4IUFA

Crystal structure of human tdp-43 rrm1 domain in complex with a single-stranded dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
b'TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAR DNA-binding protein 43
publication title The crystal structure of TDP-43 RRM1-DNA complex reveals the specific recognition for UG- and TG-rich nucleic acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator/dna
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iufA00
4J5OA 1YWXA 3RW6A 1X5SA 2HGNA 1QVFR 3ZZYA 2DGSA 2D3OR 3CTRA 2QA4S 1WEZA 4P6QA 2F9JA 3SDEA 5JVHQ 1Q7YT 2DHGA 4PR6A 2J76E 3CCLS 3IWNC 1BY9A 2PEHA 2PE8A 1VC5A 5GMKa 3CPWR 2VODA 3CCMS 3G71S 2FHOB 2L9WA 4Y0FA 2KXNB 4W92B 1NU4A 1SJQA 1JJHA 5CA5A 3CUNA 1HA1A 2OSQA 1WHVA 2DNPA 3EX7B 2RRBA 2FC9A 4F25A 1X4EA 2CQBA 2DGVA 2DITA 2MQLA 1YHQS 1X4BA 4CIOA 3VAJA 2N3LA 2CQIA 2DISA 1Q86T 4A8XA 3N9UC 1U1KA 3UD3P 2XS2A 3CULA 2CQCA 4YUDA 1YI2S 2M0GB 2CQHA 3UWTA 1YJWS 1VQ9S 1U6BA 3S01A 2ERRA 3J7YU 1H2TZ 1WHWA 3B4MA 2X1FA 1D9AA 4CH0S 1U1RA 2DB1A 2MQPA 3BO4A 2CPHA 2JVRA 4TU8A 1KD1T 2K3KA 2EK6A 2CPIA 2MKJA 1PGZA 1QM9A 1UAWA 3G8TA 3MUMP 2DHSA 2YWKA 1X5PA 1M5VC 1WI6A 1WF2A 2LQ5A 1VC6A 2KN4A 2EK1A 3S7RA 3VAFA 1WTBA 3CC4S 2YKAA 3JB9k 2CQPA 4Y00A 2N82B 1U1QA 1VQ5S 5GAEU 4C4WA 3NS5A 1XN9A 2HGLA 1SJ3P 1VC0A 1DBDA 4ED5A 2RS8A 1FXLA 3CCQS 5IQQA 2X1AA 5IM0A 4WIIA 1U6FA 4BS2A 2D9OA 3MD3A 4RU2A 2GHPA 2DNMA 3IRWP 4OZ0A 2AYEA 1K8AT 4EGLA 1U1PA 2DO0A 3BEGB 2KH9A 5GAHU 3H2UB 4UQTA 2MQQA 3BO3A 2MKKA 1VBZA 1HL6A 1A7GE 2DNRA 1ZZNA 5CYJA 2DK2A 3CMAS 1N8RT 2MKIA 4UY8T 2L08A 1U1MA 2MZJA 1PO6A 2RS2A 2YH0A 3CCVS 2RQCA 2CPXA 1M5PC 2JVOA 5GAGU 1U2FA 4CQ1A 3LQVA 3MXHP 2DGTA 2DHAA 2DNHA 2D9PA 2OTJS 2KT5A 2NZ4A 1WG5A 1WEXA 3UCGA 2OTLS 2MZSA 1M5KC 1R8HA 3R27A 2OJ3A 2MHNA 4WKRA 1YJ9S 2VOOA 2LA4A 2DIUA 2KXFA 2E5IA 2MB0B 3EGZA 2MGZB 1RKJA 4LMZA 2RNEA 2ZJRQ 1D8ZA 2X1BA 1W2BR 2JWNA 2KRBA 5LJ3Y 2FY1A 2UP1A 2DGOA 1UW4A 5DDQC 3SXLA 1YIJS 3Q2SC 3VAKA 2RUGA 2F3JA 3R1LA 2DGXA 1DZ5A 2HVZA 1M5OC 5IFMA 2AYBA 2MKCA 4OZ1A 2I2YA 3NNCA 2LXUA 1WF1A 5DM7Q 5EN1A 4Z2XA 2Q79A 4WFBQ 2OIHA 2F9DA 3I55S 2FC8A 3R1HA 3S6EA 2M8DB 1N52B 2M2BA 5JVGQ 2MY8A 3K0JA 2MJUA 2KHCA 3VF0B 2MZQA 2N7CA 3U1MA 1X4AA 1ZZFA 4PKDB 2LEBA 4WFNQ 3EGNA 3FEXB 5GADU 3G8SA 1WHYA 1N54B 3U1LA 2MXYA 1VQNS 5MLCV 1HD0A 2SXLA 2LKZA 1KOHA 3TP2A 1JJ2R 2NLWA 2KM8B 1HD1A 3BO2A 2LECA 4CH1A 1KOOA 2MSSA 1FNXH 3CCSS 1UP1A 4IOAQ 2M4MA 2J0QD 1KC8T 4QQBA 2CJKA 1Q82T 1JMTA 4QU7A 4QU6A 2M70A 4M5DB 1R8PA 3TYTA 1OIAA 3VAGA 2DNYA 1ZH5A 1X4CA 2E5HA 5LXYA 3VALA 5FJ4A 1NJIT 2VONA 3FEYB 1N88A 1U1NA 2BZ2A 2CQ0A 5D77A 2CQDA 1Q81T 3NNAA 2YTCA 4QPTA 1H2VZ 4WF9Q 2KVIA 3MI7X 2ADCA 3LPYA 3THTA 2LXIA 5LSOA 3CCUS 3G9CA 2MQOA 2FPHX 3CCES 2DO4A 2QEXS 1SJRA 2DHXA 2MYFA 3CC2S 3H2VE 2DH9A 3CC7S 2B0GA 5D78A 5BJRA 5HL7Q 2XNRA 2CPEA 3CD6S 2CPDA 2MZRA 2HZCA 3MURP 3MOJB 5DDOC 5ITHA 2M88A 2MQMA 2DGQA 2CQ2A 3P5TL 2XS5A 1WWHA 1WEYA 2J0SD 3VAIA 2O3DA 3UCZP 4F02A 2LCWA 5LXRA 1YITS 2K8GA 1QVGR 1OO0B 1U1LA 3DLLQ 2AYMA 2DNQA 2MGZA 2U1AA 2A3JA 3P3DA 1X4HA 3V4MA 1VQLS 2XS7A 2LEAA 1FJ7A 1NO8A 2KU7A 2VOPA 1SJ4P 2DNLA 2KYXA 4TU9A 3VAHA 2RT3A 2X1GA 2OSRA 4LJMA 1X0FA 2ADBA 2AYGA 1KQSR 3US5A 5DDRC 2MJNA 2RU3A 3THPA 2DIVA 1U1OA 1VBXA 1WELA 2ZJPQ 3P49B 3PIOQ 2DNKA 3MUVP 1X5TA 4LIRA 3HI9A 1UFWA 2MMYA 3NS6A 1FO1A 1WG4A 3SDEB 3UCUP 2QFJA 2G4BA 1VQPS 1OWXA 1F9FA 1P27B 2XNQA 1H2UX 2MKSA 2GO9A 3CCRS 4TLQA 1M90T 4C0OC 1WF0A 2E5JA 1O0PA 2MPUA 2M9KA 2RRAA 5LSLA 3L3CA 2XSFA 3G96A 1WG1A 2LA6A 2DGWA 1AUDA 1VQOS 2MQNA 3OW2R 3RW7A 1FHTA 4YOEA 1B7FA 4C7QA 2DGUA 4FXWA 2CQ4A 2DNNA 1WI8A 2CPFA 2KXHA 2MZ1A 3MUTP 1VQ4S 3B4DA 1VQ6S 2KM8C 3NMRA 5H1SV 2E44A 4PRFA 3MDFA 2YH1A 1G2EA 1VQ7S 2BOPA 4WFAQ 3I56S 1FJEB 3TO8A 4YB1P 3CCJS 2G1DA 3G4SS 2CQ1A 2JRSA 2WBRA 5DM6Q 1URNA 3ZZZA 3G6ES 2LMIA 3UD4P 2CQ3A 2XB2D 3J7ZT 1VBYA 2RQ4A 3P6YC 2DNGA 2CPJA 2AD9A 2MY7A 4ERDA 2KI2A 3CMES 3MD1A 4U67Q 2DNOA 3D2WA 1YJNS 1WHXA 2KG1A 4FXVA 1OPIA 2DH8A 1FT8A 1RK8A 1X5OA 2KRRA 1X4FA 3BS9A 1VQKS 2E5GA 1A9NB 2J8AA 2I38A 2CPYA 1SXLA 1M1KT 1L3KA 1K9MT 1VQ8S 2DNZA 1S72S 1H6KX 2HGMA 4F26A 2EVZA 5DDPC 3PIPQ 3HHNB 3SMZA 2MKHA 5GVQA 2ZJQQ 1FJCA 2RVJA 3Q2TC 1S79A 5IM0B 3VAMA 2U2FA 5HO4A 2CQGA 1VQMS 3UE2A 2HYIB 1K73T 2M52A 3CF5Q 3DXBA 5DETA 2M7SA 1YTYA 2CPZA 3ULHA 1DHMA 1SJFA 1IQTA 2MSTA 4IO9Q 1X4DA 2V94A 2M8HA 5LJ5Y 2KFYA 3NNHA 1JJ4A 1X4GA 3CXCR 1P1TA 4TU7A 2MZTA 4ZKAA 2JX2A 2G0CA 4V19X 2L41A 4W90B 4WCEQ 2LYVA 2KG0A 2DH7A 1CVJA 2N3OA 5CXTA 1DRZA 3S8SA 4IUFA 4IOCQ
chains in the Genus database with same CATH superfamily
