4IUKA

Crystal structure of nrea of staphylococcus carnosus with bound nitrate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
143
structure length
143
Chain Sequence
FDYQDALDEIRETEKFDFAAIALPEDGLHSAVIKWKYASGNINYRYRMIVLRPGKGLAGLVIRTGSRKIVEDVDAELSQNDKLGYPIVLSEALTAMVAIPLWKNNRVYGALLLGQREGRPLPEGSTTFRINQRLGSFTDEINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NreA Protein Functions as a Nitrate Receptor in the Staphylococcal Nitrate Regulation System.
pubmed doi rcsb
molecule keywords NreA protein
source organism Staphylococcus carnosus subsp. carnosus
molecule tags Nitrate-binding protein
total genus 33
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4iukA00
2W3GA 4LRXC 4EUVA 3S7NA 1VHMA 4ZRRA 5I5LA 1MKMA 4O01A 2K31A 2KLIA 2W3DA 2LB5A 3MF0A 4Q0HA 4G3VA 2XRNA 3DBAA 5HPFA 2ZMFA 4ETZA 1TD5A 4GLQA 3W2ZA 3S7OA 4O8GA 2O0YA 3OBFA 2XROA 3IBRA 3E98A 4R70A 1F5MA 4YOFA 2O99A 3TRCA 2O9BA 1YSPA 2Y79A 5HSQA 4QPRA 3LFVA 3KSIA 2O9CA 3E0YA 2VJWA 3KSGA 4FOFA 1TF1A 2G7UA 5C5KA 4ME4A 5AJGA 2LB9A 4BWIA 4LRZE 3OOVA 3S7QA 3NOTC 4YNRA 2VZWA 5LBRA 2QYBA 4G3WA 4Z1WA 2M7UA 3RFBA 4IUKA 5DFXA 5K5BA 1STZA 1MC0A 2VKSA 2W3HA 2M7VA 4DMZA 2O9AA 4E04A 4EU0A 1YKDA 3CI6A 3ZQ5A 4ETXA 2W1TA 1YSQA 4DN0A 4R6LA 3BJNA 1ZTUA 2GX5A 3NHQA 3NOUC 3MMHA 3MQ0A 2W1TB 4Y2FA 3CITA 2XSSA 4O0PA 2B18A 3KO6A 3KSFA 2W3FA 3VV4A 2OOLA 5DFYA 5L8MA 3S7PA 3EEAA 3D3OA 4Q0JA 4PAUA 3G6OA 5HL6A 2HGVA 2K2NA 2VEAA 5HPIA 3IBJA 4GW9A 3KSHA 3K2NA 4MN7A 3R4KA 2Y8HA 2W1RA 3C2WA 5TJJA 4MMNA 2KOIA 4G3KA 4RQ9A 4LRYC 2IA2A 4MCWA 4MDZA 3NOPC 4Y5FA 4CQHA 2W3EA 4IJGA 4IUHA 4Y3IA 3O5YA 3HCYA 4Q0IA
chains in the Genus database with same CATH superfamily
1DJBA 4KZBA 1ZG6A 4BL2A 4ZRRA 2EX2A 4GDNA 5KSHA 2K31A 2D02A 2MJ6A 4S2IA 3LGOA 2Y59A 1NZUA 3LO7A 5HPFA 1YLTA 4EBLA 5A91A 2WKHA 4QJGA 1ES2A 2ZBBA 4R4RA 2C5WB 2J8YA 5CGWA 4FTXA 3CAXA 2DNSA 1SZVA 1LI9A 3QP5A 1TS0A 2I9VA 2PU2A 2G2WA 2VGLS 3IF6A 4NG2A 3V67A 2PYRA 1CQAA 3H82A 2GZAA 4DXCA 4BBUA 3OOVA 1YLZA 1M6KA 1PWCA 2WGWB 2XK1A 4Z9QA 1W63M 1L0EA 4A5RA 2Y2NA 3NBLA 1E3UA 3UDFA 1YAXA 3E2KA 5DTTA 2RCXA 2QMIA 3T1XA 5GLBA 3CPTA 2PBDP 2JKRI 3DW0A 2EX8A 3EEAA 5DKLA 5DF9A 5HD3A 3PBOA 5EUAA 2OAP1 3G31A 3HUMA 2V1AA 3LR3A 1K57A 3ISGA 1K54C 2WKPA 5CERA 2ZC7A 1P97A 3C38A 1KGEA 1UGUA 3W4PA 4BQMA 4RX2A 1LSVA 5FQMA 3E4OA 1HTZA 4JF5A 3SS3A 1OJGA 4PM6A 2Z2LB 4BD0A 3S7NA 1VHMA 3T4JA 4K0XA 1MKMA 2WKIA 2WKRA 2H10A 4FUWA 3LY4A 3S4XA 3LR5A 2ZMFA 5FQIA 3FC7A 2JE5A 5GHZA 3BFEA 3L7HA 3PBNA 1MXOA 1G6OA 1D1JA 4Q8IA 4LV3A 4WZ5A 4IHQA 2A49A 3SW1A 2O9CA 1PI4A 1TF1A 1XJ4A 2LB9A 2XF3A 2Z6CA 3BFCA 3GRJA 3HLWA 1DJAA 4QY6A 1ERMA 4G3WA 3HLDA 3BYDA 4Y13A 3QHYA 1S4RA 4ZBEA 3O86A 3G35A 1NRJA 2V1ZA 1W5DA 4DKIA 3PYPA 4ZJ2A 4O7DA 1Q2QA 2XSSA 2B18A 1Q2PA 1PYYA 3LR0A 4UA6A 2V1BA 2VV7A 4HH3A 4FH2A 1V9ZA 3QP6A 2W27A 3RXWA 4AFIA 2XFTA 4I39A 3H7WB 4R0QA 3ZVTA 4MDZA 3IXDA 3UE1A 1EROA 2XQZA 2DRWA 4PM5A 1NRFA 3T4TA 3MF0A 3OPLA 3WRZA 3FPVA 4DF6A 1NJ4A 3GECA 3WS2A 3PHYA 1CEGA 1XA7A 1XFNA 2ZC6B 3BM6A 3CHWP 5F82A 1H0MA 2BG1A 4BBVA 3C7UA 3OPPA 1TDLA 1PZOA 1S0WA 5A90A 4R70A 1DP6A 3NECA 2FZ0A 4LV2A 5EPHA 3V3SA 2QWSA 3T1SA 4WELA 5FQ9A 1CI8A 2UV0E 2ZMAA 3A0SA 3KYQA 4OLGA 3MQQA 1Z6FA 3ZNTA 3ZNYA 2XDMA 5FI7A 4E3KA 1EW0A 3D9YA 1XXMA 2ZC3B 4S2NC 4E04A 3CI6A 5E2HA 1LLBA 1XPBA 5EVIB 2H0YA 1LT0A 4X68A 4IEDA 1MWUA 2L4RA 5CHJA 5D3OA 3DTIA 3T4LA 5EOEA 2VEAA 1FOFA 1MY8A 2R9WA 1XP4A 1Y54A 3KSHA 4IVKA 4NEED 1J3WA 4XT2B 1L3LA 4EBPA 3FV7A 2W1RA 1YLJA 5F5YA 3N8RA 5CEBA 5FASA 3CMZA 4P6BA 5EVID 1SDEA 2J9OA 4PMAA 3CZDA 5L2FA 3CUEC 3PBRA 1Z09A 3HLFA 5E43A 4RA7A 4LLOB 4UQIS 4KZ3A 1JTDA 1LSXA 4H6JB 3K3CA 2B95A 2WGWA 3DBAA 4NK3A 2VV6A 4FCFA 2EA9A 3PBQA 2EXAA 4WEKA 1NY0A 3TW8A 2ZQ7A 4OLDA 5CHMA 2XR0A 3HLCA 4YFMA 1W7FA 4EUZA 4GHIB 1ZG4A 1RCJA 2O99A 5GLCA 