA 3PIPQ 3K8WA 1N5YB 4C98A 3CD5A 2D7SA 1LWXA 1YDLA 4EGLA 4BC7A 1R43A 2C1EB 3E01B 2KG1A 3MM8B 2DCLA 1L5UA 1VQNS 4P9SA 3OSNA 2V2VA 2FPHX 1XBWA 4MJKA 1JWWA 2QN6B 3CJ4A 3JQKA 4M5NA 4W92B 1GMVA 4P74A 2GO8A 1TV6B 1F0XA 1WDTA 2OEJA 3DKDA 3T3FA 4CTAA 2E9TA 1S9GB 3V4IA 4H4MA 4DUTA 1TK8A 3SMZA 4C11A 4O3NA 3O5TB 2COLA 1I94J 4RU9A 1JJCB 4FDFA 1L3UA 3KNGA 3NS5A 1VRTA 3GU0A 4AD6A 5FJ4A 4TU9A 4IDKA 4WIQA 5E0OA 1NU4A 3TJ8A 5F41A 1SKUB 2UUBF 2EFOA 2QFJA 2FB0A 3Q8PB 1HD1A 5F8NA 2CPIA 4MKAA 3JQJA 3VGUA 1RT7B 1HQUA 1Z2LA 3CJTA 3JTNA 5BYQA 1RWWB 2FJAB 4X66F 1W25A 1OWXA 2W01A 2ZJRQ 5J2MB 3B54A 3PW7A 2XCPA 1X5TA 2NSCA 1HNXJ 1S59A 1NAQA 4WFYA 1J5EF 2W7OA 4URGA 1Y11A 4ECZA 1JLCA 3I5BA 1JLEB 3MDFA 4R5PB 4JI2J 2R7XA 4XTTA 1FCAA 3A8EA 2J9CA 3OLAA 1AT1B 2CZVC 4NI2B 1K44A 1WHVA 3NOCA 3VAFA 1HD0A 2QLWA 4DR1F 2B0GA 1HYSA 4AL5A 2UXDF 5C42A 3LGNA 3DU5A 4NLDA 4OHVA 5EWFA 2DHHA 3HF5A 4A8XA 1RQ0A 3QLHA 1P27B 3VAKA 2ZE2B 3AA9A 2FLOA 2RRBA 4ANCA 5LSLA 3AXKA 3TVYA 1QAJA 2JEJA 2IRYA 1KS2A 2R7QA 3P3DA 5EX0A 1LW0A 1SJQA 2VC0A 2AF6A 2J5AA 2HFUA 1S1TB 2YNGB 3LTOA 3MPDA 3W5ZA 2VC1A 4D3GA 4LRAA 3ZTRA 1B64A 5T41A 3OLBA 3IFEA 3OL8A 1R0BG 2F65A 3UVJA 1H98A 1WTFA 3ZZ0A 1GX6A 4Y28C 4ID5A 1VHFA 2PI5A 1VK8A 5D4PA 4WTYA 1UWBA 1WOOA 4NZ7A 5T7LB 2UXBJ 1U25A 2PDAA 4K4WA 4DV7F 1VQ8S 2WB1D 4RWXA 4YOEA 4USVA 1JKHB 1PAEX 1YK9A 3DNCA 2IBOA 4CLYA 3OXLA 1IM4A 1EETA 1XMQF 2XSJB 3OR1B 3NS6A 4X4QA 2Z2ZA 3CCZA 1FRMA 1CJVA 4NOHA 3UDVA 2KRBA 4D3HA 1NRKA 3I5CA 1SJ4P 1HL6A 2LMIA 2EBEA 2UVUA 2GVZA 5HP1A 3MMJA 4MIAA 4LF1A 4MFBA 4LT6A 5ETNA 3S6EA 3THPA 4J9OA 4ED8A 2VQEF 2C3YA 1Q79A 3Q8RB 3Q8VA 3ZC4A 3OVSA 1HWLA 2AJ1A 1KHVA 2BJ3A 2LCWA 1XIQA 3MPYA 4KH1B 2OUGA 3U02A 3M2UA 3UCUP 4LRCA 4USTA 3THVA 4C9DA 2V34A 4L75A 1RADB 1VFJA 4NYZA 5H9FJ 3V6DB 4RNNA 3CXCR 3M7VA 5FIIA 3KHLA 1NBEB 1QM9A 2MKHA 1SL1A 4HLBA 4H4MB 4HHJA 2YXLA 2FVSA 3SYZA 1WKKA 4P2XA 1NPRA 3Q0AA 1R0AA 3OVBA 1VQ9S 2ZC3A 2V8HA 1QY7A 2ZH3A 2V8DA 3LF0A 4ITSA 1U24A 3HXMA 2ZH2A 4PRFA 1FRHA 2KXFA 2N7YA 4KY3A 3RBEA 3F0NA 4OYIA 1NK5A 2HWHA 3JTPA 1QJHA 1NJYA 1WACA 1X4GA 2W4PA 2IM2A 4M5HA 6FD1A 3J7A1 3GSIA 1QE1B 5LXRA 1SJFA 3O8WA 1UP1A 1VLYA 4DLGA 4TYBA 2O66A 4C2MA 1S1VB 3T19A 1NK0A 4O3RA 1TKXB 2ZKUA 3RBZA 4F2SA 2C42A 4ED7A 3PNIA 2G2YA 3JQMA 3BGOP 2NPIA 3IWXA 4OYBA 5K5MA 3OHAA 3V81A 4LF6J 3M2UB 2DXFA 1D8ZA 3W66A 2R8GA 4ZOSA 2I9SA 2W9CA 4PXCA 5KFOA 1F3FA 1O5JA 4NLSA 5L1LA 1HI1A 4HHUA 4L3KA 2QA4G 1UVNA 1R0AB 3KJFB 1O8BA 3E3XA 2WOMB 4DF8A 2B3TB 2WVFA 4C3MA 1RAOA 2ZH4A 4DU7A 2ASJA 3QWPA 3OUYB 1RYRA 2ZOFA 3TAMA 5LMNJ 4XPEA 3VVUA 3CCWA 1TP7A 1MWQA 1GK8A 3DC2A 3MUMP 5EGYA 1FERA 4W4MA 4F0KA 3KK3A 3DMJB 5LL6d 3ZTQA 1MMDA 4DR6F 1DLOB 1OYDA 2B9XA 2CQGA 2MJUA 2MLYA 4QIFA 3RR7A 2GS8A 4U8VA 3HVWA 3TO8A 2JX2A 4FYWB 1UVKA 1ZBTA 4LSNB 3HJVA 3AD8C 9RUBA 2JLGA 3SQGA 1RWXB 3CJ8A 3JSRA 5D8HB 2B7BB 4DPUA 2E5IA 3UNYA 5HQMA 3OR2B 4KHMA 1JK9B 2HWTA 2WW8A 2GGPA 3MMCA 3WHIA 2NZCA 3Q8UA 3R97A 3B4DA 2OEMA 4ZPAA 2QA1A 2ALZA 2H9ZA 3Q22A 2A2CA 2ZDPA 2XULA 3X1LB 2XLKA 2YKQA 1UJ4A 5HVFA 4RUCA 1OSDA 1PYTA 3CMAS 1WOSA 1ZAXA 