1QUPA 1Y7PA 1SIZA 2V67A 1Y3JA 3BKUA 2RH3A 3QGHA 4QIVA 2DD8S 5B0CA 5KFRA 4ZLNA 2Y1RI 1FFSB 4B02A 2L9WA 3MHYA 4R25A 1SJQA 3ILLA 4NLQA 3MZIA 3IR5B 2FC9A 1FDAA 4LT6A 4CIOA 1IJEB 2W24A 3C6UA 2YVSA 5I3PA 3N9UC 3TVYA 1U0SA 2QZ8A 2QA1A 2JC1A 3MM5B 4OYMA 2JNJA 1XQIA 4CLZA 4RW8A 4ZIWA 1SBRA 4Y2MA 4QW9A 2QMWA 1NSAA 1NBEB 1S6PA 2EC0A 1S76D 2JOQA 4FZVA 2MLZA 1N0UA 3T9ZA 2GGPA 3FQKA 2VICA 4QR0A 3MCOA 5JJBA 5GAEU 1D0EA 2KZMA 4ECYA 4DUTA 3V2UC 1H38A 4O3OA 4ID5A 1T8EA 2VPXB 2XG8A 5I3UA 5ETQA 2NREA 1RT3B 2F5GA 1AB8A 4C6AA 2MQQA 1VBZA 1HQUA 4ATNA 2FJAB 5CYJA 3CMAS 3TANA 1I3OB 1KHVA 2MZJA 2OFGX 2G2OA 1IBMF 3UFCX 5DQHA 2DHAA 3BGRA 3EVMA 3IO1A 1S6QB 5AE3A 3Q24A 3R27A 1RHKB 3SBMA 1FRKA 2X1BA 1W2BR 3R7SB 2NXNA 3RRKA 4XIUA 2KHDA 2HHPA 2RUGA 4OX7A 3R1LA 2YWWA 1DZ5A 5GADI 4LF7F 3BBFA 1WOSA 1AFJA 1NUEA 2ZE2B 1MROA 5EN1A 3KNAA 3AA9A 3I82A 1TKTB 1YJVA 1ACMB 4U8YA 2VG7B 4K4ZA 3QYYA 4IR9A 3HLUA 1NMEB 4KGVB 4RKUC 1S1TA 1RBOB 1Y5LB 1IWAA 2RDJA 1VLOA 1VIOA 1JXEA 3X3UA 4PQUB 4OZ5A 3KG0A 4OLOA 1VLYA 4Q43A 4OJ1A 4HT7A 2VA2A 5HJXA 4KBIA 4L72B 5GAHI 5K8PA 5A8KA 3GJRB 4AT1B 3GCWP 2UUWA 4X4QA 1N88A 4QYZK 1HR0J 1WSVA 4H4KA 4IH5A 3R5AA 1N56A 3FNNA 4X4SA 3KHRA 3PRVA 3QJPA 1ROFA 3MR6A 1EJ7L 3MMCB 3KK1A 2VDHA 1KLMB 2HK3A 3BKFA 3F41A 3IM8A 4RW9B 1HKAA 1RHJB 3M2VA 2O3DA 4EEYA 2K8GA 2IRXA 1QVGR 3C46A 3R5DA 4YHHJ 4J9QA 3V4MA 4GVBB 4K4YA 1HBMA 4GKJJ 3CSKA 1SQEA 2RU3A 4DU8A 2AMCB 4ED4A 5J2PB 4M5LA 2XHWA 3SDEB 3ILIA 1OWXA 2D74B 3UR0A 4BWJA 1TL7B 4J9RA 2E5JA 2JZ5A 3HHLB 1I94F 3G96A 1LFPA 1UPMB 1AFIA 3CD0A 1S1UB 2DNNA 3VGVA 1WACA 4LR9A 3DLKA 5B08A 2WAQD 3B4DA 3KKFA 2AEFA 4X4RA 3MMAB 2D3ZA 3TUJC 3QGGA 4Y65A 1Z4UA 3TEHB 1S48A 4JI6J 1U25A 4DCOB 1MWZA 2UUTA 5KFIA 2CADA 2IIHA 2VPYB 2XSJA 3MM8B 4RJVA 4X62F 2DNZA 1S1XB 3IG1B 6FDRA 4DL2A 2D3UA 2ZJQQ 3CIZA 3ZTOA 2HHHJ 3OTBA 3SFGA 1BXNA 2HYIB 1JLQA 3G87A 4HACB 4KY3A 5E3RA 1JIHA 4XK8C 2ZH7A 4G1PA 1Q95G 2HKEA 3Q8PB 3R5BA 2BABA 3D68A 1XNRF 4HL9A 2JX2A 2G0CA 2B4UA 4V19X 2KG0A 2PO4A 5FDLA 2QE5A 5K20B 3MM9B 2A1BA 4IUFA 2AF6A 2QA4S 1CJKA 2V2ZA 1N4LA 4G1QB 5KFLA 2DHGA 2Z0GA 3DOKB 4F4KA 5C24A 5F0UA 4ZLLA 2ZH3A 5F3ZA 2GZOA 3J7YI 1Y0HA 4DSKA 2WSFC 3AB4B 4QIWD 2C3UA 2VBXA 5HP1A 4WTOB 3HHLC 5HLFA 1KS2A 3UD3P 2XS2A 4KHMA 1YJ7A 1TK5A 4WE1B 4KE5A 4CZCA 1Y9OA 4EZ6A 3CO9A 2QFIA 1DLOB 2VBWA 1DJ0A 4JI8J 1S1WA 3GFXA 3H5XA 3BBBA 4NLVA 4V19J 4KC5A 1X60A 1VHFA 2LP4A 2YWKA 4F4AA 3IP0A 1WF2A 2CXEA 1UWBA 1NAQA 1V5IB 3P96A 2CQPA 4LBPA 3AT1B 1ZYQA 2J0WA 3KJVB 1S4FA 1IKVA 1TFWA 2W8KA 3PNIA 1CSJA 1MMNA 4U8VA 5IM0A 4YB5A 5ETKA 3IC1A 5G0RA 2YWEA 3BSAA 5IT4A 2KH9A 3PYDA 1NJWA 4DF8A 4CI0B 4KJIA 2W2NP 3AB2B 3HHEA 2L08A 3M9NB 2VPZB 3QAUA 5A0YA 4OI1A 1HBNA 5F8HA 3BH6B 1WG5A 3EZUA 1WKJA 4B3TF 4CLWA 5KFYA 1EIYB 4DR3J 1RISA 1JLAA 4ZMMA 2MKCA 2NSCA 4OJ3A 2OIHA 2A6OA 3KLEA 3Q8SB 1VQYA 3T1YF 1V5VA 4P52A 5LMUJ 4PWUA 2LKZA 3ZZPA 2QA2A 1ZAWA 3SQGB 4CH1A 2KT2A 2WVBA 3CDUA 2OPQA 3MPYA 3JTNA 3OL6A 1MW7A 1NZ8A 4M5DB 5F9LA 4DX8H 3IS9A 1QAXA 2G9OA 4F36A 3R7BB 1R8BA 2HNDA 2CQDA 4XO0A 1REVA 1CEZA 1RAOA 3VVUA 1KQGB 1S9EA 4H4OB 2GVDA 3R5GA 1RTDB 3OUYA 2FYXA 2M3DA 2HEKA 1XMOF 3QGPA 3GP9A 2MQOA 2XNRA 3EYZA 3ILOA 2CNNB 3MOJB 1CJTB 2XMWA 3MAAA 1N32J 2MQMA 3V6KA 2R42A 5KG3A 1UMJA 4LR8A 4UQGA 1WC3A 5ETSA 2DRAA 1Z2ZA 3B54A 2HLUA 3OXLA 2KYXA 1NCLA 5DG7A 1WELA 4X2BA 1PJ7A 2CAJA 5BR8F 4M5GA 1LWEA 1P27B 5LMNF 4XTTA 1RADB 4YFUA 2EG1A 2A10A 3PZPA 3L3CA 4ED2A 2YQ0A 3RW7A 1P1LA 3DM2B 4FXWA 3C6UB 3D6TB 4BWMA 3F56A 5H1SV 4C0HA 1CPZA 1T9TA 2W4DA 2BM0A 1J5EJ 3BR9A 3Q86A 1G2EA 4RW8B 2BOPA 4WKYA 4CM0A 2G1DA 3LGMA 3G4SS 4PWWA 3LAMA 1S6PB 2ZDOA 5J2QA 4FYVB 3MD1A 2PMWA 2GGPB 4ZVGA 2CVEA 2ZBRA 1C0UB 2GS8A 2QL7B 3BS9A 1PIEA 3M2UA 1CC8A 3KLFA 3W9HA 2AGOA 1K9MT 3KLGA 4X66F 4B3RF 2J6TA 2XYGB 5I3QA 1HNVA 5D4OA 1NNDA 1RSCA 3I87A 2CPZA 1GMUA 5LM7E 1HQUB 4Y6IA 1T02A 5H9EK 1X4GA 2UV8G 1G4CA 3ISNC 1QD1A 1RGVA 4DOZA 5AXMA 2FJWA 3BGRB 1P9YA 1CVJA 3OR1A 5CXTA 3IM9A 1OQ3A 4AQYF 1QVFR 2HURA 1O6XA 1HI8A 3PJXA 2F9JA 2E1RA 5KFJA 2DR7A 2VODA 1HNIA 2Z2LA 3IAM9 3N6MA 5T7LA 4DJBA 3BDPA 1RHMB 5CA5A 5KFDA 3MPDA 4ID8A 2FLNA 1MROB 4OHYA 2QLFB 3M7VA 4Y34A 2N3LA 4XDCA 2EFOA 4DX5A 1JLGA 1VQ9S 1VYAA 1S1TB 5L8RC 3Q8QB 2VV5A 2L9NA 3J7AN 3D3CJ 4DLEA 1UVMA 1LOUA 1TAQA 2CPIA 2ZWPA 2CZ4A 2FJXA 4RNFA 3TEGA 5A8KB 4ED5A 4RW6A 1Q53A 1NRKA 3FGVA 4ZCLA 1MG7A 1RHQB 2IJFA 3OHAA 4ECWA 1LW0A 2RQCA 3KK1B 1S7HA 1U2FA 3BREA 5D0EA 4CLFA 1UVNA 4UY85 3M2VB 1D8YA 4AUKA 3GPAA 4HHJA 4ANDA 5DG9A 3CJRA 5J2NA 2C2RA 5CHCB 3J80U 4DHVA 1HBMB 1XNRJ 1GAOA 5A8RA 4CDIA 1B0VA 4UZBA 2I2YA 4ZPCA 3SSRA 5EWFA 1UW9A 2WONA 3OD2A 1NSPA 2HHQA 1YJUA 1HWJA 4CLPA 1C4CA 2XMUA 2PGCA 4URQU 1ZZFA 3JSYA 4XPEA 2CWKA 2OPRA 3CB4A 3DLKB 4TKTA 3BSCA 5DG8A 4YN3B 3OFGA 3QZ7A 2CJKA 3SCKE 3OPKA 3UVJA 3LAKA 3BSOA 4ECUA 1FEEA 2DY9A 2AGQA 3GE9A 2BUNA 1XMBA 3R3TA 4EO6A 5E5NA 2AKWB 4NLSA 5F8JA 4L76A 3OL8A 1FI4A 5C7PA 4WP9A 2FJVA 4H4KC 5KTQA 1SJRA 3EE3A 4EZ9A 5KFNA 3THVA 5K8NA 2BBEA 4C9DA 5U47A 3M4XA 3BYRA 3D5MA 1R0AB 2AYMA 2U1AA 4URSA 2A3JA 4FF3A 1N6QA 3SCLE 1FCAA 1IR0A 4KH0B 4LJMA 1KQSR 5FDLB 3BN7A 4KT0C 4LVOP 3HT3A 4Y3CA 4U7UD 1CJKB 1YQHA 2V69A 5D3GA 2QFJA 1H72C 1R6VA 1GH8A 5ETTA 5C24B 4RNMA 4B3TJ 3TA1A 2HHVA 1JKHA 4ZCMA 2I1RA 4OHZA 2RQKA 2M9KA 2H1YA 2I5JA 4Q2LA 4NX9A 3U1NA 1S5ZA 1SC1B 5HLFB 2B4OA 2ASJA 4NZ6A 2ABYA 3R5CA 2BJ7A 3T1YJ 2DR8A 4DR7J 1S1WB 3QJLA 3KUGA 2IVYA 3UPFA 3PDNA 2CQ1A 5KFTA 3R2DJ 3DRPA 1PBUA 1FDBA 1DY3A 1R89A 4MMOA 2Y1IA 2Z56B 3E3XA 2VQEF 2E9RX 3L4BC 1UWBB 1VQKS 2E5GA 2I38A 2QLJB 5HVGA 4MKAA 1TKDA 1S10A 1H6KX 4PAAA 1IKVB 3QATA 4Q44A 4YDDB 5IM0B 3PO4A 2R2RA 3OTOJ 3CCZA 3GV5B 3UE2A 4FPIA 4DS4A 