2V8FA 5CTNA 3P7NA 1KE4A 4JXSA 4LENA 4EEUA 3IWQA 3MZDA 3HL9A 5HDCA 1ES5A 4MBHA 4HY8A 1N9BA 3O87A 3CJMA 1GHIA 1VETB 3EWKA 4JKTA 2W1TA 4R6LA 3HJKA 1ZTUA 2DMWA 3VP4A 4M4XA 3V3RA 5EVEA 3UPPA 2P9VB 5EE8A 2XA7M 3DAVA 4CLCB 2P08A 3ZCZA 3SZTA 3ZDJA 2QZ6A 3GR2A 4ARZA 4S2MA 3BQ8A 2X01A 3UE0A 3LCEA 4MMNA 1XGIA 4LRYC 3FYZA 1ESIA 4F3LA 3O5YA 3PAGA 2ZC5B 2V20A 3VSKA 5FDHA 5EM0A 5I5LA 1BULA 1RP5A 4CLCD 2HJEA 1SDNA 4OQHA 3IX4A 3B3XA 5FAQA 2V0UA 5IHVA 4BL3A 2KDKA 5FEGA 1DP9A 4R4SA 3NDEA 1IEMA 5FI2A 3TRCA 3B47A 5IS1A 1YSPA 4S2OA 4HBTA 4XXRA 1H3QA 4PKYA 5LBRA 3NC8A 2V0WA 3WS5A 4UQIM 1BUEA 3PAEA 4D2OA 4P6ZS 4NXBA 4WEJA 1S4SA 4N92A 3IXHA 3QP8A 2GX5A 1AWIA 3DTKA 5AQAA 1CEFA 3G30A 1O07A 1XJ2A 1N9OA 3JPUA 5DFYA 3P09A 3N8LA 1ESUA 4E3MA 1BTLA 3BW6A 3UB6A 2KOIA 5JYOA 1UWPX 4MN6A 4UA9A 3ZG5A 3HVFA 1LL5A 4MEZA 5GLAA 2L0WA 3T50A 1YLWA 1NWZA 4BLMA 2HP9A 3F1PA 2A2LA 3ULFA 3G32A 1YLYA 4E3IA 4IBRA 1WA9A 3FZCA 1L0FA 1P9RA 1T19A 2ZQAA 3RJUA 3B33A 5F1GA 5TBMB 2IWBA 3UDIA 5HFOA 4ZAMA 4MN5A 3BLMA 2Y55A 1PNEA 1WYCA 3O88A 2G7UA 4GKUA 4BWIA 1DRMA 4YNRA 4Z1WA 4F94A 3A3FA 2QPNA 4K08A 1VEUB 1IKIA 2JKRM 3M2JA 4UAAA 4L9GA 5A92A 2QJ7A 3ZG9B 5J3WA 1IYQA 3CUEA 2OLUA 2IWCA 4GS9A 1MBLA 3KSFA 3IT9A 4I3AA 1QMFA 4Q0JA 5HL6A 2Z6DA 4II7A 3PTEA 1OTAA 1TS7A 2CC1A 2IWDA 4OQGA 4DDYA 3UDXA 5CHUA 2Y8HA 1ZHHB 5TJJA 3SOIA 1F2KA 1GHPA 4P6ZM 2IA2A 3EGXC 4OONA 1G28A 3BRMA 3DWZA 3MXQA 1CJFA 1YT4A 4R3JA 3QNBA 3VFFA 2W3DA 5HD5A 2GDNA 3LUQA 3IF5A 3NULA 1W79A 1BYWA 3RH8B 4HEFA 3T4QA 4R1GA 3C4OA 3MFDA 2EXBA 3MZEA 1MWTA 1T1BA 4ID4A 5HSQA 1K4FA 4WMCA 3QNCA 2VJWA 1FILA 2EWWA 5C5KA 2Y2JA 2WYXA 2Y2MA 3EOIA 4WUJA 4OVDA 3CG5A 3S7QA 5CGXA 3C8CA 4JLFA 1H8MA 4IVIA 1OMEA 5CRFA 5G4YA 2EX6A 4OOYA 4HJ4A 3ZQ5A 4WL9A 3ZG8B 3F1NB 4EQIA 3UE6A 3TG9A 5KMWA 3HJIA 5FI6A 4EXOA 2Y2GA 3D3OA 3SH8A 2K2NA 3Q7VB 2H0TA 3CWFA 1MPLA 2XFSA 1IYOA 5M1AA 2PBYA 1PRQA 2XH9A 3R7WB 5E2EA 4PKYG 5J4EA 3R4KA 4FSFA 2PD8A 4KUKA 4EETB 1WE4A 2J80A 4U3TA 3I7JA 4RYEA 3UNWA 3C5AA 3HCYA 4OQ0A 1JWZA 3UY6A 3WS4A 1K38A 2P74A 3UE3A 3MQOA 3IS2A 3SS4A 3Q82A 2ZL1B 4EWFA 3T4SA 3NCKA 3VE3A 3V5MA 4HP9A 4XUZA 3WRTA 1S1YA 3KYEA 5FDSA 4OH0A 3UN7A 1SKOA 1GSVA 3DWKA 1LHYA 2Y79A 1XJ6A 3P01A 1KVMA 4GOGA 1ACFA 3UB9A 1YLPA 5HWWA 3VOLA 4U0TA 2W0NA 4YWZA 4B9OA 3IH8A 1ES3A 3ZVWA 5AQBA 4X69A 2A24B 1F98A 2CMNA 3FG8A 2JKGA 2J9PA 3AGEA 2PDRA 4GCZA 4HESA 3GDIA 3W8KA 2PHYA 2XA7S 4D60A 3A3IA 2EFXA 3ZFZA 3MR0A 3PBSA 4JXVA 2JC7A 1KDWA 2FFYA 3G2YA 1QMEA 2Y2IA 3Q7ZA 3ZG7B 3M6BA 4PAUA 5EM1A 5EVIC 3IBJA 4UA7A 1HVBA 5BOHA 3QP2A 3GTCA 1G68A 4S2PA 1S6RA 1ONGA 3IWIA 5EV0A 5TR7A 3LIFA 3NOPC 1JVJA 3BWLA 3E4PA 3C7VA 2NUPC 3N8SA 2H5SA 4HI4A 2B5RA 1XA1A 3GVBA 3MJQA 2KLIA 3P98A 1IYSA 2LB5A 3HUNA 4CPKA 1IKGA 1ZC2A 2PT7A 4DE0A 3IHAA 1H8YA 2EFUA 4E3JA 1K56D 3S22A 3FPWA 1TD5A 1SHVA 2Y2OA 3BY8A 3ITBA 1GHMA 3LIDA 4WBGA 1F5MA 2WZXA 3KSIA 4FOFA 3FKVA 2JKFA 4RVAA 5E2FA 2I72A 4GJ4A 4B4ZA 4BMWA 3IF6B 4CLCE 2Y4AA 4QU3A 4X1MA 1S67L 3H82B 1FR1A 5K5BA 5EFWA 2OWJA 4JGRA 2M7VA 2HJ9C 4HOIA 3NI9A 2WUQA 4FH4A 1HLUP 3NHQA 1A0KA 2XLNA 3MMHA 4LFUA 4DRTA 4GD6A 3ITAA 4RX3A 1IYPA 4DE1A 3Q1FA 2W3FA 1DJCA 4MBFA 5FEFA 1BLHA 1Y4OA 5U47A 3CPTB 2PRFA 3MXSA 5KSCA 2ZQDA 1MZUA 5HAIA 1M40A 4GW9A 5F83A 1K0KA 1GCEA 2WZZA 1G6AA 4M3KA 3MKFA 4MBKA 4MCWA 4CLCC 3LIAA 4Y3IA 1E3UD 4OOMA 4EBNA 2Q0OA 3A3JA 3LR4A 4OP8A 3EEHA 4N9LA 3HUOA 4KZ6A 4KQDA 4O01A 3OPHA 4Q0HA 1CK3A 3VE4A 5L09A 3AGDA 4X55A 4MNRA 1NLZA 1BZAA 4GZBA 1XX2A 2P04A 4JGPA 1VM1A 3F1NA 3CLOA 2R78A 3IBRA 4I38A 1VB6A 1ERQA 1PW8A 3U4LP 1NYMA 4KQOA 2H28A 4B93A 1FSYA 5TGFA 2J3TD 4LRZE 3W4OA 3NOTC 3N6IA 5HDSA 1P0ZA 1FCMA 5CX7A 3W4QA 1STZA 1FR6A 1XFQA 2VGJA 1JWPA 3SH9A 2NUTC 3TE8A 3Q81A 4BD1A 4OPRA 3M2KA 4NXFA 3D72A 1BLCA 3T1QB 3IXGA 1D7EA 2ZJ9A 4JPMA 4KG2A 2HPBA 2QJ5A 5F68A 1LL8A 4EEPA 2V2FF 4PM7A 2ZL1A 