5A8RA 2YNHB 4GRSA 4TU7A 3N6LA 5F0WA 4DV2J 4UW2A 4P2MA 4C11B 3PR5B 1KOOA 2J9DA 2IVYA 2WVEA 4AXJA 3AOAA 3CDWA 1Y4ZB 4PPDA 1D8YA 2HVDA 2BJ1A 3OFEA 3R5BA 4XPCA 4L6V3 3H4BA 3DMJA 1RGVA 4A8YA 2XZTB 1OY8A 2EI5A 2ZE2A 1TL7A 3M30A 2OFHX 4JOUA 8RUCA 4N8OA 3GB0A 2VJVA 3UD3P 4EZ6A 2VG6B 3M8WA 3GLJA 3NGUA 3P5BP 4DSEA 1KR4A 1XMOF 4F8RA 1JMTA 4QW8A 3LWLA 3K57A 2DBBA 1JJ4A 1Q8BA 3HULA 3IGVA 4MYUA 3CPWR 2OKQA 5E3RA 1VBZA 2FLNA 2VBWA 5K8OA 4X65F 2EWHA 2I0XA 3R5GA 1WDDA 1UL3A 4OZ5A 3AHPA 1IBCB 1RWUA 2MHEA 1MMLA 3T9ZA 3SSSA 4F67A 4P7VA 2GGPB 2XBPA 3MMCB 4I2QB 5BXIA 1F3VA 3MECA 4LIWA 4LF8F 5T7LA 2V50A 2IDLA 3GZ7A 3UN2A 5A8WB 2PMZD 3I55S 3MAHA 4KJIA 1BGXT 2ZH9A 4DUYJ 3EXCX 4ZHRA 3MUVP 2V8GA 4P2FA 1S7HA 4X4PA 4C8YA 1HNZJ 2BXJA 3SQOP 4IRKA 1CEZA 2H54B 2HRYA 2Y1RI 5E3PA 1TK5A 1DRZA 2DGWA 3T5HA 3W2VA 1HPZB 1FKAF 3HK2A 1TL5A 1FJGJ 4UF4A 1RHMB 3CJ2A 4XAKA 2YKAA 1NUEA 4J5OA 4M5IA 1APSA 1NZAA 4ECSA 2CPFA 1LK7A 2LXIA 5D3GA 1U7LA 4V19J 3TEHB 1H72C 3HFZB 3ZTOA 2DISA 2BE9B 1EJ7L 2VBZA 1VBXA 4NCBA 1GH8A 3MAAB 4HACB 5DDPC 4QW9A 1B4SA 4DQPA 2VKRA 1WF2A 4C3LA 5CD4A 1U2CA 2QMUB 4U6PA 4ZN3A 4GO5X 4B9VA 4AT1B 4F0MA 3GYGA 4OMFG 2XB2D 2QG9B 1HA1A 1HQUB 4P52A 5BJRA 3O3LA 3M1VA 4O3QA 4LMZA 1S0MA 3IM8A 3IGNA 4ZITA 3MD3A 4WJBA 2Z56B 4DLEA 2QC3A 4USUA 4GVBB 2EFNA 1Q8LA 3DLKB 3LAMA 4KV8B 3T5KA 1X9WA 3TZXA 4N5SA 2RB7A 5CXTA 1QVFR 1O6XA 2ZC4A 1DARA 3R6GB 1S10A 1B0VA 3U7JA 1MWZA 1WC5A 4FPRA 5CH7B 5L38A 3GG0A 4Y6IA 4DL2A 2C2KB 1FXDA 3D4JA 1OIAA 2HHHF 2CZ4A 3I0SA 4DV1F 2UUTA 1X5PA 2HYIB 2POKA 5DJBA 2HVHA 1DQ9A 4CLPA 2MZ1A 2O3DA 2ZM6J 4DR5J 1RTDA 5C7PA 4FKYA 4CO1A 3J7ZT 4DV0J 4R8UB 2CWKA 1RHUB 2BJEA 2HHUA 5A0YA 1FF2A 3HP6A 3ENWA 4NLWA 4ZVEA 1LW2B 5JUMA 4TYAA 4LRFA 3RG6A 4MH8A 2QLJB 1UA0A 3UPFA 2GCFA 3DI6A 4ZVOB 4F3OA 2N3LA 1Y0HA 3F56A 3JSBA 4JI1F 4GKKF 5GAEI 1JLBB 4DR2F 2CZ9A 3IN5A 4X4OA 2YKNA 2LEBA 2KT3A 1CJKB 5D78A 3TX0A 4JI6F 1N32F 2IJRA 1HR0F 5T14A 3VAJA 3PRBA 4YQWA 4A48A 2WBRA 4WP8A 3RAMA 3ZZZA 3KUEA 1HLWA 3Q89A 5DG7A 3QGHA 4B9UA 2LXFA 1WOPA 2HKEA 4UOCA 5B08A 1PKUA 1I94F 1H2TZ 3CC7S 2CUYA 1JB0C 1ZM3A 3G96A 3QGIA 2OJ3A 2YWKA 1FX4A 4HTJA 3FQKA 3G82A 5G0RB 3TA2A 1NJXA 4M5LA 2AT1B 5KT4A 4EO6A 2OLWA 3FFIB 5KFZA 1VQ6S 2JVRA 4ZPBA 4JI4J 3JAMU 3R7SB 3I9V9 3R6LB 4IQXA 3AODA 3TQEA 4P71A 1HIYA 3WC2A 4ZCMA 2OPRA 4RNHA 3ZXWA 4DX7A 4F4WA 4Y65A 3LP2B 5DZ7A 2R7UA 2FVCA 2ZBPA 3US5A 1PG5B 1YKWA 2XMVA 3QZ8A 1WWHA 3KLGA 3H5SA 4DR7F 2CPHA 3CC2S 1K8AT 2GC8A 4JI3F 1FRIA 1D0EA 3MR3A 1T7PA 3UR3C 4XIUA 1M5OC 1SJ3P 1YJTA 2ZD1A 4I7FB 1N5SA 2LKZA 2A18A 2AIRB 3VGTA 3PACA 1NK4A 2NSBA 1K73T 2XSJA 3QRRA 2V8PA 4RUAA 4ZDNA 3KJVB 3QFHA 1EAYC 1HI8A 3CVKA 4F02A 4OV1A 4PG6A 5JVHQ 1RTJA 4L3NA 5ETOA 4NLTA 4DV2F 4ZP9A 2J9DE 3C19A 1HNVB 2WTFA 5AXKA 1LOUA 4IH7A 2RDJA 1TVRA 2RHQB 5K20B 4LF4F 1N5VA 2UP1A 1LV5A 4NRTA 2Y0SD 3MXHP 3IBCB 5L9XA 3KLFA 5AT1B 4CT9A 1KEKA 3VAGA 1KVIA 2QIFA 2EK1A 2MZSA 3SCJE 4ICLB 1HHQA 1Y7PA 1RI7A 2UUWA 5L46A 1U45A 4LREA 1P1LA 1JNRB 2HS0A 2C3PA 2J0XA 2HIYA 3DXSX 3MCNA 3W60A 8ATCB 3C66A 4ZPTR 2X1AA 3CJ0A 1NZ8A 1UAWA 5C5JA 2B6AB 