2HG4A 1HMVA 2BE9B 3ZTPA 2V8DA 4OYIA 4USMA 5LSRA 4LBHA 2ZH8A 2CUYA 1AW0A 1U8SA 4WCEQ 5A0YB 1HBNB 5E2QA 1G1XA 2QRRA 4MYTA 3RW6A 1WEZA 4P6QA 4DUZF 4PXBA 3DC2A 3CVKA 4R8UA 1JXLA 2Y9HA 1N5VA 3W1YC 3ENQA 3VGUA 3QRRA 4F67A 1RYSA 1JLAB 4ZPTR 4A8KA 4KKOA 3UN3A 3NXZA 3Q8UA 5A2QU 1FX4A 4DI6A 2V68A 5C5JA 2XWXA 2BACA 3KLEB 4A8XA 3H0PA 5L9NA 5LMNJ 2N7YA 3HX9A 3BGUA 1F5AA 1U6BA 2ERRA 4DL4A 1H2TZ 1VK3A 1D9AA 2R7QA 2IVFB 5GAEI 3TUZC 3PYFA 4ILLA 3NGKA 4C8MA 5HMZA 3UR3C 3RG6A 3CC4S 2N82B 3RBZA 3AQOA 3UDLA 4JV5J 3IS9B 2HGLA 5D6GA 2HNDB 2VUGA 2DPIA 3EM1A 4MAKA 2YQ3A 1REVB 4QWAA 2K06A 4R0JA 4WIIA 3HP6A 1S9EB 2GVDB 3OUYB 2AYEA 4EGLA 3ITHA 2FVPA 3BO3A 1DARA 2HZAA 2OPSA 2BKPA 4DSJA 1M5PC 3D6MB 3GFHA 3MXHP 1HWIA 1NDKA 1WEXA 4LREA 5B0EA 2OJ3A 5ETMA 1JLCB 1D8ZA 1YGYA 1VRUA 5L1KA 1ZBTA 4AXJA 5ETNA 5IFMA 4YDXA 4DV2J 1SH2A 2LXUA 1QAYA 2Q79A 4WFBQ 4LFAF 4CH7A 1LWEB 1Q5YA 4WTYA 5JVGQ 2J9DE 3TQ1A 4U7UK 1UVIA 1Z2LA 4UF4A 4YR2A 2B43A 4H54A 2NLWA 1TKXA 1HD1A 5HAOA 1T0TV 1FNXH 3CCSS 3VHQA 2BM1A 2C22A 1KC8T 3ZZTA 1BGXT 4JV2A 3I9ZA 4B9SA 1BLUA 2R7OA 4OHVA 3VAGA 1AXQA 1BMQB 2VBZA 4C3LA 2YWGA 2UXBF 5J2QB 1H73A 4BDPA 3PFEA 1PBAA 4N8OA 4I6AA 4QYZJ 3MTJA 3NCPA 4C8LA 1RU1A 1TKZA 3THTA 3M2UB 4P73A 3CJ0A 3KLFB 3H4DA 4F50A 5SZTA 1SL2A 3KLGB 3TJ9A 5D78A 4LF9J 3IR7B 3C66A 2HZCA 2QLXA 4PYDA 2ILZA 1O8BA 4RWXA 3GIRA 2CQ2A 1U24A 2FZCB 2F40A 2XS5A 1F6TA 1VISA 3ETMA 2HLTA 1TL3A 5KFMA 2X7IA 3Q0AA 3DXSX 2IHR1 3I0RA 5L1IA 4X4TA 1FJ7A 2QSFA 3M8ZA 4HHHA 2X1GA 4AL5A 2MJNA 3C14A 4EI2A 4M5JA 3TJ8A 3OR1B 5E3PA 1F60B 2DNKA 5F8NA 3GWCA 4W4MA 3HI9A 1CJVA 1F9FA 1PC5A 3HKWA 4KYZA 1HNIB 3RRGA 4FNIA 3CD5A 5T7LB 5DLFA 3TR5A 2RDDA 3T41A 4C8ZA 4C48A 4NCGA 4O23A 1AUDA 1VQOS 3TWZA 1XNQJ 2CQ4A 4WJBA 3MR5A 3KNGA 5L9XA 1VQ6S 3NMRA 3L9ZA 2UUBF 1JLGB 2R3VA 4Y28C 3FK4A 4HTJA 2P2CB 2H65B 2QL5B 4U67Q 4F4WA 5E7OB 1FE4A 1F3VA 4O0IA 3BJYA 3GJQB 1A9NB 3ZZRA 1H7WA 4EBDA 1D1UA 3PEHA 4ZVSB 1RHRB 3HHNB 4RW6B 1N48A 4X4VA 1FJCA 2GJIA 2RVJA 3BR8A 1RA7A 4ZVUB 1UKUA 1V3SA 2AJ2A 3AFGA 5B0AA 3PKMA 1X4DA 4ZITA 1OY8A 2EFNA 3FZ2A 2XULA 1LW0B 1SJ1A 4YR0A 2L41A 1FNOA 2OAUA 1HW8A 2XY5A 1HBOB 1SQGA 2DHHA 4DL3A 5EWGA 4LF4F 2CJBA 2P6TA 1P6TA 3QNWB 3H90A 2KZZA 2D3OR 4YY3F 4K50A 2GQ2A 2E1PA 2H9ZA 2J76E 3FVYA 5J2NB 3M8WA 4HH0A 5KFKA 2NPIA 1PAEX 3HJVA 1NU4A 5A8RB 3K59A 1GNKA 2J7WA 1X4EA 2ZBCA 5B0DA 5M2RA 1UVKA 3M32A 2E7WA 1WC5A 3LOUA 2WONB 2HQIA 3K17A 2CQCA 4AE5A 1X7VA 4G6VB 3H8YA 3GYNA 1RP5A 1GX6A 1RQ0A 3H5UA 3FBCA 4LRDA 4DMZA 3KHHA 4LF6J 3RRHA 4LRBA 1QJHA 1LQ9A 2QTWA 4QPXA 1VK8A 4ECQA 2JVRA 1T9VA 2OPRB 4RNOA 2VFSA 4DPYA 4HYKA 4B08A 5L39A 1RAAB 1WI6A 4N41A 1RCXB 2HIQA 3S7RA 4NA1A 3T1AA 1RYRA 3FJ2A 2BRKA 3MFIA 3JQJA 3RBEA 2MLXA 4J90A 3IRWP 3DNCA 2AP6A 5GAHU 4IRDA 1WOPA 2DK2A 4DV7F 1PC4A 3O2IA 1PO6A 2HFZA 2CPXA 2DKOB 5GAGU 2ZOFA 4MK7A 1XR6A 4P2FA 3BB5A 1M5KC 1YJ9S 1N34F 4KR0B 1YJRA 4DR5F 1X8DA 4ES2A 1RB0A 4TVAB 2VC1A 2RJZA 3T6JA 2ZC3A 4HEA9 5CZXA 1M5OC 2HQFA 2AYBA 4NYPA 3MGJA 1FD2A 5CD4H 4ZCIA 1FJGF 3GILA 1NK0A 2ZZNA 2W4PA 2ZITA 1E6VA 1Q16B 2M2BA 4N76A 3A3NB 3K0JA 1HHTP 4WYLA 4O4GA 2HVDA 3IBWA 1S4EA 4G1IA 2I5JB 2MXYA 3H98A 1KVKA 2HHTA 2QSWA 2KM8B 3FZBA 5IWAJ 2HS3A 4ZVQB 2FHJD 2X3DA 1QE1A 3C3LA 4LIWA 3IFEA 2IAJA 1VJQA 3HULA 2ZEJA 1NJIT 3FEYB 3DRPB 4LRFA 3IRXA 5A8WA 3NNAA 1RXOB 2UU9F 4RLEA 4N47A 4ECTA 3EVOA 4OV1A 2H48B 1KQKA 3VGTA 2DHXA 1HHQA 1R7IA 3H40A 4R5PB 3D0HE 3R9LA 2F8HA 2DPJA 4USTA 1HMVB 1OYDA 4PPZA 2DNQA 3M8QA 1WKKA 4DR4F 2WBMA 2LQ9A 3OT9A 2J9DA 4I2PA 4ECRA 3THPA 2ASYA 2FZGB 4WU3A 1FRMA 3K5NA 2FLLA 1U48A 4NCAA 1UFWA 1SIWB 4DFJA 4J9NA 4R8UB 3I5CA 4NZ0A 3CJKA 3T19A 2IBOA 1O0PA 1QLNA 1IKWA 1TUVA 1S59A 2QMUB 2B51A 4KKOB 5E3CA 2DGUA 3OJUA 2MZ1A 2GIFA 3RR8A 1D09B 2KM8C 2KVQE 1NXIA 3N5BA 3AH6A 1ZA1B 3D66A 2DY1A 2R2TA 2VFUA 4FP9A 1HWLA 1PJ6A 5CCMA 3IN5A 1VBYA 2RQ4A 1CS4A 3DDIA 3DYAA 1NDCA 3EZOA 4DV0J 2DCUB 4O3PA 3MEEB 1RUSA 3W5XA 1YRXA 2FHJA 2K3IA 3FMWA 4QIEA 4RX6A 1WD6A 1FVQA 2CQGA 5KG5A 2OH2A 1HYSA 1DQ9A 3ITHB 5F8MA 2M7SA 2UZAA 2MSTA 2FD2A 3RBXA 2V94A 3NP5A 4OLPA 2OMLA 2PEBA 4NE9C 2DBBA 2MZTA 2UVVA 3SCJE 4J9PA 2COLA 5H9EJ 2W2MP 1I1GA 3QFHA 3VQTA 4KGKA 1LWCA 1EKSA 1JX4A 2E66A 1VC5A 3CPWR 5KFBA 1SKRA 1RWKB 4EYIB 3GONA 1SC3B 4LSLA 1F1BB 1LK5A 4NMXA 2W01A 4AFFA 1HA1A 3FFIA 3FCVA 2VF3A 2VU5A 4RUBA 2Z2YB 3K5MA 4A8FA 2MQLA 1R27B 3DOMA 2BJ9A 1DTQA 2L48A 3VVTA 2K2PA 2FY8A 4YUDA 2KTQA 3MCMA 2RF2A 2BQ3A 3I9V9 3N28A 4ZPBA 4OQJA 1TKXB 4Y2KA 3KMSA 4RW7A 2WW4A 3IWLA 4DQRA 3I32A 3VAFA 1VIXA 2UUBJ 1NJZA 1T03A 2DEIA 2KKHA 4TYAA 3B78A 4JB8B 4DPOA 3C15A 4A8YA 2DR9A 5GMEA 4KGXB 3HO1A 1HBUA 2DR5A 1TKZB 2HMIA 3HDSA 3BEGB 3H2UB 2FVSA 3NS7B 4ILMA 4X84A 1H98A 1TU0B 3P8BB 2B7CB 1N33F 1NB7A 3MECB 3HHLD 3MPWA 3QBCA 2LQJA 2F4FA 1WDDA 2OTLS 2O67A 1TL3B 4MK9A 1AA1B 4FF4A 2VOOA 2JEFA 3I0RB 3F73A 5J2MA 3D7SB 5I4MA 3Q2SC 4XPCA 2HVZA 4QYRA 3C14B 2UVUA 5DGAA 3TX0A 3GSDA 2HAFA 3I55S 1CJVB 1WJ9A 4YY3J 2QGFB 4NLRA 3RAMA 1NHVA 3GIIA 4EK2A 4QWDA 1NJXA 3DI6A 1ZTTA 2SXLA 4OX8A 1HNWF 5KFEA 3UNGC 4B9UA 3DHWC 4L75A 1V9OA 1D9DA 4OHWA 1WNEA 4B3SJ 2VDIA 1Z1ZA 2M70A 4EMDA 1OIAA 2Y8YA 5FJ4A 1RT5A 