4QWOA 2JN7A 5GHXA 5HPIA 1SCWA 1H5XA 1RGZA 3FWLA 3VOZA 4MN7A 3H7WA 1EI5A 1GA0A 3GV9A 3C4PA 1WYBA 5HAPA 4KZ4A 2FFFB 5DKKA 3OCLA 2QHKA 1MWRA 4NKPA 3OZHA 5HAQA 4WYYA 4QD4A 4LRXC 2ZOHA 1F9IA 3M6HA 1JWVA 2GNXA 2J7VA 1GSWA 2GJ3A 2XRNA 1W8QA 4JBFA 1X0OA 5M19A 4GLQA 3GSGA 3S7OA 4O8GA 5M18A 4L0LA 4L9FA 2O0YA 2PD7A 1CI9A 5DF7A 2INWA 3QP1A 5EECA 4E3OA 1JTGA 3E0YA 3DTMA 4S2KA 3VP2A 2ZQ8A 5AJGA 5A93A 3T12B 3HLEA 2BLSA 5FL3A 4KQQA 3OC2A 1PZPA 3K3DA 2M7UA 2ZM0A 3G4PA 4HJ6A 4QY5A 1E4DA 4WLAA 5EVIA 1OPXA 5F69A 3LIEA 5FSRA 3C30A 4EU0A 4ETXA 4KENB 5L07A 3F1OB 4HBUA 2VV8A 4LCMA 3MQ0A 2Y2QA 4O0PA 3ICYA 2OOLA 4DJ3A 1S1ZA 4LPZA 4HNBA 4KZ8A 3G6OA 4Y0TA 1FSWA 4XT2A 4C3QA 2E8JA 1YPRA 2HF6A 4GDBA 1K55C 1RGYA 3K2NA 5FAPA 4E6XA 3LEZA 1LI0A 3QP4A 2XEPA 4ZDXA 5F1FA 4Y5FA 4CQHA 5JYPA 1I2SA 3UMEA 3KX0X 5FA7A 5HDDA 1IELA 1L0GA 1LL9A 4H6JA 4KG5A 4JF4A 3LICA 5EVLA 2E8IA 3FKWA 5DJTA 3VSLA 5TFQA 3A0RA 3MKEA 4R23A 1ALQA 1PWGA 3E4QA 3TJZC 1YMSA 2OAQ1 4GHIA 2XROA 3EQUA 4JGOA 1OT9A 2PR6A 3OLOA 3T1RA 3DTEA 2RL3A 2WAFA 2Y2HA 1ES4A 2O9BA 3LFVA 4JF6A 1PIOA 4YINA 4WZ4A 1OTDA 1H8ZA 3IX3A 4EQ1A 3LI8A 1PI5A 3OPRA 4ME4A 3VP1A 2HZ5A 4KUOA 2QKPA 2G2UA 4I5SA 2QYBA 1VETA 3UB5P 3NY4A 3N4IA 5DFXA 1AXBA 3GMWA 4Y0UA 1UWNX 3G2ZA 3Q07A 2HDQA 3N7WA 1T18A 3A3EA 2J3WA 2P9VA 1NYYA 3HREA 4CLCA 2W1TB 3MZFA 1D06A 3PBTA 1HD8A 1N9NA 3AGFA 4WN5A 4KZ7A 1XGJA 5EOOA 1MKIA 5HW3A 3SS5A 4OPYA 1XKZA 3C2WA 2VA0A 4ARZB 4G3KA 3RTYA 2XGNA 4MLLA 5GL9A 3JYIA 4PHTA 1K6RA 4X1LA 3VP0A 3NIAA 4L9EA 4F3LB 4LGWA 2XD5A 4NETA 4H8RA 5DTSA 4R38A 1YM1A 3BLSA 4C6YA 3S1YA 4ETZA 1KDSA 3UO9A 2YKHA 3W2ZA 3NDGA 3GQZA 2V8CA 4DXBA 1PWDA 1EWZA 3IWOA 4GN2A 4UEYA 4YOFA 1MWSA 2HP6A 2HDRA 3BQAA 2JKTM 2A3UA 4S2LA 3LEQA 2FH5A 1O7EA 3IHBA 3E2LA 3LIBA 3BEBA 1IFQA 3LI9A 3UB7A 1FCNA 4HQAA 2Y2LA 3H9WA 4X6TA 2PR5A 4IUKA 2VGLM 4DE3A 1K25A 2PYPA 1ODVA 4DN0A 2HDUA 4OQIA 1HZOA 4OP5A 3NOUC 5HL1A 5J8XA 2V9AA 1U60A 3CITA 3KO6A 3KYZA 3ZHHA 4X25A 3IXBA 2K7SA 5L8MA 4UHUA 3NJAA 2EX9A 5FATA 5AVFA 2JKTI 4NXGA 1OTEA 1JNUA 2BTFP 1TS6A 5CTMA 4R3BA 1YQSA 4FD8A 2ZMVA 4DDSA 4Y15A 1S66L 1KGFA 1DP8A 4KG6A 2OWHA 5CEDA 2OSUA 4LCLA 4GNUA 4Q0IA 5F6AA 2W3GA 4EESA 4N9KA 4C75A 1VQQA 4PPRA 4Y17A 2JCHA 4HH2A 3EQVA 3O3VA 3BY9A 5AQ9A 1T1CA 1PFLA 4ZJ3A 4U0XA 4G3VA 2OLVA 5IT5A 2ZQ9A 5TBMA 3F1PB 2XD1A 4N1XA 3HLGA 4HP4A 5FQQA 1J9MA 2X02A 3HBRA 4EERA 3F1OA 4HIAA 5J7EA 5I94A 2PU4A 3VP3A 4I3IA 4JXWA 3MSHA 1N4OA 2WAEA 3BFDA 2ZLYA 4P0MA 1I5QA 1ZKJA 2WKQA 1CF0A 3RXXA 4OPZA 2WGVA 4WM9A 2ZC4B 1VEUA 1PW1A 3JVUA 3ZYTA 2KX6A 1MC0A 2VKSA 2YKFA 4KQRA 1K55A 4DMZA 1YKDA 4BBTA 2BASA 1FQGA 2EWVA 4GD8A 3WS0A 4Y0OA 1ONHA 3T4KA 3IF6C 3B42A 1FIKA 1IOUA 5GHYA 2C6WB 2JHEA 5DVAA 1KE3A 3LYXA 5CXWA 4E6WA 2VGKA 4GS9B 1W8YA 5HWTA 1V9YA 5KZHA 1TVFA 4ESPA 5AVEA 3WWXA 5AQ7A 3PXPA 5FQJA 4P87A 3VFHA 4XUXA 3IX8A 3G34A 5KIZA 4KZ9A 4S2JA 4NXEA 4QB8A 1NXYA 3L9KA 4EUVA 2Y2KA 5CECA 1BSGA 3WS1A 4LV0A 1K57C 4LV1A 4WF0A 1L0DA 5GLDA 2ZD8A 1P9WA 5HX9A 3T4OA 4I3JA 2HP5A 2X71A 1K54A 1N9LA 2P7JA 1OJ5A 3E98A 4BENA 2J3TC 2R9XA 4ZJ1A 2Q9NA 2WK0A 2WGIA 1LSWA 3KSGA 4GB7A 4K0WA 3MXRA 3PR6A 5DTKA 2Q9MA 3UB8A 4B88A 4EV4A 1T1AA 2ZM8A 5A8BA 5HZHA 2VZWA 3RFBA 2M1CA 4BJPA 4KZAA 3U2AA 3BFFA 4PM8A 1TS8A 3VMAA 3HLBA 4WZ5C 3V50A 3UPNA 3OCNA 1OTIA 5FAOA 4X56A 3MS6A 1KGGA 3Q7VA 2L1MA 5L10A 4PM9A 5DJUA 1GSXA 3S7PA 4E3NA 5MC7A 1BLPA 5HWVA 2HV1A 2JBFA 2HGVA 3EGDC 3R7WA 3A3DA 4WMCD 2UWXA 4OOLA 1OTBA 5G18A 3SH7A 2VK3A 1NZOA 4Y7PA 2VLGA 3MBZA 4X53A 3JVVA 3TOIA 3ZGAB 4IJGA 4P85A 3IQAA 4CJNA 2ACGA 4HJ3A 4DJ2A 2Z2MB 4EW7A 1FCOA 1Y28A 1K4EA 1YMXA 1G5UA 2WADA 1K6SA 1L2SA 1NLYA 3IS2B 3D4FA 1OT6A 2AVXA 4IBXA 5G4ZA 3IH9A 3MFXA 5CGSA 4R3AA 4QHCA 3OBFA 5DF8A 4OPQA 2PAVP 4K91A 3ZG0A 1E25A 1W63Q 5HARA 4JGQA 1SKFA 5E2GA 5FQKA 4QPRA 2Y91A 1SKOB 3UPOA 2B02A 2A24A 1BLSA 1BT5A 2ZQCA 1KVLA 3TSGA 3V39A 2OV5A 4ZTKA 4E3LA 2W3HA 3LY3A 5IU1A 2O9AA 2WKEA 4N1HA 1XJ3A 1YSQA 3VOYA 3BJNA 2Y2PA 1KOUA 2HDSA 1C3BA 2DCFA 4Y2FA 3BFGA 4OKPA 4DE2A 3VV4A 2VX8A 1K56A 4JXGA 4KZ5A 1I2WA 3A0VA 2ZOIA 4HHDA 4RQ9A 4B4XA 2ZM2A 3UMDA 1KE0A 1TDGA 4S2NA 3BECA 1DY6A 2W3EA 4IUHA 1TEMA 2D01A 1GA9A