1RAGB 2JL9A 1HNIA 3ICLA 2HSEB 3HSGA 2YWEA 2ZNYA 3DLLQ 4NLYA 1FKPB 1SKRA 3NMAA 4CLFA 2XNRA 1XR5A 3CCLS 4DV0F 5KFEA 4LR7A 5F8JA 1JIHA 2C3OA 4YR0A 3CJRA 2OSRA 4GO7X 4DSFA 4KHPJ 1UEVA 4C97A 1C2PA 3RTVA 3CMES 1CLFA 1HMVB 1R3NA 4KT0C 1F2HA 1KRPA 1X4CA 3QWUA 1D9AA 4KRWA 1JLQA 4QZVB 1TKTB 2BEFA 1U4BA 5KOWA 1CJTA 2F4VF 1G7CB 1EZZB 2DY1A 3RBXA 1K1QA 1KWMA 4LSLA 2XWXA 4ZLNA 4WFAQ 3A3PB 2ROPA 2VB6A 3H59A 3FC9A 1WI8A 2FHJD 1RT6B 3SSQA 5JMNA 3RB4A 2VODA 4K0KJ 1CPZA 3MURP 2VZ9A 2C22A 1SI9A 4KQZA 2RJZA 2XMUA 4AE5A 1VRUA 1IKWA 2FQQB 1N5QA 3KHRA 1U2FA 4K4UA 2QJ3A 3G8TA 1GXUA 2LDYA 3QFWA 1Q86T 4ICLA 2G2OA 3W8GA 3G6XA 2Y9HA 2JDJA 2IMOA 4X62F 3IRXA 1M5PC 2FHMA 4J9UE 1WHYA 1N33J 1JXVA 2X1GA 2QLBB 4M95A 3FFIA 1ZH5A 1HNIB 3NOGA 2PFDA 3KDOA 1QAYA 1X0PA 3O2IA 2IC3B 2OMOA 1V3ZA 1JLGB 2CJQA 3NGKA 3FCWA 3BGLA 3A3OB 5B0AA 2Z0GA 1YITS 3HHLB 3QGGA 3QMQA 2MTLA 1WC6A 5KT3A 2BBEA 4LF6F 4YDDB 1YJ7A 3PXGa 1RZMA 4UOHA 2F8HA 2CXEA 2D9PA 4KO0B 3HZGA 4X4SA 2HAIA 4LF9F 1CJTB 3MFIA 4K4XA 1BQNA 1N36F 3FCVA 2MKIA 2P9GA 4DL3A 1X5OA 2V4JA 7AT1B 5ETRA 1AB8A 1JLEA 3ENVA 4CH7A 2E29A 4MK7A 1FEEA 3W2VB 2ZZTA 2OPPB 2XZDB 5KG0A 3J80U 4UY85 2HURA 2MY7A 2QEXS 2XYPB 4KGZB 3TQ1A 2QSWA 4G1PA 5GMEA 4M5MA 3UO0A 2CG4A 2HQIA 1U1OA 1AUDA 1TL3A 3GFZA 3BO4A 4OL8A 2K7JA 2EC2A 3AD9C 2GHVC 4NASA 1S1UB 5FLXY 4QWAA 2ZUAA 4LF5J 4IG0A 4WYWA 2VL1A 4C0OC 1NK7A 3PO4A 2BKNA 2BKOA 4ZP8A 4I2PA 5IQQA 4X4UA 2YNGA 1S1XB 4MK9A 1GAOA 3G87A 3W8PA 2CPEA 5L9NA 4JP8A 1T95A 2HNYA 2R7RA 2XC9A 4B9TA 1YJUA 2GA7A 1WKJA 1TL4A 3KDNA 3K59A 2JRSA 4UZCA 3NCPA 2KFYA 1KKHA 3V81B 3ET6A 4G3IA 1R8CA 1RT1B 4Y2AA 1CULA 1F9FA 4IG3B 2XNQA 2DH7A 4NZ0A 2KXNB 1W2BR 2ROGA 1TL1A 2BYCA 2W9AA 1RT7A 1E6VA 4BBYA 4NLXA 3JYTB 2RKIB 3HVTB 3CGIA 3M2RA 1C4CA 1KDNA 1RT5B 2CQIA 4RU2A 4P10A 5EUHA 1IBMJ 3CW2C 3QSIA 4LVNP 3U1NA 5F9NA 2H5JB 1XTZA 2HQ3A 3D68A 1WTBA 2GVDA 1RWNB 1DTTA 2GW8A 1T94A 4FKXA 2NXJA 3ZFVA 4ZPCA 2XMMA 1UKUA 4WE1B 4ZP7A 4A47A 3DU6A 4IG0B 4CLWA 4FBUA 3VZHA 2VG6A 4UQGA 2RRAA 4MKYA 3MM7B 1TL3B 3M6UA 4KH0B 3HHLD 4AQYJ 5A2QY 1XNRJ 3O1LA 2AX0A 2F40A 3A8KA 3AJ2A 3BR8A 3IR6B 3R7BB 1LWEA 1N6QA 2E1CA 2HK3A 4IFYA 1FJEB 4IR1A 5LSOA 2R9LA 4CNYA 4DR4J 3GFXA 1TKDA 2HVIA 3PYFA 4AQYF 1VC5A 2FGCA 1U26A 2CJ9A 4NX9A 3CCES 1W26A 1Q82T 4FYVB 2CKWA 4NRUA 1ELOA 2QMXA 3QGPA 2DR9A 2VA2A 1DFDA 1CG2A 4Y3CA 3X3UA 3M8ZA 2RSQA 1QTMA 2RQCA 3ET6B 2JSXA 4DQQA 1KLMA 3RR8A 2ZHOA 1QE1A 1VQYA 2VKZG 3BQ1A 2UXCF 2KO1A 2ADBA 3L09A 2CYYA 2FC9A 1HNZF 4ILMA 1UPMB 3M32A 4LUBA 2IAJA 3W63A 2EG2A 1ICEB 1NLKL 3E01A 5DQGA 3RAXA 1RUSA 2HVZA 3FCHA 4Y2MA 5F8HA 3HKZD 3R7NB 3EDQB 3VGVA 4QPXA 3PY8A 1Q5YA 4DN0A 2XY7A 5HQ8A 3EGNA 3MM9B 3PEHA 2OPSA 3DYAB 4ZVRB 4RNMA 1ZM2A 4CTAB 3PYDA 2IMWP 5GVQA 2DGUA 2UUAJ 4J9PA 1JLQB 2I1RA 3SXLA 4WFBQ 1VQMS 3D2WA 3BQ2A 3KTQA 4G1IA 2LEAA 3R27A 5A8KA 4YP3A 4DPTA 3A3NB 4I68A 4EK2A 3BSNA 1M5KC 4B3OA 1HBUB 2HBZB 3DOLA 4CZCA 1VS3A 1HQ2A 5DO2A 3GV5B 3OUYA 4NLGA 1CBKA 1KLMB 4O23A 4DS5A 1ZTWA 2GJ2A 1KHWA 3B82A 1MLAA 2M70A 2MLXA 4GC6A 5DG8A 5KFPA 1NDCA 1RCOB 2E1MC 2PT0A 4IOAQ 1GQEA 5HVHA 1U1PA 