2E5LJ 1FEHA 1SKSA 5I42A 2HFOA 2BOAA 5CABA 3KLHA 4HT5A 4PYAA 3A13A 2HK2A 1H2VZ 4JI5J 2ZBQA 4X4UA 3TA2A 1MSWD 3DRRA 2IRYA 2ADCA 2LXIA 4ES3A 3D67A 5FLXY 4WU2A 3PRBA 4OI6A 2ZDPA 2P8IA 2LXFA 4IYQA 2B0GA 4Q8FA 1OY6A 2DGQA 4NRTA 1PAUB 2VFTA 1RAHB 3R6LB 2B5JA 3ZNJ1 1YITS 5KFSA 2GHVC 1YRUA 1FK9A 3H5SA 4ECXA 1RT2A 2Y0SD 5HMWA 3FBEA 3E01A 2EFPA 1RT7B 3US5A 4Q8EA 2ZJPQ 2G13A 3K7RA 5M2PA 2XGPA 3D4JA 3MMBA 4OYOA 2BJDA 1N0VC 1NHUA 2F4VJ 4TLQA 4CM2A 4DR5J 2VFVA 3GFZA 3ISZA 3QFWA 1FWLA 4FS2A 3H7HB 4KHRA 4HR2A 5KOWA 3M32B 2EFVA 3RB3A 2CPFA 2GVZB 1FJGJ 1Q79A 2WTFA 3G82A 4H4MA 1ITPA 2KDOA 1IR1A 4ZPVR 1LV5A 2WVCA 1S0NA 4PRFA 3KJQB 1H3DA 1VI7A 3HXMA 2FTRA 1HR0F 3PCOB 1FXDA 1U26A 2XB2D 1FESA 2W9BA 4DL0C 3TNVA 2BV3A 3TRGA 4OL8A 4F4XA 2FIUA 2WB4A 4KFBA 1YJNS 1BQXA 4FXVA 1FT8A 3CJ3A 3KHLA 3UN2A 3NBPB 2FJBB 2EVZA 3FBBA 2BJ3A 1BWVA 3ENWA 1KTQA 1T3OA 2QYGA 2LEPA 3W7BA 4F4YA 5L38A 2P5VA 2NXJA 1YTYA 5IC4B 4IO9Q 1EP4A 3E51A 3NNHA 5EHHA 4K7QA 5H9FK 4GKJF 4L3NA 4EWTA 2FHMA 3QLHA 2HHUA 2LYVA 1UFLA 2N3OA 4NLPA 2V8PA 1YWXA 3R7NB 5D8HB 2Y3YA 5GMDA 3GTYX 3UO0A 1VRTA 1PKUA 2RSQA 3GR1A 2APOA 2QO3A 3KLVA 2DYAA 4D3GA 1HQ2A 2OPPA 2DNPA 5EX0A 3NMAA 2UVRA 4Q0BA 5DZ6A 1OSDA 1TR0A 1YHQS 2YKPA 1E6VB 1KR4A 3AHPA 3KDNA 2M0GB 2CQHA 1YJWS 4O4GB 1F2HA 2C3MA 4C8KA 1U1RA 4JI6F 5KOXA 4XAKA 1VS3A 4BHQA 1GX5A 1FTRA 4ZLPA 3KG4A 2V9KA 3PJWA 1QE1B 1PGZA 1S77D 1HQEA 1B70B 4TLRA 5DQIA 2IAJB 1E6YB 1NEEA 1Q8IA 2HHHF 3IRXB 3E8OA 5A8WB 3IMQJ 2D7SA 2GHPA 5HQLA 2Q3PA 1NJYA 3ADAC 3KDOA 2M5YA 4QR1A 4DL5A 4RNHA 2XLIA 3CCVS 3LP2A 4ALZA 4MIWA 1VQSA 1AROP 1QUVA 2AHOB 2BQUA 3NY0A 2E7VA 1W25A 3NGDA 4KRWA 3G6XA 4BBYA 3QRQA 2FY1A 2UP1A 3EMTA 1EETA 4E98A 4Y2AA 1MLAA 4Z2XA 4B3MJ 4DFPA 3CDEA 2BW2A 3DHXA 1IBCB 2IJRA 4JI1J 3JS9A 3WX8A 4TQRA 2GJ2A 4JI8F 2VHGA 2ATCB 1FRIA 5KT6A 2B6AA 4A8QA 2J8SA 3BO2A 4IFYA 4LSZB 3LWLA 3UDVA 4OYBA 2K1RA 3QRPA 3HSZA 2I9SA 2ACYA 2Y0BB 3OXGA 4ZOSA 4ZP9A 2R7XA 1PYOB 3KK2B 1CS4B 4G3IA 1TTHB 4YS2A 3RYLA 2KVIA 3SZ2A 2ZH5A 1QY7A 5KG7A 1VHIA 1QTNB 1LEOA 4RZRA 2B4VA 1U6ZA 2F8MA 3SIPB 4KV8A 2M88A 3QIPA 5IT0A 2ZH2A 2VC0A 4GC6A 3POTA 1HYSB 3OTEA 4K8RA 1NSQA 2J0SD 3VAIA 4OZJA 4CTAA 3HF5A 3K57A 4C11A 1OQ6A 4DR3F 4TQSA 2MGZA 2IY5B 4JI3J 2XS7A 1NO8A 5J1PA 4MIBA 4MFBA 4PXEA 1IKXB 2E1MC 2O01C 3BDEA 4OIXA 2XY7A 1HFEL 4ZP7A 1HWUA 2B9WA 2OD4A 2RIJA 1SKUB 5IXUA 5LMUF 2RRAA 1NK4A 3PX0A 2ZH9A 3FFIB 2PDAA 1XBWA 2GX8A 1TP7A 1AZSA 1XR5A 4OI3A 2R7SA 4ZP6A 4KHPJ 3DOMB 1DTQB 2Z57B 4TN2A 2RF2B 1S9GA 1WC4A 1FF2A 1RJJA 2Q1LA 3LTOA 2HQDA 3TO8A 3CCJS 3V6HA 1I51B 4ENOA 3TI0A 1HNWJ 4RW7B 1AT1B 1FKOA 3CJ5A 4C2MA 3CMES 3D2WA 5K5MA 1RTIA 2KG1A 1FWKA 3GJSB 4RR5A 4DCJB 1ZETA 2NXCA 3ENAA 2HFVA 2J8AA 3PVXA 3E2EA 3QT5A 5KT4A 4JUZA 5DJBA 1RZMA 1N32F 1CLFA 3BGLA 3C15B 3FSIA 2G1HA 3JSMA 4YR3A 2PMHA 2J6SA 1S1VA 3M8YA 1HBUB 2HMIB 2M52A 2BQRA 3OFEA 1RTHA 3TAMA 2XY6A 5D4PA 5A76A 1PYTA 2M8HA 5C42A 4L74A 1JLFA 2VG6B 1EQMA 2DH7A 4KPYA 1DTTB 3LP0A 3T5JA 1T7PA 3IGNA 5F8GA 3VZHA 3SI8A 3CCLS 3IWNC 3NL0A 4BLGA 1CJUA 3GB0A 5J2MB 3TUIC 9ATCB 1JXVA 2FQQB 3W5ZA 4ZVTB 4O0NA 4PCQA 2HZVA 4NYZA 1ICEB 4FN5A 1L3SA 4QJVA 1WTFA 2WCXA 4IO1A 1J5EF 1M0SA 1L3TA 4DPUA 5J1NA 3DI6B 3T9NA 5CAAA 2NQPA 3QGIA 1BQMA 3F44A 3HD2A 2QL9B 2MDAA 3Q8YA 1H7XA 1TMMA 2LQ5A 2HQCA 3M30A 3JB9k 3C16A 3N01A 4K5SA 1WC6A 4NWBA 3AODA 2W9CA 1RT5B 4LF1A 2RS8A 2JFDA 5I42B 1EHWA 3KLHB 5IQQA 4FF1A 5GAGI 2NCKL 4RU2A 3BH7B 3DRRB 4OYPA 2E9TA 2G0JA 4ED3A 2I8EA 3HSDA 1XEZA 2IC3A 1SL1A 2OLWA 3M6UA 5KT3A 2DXDA 3DLJA 2IYIA 2DIUA 3QO9A 2MB0B 3O44A 3V4IA 2R8KA 1FK9B 2ROEA 3U7JA 1RT2B 1YBAA 1RA6A 5CD4A 3E01B 4P7VA 3NRBA 1QTMA 4GO7X 4ZVHA 2PMZD 3EICA 3FRYA 4C8NA 4O44A 3MMBB 5RUBA 2B7BB 1ULRA 2W2QP 4A47A 4ED7A 1H0HB 5CYMA 4IH6A 3K5OA 3C6TA 2UVWA 3FBFA 3DKDA 5CYQA 2ZZTA 5KFWA 4WZMA 4DPXA 1YK9A 3D6FB 1KOOA 4M63A 2B8PA 3G82B 4H4MB 3QSYB 3MTKA 2B9YA 4QU7A 3LO3A 2P9EA 3SFUA 5HI7A 1RAGB 3CJ8A 3VALA 5KFQA 2VONA 1K1SA 3V81B 1U2CA 2VASA 1LWFA 5A2QY 5HROA 4E8UA 4KFBB 1LNQA 2DT9A 3HFKA 4LF8J 4RPFA 4AYBD 3CCUS 3OVBA 4DCPB 3U27A 2QEXS 3MF5A 4CWBA 2B4PA 4M95A 3CC7S 2CYYA 2AJ4A 1G7CB 4C0BA 3SV3A 5ITHA 2JEGA 2GIQA 2GO8A 1S97A 3ET6A 4ZS6A 3CIMA 4B9LA 3PACA 2YNGA 4NEZA 1EP4B 3RUBL 2C2EA 1X4HA 1B7YB 1XMQF 2AYGA 3QLHB 1RTZA 4NASA 1KSPA 4LIRA 4PG4A 2MMYA 1WG4A 1RT6A 1PCAA 3WC2A 1VRTB 4Z37A 2G2ZA 2PC6A 3RGIA 1WF0A 3B82A 4ECSA 2OPPB 5HATA 4MIAA 3PEJA 4JV1A 4Q0BB 1SI9A 2MQNA 3PR5B 2CKWA 4YMEA 1IBKF 1IWGA 5G4DA 3P5BP 4YP3A 1PG5B 1WOOA 2JRSA 2V0NA 2FJEB 5DM6Q 3ZZZA 1RAIB 3P6YC 2CPJA 3TVZA 1HQEB 1OPIA 3FCHA 3JQMA 1M1KT 3ZO7A 4E0DA 4MYUA 5K14A 3TW0A 2HS0A 3PIPQ 3DDNA 2A18A 2H5IB 3Q2TC 1B64A 3T3FA 3T1HJ 3OXFA 1UVLA 5DO2A 4RUCA 3BBCA 4ETXA 4F3QA 4JYAJ 1LXNA 3VWSA 3F0NA 4NLTA 1TAUA 3K5LA 1ZM9A 3LP2B 4ICLA 3I5BA 2GAHC 4EYHB 2QJ3A 2OFHX 4DR6J 1HI0P 1SV5A 2ALZA 2CJAA 3CJQA 5KAKA 2VG7A 2Z2ZA 2QMXA 4PG7A 2OHDA 1EETB 3CUNA 1JJHA 3HJFA 3JYTB 2R7RA 1C1CA 2CDRB 2O66A 4ITSA 2YKQA 4IQMA 2LLZA 5K8OA 4C3MA 4PG6A 1RWPB 3BV8A 3CULA 1X9MA 3G8QA 4ECZA 4DR7F 2HVIA 1T11A 3JAMU 2B6AB 4DZDA 2XC9A 2QG9B 4RL1A 5K8MA 1RLDA 3FSXA 4KSEB 4M5KA 2HAIA 2EWHA 4IFYB 4TU8A 