chains in the Genus database with same CATH topology
4L9EA 4F3LB 4HI4A 4ZRRA 5I5LA 4CLCD 3MJQA 5KSHA 2K31A 2HJEA 2D02A 2KLIA 2MJ6A 2LB5A 4R38A 2PT7A 5HPFA 4ETZA 3FPWA 1TD5A 2YKHA 3W2ZA 2ZBBA 2V0UA 3BY8A 2KDKA 3LIDA 1DP9A 3CAXA 4UEYA 1F5MA 4YOFA 3TRCA 1TS0A 3B47A 5IS1A 2I9VA 1YSPA 3BQAA 2JKTM 3KSIA 2VGLS 2FH5A 4FOFA 3V67A 2PYRA 3H82A 2GZAA 3LIBA 3LI9A 1IFQA 3OOVA 4GJ4A 4BBUA 3UB7A 4BMWA 1H3QA 4CLCE 4PKYA 5LBRA 4HQAA 3H9WA 2V0WA 1S67L 4UQIM 2PR5A 1W63M 3H82B 4IUKA 5K5BA 4P6ZS 2VGLM 5EFWA 2PYPA 2OWJA 1ODVA 4JGRA 4NXBA 4WEJA 2M7VA 2HJ9C 4HOIA 1S4SA 1YAXA 4DN0A 2GX5A 3NHQA 3NOUC 3MMHA 2V9AA 3CITA 3KO6A 1XJ2A 2W3FA 2JKRI 1N9OA 3KYZA 2K7SA 5DFYA 5L8MA 3NJAA 3EEAA 5DKLA 5AVFA 5DF9A 5HD3A 2JKTI 3PBOA 4NXGA 1OTEA 2OAP1 2V1AA 3LR3A 1JNUA 1MZUA 4GW9A 2WKPA 1TS6A 3BW6A 1P97A 2ZMVA 3C38A 1UGUA 1S66L 1LSVA 3UB6A 1DP8A 2KOIA 3E4OA 2OWHA 1UWPX 4MCWA 4MN6A 4CLCC 3LIAA 4Y3IA 4OOMA 1OJGA 4Q0IA 5F6AA 2W3GA 2L0WA 3LR4A 4EESA 3T50A 3S7NA 1VHMA 3EEHA 3T4JA 4KQDA 1MKMA 1NWZA 4O01A 4HH2A 3F1PA 3EQVA 2WKRA 2A2LA 3BY9A 3ULFA 4Q0HA 1T1CA 4G3VA 3VE4A 1WA9A 5IT5A 5TBMA 3F1PB 1P9RA 1NLZA 3LR5A 2ZMFA 1T19A 3FC7A 2P04A 4JGPA 4HP4A 3B33A 5TBMB 4EERA 3F1OA 4HIAA 3F1NA 5J7EA 3CLOA 3PBNA 2R78A 3IBRA 4I38A 4MN5A 1VB6A 4I3IA 1G6OA 4IHQA 3SW1A 2O9CA 2WKQA 4KQOA 2H28A 4B93A 1TF1A 2G7UA 1XJ4A 2J3TD 2LB9A 4BWIA 4LRZE 2Z6CA 1DRMA 3NOTC 4YNRA 5HDSA 3JVUA 1P0ZA 4G3WA 4Z1WA 3ZYTA 5CX7A 1STZA 2KX6A 1MC0A 1XFQA 1S4RA 2VKSA 2YKFA 4K08A 4DMZA 1YKDA 4BBTA 2NUTC 1NRJA 3TE8A 2JKRM 4L9GA 2BASA 2EWVA 2QJ7A 4NXFA 3D72A 3PYPA 5J3WA 3CUEA 1D7EA 3T4KA 3B42A 2XSSA 2B18A 3KSFA 4GS9A 4I3AA 1IOUA 2QJ5A 2JHEA 5F68A 1LL8A 4EEPA 3LYXA 4Q0JA 5HL6A 2Z6DA 3LR0A 4GS9B 4II7A 2V1BA 5HWTA 2JN7A 1OTAA 2VV7A 4HH3A 5HPIA 1V9YA 1TS7A 1V9ZA 2W27A 4MN7A 3H7WA 4AFIA 4I39A 5AVEA 2Y8HA 1ZHHB 5TJJA 3PXPA 4P6ZM 3H7WB 2IA2A 4MDZA 5DKKA 3EGXC 3OCLA 2QHKA 1G28A 5KIZA 4NKPA 3MXQA 4NXEA 4LRXC 4EUVA 2ZOHA 1F9IA 3T4TA 2GNXA 2W3DA 3MF0A 1GSWA 5HD5A 2GJ3A 2XRNA 3FPVA 4WF0A 3LUQA 3GECA 3PHYA 1P9WA 1X0OA 1BYWA 1XFNA 4GLQA 3RH8B 3T4OA 4I3JA 3S7OA 4O8GA 4L0LA 4BBVA 1N9LA 3T4QA 4L9FA 2O0YA 2P7JA 1OJ5A 3E98A 4R70A 1DP6A 2PD7A 2FZ0A 2J3TC 1T1BA 2INWA 2QWSA 5HSQA 4WELA 1LSWA 3E0YA 3KSGA 2VJWA 2EWWA 3A0SA 5C5KA 3PR6A 3KYQA 5AJGA 3UB8A 3EOIA 4WUJA 5FL3A 3MQQA 1T1AA 3S7QA 5A8BA 5HZHA 2VZWA 3OC2A 3C8CA 3K3DA 2M7UA 2M1CA 3RFBA 1EW0A 1H8MA 4HJ6A 4WLAA 4BJPA 1OPXA 5F69A 5G4YA 3LIEA 3U2AA 3C30A 4HJ4A 4E04A 4EU0A 3CI6A 3ZQ5A 4ETXA 4WL9A 3F1OB 1TS8A 3F1NB 1LT0A 2VV8A 2L4RA 3MQ0A 3OCNA 3UE6A 1OTIA 3HJIA 4O0PA 3ICYA 2L1MA 2OOLA 4EXOA 4DJ3A 5DJUA 1GSXA 3S7PA 5MC7A 1S1ZA 4LPZA 5HWVA 3D3OA 2HV1A 4HNBA 3G6OA 2HGVA 3EGDC 3R7WA 3T4LA 2K2NA 3CWFA 4XT2A 2VEAA 4OOLA 1OTBA 3KSHA 4NEED 2HF6A 3R7WB 3K2NA 4XT2B 4PKYG 5J4EA 3R4KA 4FSFA 2W1RA 2PD8A 4KUKA 5F5YA 4EETB 2J80A 2VLGA 3JVVA 4Y5FA 4CQHA 3CUEC 3PBRA 4IJGA 3HCYA 3UMEA 3KX0X 4HJ3A 5HDDA 4DJ2A 4EW7A 4H6JA 1Y28A 3UE3A 4LLOB 4UQIS 3MQOA 3IS2A 3LICA 5DJTA 3A0RA 1LSXA 4H6JB 3K3CA 3T4SA 3DBAA 2VV6A 1NLYA 2EA9A 3IS2B 3VE3A 3PBQA 3E4QA 1OT6A 3TJZC 4HP9A 4WEKA 5G4ZA 2OAQ1 4GHIA 1S1YA 3MFXA 3TW8A 4R3AA 3OBFA 2XROA 3EQUA 4JGOA 1OT9A 2PR6A 3OLOA 1GSVA 4GHIB 1W63Q 4JGQA 2O99A 2O9BA 2Y79A 1XJ6A 3LFVA 3P01A 3P7NA 4QPRA 3UB9A 5HWWA 1OTDA 2B02A 3VOLA 2W0NA 4EQ1A 4YWZA 2A24A 3LI8A 4ME4A 4B9OA 4EEUA 4KUOA 2QKPA 4I5SA 2A24B 2QYBA 1F98A 2CMNA 3FG8A 5HDCA 5DFXA 4HY8A 2PDRA 2W3HA 1UWNX 4GCZA 5IU1A 2O9AA 3GDIA 2PHYA 1XJ3A 2XA7S 3EWKA 2W1TA 1YSQA 1T18A 4R6LA 