2IA0A 2ZBCA 2KHCA 3A1YG 3PHEA 4F0HA 3S01A 1S99A 1N32J 1U8WA 2QL7B 3QIPB 4R0EA 1AUSL 1VK3A 1VQ5S 2DR6A 4AUKA 4ED5A 2BJ7A 1BUXA 3PM9A 2VV5A 2DR5A 4Q5VA 4U7CA 4RUHA 2AGPA 1HWJA 3NAHA 3QPIA 1ULRA 4Y2IA 4ES3A 2LQ5A 4DL0C 1RHRB 2MQNA 2PEHA 4RW8A 8AT1B 4ETZA 5D6GA 4V1Ak 4FF1A 5DS7A 2B8PA 1GTHA 1VRUB 1U1RA 5CYMA 3TX8A 1V3SA 4EU0A 2RH3A 1SQGA 3ZZTA 4WCEQ 4F4YA 3E51A 3CO9A 2NS1B 3W5XA 3EVOA 2SXLA 4MIWA 4XK8C 3GV7B 3DLGA 1P1TA 4Z37A 3FBCA 2ZHBA 2XMJA 3B78A 3AJDA 2GMLA 4DL4A 3OVAA 2J0SD 1TL7B 2VG5A 3GCXP 2JLFA 2FHOB 2U2FA 3HPOA 1T02A 3LO3A 5L1KA 2BQRA 4OJ1A 1FJGF 3DRPB 4USHA 1FFWB 3QAEA 3TP2A 3FK4A 1TFWA 1OY6A 1X60A 2CG8A 3J81Y 2GJFA 2EPIA 2VFSA 2LQ8A 4B3SJ 3UN3A 2Y1IA 2VIHA 1S4FA 1NH7A 1YBAA 1J5EJ 1N5YA 4FYDA 2VDHA 1S97A 3EDRB 3J7AN 1T03B 2W25A 3MGJA 2K7KA 5DRKA 2A1BA 1KP6A 2G0JA 3DOMB 5K14A 5KG7A 3GQCA 1HR0J 1EP4B 3FBFA 4LRDA 3CO0P 3MUTP 4EBEA 3C14A 4PCQA 4TNOA 5K8PA 3J7Z5 2OMLA 4OHZA 3BGUA 5IM0B 3JB9k 4DSJA 1RWOB 1RWPB 3M8PB 3LH2S 4OX6A 3UW1A 4Y0FA 1T9VA 5EWEA 2UUBJ 2R7OA 1Q8IA 3OTBA 4NI2A 3D54A 2V5HG 2XLIA 4KKOB 5CYQB 3R5AA 4TXSA 4JV2A 1UZDA 3BM7A 2PMWA 4OI2A 1CJUB 3KXDA 2AGOA 2LU1A 2JNJA 3ZTSA 2RT3A 2ZEJA 5CHCB 4LFAJ 1NKCA 1X5SA 2XYHB 3LALA 4L73A 2KM8C 3POTA 4OLPA 4Q8FA 3RJMB 1Q8KA 3P8BB 4OYMA 4KB7A 5KFGA 4JI5F 3ILOA 2FD2A 4CM2A 4Q2MA 3W7BA 1T03A 4YB6A 3G71S 2G2ZA 4PKDB 4CLKA 4ED6A 4P6QA 1ZA2B 4FS2A 3I96A 4K4SA 1FTRA 1TZ0A 1BXNA 3FQLA 3MCSA 4ZLLA 4XO0A 1CJKA 2CPDA 2MKCA 1PJ7A 2UVWA 1JLCB 4K59A 5IFMA 1MU2B 1MN9A 5KG4A 3IC1A 2DGTA 3W9HA 4DV5F 1SL2A 3DCAA 1WELA 2LU2A 3M8YA 2L08A 2YTCA 4UZBA 4ES2A 1K47A 4H4OB 3O44A 3AA8A 1WC1A 4DV6J 4OI6A 5CCMA 5LMUJ 2YQ1A 2V0NA 5GAGU 2DRAA 2XWYA 4KO0A 1D9FA 4OZJA 3PEJA 5F8LA 1U47A 5F8IA 1XEZA 3CDBA 3DHXA 5HBMB 3G82B 3G4SS 1MWYA 2Z2MA 4DOZA 4X2BA 5LSRA 4CWBA 2QTWA 1SBRA 2OGUA 3ZZYA 3BGRB 4MMOA 3MEEB 4A8QA 1TKZA 3M9NB 1NMEB 3PG9A 4K7QA 4TY9A 3EZOA 4C8ZA 4CM0A 5D0HA 5IV3A 2K8GA 3L7UA 3PHTA 4I4BA 2MQQA 1X8DA 3F41A 1Q0NA 2AW0A 2ZFHA 1XK8A 3GR0A 2VOPA 5ETSA 2KKHA 2Y1JA 4IOCQ 4LFBF 1C0UA 1XR6A 2FJEB 1CC8A 1T0TV 3ONQA 4HEA9 3GFYA 4B9MA 1K1SA 5IQ6A 1MN7A 3KJQB 2FUG9 2HNDA 1F6TA 1V3RA 2B4PA 3HSJA 3MAAA 1PYSB 1DY3A 1PC5A 2JJ4D 3D0IE 1IJEB 3IRWP 5IS2A 2GAHC 2GVZB 2FHJA 4FYYB 4WBFA 1JJ2R 2VQFJ 2Y1LB 4CQ1A 2KVQE 1NKEA 3Q2TC 4ILLA 2YWWA 1P6TA 4NCGB 2N4CA 2RF2A 1DTTB 3TOQA 1Q5VA 4KC5A 3M8PA 3FJ2A 2B56A 4QJVA 4B17A 1KSPA 5KG2A 1IR2A 5KFWA 5A2QU 1T9TA 5BYSA 1M1HA 2CPJA 3DFEA 4KKOA 2QA2A 4NPOA 5CYQA 4JYAF 2QMWA 4OLOA 2IJNA 4QR0A 5HROA 4NLUA 1FXLA 1WHWA 4TVAB 1DQ8A 3EGWB 3WBZA 1RA6A 4L76A 1F60B 5KT2A 4X4TA 4J9LA 1RB0A 2GMJA 1BE4A 1GMWD 2ASYA 4HTIA 4QPTA 3V2UC 4LR8A 1PILA 2J8AA 3BREA 4IKAA 1FWKA 5KFVA 1OYEA 2Q66A 4QCLA 3K17A 4UUXA 2OTJS 3UCGA 1KLNA 3CIMA 3CMQA 2XI3A 5HLFB 1H7WA 3PFOA 1ZAWA 4LBHA 4PG4A 1XMBA 3KG1A 2QLXA 2BJDA 4IO1A 3QSYB 2AYBA 2BRKA 2FJXA 5I42A 3AOCA 1IWGA 4IFVA 3GPAA 1X9MA 1Y3JA 1GMWA 2IRUA 3DDIA 3DRSB 2FJWA 1VQKS 1NO8A 3MECB 3DRXA 4JI7F 2J7WA 3HLUA 4ZP6A 4USMA 2LQJA 3ILJA 1IKVA 4NXMF 2V63A 4CP5A 3IMQJ 1JLFB 1YJRA 3IA0A 3BKTA 1WC0A 2XLJA 