1MU2B 3KG1A 2CZVC 2DJWA 3EZ5A 3MUMP 2DHSA 1YJTA 2AX1A 1F5BA 1U02A 1A6LA 2KN4A 1HPZB 4B9MA 1CQNA 3CWJA 2YKAA 4HH1A 4RWWA 4C4WA 4A8WA 3ILJA 5JUMA 4CCHA 2OEKA 3OTOF 3KUEA 2MHEA 4CLYA 2XCAA 1K8AT 2HBRB 4M5NA 1RCOB 2JH3A 2B3TB 4HHUA 4NPOA 4OFZA 1O5JA 5MAOA 4KV8B 1ZA2B 2DGTA 2UUAJ 2DNHA 2KT5A 2ZKUA 3I96A 4CTAB 3VZIA 1W7WA 3KFWX 2MGZB 1T94A 2RNEA 4LRAA 5LJ3Y 1TL7A 4PABA 3VAKA 1ZOTA 2ASDA 2HWTA 5IS2A 4MFBB 2AV5A 4OJGA 5L1LA 1JQGA 2CNLB 1TMJA 4PZVA 5KFZA 3U1MA 1OS5A 3FEXB 4ILRA 3K5PA 4DV5J 1KOHA 1AZSB 2LQ8A 1R6YA 5F8IA 4NA2A 2MTLA 3NEKA 3GMGA 1UP1A 2BJ8A 2M4MA 4JI2F 3Q8VA 4KGMA 4I68A 1S9GB 2H3EB 3PHEA 1Q82T 4JV5F 2XEXA 3PM9A 1RWXB 4IR1A 4ANCA 3ZXWA 1X4CA 3ENVA 2R7WA 1KTVA 4LVNP 4IQXA 4JI7J 4P9SA 4DX6A 4L6V3 1QSSA 1VBKA 1RTIB 4A8MP 4ZJOA 3IA0A 3LPYA 1JNRB 3DRYA 5KFHA 1B3TA 3CO0P 4HACA 1SCJB 4M94A 4ID5B 1TL1A 3CC2S 3PYGA 5KG6A 5BJRA 3CD6S 2MZRA 5I3UB 3JSMB 2IM1A 3MURP 1S1VB 1N36J 3JQKA 3CDAA 2P9GA 1LK7A 4RBUA 1WEYA 3JTOA 1RTHB 3TAMB 4F02A 2LCWA 4A46A 5C42B 3Q23A 1FFWB 1HNZJ 2OGUA 1KKHA 3VAHA 2BW7A 4DV2F 4DSIA 4DZ6A 3LP0B 1Q1KA 1J5OA 5HN0A 3MUVP 1X5TA 4ZJQA 2G4BA 3GYXB 4Z7CA 3I0SA 1CJUB 2MKSA 4UUXA 1CULA 2YWFA 1LWXA 5E33A 3QWUA 3D1QA 2HFSA 3L7PA 3M9MB 2E9ZA 3AAWB 1K0VA 1FHTA 4OZ3A 4FBTA 2JEJA 4WXWA 3ZC4A 1VQ4S 2FGCA 2Y1LB 2JDJA 4OHXA 3MDFA 2EPIA 2YH1A 4P7TA 2ZWOA 2GFFA 3UD4P 1BQMB 1K0TA 4LF5J 4UZCA 4DV4J 1RK8A 2Z2MA 4IG3A 3M30B 3C16B 3W2WA 3GIMA 2IVMA 2HBQB 3JTPA 1L3KA 4LF9F 1RWUA 2W9CB 2R8JA 4ED1A 3L7UA 4M5HA 2CG8A 4OI0A 1S79A 3W3SA 3AD8C 4KTQA 3QQCD 2YQ1A 3M1VA 3NWRA 4DL7A 2V4JA 1SJFA 1IQTA 1S0OA 2WSEC 2DRBA 1WC1A 2AT1B 1UA0A 1GXUA 1Y3KA 3GU0A 4TU7A 2HNYA 2IC3B 3DDKA 4W90B 5FIIA 5H9FJ 5BXIA 3FQLA 4WFYA 3CTRA 4DSFA 1R31A 3BYPA 1QSYA 3QO9B 3NAIA 4FYYB 2RILA 2QV6A 2PEHA 3V4IB 2PE8A 3BGOP 5GMKa 4WK3A 4OZNA 3WIUA 3KXDA 1GXLA 4Y0FA 5F3TA 1XMQJ 1JLBA 1XNQF 3G2XA 4USUA 3BPSP 2DGVA 4O44B 2JEIA 1X4BA 3PTWA 3A1YG 3VAJA 4OMFG 3SQGA 5CYMB 1YI2S 3SSSA 3C6TB 1BD6A 2PI4A 5HMYA 1GTHA 2R9LA 2MEWA 2P9CA 2DR6A 1S7IA 2EK6A 3J81U 1IBKJ 1FVSA 1M5VC 3PX6A 1VC6A 2EK1A 1GMVA 1RTDA 1WTBA 3TZZA 1FRJA 1U1QA 2BANA 3NS5A 3V6JA 3W62A 3DFEA 1LWFB 2E1CA 5HROB 3W9JA 4WXOA 2XSJB 2IM3A 3T5HA 3FC9A 1HI1A 2RHQB 2YXLA 1UJ6A 3O8WA 5FD1A 4NLXA 2EEYA 2D9PA 2NZ4A 3ET6B 1JLQB 2AJFE 1UEKA 4P75A 3PW2A 2YNGB 2VQFJ 1KQFB 2HHXA 2XI2A 2HFNA 1JB0C 2C3YA 2KRBA 1NK6A 3T5LA 2H5JB 3W63A 2NYHA 2YKMA 1CQMA 2VIHA 4U95A 1X31C 1UEUA 3DM2A 3R1HA 1RT6B 4CO0A 2QT7A 5IT9Y 2MJUA 2XI3A 1T05A 2ZH4A 2MZQA 4RBVA 1HW9A 4PKDB 4LF6F 4L73A 4F0MA 3HVTA 2NS1B 3EGWB 5HP1B 1JJ2R 4I67A 4F2RA 2UXCF 2XMTA 1U4BA 2BMBA 1EKRA 1U49A 4KIAA 2MSSA 1P9QC 1NK7A 2V34A 3O3LA 1C0UA 4DPTA 1GQEA 4EFAC 4ZVRB 3KYLA 1J27A 1ZH5A 1U1NA 2BZ2A 3O5TB 3IWXA 4NOHA 1KWMA 4WF9Q 2Z58B 5LSOA 3W66A 3A3PB 3CJ4A 5AT1B 4YEAA 3LP1A 1RHUB 1WKLA 2OEJA 4N8NA 3H2VE 5K14B 4DQPA 5HL7Q 2CPEA 2IDEA 5LT5A 4QOTA 1HNXF 4GKKJ 1C2PA 5DDOC 3LPEA 5G0RB 4NLWA 4DG1A 3IBCB 2CJ9A 5KFAA 4LFBJ 4TY9A 2IDLA 5LXRA 1RAEB 2ZNYA 1U1LA 2VA3A 5D4LA 2J6UA 3GCXP 3PW7A 1U47A 1WUUA 2VOPA 2RDIA 1RACB 5ETOA 4ICLB 5DDRC 1U1OA 5A6WA 2NSBA 2XBPA 5E3QA 4JOUA 2LU1A 4YB6A 4CO1A 5HJYA 2EFQA 1SV5B 4UOGA 1GMWD 2C1EB 2R8HA 2W9AA 3H2LA 2QN6B 4I4BA 1C1CB 1HIYA 2LA6A 5IWAF 3AD7C 4O3RA 2VZ9A 1U0HA 4C7QA 1R8CA 2BA9A 5AE2A 9RUBA 2CVIA 4J91A 3OVSA 3W2VA 1UEVA 3DU6A 3MCSA 1F9EB 3WDOA 4NZ7A 2V8HA 1KP6A 3M05A 3G6ES 4NXNJ 3J7ZT 3TOQA 2DNGA 4J37A 2OPQB 3GZ7A 2DNOA 5HSPA 4JI2J 8AT1B 2EI5A 5KG0A 3PJ9A 5AXNA 3MPUB 1TK8A 3EDRB 3W60A 3P4UB 2BDPA 1F9HA 1K1QA 3A8KA 4OYAA 3W8PA 3Q89A 3D1OA 3SMZA 2MKHA 1WDTA 5DS7A 5HO4A 1NSKL 1IJFB 1GK8A 1S99A 3MEDA 1OMSA 5E0OA 3N6NA 1SL0A 3CXCR 7AT1B 1T3NA 5B0GA 3MAAB 2CDQA 5E3AA 1R0BG 4X4PA 3CCWA 3JSRA 2C2OB 2XMAA 2C2ZB 2HRTA 3QJJA 5HBMA 2HVHA 3HSGA 3ZNUA 4OX9J 2OSQA 4WPAA 3HPOA 1S49A 1WORA 5KT7A 4EU0A 2RRNA 3V6DA 2PD1A 1RTJA 2Q6CA 4M5IA 3DRXA 3S01A 3OTCA 2KB2A 2Z4PA 2DB1A 1NKCA 3BO4A 4QWEA 1YBTA 2IA6A 1TL4A 2NR0A 2OO4A 4NLGA 4CO4A 3J81j 1GMWA 2BRLA 1QM9A 4DV0F 3RAQA 1RAFB 2BX6A 2YNFA 2CZ9A 1RU2A 3OR2A 1UETA 1HWKA 3VV2B 5HVHA 4UTGA 1DBDA 3TX8A 1VC0A 2F8EX 4PWDA 2OI2A 2X1AA 3WBZA 3R5JB 1S0MA 2C42A 2DEJA 4QCLA 2ZFHA 1RWOB 3I6PA 3RTVA 1R0AA 5ETRA 4NI2A 1HL6A 3MM6A 1TL1B 3TZXA 2KFNA 1U1MA 2YH0A 5BYSA 1HNVB 2AZ3A 2JVOA 1FERA 2WB1D 3M6XA 2QLWA 2N4CA 3UCGA 2MZSA 3UDCA 2AJQA 4DN0A 4G65A 3HSJA 2GMLA 1UTAA 4DV1J 4WKRA 1RWVB 2LA4A 4NCBA 4U7CA 2ZJRQ 4FXDA 4RW4A 2OUGA 3PXGa 3SXLA 2CG4A 2XYPB 4RU9A 1TUWA 1J5OB 2ZHAA 3V5RA 4XDDA 5L1JA 2WK4A 2GA7A 5IOLA 2MY8A 3I0SB 5FLXU 1CULB 2N7CA 4DWIA 1BC6A 4WFNQ 3RR7A 3M8PA 1JNZB 1N54B 1V6HA 4OYXA 1O51A 1IXKA 1RT4A 3EXYA 2DXFA 2LECA 5THWA 1NPPA 2E1AA 2AWZA 4LQ9A 3VGSA 5L46A 3P45B 1JMTA 4K5RA 3AA8A 1R43A 1F2GA 4JI4J 3H4BA 4GMKA 4F2SA 1TELA 1Q81T 3I4HX 3ZTQA 2W25A 3EPGA 2XLJA 2GCFA 3MI7X 4K59A 2IM2A 4IG3B 4USWA 1MWQA 3G9CA 3W2WB 4ES1A 4NXMF 2C28A 2UXDJ 1MMDA 4P72A 1EAYC 4PXCA 2F65A 1NB2A 2LFVA 3QWPA 5DLGA 1TL5A 3L7OA 4ANEA 4I6WA 3CJTA 1FKPA 2IPOB 2ZM6J 4ED6A 3M1VB 2V4JB 4K2XA 4TU9A 2HNYB 2RT3A 4F8RA 4LFCJ 2X51A 1VBXA 3GFYA 2IFXA 5KFPA 1FE0A 2NZCA 2YX1A 1FO1A 2YY3A 3UDEA 