3HJKA 3BJNA 1ZTUA 2DMWA 3MR0A 2J3WA 3PBSA 1KOUA 4M4XA 4CLCA 2W1TB 4Y2FA 1D06A 3PBTA 3VV4A 2VX8A 2XA7M 1N9NA 4CLCB 4WN5A 2P08A 4PAUA 4ARZA 3IBJA 3BQ8A 3C2WA 2VA0A 4ARZB 3A0VA 4MMNA 4G3KA 2ZOIA 3RTYA 4HHDA 4RQ9A 4LRYC 3UMDA 4F3LA 3LIFA 3NOPC 3BWLA 3E4PA 2W3EA 4IUHA 3O5YA 2NUPC 2D01A 4PHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3G A;  4LRX C;  4EUV A;  3S7N A;  1VHM A;  4ZRR A;  5I5L A;  1MKM A;  4O01 A;  2K31 A;  2KLI A;  2W3D A;  2LB5 A;  3MF0 A;  4Q0H A;  4G3V A;  2XRN A;  3DBA A;  5HPF A;  2ZMF A;  4ETZ A;  1TD5 A;  4GLQ A;  3W2Z A;  3S7O A;  4O8G A;  2O0Y A;  3OBF A;  2XRO A;  3IBR A;  3E98 A;  4R70 A;  1F5M A;  4YOF A;  2O99 A;  3TRC A;  2O9B A;  1YSP A;  2Y79 A;  5HSQ A;  4QPR A;  3LFV A;  3KSI A;  2O9C A;  3E0Y A;  2VJW A;  3KSG A;  4FOF A;  1TF1 A;  2G7U A;  5C5K A;  4ME4 A;  5AJG A;  2LB9 A;  4BWI A;  4LRZ E;  3OOV A;  3S7Q A;  3NOT C;  4YNR A;  2VZW A;  5LBR A;  2QYB A;  4G3W A;  4Z1W A;  2M7U A;  3RFB A;  4IUK A;  5DFX A;  5K5B A;  1STZ A;  1MC0 A;  2VKS A;  2W3H A;  2M7V A;  4DMZ A;  2O9A A;  4E04 A;  4EU0 A;  1YKD A;  3CI6 A;  3ZQ5 A;  4ETX A;  2W1T A;  1YSQ A;  4DN0 A;  4R6L A;  3BJN A;  1ZTU A;  2GX5 A;  3NHQ A;  3NOU C;  3MMH A;  3MQ0 A;  2W1T B;  4Y2F A;  3CIT A;  2XSS A;  4O0P A;  2B18 A;  3KO6 A;  3KSF A;  2W3F A;  3VV4 A;  2OOL A;  5DFY A;  5L8M A;  3S7P A;  3EEA A;  3D3O A;  4Q0J A;  4PAU A;  3G6O A;  5HL6 A;  2HGV A;  2K2N A;  2VEA A;  5HPI A;  3IBJ A;  4GW9 A;  3KSH A;  3K2N A;  4MN7 A;  3R4K A;  2Y8H A;  2W1R A;  3C2W A;  5TJJ A;  4MMN A;  2KOI A;  4G3K A;  4RQ9 A;  4LRY C;  2IA2 A;  4MCW A;  4MDZ A;  3NOP C;  4Y5F A;  4CQH A;  2W3E A;  4IJG A;  4IUH A;  4Y3I A;  3O5Y A;  3HCY A;  4Q0I A; 
#chains in the Genus database with same CATH topology
 1DJB A;  4KZB A;  1ZG6 A;  4BL2 A;  4ZRR A;  2EX2 A;  4GDN A;  5KSH A;  2K31 A;  2D02 A;  2MJ6 A;  4S2I A;  3LGO A;  2Y59 A;  1NZU A;  3LO7 A;  5HPF A;  1YLT A;  4EBL A;  5A91 A;  2WKH A;  4QJG A;  1ES2 A;  2ZBB A;  4R4R A;  2C5W B;  2J8Y A;  5CGW A;  4FTX A;  3CAX A;  2DNS A;  1SZV A;  1LI9 A;  3QP5 A;  1TS0 A;  2I9V A;  2PU2 A;  2G2W A;  2VGL S;  3IF6 A;  4NG2 A;  3V67 A;  2PYR A;  1CQA A;  3H82 A;  2GZA A;  4DXC A;  4BBU A;  3OOV A;  1YLZ A;  1M6K A;  1PWC A;  2WGW B;  2XK1 A;  4Z9Q A;  1W63 M;  1L0E A;  4A5R A;  2Y2N A;  3NBL A;  1E3U A;  3UDF A;  1YAX A;  3E2K A;  5DTT A;  2RCX A;  2QMI A;  3T1X A;  5GLB A;  3CPT A;  2PBD P;  2JKR I;  3DW0 A;  2EX8 A;  3EEA A;  5DKL A;  5DF9 A;  5HD3 A;  3PBO A;  5EUA A;  2OAP 1;  3G31 A;  3HUM A;  2V1A A;  3LR3 A;  1K57 A;  3ISG A;  1K54 C;  2WKP A;  5CER A;  2ZC7 A;  1P97 A;  3C38 A;  1KGE A;  1UGU A;  3W4P A;  4BQM A;  4RX2 A;  1LSV A;  5FQM A;  3E4O A;  1HTZ A;  4JF5 A;  3SS3 A;  1OJG A;  4PM6 A;  2Z2L B;  4BD0 A;  3S7N A;  1VHM A;  3T4J A;  4K0X A;  1MKM A;  2WKI A;  2WKR A;  2H10 A;  4FUW A;  3LY4 A;  3S4X A;  3LR5 A;  2ZMF A;  5FQI A;  3FC7 A;  2JE5 A;  5GHZ A;  3BFE A;  3L7H A;  3PBN A;  1MXO A;  1G6O A;  1D1J A;  4Q8I A;  4LV3 A;  4WZ5 A;  4IHQ A;  2A49 A;  3SW1 A;  2O9C A;  1PI4 A;  1TF1 A;  1XJ4 A;  2LB9 A;  2XF3 A;  2Z6C A;  3BFC A;  3GRJ A;  3HLW A;  1DJA A;  4QY6 A;  1ERM A;  4G3W A;  3HLD A;  3BYD A;  4Y13 A;  3QHY A;  1S4R A;  4ZBE A;  3O86 A;  3G35 A;  1NRJ A;  2V1Z A;  1W5D A;  4DKI A;  3PYP A;  4ZJ2 A;  4O7D A;  1Q2Q A;  2XSS A;  2B18 A;  1Q2P A;  1PYY A;  3LR0 A;  4UA6 A;  2V1B A;  2VV7 A;  4HH3 A;  4FH2 A;  1V9Z A;  3QP6 A;  2W27 A;  3RXW A;  4AFI A;  2XFT A;  4I39 A;  3H7W B;  4R0Q A;  3ZVT A;  4MDZ A;  3IXD A;  3UE1 A;  1ERO A;  2XQZ A;  2DRW A;  4PM5 A;  1NRF A;  3T4T A;  3MF0 A;  3OPL A;  3WRZ A;  3FPV A;  4DF6 A;  1NJ4 A;  3GEC A;  3WS2 A;  3PHY A;  1CEG A;  1XA7 A;  1XFN A;  2ZC6 B;  3BM6 A;  3CHW P;  5F82 