3BJYA 1SUQB 1AZSB 2VJUA 1TFYA 2V94A 1FESA 4USWA 2PC6A 1AFIA 5ETTA 2U1AA 1H73A 1FA0A 3IP0A 1RT6A 4J91A 2A6MA 5THWA 1QSLA 4BDPA 1HYSB 1R7IA 3OFGA 1UZHA 2AD9A 2YPZA 3L7PA 2HK2A 1R8HA 3T5JA 2MZRA 4ZN1A 2LEPA 1VC6A 4DR4F 1HFEL 1V5IB 1ZZFA 5I3QA 1IBLJ 1DAXA 4R8UA 2ACMA 3MEDA 4K5SA 4G65A 1UEKA 3TJ9A 4DUZF 4B3MF 4OYZA 1PIEA 4CLTA 3KLIA 3PYGA 1JLAA 3IG1B 2YQ3A 1XWLA 2H3EB 3C15A 3TVKA 9ATCB 5GAHU 3EX7B 5HVGA 5DZ6A 3NAIA 2ZM6F 2I8EA 5J2MA 3LANA 2RNEA 2Q79A 4K5RA 2CPYA 1D3WA 2H4YB 3D6MB 4PWUA 3LP0A 4A4JA 4B3TJ 3W61A 4HI1A 4PXBA 4GVLA 2R3VA 5EDWA 1OPZA 3VWSA 1BQMA 4NEZA 4NA2A 2RU9A 4QWBA 1OJ4A 5CA5A 2HNDB 1I6JA 2FDNA 3HCXA 5H1SV 3ELHA 2GFFA 3H5YA 3NP5A 1J27A 2Y8YA 2HGNA 2VH7A 1UFKA 4YY3F 1J5OB 1ZPVA 2HPUA 2PEBA 3LA0A 4IOBA 2AU0A 5KT5A 2AEFA 3NGTA 1Y9OA 1RLDA 1FO1A 3BSAA 4OX7A 4HDHA 5LJ3Y 3GR1A 4B3RF 1QUVA 2DGOA 3LOUA 3F73A 5JVGQ 2HW3A 2VFUA 1TAUA 1YZ7A 1KBRA 4PG8A 2VBXA 3OTDA 1HWIA 2BZ2A 4X65J 2FVPA 1NHUA 4LBPA 2MEWA 4LBIA 3CD0A 1WD6A 2MDAA 2VG5B 3GV8B 4PZVA 1IR0A 3EZUA 3C16A 2NREA 1VIOA 2CJAA 5MAOA 3QYYA 4J9QA 1U0HA 1I1GA 2FZGB 3FGVA 4FVMA 3T6JA 3ZNJ1 4C6AA 2HHSA 3MMAB 2C3UA 1R6YA 3ENQA 3WX8A 1LWFA 4DR7J 2HLUA 2F3JA 3EICA 2DB1A 4L74A 5AJ3J 2IAJB 3AQOA 4WK3A 5LOQA 5KFCA 2KU7A 4WK1A 5GAGI 5AXNA 3PW0A 1RHKB 2APOA 2V6AA 4J37A 3SV3A 2HLTA 5RUBA 1KONA 1DZ5A 1R8AA 3G6YA 3UI3A 1BQXA 2YX1A 1R0CB 3CJ5A 1EQ0A 1L3KA 1KVJA 2P9CA 4RW7B 1FFSB 5J2PA 3KJNB 5G4DA 2WSFC 2YNFA 4DG1B 3QIPA 2PMHA 5DQHA 4A8MP 1QSYA 5KG3A 2NPFA 4F3QA 3UR0A 1RTJB 4ES1A 2QLFB 5KFNA 2W1BA 5IM0A 2BABA 1RHQB 2DITA 3HMJG 4CH1A 1RTHA 3K5NA 2R7WA 1S9FA 4CLLA 4ZVUB 3HDSA 1GFWB 4DV6F 2H51B 2ZJQQ 3KMQA 2KRRA 3NLCA 4QIWD 1IKXB 1RTDB 2M9KA 2O01C 1FT8A 1SQEA 2W2MP 1S4EA 1RTIB 3C6UB 3PJXA 1Z4UA 5DETA 3VAIA 4DF4A 4DPXA 2E5LF 3U1LA 3GYNA 3UQSA 3DXBA 2XGPA 3H5UA 3DLHA 1UVMA 1X4BA 2MKSA 2CA9A 4PWWA 1LWCB 4QIVA 1S6OA 4ZCKA 4QWDA 4CH0S 2LECA 1T9UA 2DR7A 2LA4A 3LP0B 4HI2A 4PG7A 5IT9Y 2VPWB 1FKPA 2YVSA 1B70B 2MQOA 4N8NA 7FD1A 4KYZA 3I56S 1SJRA 2OSQA 3JYTA 1RT4A 4ECQA 4NE9C 4EEYA 2KTQA 2BRLA 3VV2B 2CJKA 4DL5A 2JEFA 3OR1A 1T3OA 3QJJA 2AJ4A 3BYPA 4U8YA 2UV8G 3AB4B 4Y00A 4I67A 4OZ1A 3WIUA 5AE2A 3L95X 2A6OA 4DR5F 3D0HE 5E2QA 2BUNA 4OI1A 1TUGB 2MYFA 2HWIA 4RX6A 1TMJA 3K58A 3HKWA 1E6VB 3B8HA 4OV6A 1SC3B 2GV1A 1TVRB 4PABA 5HROB 4OX9J 3MR2A 1SUQA 1VIXA 1KFSA 4HDGA 4DI6A 5JJBA 1Q53A 3CCRS 3FZ2A 3P45B 5DM6Q 4RKUC 3H90A 3DRPA 4U67Q 4KGMA 4ER8A 2FJVA 3FBEA 2QX0A 3NNAA 1RTZA 4DV3J 3ZNUA 3GG1A 3Q8QB 3B4MA 3BPDA 1N48A 1W2IA 3MM7A 1OSCA 1VQ7S 2GHWA 4E0DA 4JI2F 2CWXA 1H2UX 3HX9A 1LQ9A 4FBTA 4O4GB 1BD6A 2DH8A 3MPUB 3M30B 1YTYA 2IPOB 2WVDA 3BB5A 4AYBD 2GMHA 1F5AA 2X1FA 3MZIA 2L3MA 4I1TA 2W2NP 5JXSA 1M5VC 4OHXA 4RJVA 1DTQA 2IIHA 2HZAA 4JV5J 5L39A 5HN0A 4N76A 1URNA 3W5YA 4E8UA 4WZMA 1SKWA 1T9XA 1D9DA 2A2DA 4WXWA 4WU2A 5HL7Q 4MT1A 5LT5A 3M9MB 4M63A 4JI7J 3D6FB 4LF4J 1EKRA 5I3UA 3VF0B 3E8OA 3BDEA 3DGVA 1QLNA 2VG7B 3PCOB 1FI4A 2V4QA 2ASLA 4RW9B 1A7GE 1HWKA 2G9OA 2FC8A 2FIUA 5A8KB 2JZ5A 3DLEB 4TQSA 5C42B 3QNWB 2CQBA 5J1EA 1FDAA 1PO6A 3AAWB 2ZBIA 5HK4A 1DHMA 