5HVFA 1JLEA 3VTIA 1PILA 1WG1A 1JLBB 1N5SA 3Q83A 1FDNA 5M2UA 2KXHA 2ZOGA 3OLAA 4B3SF 3CCTA 1U09A 3PX4A 2A2DA 3LANA 3DLGA 4YQWA 2H5EA 3RU0A 2E5LF 2BJ1A 1FRLA 1XWLA 4JI5F 2UXCJ 4UOCA 4DR1F 4WIQA 4ERDA 3K8WA 1TVRA 4B9VA 3U02A 1F0XA 2HVEA 2KRRA 3UVJB 3QT6A 4MKYA 3TJAA 1I5OB 5KFXA 2BANB 1K47A 1SH0A 1VQ8S 2BVZA 1IM4A 4DQIA 3MEKA 4DEZA 2HGMA 1R3NA 3MEGA 1TK0A 5D0HA 2L3MA 4RBTA 1SUQA 4DV6F 3ULHA 3D0IE 1Y11A 2NUHA 1MWYA 2KFYA 2FLPA 1JJ4A 1JLCA 4IH7A 5CH7B 4I64A 1HNXJ 1IBMJ 2HGNA 2F4VF 3CE8A 2W2OP 1Q7YT 4JI0F 1N6QB 1VR6A 1NH7A 3G71S 2FHOB 4I2QA 2LDYA 2MKYA 2YKMB 4TYBA 3FMBA 3TQEA 1L5UA 1QDUB 4N77A 4C98A 3EX7B 4DBQA 4DX7A 4LF7J 3CJ2A 3RB0A 5D3GB 4PQAA 3HM9A 3RBDA 2RQMA 3BQ2A 1ZM4A 1JKHB 1T05B 2E7XA 2JHEA 2BEFA 3BF4A 3TUPA 3C2PA 2X1FA 4CH0S 3HVTB 1C0TA 1NDLA 2MQPA 1YBUA 1JK9B 3FCWA 5HQMA 2GJFA 3N6LA 1S6UA 5E41A 3GYGA 1VFJA 4Q7AA 1ZAXA 4U9RA 1KONA 4I6YA 4WYWA 1APSA 1EARA 2XMVA 1Y10A 4LSNA 2V4QA 3EWGA 3MD3A 3RZAA 1F5CA 1BHNA 2DNMA 3KTQA 2DO0A 4UQTA 3LP1B 3CT9A 2QIFA 1ZS6A 2HW3A 2XGQA 2DNRA 3LGHA 1U7LA 1N8RT 1EZZB 3AXKA 3KK3A 2DCLA 2B9XA 4WP3A 3MPVA 3UD5A 4DG1B 4NRUA 6FD1A 1SPBP 2V50A 1RT1A 2KXFA 1D9FA 2V8VA 3QMQA 1UZDA 3N0VA 2F3JA 3A8IA 2ROPA 4OI2A 5AE1A 4OZ1A 1WF1A 2XM3A 1T95A 1MN9A 3H42A 3IBFB 2KHCA 2W1BA 2GQCA 3FSYA 3W65A 2MLYA 1X4AA 2GV1A 3K58A 1VMBA 2BE7D 1I94J 4DPWA 3PRDA 3TP2A 1BE4A 2XTJP 1U0HB 1XIQA 3BZQA 2B8QA 4M8LA 3KHGA 4LBIA 2VB6A 2WOMA 1NLKL 3W2VB 4ZVEA 4QQBA 2XZDB 3MR7A 3GIKA 3CNQP 1R8PA 1M1GA 1QAJA 2IBKA 4QR2A 1LKZA 1Q8BA 1EB0A 2H4YB 2C3PA 1DQAA 3QPIA 2LU2A 4WK1A 3N4WA 2PN6A 2FPHX 3CCES 4DV3F 2DH9A 4X62J 5J1EA 4O3SA 4JV0A 3M8SA 1HBOA 1TQLA 1WWHA 2OKQA 1UFKA 1BQNA 2XWYA 3MEDB 4CLUA 4MT1A 2YNHA 4MKBA 2OPSB 3CDWA 5IC6B 1IN0A 2N4DA 4ED8A 2LEAA 3TVKA 4UOFA 2W7AA 2V2QA 5EWEA 4B3MF 4A4JA 4X65F 2NYIA 4JI1F 1OJ4A 5HBMB 2GO9A 1VRUB 1KRPA 3EDQB 3CCRS 2GIRA 4PG5A 3PO5A 2MPUA 5LSLA 3UW1A 3AOCA 1SQFA 2VKZG 3V6DB 3NGTA 2DVIA 1RTJB 1L3UA 2FHKA 4CLTA 7FD1A 5C25A 3ZFVA 4GC7A 4P2SA 4J9UE 2LMIA 2VH7A 3UN5A 2EXUA 2R7TA 3H25A 4JP8A 1KVIA 2YNFB 1B0TA 3W64A 3OR2B 5KT2A 2HBYB 4F26A 5DDPC 4PWDB 5GVQA 4RUHA 3VAMA 2XYHB 5DZ7A 2R8GA 2GQQA 1R0CB 3BQ0A 1K73T 3DXBA 2R2SA 1FD8A 1RDRA 4ZPWR 2L9DA 1G6BA 3Q8RB 4JI3F 4NI2B 4NXMJ 3MM6B 4B9TA 3OBIA 1KFSA 1W2IA 4LR7A 4WFXA 4F0HA 4KPCA 1AUSL 4J9KA 1HHSA 4J5OA 1OPZA 4A8OA 2XZTB 2Z8QA 1GEHA 4PR6A 1BY9A 3MWBA 4WFZA 4RW4B 4ER8A 4UW2A 1B99A 2XMMA 1D3WA 4KHPF 4LRCA 2DITA 3LGNA 5KG4A 3SSQA 2CQIA 4DS5A 2F63A 5ETLA 4GVLA 3HZGA 1FX2A 1WHWA 4NCGB 3M8PB 2R8IA 2HQGA 2I6WA 4QWCA 1TFYA 5A6PA 1RT4B 2CPHA 2BKOA 5F41A 3NOGA 2MKJA 2O1PA 2VJVA 1X5PA 2RUSA 1UCNA 2J9CA 3DLHA 1Q7LB 4Y00A 1VQ5S 3NOCA 3TZYA 4C3KA 1SJ3P 4D3HA 3NWGA 3HT0A 4PPDA 2CJYB 4R5PA 4NLOA 2VD3A 3OLBA 2PFFB 4DN9A 4BS2A 4DR1J 5B0FA 4OZ0A 3UI3A 2KYZA 2RHSB 1U1PA 1IR2A 3LA0A 2MKKA 3MR3A 4LF2A 1XMOJ 1ZZNA 4C8YA 1EQ0A 1XTZA 2P6SA 2VL1A 4CNYA 2G0IA 1FKPB 1NDPA 2OD6A 3CDBA 1KN6A 4DV6J 5LL6d 2DGOA 1UW4A 3BPDA 3PG9A 2ZH6A 3MM7A 3EGVA 4IDKA 1RI7A 4NYOA 1QSLA 3KMQA 3EXCX 5EX3A 2FC8A 4CRJA 5BR8J 3S6EA 4OZLA 2M8DB 3OV7A 4JI0J 3GLJA 1JLEB 3ETOA 2LEBA 4X64F 3ONQA 1HD0A 4K4TA 3OSNA 2VKRA 3HK2A 4HDHA 4IOBA 2YKOA 1Q0NA 4HDGA 4F3MA 2ROGA 4O4RA 2ATLA 2IA0A 2W8LA 5KG2A 4WP8A 3PV8A 3DLGB 4TY8A 5KFCA 4QU6A 3FRZA 2DNYA 3MEEA 4DDFA 4MKVA 3HKZD 2ZKTA 2WVEA 2R7VA 5D77A 4QPTA 4CYUA 4OJHA 1TVRB 2B56A 3MCNA 2HRUA 4FDFA 3IXQA 5HQ8A 3G6VA 4A48A 2BKNA 4IRKA 1XC9A 4F04B 2HPUA 2J0XA 3WHIA 3JAMY 3GG0A 2CPDA 3MEGB 4X66J 4B3RJ 4CO3A 2XHCA 1GXTA 1NZAA 1UVJA 2BXJA 3RB4A 1SUQB 3A12A 1SVDA 3DLLQ 1NK5A 1DQ8A 3P3DA 4QW8A 3WQPA 3QZ8A 2KU7A 1M1HA 4HVZA 4W98A 2OSRA 1YKWA 2R2UA 1RLCL 3D54A 3ZZOA 3RAXA 3P49B 2XMJA 5EDWA 3B6BA 4AQYJ 3UCUP 4USJC 3DLEA 3DRSA 5HK4A 2EBGA 1H2UX 2ZVSA 3N79A 2ILYA 1M90T 4C0OC 4M5MA 4I2QB 4L3KA 4ZVPB 2CFXA 2AZ1A 1U8WA 2ZD1A 4KAIA 2BE2A 2PIIA 3MMJA 1DURA 2IRUA 4E2FB 3DGVA 4A8SA 2E44A 4ZDNA 3I31A 4MTPA 1C0TB 2XO7A 3TZWA 1T9WA 4HI1A 3I56S 1FRHA 4DSLA 2WBRA 3DLBA 3R8YA 2IJNA 2KO1A 3H5YA 2AD9A 4LF8F 2MY7A 3TAPA 1UA1A 4ELUA 3CD7A 5CZVA 2AQ4A 5EUHA 1X4FA 4FPRA 2CPYA 4P2XA 4QIFA 3DMJA 1RE1B 1YDLA 1JJCB 5D4NA 3DOLA 4U6PA 4LSNB 1LW2A 3MECA 4DUYF 2DRDA 2YPYA 4QZVB 4RO0A 1KEKA 1C1BA 5KFVA 5LJ5Y 1VOMA 3D1HA 3M2RA 3GSIA 3KK3B 4DV3J 1M5SA 4ZKAA 2OELA 2W4CA 5CQGA 3R6GB 4IRCA 4F0KA 1KVJA 1K44A 3HFVA 3M6WA 1IM6A 4NLDA 3K8VA 3H20A 4ZHRA 4IG0A 3T6BA 3M8QB 1RT1B 4AD6A 1QAIA 4C8OA 1KDNA 1VDHA 4I2PB 4NEYA 4KO0A 2D41A 1KFDA 1BUXA 5IQ6A 3MAHA 4F25A 1U2RA 2CQBA 3AD9C 4FS1A 4DU7A 4X65J 1YVFA 2FJDB 1Q86T 4DXLA 3CJKB 2XQCA 2DTJA 4B3OA 4DFMA 1MNEA 1FKAF 4NLUA 1IKWB 1YLXA 3UWTA 2A0FB 3B4MA 1YZ7A 4X4OA 2XMKA 5KFGA 4RNNA 2BR0A 1XK8A 4FNHA 5BYRA 2J9EA 1UAWA 3WX4A 2ZZMA 2WOMB 1TUGB 1N5YA 1GTEA 5IV3A 2EBEA 2Q43A 8RUCA 1RKIA 4USKA 3Q22A 1B4SA 1IBLF 2NXEA 1UL3A 2VBYA 3T1HF 2YX7A 2GMJA 5K9FA 3DYAB 1ZPWX 3DGPA 2RKIA 4JYAF 5ETPA 2YWHA 3OSPA 2KL8A 3O6QA 2QX0A 1FFGB 4UY8T 5J1EB 1T9UA 4F4ZA 3NCRA 2OEMA 1RT7A 4OYWA 4DR6F 3M6VA 3GR0A 1OYEA 1BQNB 5KT5A 4ZJLA 5DRKA 1RWMB 4EBCA 2RU9A 3RB6A 3EGZA 2YNHB 1P8GA 2PA8D 1IKYA 2ZBIA 5DDQC 1L3VA 2DGXA 1LWCB 