A;  1H0M A;  2BG1 A;  4BBV A;  3C7U A;  3OPP A;  1TDL A;  1PZO A;  1S0W A;  5A90 A;  4R70 A;  1DP6 A;  3NEC A;  2FZ0 A;  4LV2 A;  5EPH A;  3V3S A;  2QWS A;  3T1S A;  4WEL A;  5FQ9 A;  1CI8 A;  2UV0 E;  2ZMA A;  3A0S A;  3KYQ A;  4OLG A;  3MQQ A;  1Z6F A;  3ZNT A;  3ZNY A;  2XDM A;  5FI7 A;  4E3K A;  1EW0 A;  3D9Y A;  1XXM A;  2ZC3 B;  4S2N C;  4E04 A;  3CI6 A;  5E2H A;  1LLB A;  1XPB A;  5EVI B;  2H0Y A;  1LT0 A;  4X68 A;  4IED A;  1MWU A;  2L4R A;  5CHJ A;  5D3O A;  3DTI A;  3T4L A;  5EOE A;  2VEA A;  1FOF A;  1MY8 A;  2R9W A;  1XP4 A;  1Y54 A;  3KSH A;  4IVK A;  4NEE D;  1J3W A;  4XT2 B;  1L3L A;  4EBP A;  3FV7 A;  2W1R A;  1YLJ A;  5F5Y A;  3N8R A;  5CEB A;  5FAS A;  3CMZ A;  4P6B A;  5EVI D;  1SDE A;  2J9O A;  4PMA A;  3CZD A;  5L2F A;  3CUE C;  3PBR A;  1Z09 A;  3HLF A;  5E43 A;  4RA7 A;  4LLO B;  4UQI S;  4KZ3 A;  1JTD A;  1LSX A;  4H6J B;  3K3C A;  2B95 A;  2WGW A;  3DBA A;  4NK3 A;  2VV6 A;  4FCF A;  2EA9 A;  3PBQ A;  2EXA A;  4WEK A;  1NY0 A;  3TW8 A;  2ZQ7 A;  4OLD A;  5CHM A;  2XR0 A;  3HLC A;  4YFM A;  1W7F A;  4EUZ A;  4GHI B;  1ZG4 A;  1RCJ A;  2O99 A;  5GLC A;  2V8F A;  5CTN A;  3P7N A;  1KE4 A;  4JXS A;  4LEN A;  4EEU A;  3IWQ A;  3MZD A;  3HL9 A;  5HDC A;  1ES5 A;  4MBH A;  4HY8 A;  1N9B A;  3O87 A;  3CJM A;  1GHI A;  1VET B;  3EWK A;  4JKT A;  2W1T A;  4R6L A;  3HJK A;  1ZTU A;  2DMW A;  3VP4 A;  4M4X A;  3V3R A;  5EVE A;  3UPP A;  2P9V B;  5EE8 A;  2XA7 M;  3DAV A;  4CLC B;  2P08 A;  3ZCZ A;  3SZT A;  3ZDJ A;  2QZ6 A;  3GR2 A;  4ARZ A;  4S2M A;  3BQ8 A;  2X01 A;  3UE0 A;  3LCE A;  4MMN A;  1XGI A;  4LRY C;  3FYZ A;  1ESI A;  4F3L A;  3O5Y A;  3PAG A;  2ZC5 B;  2V20 A;  3VSK A;  5FDH A;  5EM0 A;  5I5L A;  1BUL A;  1RP5 A;  4CLC D;  2HJE A;  1SDN A;  4OQH A;  3IX4 A;  3B3X A;  5FAQ A;  2V0U A;  5IHV A;  4BL3 A;  2KDK A;  5FEG A;  1DP9 A;  4R4S A;  3NDE A;  1IEM A;  5FI2 A;  3TRC A;  3B47 A;  5IS1 A;  1YSP A;  4S2O A;  4HBT A;  4XXR A;  1H3Q A;  4PKY A;  5LBR A;  3NC8 A;  2V0W A;  3WS5 A;  4UQI M;  1BUE A;  3PAE A;  4D2O A;  4P6Z S;  4NXB A;  4WEJ A;  1S4S A;  4N92 A;  3IXH A;  3QP8 A;  2GX5 A;  1AWI A;  3DTK A;  5AQA A;  1CEF A;  3G30 A;  1O07 A;  1XJ2 A;  1N9O A;  3JPU A;  5DFY A;  3P09 A;  3N8L A;  1ESU A;  4E3M A;  1BTL A;  3BW6 A;  3UB6 A;  2KOI A;  5JYO A;  1UWP X;  4MN6 A;  4UA9 A;  3ZG5 A;  3HVF A;  1LL5 A;  4MEZ A;  5GLA A;  2L0W A;  3T50 A;  1YLW A;  1NWZ A;  4BLM A;  2HP9 A;  3F1P A;  2A2L A;  3ULF A;  3G32 A;  1YLY A;  4E3I A;  4IBR A;  1WA9 A;  3FZC A;  1L0F A;  1P9R A;  1T19 A;  2ZQA A;  3RJU A;  3B33 A;  5F1G A;  5TBM B;  2IWB A;  3UDI A;  5HFO A;  4ZAM A;  4MN5 A;  3BLM A;  2Y55 A;  1PNE A;  1WYC A;  3O88 A;  2G7U A;  4GKU A;  4BWI A;  1DRM A;  4YNR A;  4Z1W A;  4F94 A;  3A3F A;  2QPN A;  4K08 A;  1VEU B;  1IKI A;  2JKR M;  3M2J A;  4UAA A;  4L9G A;  5A92 A;  2QJ7 A;  3ZG9 B;  5J3W A;  1IYQ A;  3CUE A;  2OLU A;  2IWC A;  4GS9 A;  1MBL A;  3KSF A;  3IT9 A;  4I3A A;  1QMF A;  4Q0J A;  5HL6 A;  2Z6D A;  4II7 A;  3PTE A;  1OTA A;  1TS7 A;  2CC1 A;  2IWD A;  4OQG A;  4DDY A;  3UDX A;  5CHU A;  2Y8H A;  1ZHH B;  5TJJ A;  3SOI A;  1F2K A;  1GHP A;  4P6Z M;  2IA2 A;  3EGX C;  4OON A;  1G28 A;  3BRM A;  3DWZ A;  3MXQ A;  1CJF A;  1YT4 A;  4R3J A;  3QNB A;  3VFF A;  2W3D A;  5HD5 A;  2GDN A;  3LUQ A;  3IF5 A;  3NUL A;  1W79 A;  1BYW A;  3RH8 B;  4HEF A;  3T4Q A;  4R1G A;  3C4O A;  3MFD A;  2EXB A;  3MZE A;  1MWT A;  1T1B A;  4ID4 A;  5HSQ A;  1K4F A;  4WMC A;  3QNC A;  2VJW A;  1FIL A;  2EWW A;  5C5K A;  2Y2J A;  2WYX A;  2Y2M A;  3EOI A;  4WUJ A;  4OVD A;  3CG5 A;  3S7Q A;  5CGX A;  3C8C A;  4JLF A;  1H8M A;  4IVI A;  1OME A;  5CRF A;  5G4Y A;  2EX6 A;  4OOY A;  4HJ4 A;  3ZQ5 A;  4WL9 A;  3ZG8 B;  3F1N B;  4EQI A;  3UE6 