1XNRF 2IDEA 1SVDA 1SCJB 3IRXB 4HH0A 5KT7A 1N34F 4OHYA 3RB3A 5A76A 2P8IA 2YY3A 4NEYA 1TMMA 4KGVB 1IQZA 3PIOQ 3WDOA 4I64A 1TU0B 2Z57B 1HBOB 1WHXA 3OTEA 3QO9B 5A6WA 5C25B 2RDIA 1EKSA 3Q83A 2VU5A 4UTGA 3AT1B 4UQTA 3I0RA 1CSJA 4DFJA 1JNZB 2KN4A 4JI8F 3DDKA 1VQOS 2ZOGA 1S1VA 2R7SA 5M2PA 3L7OA 1ZYQA 1F9EB 5I4MA 4DQIA 2ZDOA 4WYLA 1R8BA 1J5OA 2G0IA 2CNNB 4WFXA 1N56A 5SUHA 2UV8A 2KHDA 3HHLA 1HNXF 2XMWA 3W3SA 4V19X 2JEGA 2QV6A 4DL7A 3JSYA 4ED2A 3GJQB 4PQAA 2B9YA 3BGRA 1G2EA 3M32B 2CNKB 4MIBA 4TN2A 3AJ1A 2QFIA 4M5JA 3UDLA 2KT5A 3FSXA 3IWLA 4WFZA 1O51A 2CJXB 2VDIA 5GMKa 4EYIB 2PA3A 3M6XA 2DNYA 3WC0A 2XGQA 2AYEA 2UU9F 4OZ3A 3BGFA 3S8SA 3GJSB 1LEOA 4AL6A 2M0GB 2CNOB 1O0PA 2E7WA 2FGOA 3C15B 1N34J 1S7IA 2KB2A 4DV4F 1FRXA 1R6VA 1S6QA 1VQSA 2L48A 1S0OA 3JSMB 3POTB 3D67A 3UDEA 3TI0A 4MAKA 1FHTA 1T05B 5KFRA 4ANEA 2QZ8A 3TAQA 3BDPA 3TJAA 2ILYA 2BQUA 1PGZA 2GX8A 1I3OB 3ILIA 4EMDA 2Q6BA 1T11A 3H42A 4EI2A 4DV4J 5EN1A 2I5JA 2B43A 3G8QA 4P75A 4EYHB 1VHIA 4EO8A 1EARA 1UEUA 3OBIA 4B9SA 2G0CA 3MPVA 1FWLA 4F4AA 1NM2A 3FMWA 5A8WA 4YEAA 1LXNA 3TA0A 2CQ2A 4LF9J 4WKYA 5IC4B 1FXRA 3W64A 4YS2A 3H40A 1XR7A 2FTRA 3C14B 3AQPA 4LFAF 2M88A 2VBYA 1UJ6A 2BKPA 2DIUA 2YWFA 3GMGA 3EGVA 1VR6A 3K2YA 1RABB 3W2WB 4PR6A 3ZZOA 3CCJS 1S9EB 2O1PA 2VFRA 3BH7B 4CNZA 4YFUA 4HHHA 5D3GB 4ED4A 1IKXA 1C1BB 2YKPA 1FVSA 4KE5A 2R8HA 3T1AA 4ATNA 2RE1A 4RW9A 4TKTA 2PGCA 1P9YA 3THTA 4KBIA 2CQCA 2W9CB 3GFHA 4LFCF 4CI0B 1NJIT 2HRTA 4PG5A 4BCAA 3G6ES 1CJUA 3C3LA 3TR5A 3D0GE 1S12A 3KKFA 3VR1A 3WQPA 4O3SA 4C7QA 4N41A 2HQCA 4J7CA 3KHHA 5M2RA 3OT9A 5BR8J 2UVVA 2D1CA 1YX2A 4FNIA 1NDPA 3JXOA 4Q7AA 3T9NA 4JV1A 2XHWA 3DLGB 5D0GA 2E9ZA 1U6ZA 4ALZA 4IRDA 4ID8A 4ZVSB 2N3OA 3OSPA 2BR0A 3C46A 2B5JB 3UFCX 3H8YA 4C3KA 4NA1A 3ZZRA 4KR0B 3Q23A 4ZLPA 3BO2A 4DX5A 2KI2A 4LQ3A 4HH1A 4QR2A 4CLZA 3QZ7A 4HR2A 4KAIA 3J81U 3FSIA 1PCAA 2DHXA 1TUWA 4I6YA 2DRDA 4CCHA 3UE2A 2K1RB 4Q0BA 4URQU 1S5ZA 1S9GA 3D9BA 1YLXA 3CNQP 3GIJA 1TKTA 2CQ0A 3A8IA 2VASA 5CYMB 1KVKA 1NDLA 3CCQS 4DXLA 4CYUB 1VBYA 3CWJA 3ULHA 3EWGA 2L41A 1SL0A 2GIFA 3NG8A 1IR1A 1BLUA 2EKNA 3TZZA 5L1JA 2AJ0A 3IR5B 2CRLA 4PXEA 1HI0P 3CUNA 2FYXA 1RA7A 1YRUA 3U27A 3KLHA 3K5LA 4WP9A 2E5JA 4O4RA 1IBKJ 3TNVA 2EC0A 3L4BC 1VCTA 3N4WA 2J6SA 3M6WA 2RDDA 4AL7A 3N5FA 5EX3A 3VTIA 4OZNA 2DRBA 4FYXB 2H65B 4IR9A 2CJBA 2MHNA 1RE1B 3OQ2A 3RU0A 1U02A 2Q3PA 3ZZPA 2W4DA 3L3CA 2UU9J 3K89A 3TUIC 4LF2A 3EE3A 3TA1A 1T3NA 3M1VB 4JI0F 3VVTA 2G4BA 2F8MA 2IM3A 3LPEA 2DNOA 4WF9Q 4RWWA 2Z58B 3NKYA 2X3DA 3MI7X 1MROB 3DGPB 4PPZA 3T5LA 4BWJA 2DGQA 4N47A 4U7UK 5HSPA 4PYAA 1VQLS 2AZ1A 3W62A 4HKQA 2EG1A 2V9KA 4GMKA 1ZA1B 2MPUA 1N36J 4H4KC 4IO9Q 1Q95G 2GJIA 4F2RA 1VJWA 3GYXB 1VYAA 3EJMA 4X64J 2AHOB 4IH5A 2XS2A 5AXLA 1URRA 1PAUB 5HJXA 2VUGA 1SH3A 2J76E 2CPXA 2OPQB 1RAFB 2RQKA 3MWBA 4C48A 3RB6A 1WKLA 1FEHA 3HI9A 2ZKTA 2ZWPA 3A13A 3AXMA 3IBWA 3MM5B 5ETVA 2HBQB 4JI4F 1PJ6A 2XI2A 3QT6A 4CO3A 5LMNF 4B3OB 4QU6A 3QT5A 2A3JA 2MKKA 3QBCA 3OHBA 3LW5C 1F5CA 1YVFA 4IYQA 1BWEA 2LQBA 1JXLA 3TVZA 3QRPA 3QRQA 3D6HB 4FXVA 4AFFA 1H7XA 4B3SF 1K0VA 2E5HA 3KUHA 