3NNCA 1NPRA 5DM7Q 4DR2F 3A3OB 3D6HB 2I0XA 3FDSA 1N52B 2GVZA 1AYEA 2CNOB 3VF0B 3EJMA 3VCDA 1Y5IB 4LSLB 2AX0A 2H54B 2GMHA 5GADU 3G8SA 3U1LA 3ZTRA 4KH1B 2RMLA 3AQPA 1A0OB 1Y4ZB 2WZ1A 5C25B 3WIVA 1XR7A 1NK8A 3J80Y 2CJQA 2J7UA 3NBPA 4ZN3A 2E5HA 3KLIA 2AW0A 2YTCA 4K4UA 4GRSA 3KWMA 3PW5A 2VQEJ 2JLGA 1MN7A 1T03B 2ZBPA 1ELOA 3A4TA 3IR6B 4DL6A 4R0EA 2UUAF 2R7UA 4OYZA 4OX6A 2HSEB 3UCZP 3J81Y 2IYGA 2C2MB 1R8AA 2V2KA 1OO0B 2MQ8A 3NGUA 2C3OA 2VJUA 4B17A 3WC0A 2DNLA 3OTDA 4RUAA 5DQGA 2ADBA 4K0KF 2UUCF 2WHOA 3PIOQ 4PG8A 2PSZA 3NS6A 1CC7A 3L09A 1WC0A 3I4PA 4DUZJ 4UUWA 5D0RA 4N56A 1TV6A 4F7VA 5KFOA 4DV5F 3NAHA 2FVRA 3OJSA 2HHWA 3HMJG 1CBKA 3OW2R 4IFVA 1B7FA 2OMOA 4X4NA 3MUTP 4J9LA 1C4AA 3PHTA 3LUYA 4I7FA 2LQBA 4HKQA 3M9OB 2CJXB 3NLCA 3CGIA 4FKXA 5KFUA 2V63A 1E6YA 4JI7F 3I5AA 3GJTB 3N5FA 1FJEB 4X64J 1RWWB 2AIRB 2A6MA 5ADZA 1B0PA 1Q5VA 2DH8A 3OL7A 1ZAVA 2UV8A 1IQZA 1NKBA 5B09A 4HLBA 1SXLA 3PR4A 1N36F 3W5YA 3BM7A 2V6AA 3PY8A 2JL9A 2GC8A 1WSRA 5B0BA 1FRXA 1KNZA 2C2DA 4UOHA 2J7KA 3GIJA 2BYCA 1HNZF 4ZN1A 4OV6A 3MR2A 3BGFA 4MH8A 1Y00A 1P1TA 1SC4B 2HQ3A 3TARA 3AJDA 5IZHA 4ETZA 3S8SA 2B5JB 1Q4RA 1X5SA 5KFFA 2K7KA 4CO5A 2DGSA 2F7VA 4PUOA 1FTCA 5JVHQ 5AJ3F 1GFWB 1RAJA 5B7WA 3PKYA 2YNIA 3BQ1A 1DAXA 4ECVA 2YPZA 2ACMA 3MM7B 2R4FA 3AY0A 3QIDA 4IDKB 2RRBA 2ZC4A 3LALA 4AL7A 3EVWA 4USIA 2V4RA 1UPPA 4KQZA 2D1CA 2FZKB 3MFHA 4JBCA 2HNZA 4LFAJ 1U1KA 2YKNA 2CIMA 7FDRA 4F3OA 3OFHA 3NKYA 3PYEA 3J7YU 1X9SA 4J9VA 2VFRA 4LF5F 4DV4F 2A2CA 1KD1T 3KK2A 4QIGA 2KJVA 4CNZA 5C2CA 2VPWB 4YB7A 4TY8B 3B8HA 3SEOA 2FLOA 4ZLJA 3HHKA 2HS4A 2PFDA 3C19A 2W9BB 4ELVA 3CCQS 5ETVA 2UXBJ 4CYUB 4Z7YA 1U6FA 2Z30B 2D9OA 3HFZB 2WVFA 1YX2A 2XZWA 1IVZA 2K7JA 3LW5C 3VR1A 5IT9U 3HVWA 3BN4A 3JXOA 3QT8A 1SKWA 2HBZB 2KFZA 2VG5A 2JLEA 4WWSA 2FVCA 2NXUA 5KG1A 2OTJS 1S12A 4V1Ak 4DUYJ 1X0PA 1OY9A 2MHNA 5BYQA 1IKXA 2V5HG 4I69A 2V2VA 2E5IA 4LMZA 2CRLA 2B9EA 1VRQC 1YIJS 2GAGC 3LH2S 2AEMA 4J7CA 2D69A 4J9SA 1UZHA 1CG2A 2F9DA 3NCQA 3DLEB 3TA0A 2CWXA 3DRSB 4O3NA 1SH3A 1RABB 5D15A 4NA3A 1REGX 2JJ4D 3HVAA 3MM5A 3EGNA 2AJ1A 1WHYA 1VQNS 1FNMA 1FWPA 4BCAA 5T41A 1H74A 3G86A 3CEDA 3X1LB 4QWBA 2ZD1B 4IOAQ 2BE2B 2J0QD 3CJSA 4FBUA 3AOBA 4P74A 2GW8A 1F3FA 2IMOA 3EPIA 3TYTA 1I6JA 4NLYA 3SYZA 3A8EA 1HLWA 4EO8A 1TZ0A 3D28A 3IAS9 4GO5X 4UT4A 3L95X 4OZ2A 2H51B 1RT3A 1SC6A 2HIYA 3GG1A 2RB7A 5F0WA 3DMJB 2DO4A 2MYFA 3DOLB 3J7A1 4DF4A 4Q45A 3CMQA 2VG6A 4ZCKA 1IBLJ 1LW2B 1G3OA 3S1TA 2ZHOA 4ELTA 1DTTA 4BC9A 5HMXA 2VQFF 1FDDA 1S6QA 2WW8A 1NK9A 1C1BB 3W9IA 2FDNA 4FKYA 2KT3A 3M2RB 4N7TA 1VQLS 1DFDA 6AT1B 1J2VA 1KBRA 2JFKA 1ZTWA 1X0FA 3OQ2A 1Q8LA 2DIVA 4FYDA 2ZE2A 3HHDA 1Y5NB 2AJ0A 2V9WA 2WRMA 4ZHRB 4WZQA 2EW9A 4IG0B 4LQ3A 4LF4J 1VQPS 1TKTA 1KLNA 1N5TA 2XNQA 2OP5A 4N5SA 2EG2A 2GHWA 1LFWA 4KO0B 1ZM3A 4PQUA 2E29A 4DFKA 3G6YA 3MAQA 3OHBA 3QAEA 1WI8A 4DR2J 3HCXA 4B3OB 2Q6BA 3PW4A 2ZUGA 2W7OA 2EC2A 4DQSA 5SUHA 4YB1P 4FYXB 4EBEA 4CLLA 5HANA 2CQ3A 4MJKA 4ZP8A 4ZIVA 2K1RB 2IM0A 1N5YB 4USHA 5JMNA 5LOQA 4K2JA 1MMLA 1YRTA 3J7Z5 2HFUA 4U96A 1S72S 1V3RA 5D0GA 1VCTA 1XERA 4ZPAA 4HTIA 4GKKF 1S57A 3MMCA 1KLMA 1YSJA 1VQMS 4K4VA 2LDIA 3DGPB 1Q78A 4RW9A 4LFBF 3IGVA 3VQSA 3TAQA 2RKIB 3ICLA 4PXDA 4CT9A 2PI5A 2O5DA 3KJNB 5EGYA 2LVWA 3QSIA 4Y2IA 4GVBA 3K89A 2XCPA 2WSCC 3A8JA 4DV7J 3T5KA 3OL9A 3DCAA 3QIPB 1OSCA 3POTB 1N5QA 4ZVFA 4IOCQ 5J2PA 3ZZYA 3ZTSA 4C11B 3OVAA 3SDEA 5T14A 1BWEA 4ZVOB 4DQQA 1IKYB 1N34J 2QA4G 3CCMS 4Q2MA 2XLKA 2KXNB 3HHLA 3K2YA 4W92B 2XO6A 4CLKA 1WHVA 2UUCJ 4K0KJ 1S0VA 5CCLA 5IV4A 2ALYB 5DGBA 1S1UA 4NL5A 1NPKA 2DISA 1V3ZA 3HZEA 3M8RA 4DLGA 4ZPDA 1NKEA 4I0WA 3GV8B 4M1KA 3MMAA 1KHWA 1ZPVA 2JLFA 2QLBB 1VJWA 4LUBA 2C2KB 2IMWP 1XJWB 4NXNF 4HI2A 2K3KA 3V81A 3G8TA 3FEZA 3DN9A 2EKNA 2NUUG 5F8LA 2KJWA 3MM8A 2FVQA 3ZZ0A 3R97A 3FUYA 2ZVIA 3FKBA 4DSEA 1XN9A 4FYWB 1S1XA 3IG1A 3KLIB 2GNKA 1ZM2A 1FXLA 1FKOB 3RJMB 4B9NA 5AXKA 2UU9J 4TXSA 2WVDA 4BC7A 1RBLA 3EUNA 2X3GA 4YHHF 2ZUAA 5AXLA 1A7GE 2JSXA 2MKIA 1LXJA 1W26A 3LWMA 3HVRA 3BSNA 2RS2A 2W7PA 1UJ5A 3CW2C 3H59A 5JXSA 2QC3A 4CQ1A 3LQVA 3MM9A 2CA9A 3R2CJ 3KJFB 2AGPA 1R8HA 4O3QA 4C97A 1UJ4A 4Q5VA 4K4SA 4G1QA 2JC0A 3W8GA 4MK8A 1RKJA 3DOKA 1FXRA 3AXMA 2ZH1A 4P10A 1JLFB 2FB0A 2JWNA 2J5AA 3UQSA 4OX9F 3W61A 4NMLA 4DR4J 3HD1A 4FVCA 2BJEA 3SV4A 1GT8A 8ATCB 2AU0A 3OFFA 1NHKL 3NGSA 5AJ3J 4IKAA 1TV6B 2HHSA 4WE1A 2PA3A 3DU5A 1DLOA 2Q66A 4AXIA 3KUHA 2C2NA 3C8YA 5F9NA 2QYCA 5MLCV 4K4XA 1PJ5A 4IFVB 3ELHA 4CLSA 2EFGA 4KGZB 4WBFA 4I7FB 2Y8WA 3PFOA 2NPFA 3AOAA 3ISND 1JWWA 2PT0A 1UWAA 3O1LA 2YX4A 4J9MA 5LXYA 2YBVA 3KJVA 1VGYA 4ED0A 2CQ0A 3MOZA 1U45A 2EKYA 2FUG9 4CO2A 4CT8A 4PEOA 1FA0A 4KB7A 1URRA 3AJ1A 2DXEA 3D0GE 3D9BA 4P2MA 2CNKB 2RD5C 4FF2A 3QT7A 3P5TL 1HARA 4DV1F 2ZOMA 3NG8A 3AJ2A 2H4WB 1T9YA 4QBUA 3WZ0A 4J9OA 4ZK7M 4CP5A 1SJ4P 4URGA 1YG0A 3JYTA 2RE1A 3GV7B 1S9FA 3KOAA 4PUOB 4OI4A 3D3BJ 4S0MA 2HRYA 1YZ6A 2YNIB 1Q8KA 2FGOA 3SCIE 5C2GA 4USVA 1NH8A 2XSFA 2DGWA 4I56A 4Y2CA 1M5HA 4AL6A 4YOEA 2AEJA 1IUJA 1EX8A 1MU2A 2HNZB 2Y1JA 2YKNB 4FVMA 2HWIA 1PYSB 4EUVA 3UNYA 1X9WA 1HPZA 4JI4F 4M5DA 5CYQB 1VQ7S 4WFAQ 2POKA 1URNA 3GQCA 2RAQA 2KI2A 3BKTA 1WHXA 4TNOA 4H4OA 1X5OA 2UXDF 4I1TA 2W2PP 1S6OA 4ZA1A 2V8GA 2HWHA 1RWNB 2G2YA 1RBAA 3PW0A 4P71A 2ASLA 2ZM6F 1CJTA 2U2FA 2F1FA 1PSDA 2ZNZA 3CF5Q 5DETA 3LF0A 2ZHBA 3ZZUA 1NM2A 1DHMA 3SQOP 3NGRA 3JSBA 4LFCF 2VG5B 2D3O1 1T9XA 1N33J 1DRZA 1SB6A 4K4WA