A;  3TG9 A;  5KMW A;  3HJI A;  5FI6 A;  4EXO A;  2Y2G A;  3D3O A;  3SH8 A;  2K2N A;  3Q7V B;  2H0T A;  3CWF A;  1MPL A;  2XFS A;  1IYO A;  5M1A A;  2PBY A;  1PRQ A;  2XH9 A;  3R7W B;  5E2E A;  4PKY G;  5J4E A;  3R4K A;  4FSF A;  2PD8 A;  4KUK A;  4EET B;  1WE4 A;  2J80 A;  4U3T A;  3I7J A;  4RYE A;  3UNW A;  3C5A A;  3HCY A;  4OQ0 A;  1JWZ A;  3UY6 A;  3WS4 A;  1K38 A;  2P74 A;  3UE3 A;  3MQO A;  3IS2 A;  3SS4 A;  3Q82 A;  2ZL1 B;  4EWF A;  3T4S A;  3NCK A;  3VE3 A;  3V5M A;  4HP9 A;  4XUZ A;  3WRT A;  1S1Y A;  3KYE A;  5FDS A;  4OH0 A;  3UN7 A;  1SKO A;  1GSV A;  3DWK A;  1LHY A;  2Y79 A;  1XJ6 A;  3P01 A;  1KVM A;  4GOG A;  1ACF A;  3UB9 A;  1YLP A;  5HWW A;  3VOL A;  4U0T A;  2W0N A;  4YWZ A;  4B9O A;  3IH8 A;  1ES3 A;  3ZVW A;  5AQB A;  4X69 A;  2A24 B;  1F98 A;  2CMN A;  3FG8 A;  2JKG A;  2J9P A;  3AGE A;  2PDR A;  4GCZ A;  4HES A;  3GDI A;  3W8K A;  2PHY A;  2XA7 S;  4D60 A;  3A3I A;  2EFX A;  3ZFZ A;  3MR0 A;  3PBS A;  4JXV A;  2JC7 A;  1KDW A;  2FFY A;  3G2Y A;  1QME A;  2Y2I A;  3Q7Z A;  3ZG7 B;  3M6B A;  4PAU A;  5EM1 A;  5EVI C;  3IBJ A;  4UA7 A;  1HVB A;  5BOH A;  3QP2 A;  3GTC A;  1G68 A;  4S2P A;  1S6R A;  1ONG A;  3IWI A;  5EV0 A;  5TR7 A;  3LIF A;  3NOP C;  1JVJ A;  3BWL A;  3E4P A;  3C7V A;  2NUP C;  3N8S A;  2H5S A;  4HI4 A;  2B5R A;  1XA1 A;  3GVB A;  3MJQ A;  2KLI A;  3P98 A;  1IYS A;  2LB5 A;  3HUN A;  4CPK A;  1IKG A;  1ZC2 A;  2PT7 A;  4DE0 A;  3IHA A;  1H8Y A;  2EFU A;  4E3J A;  1K56 D;  3S22 A;  3FPW A;  1TD5 A;  1SHV A;  2Y2O A;  3BY8 A;  3ITB A;  1GHM A;  3LID A;  4WBG A;  1F5M A;  2WZX A;  3KSI A;  4FOF A;  3FKV A;  2JKF A;  4RVA A;  5E2F A;  2I72 A;  4GJ4 A;  4B4Z A;  4BMW A;  3IF6 B;  4CLC E;  2Y4A A;  4QU3 A;  4X1M A;  1S67 L;  3H82 B;  1FR1 A;  5K5B A;  5EFW A;  2OWJ A;  4JGR A;  2M7V A;  2HJ9 C;  4HOI A;  3NI9 A;  2WUQ A;  4FH4 A;  1HLU P;  3NHQ A;  1A0K A;  2XLN A;  3MMH A;  4LFU A;  4DRT A;  4GD6 A;  3ITA A;  4RX3 A;  1IYP A;  4DE1 A;  3Q1F A;  2W3F A;  1DJC A;  4MBF A;  5FEF A;  1BLH A;  1Y4O A;  5U47 A;  3CPT B;  2PRF A;  3MXS A;  5KSC A;  2ZQD A;  1MZU A;  5HAI A;  1M40 A;  4GW9 A;  5F83 A;  1K0K A;  1GCE A;  2WZZ A;  1G6A A;  4M3K A;  3MKF A;  4MBK A;  4MCW A;  4CLC C;  3LIA A;  4Y3I A;  1E3U D;  4OOM A;  4EBN A;  2Q0O A;  3A3J A;  3LR4 A;  4OP8 A;  3EEH A;  4N9L A;  3HUO A;  4KZ6 A;  4KQD A;  4O01 A;  3OPH A;  4Q0H A;  1CK3 A;  3VE4 A;  5L09 A;  3AGD A;  4X55 A;  4MNR A;  1NLZ A;  1BZA A;  4GZB A;  1XX2 A;  2P04 A;  4JGP A;  1VM1 A;  3F1N A;  3CLO A;  2R78 A;  3IBR A;  4I38 A;  1VB6 A;  1ERQ A;  1PW8 A;  3U4L P;  1NYM A;  4KQO A;  2H28 A;  4B93 A;  1FSY A;  5TGF A;  2J3T D;  4LRZ E;  3W4O A;  3NOT C;  3N6I A;  5HDS A;  1P0Z A;  1FCM A;  5CX7 A;  3W4Q A;  1STZ A;  1FR6 A;  1XFQ A;  2VGJ A;  1JWP A;  3SH9 A;  2NUT C;  3TE8 A;  3Q81 A;  4BD1 A;  4OPR A;  3M2K A;  4NXF A;  3D72 A;  1BLC A;  3T1Q B;  3IXG A;  1D7E A;  2ZJ9 A;  4JPM A;  4KG2 A;  2HPB A;  2QJ5 A;  5F68 A;  1LL8 A;  4EEP A;  2V2F F;  4PM7 A;  2ZL1 A;  4QWO A;  2JN7 A;  5GHX A;  5HPI A;  1SCW A;  1H5X A;  1RGZ A;  3FWL A;  3VOZ A;  4MN7 A;  3H7W A;  1EI5 A;  1GA0 A;  3GV9 A;  3C4P A;  1WYB A;  5HAP A;  4KZ4 A;  2FFF B;  5DKK A;  3OCL A;  2QHK A;  1MWR A;  4NKP A;  3OZH A;  5HAQ A;  4WYY A;  4QD4 A;  4LRX C;  2ZOH A;  1F9I A;  3M6H A;  1JWV A;  2GNX A;  2J7V A;  1GSW A;  2GJ3 A;  2XRN A;  1W8Q A;  4JBF A;  1X0O A;  5M19 A;  4GLQ A;  3GSG A;  3S7O A;  4O8G A;  5M18 A;  4L0L A;  4L9F A;  2O0Y A;  2PD7 A;  1CI9 A;  5DF7 A;  2INW A;  3QP1 A;  5EEC A;  4E3O A;  1JTG A;  3E0Y A;  3DTM A;  4S2K A;  3VP2 A;  2ZQ8 A;  5AJG A;  5A93 A;  3T12 B;  3HLE A;  2BLS A;  5FL3 A;  4KQQ A;  3OC2 A;  1PZP A;  3K3D A;  2M7U A;  2ZM0 A;  3G4P A;  4HJ6 A;  4QY5 A;  1E4D A;  