3ITHB 4NYPA 4I7FA 1CULB 2XZWA 4IG3A 2AX1A 3SEOA 2MQMA 1NK6A 3HVRA 2B9EA 3DOKA 4M5GA 5CAAA 2CNLB 1AROP 3BH6B 4OI4A 1IVZA 5AXMA 2BV3A 3BSCA 3FSYA 3RW7A 2YWHA 2DIVA 5K9FA 5B0EA 4DSKA 1FRKA 1HW8A 3D1HA 6FDRA 3VQTA 2XCAA 2IC3A 2CVIA 1A6LA 3R5DA 2R42A 2RKIA 3Q24A 4DUYF 3MAQA 3NY0A 1F9HA 3EZ5A 3CCUS 2HFSA 2PN6A 3QQCD 4K0KF 2DCUB 2DO4A 2WZ1A 4Q44A 2ZZNA 3BR9A 4EUVA 4TU8A 4DSLA 1S6UA 3CIZA 1JXEA 1WSRA 1HNVA 2V2KA 3HSZA 5B0FA 2N7CA 4J9KA 1TV6A 1JLFA 4Q8EA 3MM6A 2KYZA 3N28A 4M94A 2D74B 1DURA 4IFYB 2BE2A 3OTOJ 2MB0B 2QRRA 3ZO7A 3MTKA 2ABYA 3D66A 2O5DA 3K8VA 3MMBB 5H9EK 1KOHA 2HG4A 4NCAA 5KAKA 2MSTA 3TZWA 2YKMB 3NWGA 2HGMA 5CCLA 4DR2J 4ED1A 1SIWB 3IM9A 3NBPB 3F44A 1IBLF 5F8GA 4Y2CA 4RO0A 1LKZA 4K4ZA 4MTPA 5M2UA 1S49A 4JUZA 1N54B 4ZPDA 1FWPA 2MKYA 1YIJS 2Y0BB 2R2UA 3FNNA 3PV8A 3VGSA 2E7XA 2HNYB 3HZEA 1EX8A 4DCOB 2ALYB 5B0BA 3BPSP 4OQJA 1RU2A 1EHWA 4C8MA 2HGLA 1UFLA 2CPZA 2E1AA 3HT0A 4FVCA 4I2PB 5D0EA 5D4LA 5E33A 4DX6A 3FRYA 3OR2A 2N4DA 4ZA1A 2ZH1A 4KHRA 3T1HJ 3I82A 4RW7A 3SDEA 2OFGX 4PQUB 2X51A 4O44B 1GTEA 3M9OB 2BANA 1A9NB 2OIHA 4S0MA 1REGX 1UWAA 2HAFA 1ZTTA 3NNHA 4FPIA 2WW4A 3GJRB 1SKSA 1RTHB 4UT4A 4OJGA 4TQRA 5DGAA 4JI3J 1VDHA 2R2TA 1Y5IB 4B9LA 3TUJC 5L1IA 1YG0A 2BACA 2RMLA 2W24A 1RSCA 4IRCA 4PUOB 2DHSA 1QAXA 4F25A 3KFWX
chains in the Genus database with same CATH topology
2YKMA 2JHEA 5E7OB 1VMBA 5FD1A 5KFUA 5A0YB 4C8LA 3PX6A 2CDQA 1LWCA 2P6TA 3JSMA 1WG5A 1JLGA 3CF5Q 2B9WA 2DR8A 2G13A 3MM5A 5I3PA 3LWMA 3VALA 4Y34A 1VRTB 1XC9A 5E3QA 3U1MA 2D3ZA 1C0UB 2HFZA 2DT9A 1TKXA 1V9OA 3EUNA 4IQMA 1RT3B 3WX4A 4HYKA 1IUJA 2HFOA 5L8RC 4RW4A 4EZ9A 3OW2R 3RRKA 5LMUF 2ROEA 2WHOA 2MQPA 3HJFA 1VGYA 3K5PA 4DHVA 5GAHI 4N56A 1NJZA 1K0TA 3M8RA 3TRGA 2JLEA 4KV8A 1BQMB 5H9EJ 3J7YU 4DG1A 4O3PA 1M1KT 4DFKA 1C0TA 3DYAA 3UCZP 2PD1A 3RAQA 4DDFA 4PUOA 1U1NA 1M5HA 1MMNA 1S77D 4ED0A 2DHGA 4ERDA 2NLWA 1D1UA 4YDXA 3VAMA 1HNWF 4X4NA 2RU3A 4I69A 2EFQA 3J7YI 1SIZA 3LQVA 2C2EA 1E6YA 5AE3A 5B0DA 1NK9A 3M6VA 3RB0A 2VD3A 2OH2A 4BC9A 2UUCF 2V9WA 1S1WA 3IWNC 4OHWA 2EFVA 1X9SA 3DM2A 4F26A 5AJ3F 3FVYA 4QIGA 5KFBA 3HVTA 4FS1A 1REVB 2PO4A 2BANB 1KD1T 4K4YA 2LYVA 2HFNA 3CDAA 2FY1A 2IYIA 3FRZA 4Q0BB 4JBCA 1KFDA 1R31A 1RDRA 1IKYB 1OQ3A 2RQ4A 4KSEB 3DLEA 3FDSA 4DJBA 1X0FA 1WEYA 4LF7F 2DD8S 3C6TA 5F3ZA 2HNZA 1SB6A 2WRMA 4FF4A 2IM0A 2Q43A 1FD8A 4DPOA 4K4TA 1N88A 1SV5A 1Y5NB 2R4FA 4URSA 4ZVFA 1VQ4S 3CD7A 1OQ6A 2EFGA 5ADZA 4BS2A 2KVIA 3DLBA 3MMBA 4ZCLA 2YWGA 2ZH7A 4QBUA 3RBDA 2HHVA 2YH0A 4RZRA 3P6YC 1NKBA 2R8KA 3MTJA 3TARA 2VFVA 4HVZA 1Q7YT 5HP1B 3G9CA 4O4GA 1CQNA 4TLQA 2VFTA 1UVLA 5KFFA 1U6FA 2E44A 2RUGA 4JV5F 2HNZB 5IXUA 2DNRA 2AJQA 2ZZMA 2BW2A 2W7AA 3MM6B 4FXDA 5LXYA 2IFXA 4WU3A 4KTQA 2DNZA 3MEKA 2X3GA 4PWDB 1BQNB 4YMEA 4YUDA 5KG1A 2R2SA 3VQSA 1C0TB 2VPXB 4X84A 5BR8F 2J6TA 2B51A 3KYLA 1YGYA 4ECRA 2IRXA 1N8RT 1LW0B 5BYRA 4CO0A 1H0HB 1T05A 1N4LA 2DNNA 4KFBA 4MK8A 3KLEA 3RTVA 1X4AA 1X4EA 3I9ZA 4XDCA 1Q16B 2R2RA 4JI5F 2UXBF 5CYJA 3EYZA 2CQ1A 4XDDA 3ETOA 1YRTA 2CQDA 1E6YB 4ZMMA 1R27B 3SDEB 4LSNA 4N77A 5KG6A 1LFPA 5KFKA 1L3VA 