chains in the Genus database with same CATH topology
1HHSA 1QUPA 2OFHX 1P6TA 1SIZA 1Y7PA 4J5OA 2KZZA 1HI0P 1Y3JA 2D3OR 4YY3F 1OPZA 4K50A 4A8OA 1SV5A 2Z8QA 2GQ2A 2ALZA 2RH3A 3QGHA 4PR6A 2H9ZA 2J76E 3FVYA 2CJAA 5J2NB 1BY9A 3MWBA 4WFZA 4HH0A 4QIVA 5KFKA 2DD8S 2NPIA 5KAKA 2VG7A 4RW4B 5KFRA 5B0CA 2Y1RI 4B02A 2QMXA 2L9WA 4PG7A 4UW2A 3MHYA 4R25A 1EETB 1NU4A 1JJHA 1SJQA 5A8RB 3JYTB 2R7RA 3CUNA 3HJFA 3K59A 1C1CA 2XMMA 1D3WA 1GNKA 2J7WA 2O66A 3MZIA 4NLQA 3IR5B 4ITSA 2YKQA 2FC9A 4KHPF 1X4EA 1FDAA 2ZBCA 4LT6A 1UVKA 5M2RA 5B0DA 3M32A 4IQMA 2E7WA 2DITA 3LGNA 3LOUA 2LLZA 1IJEB 5KG4A 4C3MA 5K8OA 4CIOA 2WONB 2HQIA 4PG6A 2W24A 3SSQA 2CQIA 3C6UA 4DS5A 2YVSA 5I3PA 3N9UC 3TVYA 3CULA 2CQCA 1X9MA 4AE5A 1X7VA 3G8QA 4ECZA 2QZ8A 4DR7F 4G6VB 2HVIA 2QA1A 3HZGA 3H8YA 3GYNA 1RP5A 1WHWA 1GX6A 1RQ0A 2JC1A 3H5UA 3MM5B 4NCGB 3M8PB 2B6AB 4DMZA 2XC9A 3KHHA 4RW8A 2R8IA 3RRHA 5K8MA 4QWCA 1SBRA 1QJHA 1TFYA 1LQ9A 4Y2MA 4QW9A 4QPXA 1VK8A 2QMWA 3FSXA 1RT4B 4KSEB 5A6PA 2HAIA 4ECQA 2CPHA 2JVRA 2EWHA 1S6PA 4IFYB 2OPRB 4TU8A 2EC0A 5F41A 1MU2B 3KG1A 2JOQA 4FZVA 4RNOA 1S76D 3T9ZA 1N0UA 2VFSA 2CZVC 2DJWA 2MKJA 2O1PA 3EZ5A 4HYKA 3MUMP 2DHSA 1YJTA 2GGPA 1X5PA 2AX1A 4B08A 5L39A 1F5BA 3FQKA 1A6LA 1WI6A 4N41A 2J9CA 2KN4A 2HIQA 4QR0A 1HPZB 4NA1A 1CQNA 3S7RA 3CWJA 3DLHA 2YKAA 3T1AA 4B9MA 5JJBA 1Q7LB 4HH1A 4Y00A 1VQ5S 4RWWA 5GAEU 4C4WA 1D0EA 2KZMA 4A8WA 1RYRA 4ECYA 3V2UC 4C3KA 1H38A 4O3OA 3FJ2A 2BRKA 5JUMA 3MFIA 1SJ3P 4CCHA 4ID5A 1T8EA 4D3HA 3NWGA 2VPXB 3RBEA 4PPDA 3OTOF 4R5PA 4NLOA 2VD3A 2XG8A 5I3UA 3OLBA 2PFFB 4DN9A 2MHEA 4BS2A 2NREA 1RT3B 3IRWP 3DNCA 4OZ0A 5B0FA 2XCAA 1K8AT 2AP6A 3UI3A 2KYZA 1U1PA 5GAHU 2MQQA 2MKKA 3MR3A 2JH3A 1VBZA 1HQUA 4ATNA 2B3TB 2FJAB 4IRDA 4NPOA 4OFZA 5CYJA 1ZZNA 2DK2A 3CMAS 4DV7F 3TANA 1PC4A 4C8YA 1O5JA 1XTZA 1KHVA 2MZJA 3O2IA 1PO6A 2HFZA 2OFGX 5MAOA 2CPXA 2P6SA 2VL1A 5GAGU 1IBMF 3UFCX 2ZOFA 4CNYA 4KV8B 5DQHA 2DGTA 2DHAA 3BGRA 4MK7A 2DNHA 1FKPB 2KT5A 2ZKUA 1XR6A 2OD6A 3IO1A 3I96A 1S6QB 5AE3A 3Q24A 4CTAB 3BB5A 1M5KC 3CDBA 3R27A 1KN6A 1FRKA 3VZIA 1YJ9S 1N34F 4KR0B 3KFWX 2MGZB 1YJRA 1T94A 2RNEA 4DR5F 2X1BA 5LL6d 1W2BR 1X8DA 4ES2A 5LJ3Y 2DGOA 1UW4A 2VC1A 3RRKA 2RJZA 4XIUA 2KHDA 2ZH6A 2HHPA 3VAKA 2RUGA 3MM7A 3T6JA 2ZC3A 1ZOTA 4HEA9 2HWTA 4OX7A 3R1LA 2ASDA 1DZ5A 5CZXA 4IDKA 5GADI 1M5OC 4LF7F 1RI7A 2AYBA 4NYOA 5IS2A 1AFJA 4MFBB 4NYPA 2ZE2B 1MROA 2AV5A 3MGJA 1QSLA 3KMQA 5EN1A 1FD2A 3KNAA 5CD4H 3AA9A 3EXCX 3I82A 5EX3A 4ZCIA 2FC8A 1FJGF 3GILA 4OJGA 1NK0A 5L1LA 1TKTB 1YJVA 2W4PA 2ZITA 4OZLA 3S6EA 2M8DB 2ZZNA 1E6VA 1Q16B 2M2BA 4N76A 3K0JA 5KFZA 2VG7B 3OV7A 4K4ZA 3QYYA 1HHTP 4WYLA 4IR9A 3U1MA 3HLUA 1JLEB 3ETOA 4O4GA 2LEBA 4RKUC 1S1TA 1Y5LB 3IBWA 1OS5A 3FEXB 2RDJA 4G1IA 4ILRA 2I5JB 4X64F 1VIOA 1JXEA 3H98A 3K5PA 2MXYA 3X3UA 3ONQA 2HHTA 1HD0A 2QSWA 4K4TA 3OSNA 4PQUB 1KOHA 2VKRA 4OZ5A 3HK2A 2KM8B 3FZBA 4HDHA 4IOBA 2YKOA 1R6YA 3KG0A 5F8IA 2HS3A 2FHJD 4HDGA 4OLOA 4F3MA 1VLYA 2ROGA 4NA2A 1QE1A 3GMGA 4O4RA 4Q43A 1UP1A 2ATLA 2IA0A 2M4MA 2W8LA 5KG2A 3C3LA 4OJ1A 4JI2F 4LIWA 3PV8A 4KGMA 4HT7A 4I68A 3DLGB 1S9GB 3PHEA 1Q82T 4TY8A 4JV5F 3IFEA 5KFCA 2VA2A 2IAJA 2XEXA 4QU6A 3PM9A 4KBIA 4L72B 5K8PA 5A8KA 5GAHI 4IR1A 3FRZA 2DNYA 3MEEA 1X4CA 3ENVA 4DDFA 2R7WA 3HKZD 1KTVA 2UUWA 2ZKTA 4LVNP 1NJIT 4X4QA 3FEYB 1N88A 4IQXA 3DRPB 3IRXA 2R7VA 5D77A 5A8WA 3NNAA 4L6V3 4QPTA 2UU9F 1QSSA 4RLEA 4OJHA 4H4KA 4N47A 1TVRB 4ECTA 1RTIB 4A8MP 3IA0A 3LPYA 1JNRB 3DRYA 2B56A 5KFHA 4OV1A 4IH5A 3R5AA 2HRUA 1KQKA 1N56A 3IXQA 5HQ8A 3G6VA 4M94A 4A48A 4IRKA 1XC9A 2DHXA 2HPUA 2J0XA 3FNNA 4ID5B 4X4SA 3KHRA 1TL1A 3CC2S 3JAMY 1R7IA 3QJPA 5KG6A 5BJRA 3GG0A 1ROFA 3H40A 3CD6S 2CPDA 4R5PB 3MR6A 3MEGB 3MMCB 2MZRA 5I3UB 3D0HE 2IM1A 3KK1A 3JSMB 3MURP 1KLMB 4CO3A 1S1VB 2F8HA 1GXTA 2DPJA 3F41A 1NZAA 1UVJA 2BXJA 3CDAA 4RW9B 3RB4A 2P9GA 1SUQB 1LK7A 1HMVB 4RBUA 1WEYA 3JTOA 2O3DA 3M2VA 1RTHB 3TAMB 4EEYA 4F02A 2LCWA 4PPZA 4A46A 2K8GA 2IRXA 1QVGR 3DLLQ 3R5DA 3C46A 4J9QA 2DNQA 3M8QA 1NK5A 5C42B 3Q23A 1DQ8A 3P3DA 4QW8A 3V4MA 4DR4F 4K4YA 2WBMA 3QZ8A 2LQ9A 2KU7A 4HVZA 2J9DA 1HBMA 3VAHA 4I2PA 2OSRA 3CSKA 4DV2F 4DSIA 2R2UA 1SQEA 2RU3A 4ECRA 3THPA 2ASYA 3LP0B 1Q1KA 3D54A 4WU3A 1FRMA 3ZZOA 5HN0A 3K5NA 3RAXA 1J5OA 3MUVP 5J2PB 1X5TA 2FLLA 2XMJA 5EDWA 1U48A 4NCAA 1UFWA 2XHWA 3SDEB 2G4BA 3GYXB 3UCUP 1OWXA 2D74B 4USJC 3DLEA 1SIWB 4DFJA 4J9NA 3DRSA 2EBGA 3I0SA 4R8UB 1H2UX 2ZVSA 2MKSA 3N79A 4UUXA 3UR0A 3I5CA 2YWFA 4BWJA 4NZ0A 3CJKA 5E33A 3T19A 2ILYA 3QWUA 1M90T 4C0OC 4J9RA 2E5JA 2IBOA 1O0PA 1QLNA 1IKWA 2JZ5A 4I2QB 3D1QA 3HHLB 1I94F 3L7PA 2CFXA 3G96A 3M9MB 2E9ZA 1TUVA 3AAWB 1LFPA 1K0VA 1FHTA 2B51A 4KKOB 1AFIA 5E3CA 3CD0A 1S1UB 2DGUA 4FBTA 2DNNA 3OJUA 1WACA 2JEJA 2MZ1A 3DLKA 4WXWA 3ZC4A 1VQ4S 5B08A 2ZD1A 2WAQD 3B4DA 4KAIA 2BE2A 3RR8A 2PIIA 3KKFA 3MMJA 2KM8C 1DURA 2FGCA 2IRUA 3N5BA 3MMAB 4X4RA 4A8SA 2D3ZA 3AH6A 2JDJA 3TUJC 2E44A