4OI0A 2W7PA 1ZOTA 1B0PA 1H38A 2M3DA 2K2PA 4EBCA 1Z1ZA 2HHXA 1AFJA 2NR0A 3TYTA 2YNFB 2E9RX 3KK2B 2W8KA 2MMYA 4Z2XA 2XMKA 2RIJA 2FVRA 2MZJA 2ASDA 2C2RA 3KNAA 2WOMA 3CJKB 3O6QA 2DGSA 3SCKE 3CCVS 5LJ5Y 5EHHA 1DJ0A 3MEEA 3OJSA 2WSCC 2RILA 4FNHA 2BE2B 2CFXA 4G1QA 3HT3A 4BWMA 2DNHA 1UA1A 2B5JA 2ZH8A 2RRNA 1UVJA 3H20A 3CSKA 2KZZA 3I4HX 1TUVA 3KK1B 3Q2SC 2WB4A 1RT3A 5I42B 3MPWA 3K7RA 1MSWD 2JEIA 1U48A 2PIIA 3AB2B 3BN7A 3V6KA 1DTQB 3K5OA 3R1LA 1X4FA 4DBQA 4QOTA 2BQ3A 3K0JA 4WXOA 2JFKA 2M8DB 3N01A 4DEZA 2WAQD 1HBMB 1RT5A 1EP4A 3M8QB 5HBMA 2EKYA 1R8PA 3UDCA 3CJKA 3PVXA 3N5BA 4I6WA 4A8WA 1Y3KA 2YKOA 3MF5A 1VOMA 2ZOMA 2HMIA 3DHWC 2FVQA 1NK8A 1SH2A 4X64F 3GIKA 4DQSA 2R8JA 3HHEA 4ILRA 2MZQA 2FLPA 1MW7A 4HL9A 2W4CA 3MD1A 4CO2A 2L9DA 5DGBA 3TW0A 1V6HA 3K5MA 1C1BA 2EK6A 4OFZA 4OJHA 2UVRA 2DGVA 2WONB 2XY6A 3N0VA 1S79A 5U47A 4H54A 1JLAB 3IG1A 2AQ4A 1U1LA 4RBUA 1C4AA 2E5GA 3M2VA 3CJ3A 4DFMA 3HVAA 2KT2A 3FEZA 3PR4A 1FDNA 4X4VA 4C8NA 1G3OA 1FTCA 3NMRA 2OAUA 2IVMA 4J9MA 2ERRA 2NYIA 1U49A 1FNMA 1ZAVA 4ZHRB 1KN6A 4IFVB 3PDNA 3RYLA 1FK9B 1RT1A 2XEXA 1IBKF 3BN4A 3SFUA 1FE0A 4FZVA 4DL6A 2PSZA 3HHDA 3T6BA 1JLBA 5D4NA 2M7SA 4YR2A 3GIIA 1TKZB 3C6TB 3H5XA 4R0JA 1J2VA 1IKWB 4YB1P 3I32A 1OPIA 5J2NA 1FD2A 2M5YA 2DNKA 3PX0A 3OV7A 2AJFE 3H2UB 3CDEA 2IJFA 3CCTA 2F7VA 1CVJA 5D4OA 1RP5A 3MR6A 1U1KA 4NLVA 1XN9A 2R8IA 2LA6A 4NLOA 4DWIA 1XERA 4USJC 4F4KA 5A6PA 4NZ6A 2ACYA 1GXTA 3MEGA 4TY8B 3KOAA 2G1DA 1PSDA 4U9RA 3KK3B 2BOPA 2ZHAA 1LWFB 4OX9F 5F3TA 5MLCV 2C28A 3ITHA 1TQLA 2OO4A 3KK1A 1GXLA 4ZVHA 2NQPA 4EBDA 1C1CA 1Q7LB 1Q78A 5C24B 2XY5A 4DR3F 5HO4A 4A46A 3Q8SB 1WI6A 1LXJA 3I0RB 4ELUA 1EETB 2F8EX 4PQUA 4ECXA 4LVOP 1UFWA 1IBMF 4ZCIA 4KPYA 2J9EA 1U2RA 2WBMA 3D28A 4Q43A 2WK4A 4LSLB 1FDBA 2M52A 3MM9A 3BQ0A 5KT6A 4DFPA 3VCDA 4QU7A 4ECWA 1S76D 2AWZA 3DN9A 2W9BA 1YI2S 5F8MA 4NYOA 2GHPA 2GQQA 3BF4A 4F4ZA 2JOQA 1DQAA 1N5TA 4F3MA 3QIDA 1UJ5A 3CTRA 4TLRA 3BEGB 2QE5A 2X1BA 4GC7A 1C1CB 4NL5A 2DNPA 1Q1KA 4FP9A 1JX4A 3SFGA 2YNIA 3HM9A 4G6VB 3TUZC 5CD4H 4R5PA 2XO7A 1HWUA 1IKVB 1F5BA 1VI7A 2AP6A 4NMLA 4QR1A 4Y2KA 2JC1A 5KFIA 2OPRB 2F9JA 4B9NA 2CQHA 2XSFA 2KJVA 5B09A 5KFJA 1U09A 2K3IA 4O44A 1Q4RA 3H98A 4KHPF 4ETXA 3ISND 3I4PA 1ZETA 2HIQA 5E5NA 3NNCA 5G0RA 2UUAF 2Z2LA 2VOOA 1FVQA 2BM0A 1HQEB 3MEDB 2D3OR 3BSOA 1QSSA 4BHQA 3KJVA 4YHHF 3MMAA 2KXHA 5D77A 3BZQA 5CQGA 1FJCA 4M5DB 5DDRC 3OPKA 2XG8A 3C8YA 2QSFA 4MKBA 5K8MA 1SC6A 4AXIA 2RS2A 2WSEC 1IJFB 3KHGA 4J9SA 3KLGB 2FLLA 2R7TA 4ECTA 2M4MA 2MQLA 4Q45A 3UD4P 2HS4A 2EW9A 4DMZA 1HARA 3OL9A 5KTQA 2B7CB 3HHLC 5DLFA 3SV4A 1NB7A 2JVOA 4YB5A 3OTCA 1RT4B 2NUUG 1GT8A 2YX7A 4F4XA 1H3DA 2R7VA 3UNGC 4ZPWR 3HFKA 1S72S 4F50A 2KH9A 4LQ9A 4LJMA 2ILZA 2DVIA 2DNMA 2HS3A 5CZVA 1MNEA 4FN5A 4NCGA 1M90T 1RISA 3R1HA 4DQRA 1IXKA 2OPPA 5KFYA 4C4WA 4IDKB 1ZZNA 4LF5F 1FDDA 3MOZA 2KG0A 3DM2B 1X4DA 3NRBA 2Q6CA 4B08A 3M8SA 4K4VA 3DRRA 1S6PB 1S1UA 3OFFA 3OXGA 1DBDA 2DTJA 3SQGB 4B02A 1NHVA 1N33F 1REVA 1HBMA 2MZTA 2MSSA 3N79A 2XMTA 4UUWA 3IO1A 4K50A 2RVJA 5KFSA 3H2LA 5KFLA 4RNOA 2BVZA 3FEXB 4CO4A 3DGPA 1MROA <