4WLA A;  5EVI A;  1OPX A;  5F69 A;  3LIE A;  5FSR A;  3C30 A;  4EU0 A;  4ETX A;  4KEN B;  5L07 A;  3F1O B;  4HBU A;  2VV8 A;  4LCM A;  3MQ0 A;  2Y2Q A;  4O0P A;  3ICY A;  2OOL A;  4DJ3 A;  1S1Z A;  4LPZ A;  4HNB A;  4KZ8 A;  3G6O A;  4Y0T A;  1FSW A;  4XT2 A;  4C3Q A;  2E8J A;  1YPR A;  2HF6 A;  4GDB A;  1K55 C;  1RGY A;  3K2N A;  5FAP A;  4E6X A;  3LEZ A;  1LI0 A;  3QP4 A;  2XEP A;  4ZDX A;  5F1F A;  4Y5F A;  4CQH A;  5JYP A;  1I2S A;  3UME A;  3KX0 X;  5FA7 A;  5HDD A;  1IEL A;  1L0G A;  1LL9 A;  4H6J A;  4KG5 A;  4JF4 A;  3LIC A;  5EVL A;  2E8I A;  3FKW A;  5DJT A;  3VSL A;  5TFQ A;  3A0R A;  3MKE A;  4R23 A;  1ALQ A;  1PWG A;  3E4Q A;  3TJZ C;  1YMS A;  2OAQ 1;  4GHI A;  2XRO A;  3EQU A;  4JGO A;  1OT9 A;  2PR6 A;  3OLO A;  3T1R A;  3DTE A;  2RL3 A;  2WAF A;  2Y2H A;  1ES4 A;  2O9B A;  3LFV A;  4JF6 A;  1PIO A;  4YIN A;  4WZ4 A;  1OTD A;  1H8Z A;  3IX3 A;  4EQ1 A;  3LI8 A;  1PI5 A;  3OPR A;  4ME4 A;  3VP1 A;  2HZ5 A;  4KUO A;  2QKP A;  2G2U A;  4I5S A;  2QYB A;  1VET A;  3UB5 P;  3NY4 A;  3N4I A;  5DFX A;  1AXB A;  3GMW A;  4Y0U A;  1UWN X;  3G2Z A;  3Q07 A;  2HDQ A;  3N7W A;  1T18 A;  3A3E A;  2J3W A;  2P9V A;  1NYY A;  3HRE A;  4CLC A;  2W1T B;  3MZF A;  1D06 A;  3PBT A;  1HD8 A;  1N9N A;  3AGF A;  4WN5 A;  4KZ7 A;  1XGJ A;  5EOO A;  1MKI A;  5HW3 A;  3SS5 A;  4OPY A;  1XKZ A;  3C2W A;  2VA0 A;  4ARZ B;  4G3K A;  3RTY A;  2XGN A;  4MLL A;  5GL9 A;  3JYI A;  4PHT A;  1K6R A;  4X1L A;  3VP0 A;  3NIA A;  4L9E A;  4F3L B;  4LGW A;  2XD5 A;  4NET A;  4H8R A;  5DTS A;  4R38 A;  1YM1 A;  3BLS A;  4C6Y A;  3S1Y A;  4ETZ A;  1KDS A;  3UO9 A;  2YKH A;  3W2Z A;  3NDG A;  3GQZ A;  2V8C A;  4DXB A;  1PWD A;  1EWZ A;  3IWO A;  4GN2 A;  4UEY A;  4YOF A;  1MWS A;  2HP6 A;  2HDR A;  3BQA A;  2JKT M;  2A3U A;  4S2L A;  3LEQ A;  2FH5 A;  1O7E A;  3IHB A;  3E2L A;  3LIB A;  3BEB A;  1IFQ A;  3LI9 A;  3UB7 A;  1FCN A;  4HQA A;  2Y2L A;  3H9W A;  4X6T A;  2PR5 A;  4IUK A;  2VGL M;  4DE3 A;  1K25 A;  2PYP A;  1ODV A;  4DN0 A;  2HDU A;  4OQI A;  1HZO A;  4OP5 A;  3NOU C;  5HL1 A;  5J8X A;  2V9A A;  1U60 A;  3CIT A;  3KO6 A;  3KYZ A;  3ZHH A;  4X25 A;  3IXB A;  2K7S A;  5L8M A;  4UHU A;  3NJA A;  2EX9 A;  5FAT A;  5AVF A;  2JKT I;  4NXG A;  1OTE A;  1JNU A;  2BTF P;  1TS6 A;  5CTM A;  4R3B A;  1YQS A;  4FD8 A;  2ZMV A;  4DDS A;  4Y15 A;  1S66 L;  1KGF A;  1DP8 A;  4KG6 A;  2OWH A;  5CED A;  2OSU A;  4LCL A;  4GNU A;  4Q0I A;  5F6A A;  2W3G A;  4EES A;  4N9K A;  4C75 A;  1VQQ A;  4PPR A;  4Y17 A;  2JCH A;  4HH2 A;  3EQV A;  3O3V A;  3BY9 A;  5AQ9 A;  1T1C A;  1PFL A;  4ZJ3 A;  4U0X A;  4G3V A;  2OLV A;  5IT5 A;  2ZQ9 A;  5TBM A;  3F1P B;  2XD1 A;  4N1X A;  3HLG A;  4HP4 A;  5FQQ A;  1J9M A;  2X02 A;  3HBR A;  4EER A;  3F1O A;  4HIA A;  5J7E A;  5I94 A;  2PU4 A;  3VP3 A;  4I3I A;  4JXW A;  3MSH A;  1N4O A;  2WAE A;  3BFD A;  2ZLY A;  4P0M A;  1I5Q A;  1ZKJ A;  2WKQ A;  1CF0 A;  3RXX A;  4OPZ A;  2WGV A;  4WM9 A;  2ZC4 B;  1VEU A;  1PW1 A;  3JVU A;  3ZYT A;  2KX6 A;  1MC0 A;  2VKS A;  2YKF A;  4KQR A;  1K55 A;  4DMZ A;  1YKD A;  4BBT A;  2BAS A;  1FQG A;  2EWV A;  4GD8 A;  3WS0 A;  4Y0O A;  1ONH A;  3T4K A;  3IF6 C;  3B42 A;  1FIK A;  1IOU A;  5GHY A;  2C6W B;  2JHE A;  5DVA A;  1KE3 A;  3LYX A;  5CXW A;  4E6W A;  2VGK A;  4GS9 B;  1W8Y A;  5HWT A;  1V9Y A;  5KZH A;  1TVF A;  4ESP A;  5AVE A;  3WWX A;  5AQ7 A;  3PXP A;  5FQJ A;  4P87 A;  3VFH A;  4XUX A;  3IX8 A;  3G34 A;  5KIZ A;  4KZ9 A;  4S2J A;  4NXE A;  4QB8 A;  1NXY A;  3L9K A;  4EUV A;  2Y2K A;  5CEC A;  1BSG A;  3WS1 A;  4LV0 A;  1K57 C;  4LV1 A;  4WF0 A;  1L0D A;  5GLD A;  2ZD8 A;  1P9W A;  5HX9 A;  3T4O A;  4I3J A;  2HP5 A;  2X71 A;  1K54 A;  1N9L A;  2P7J A;  1OJ5 A;  3E98 A;  4BEN A;  2J3T C;  2R9X A;  4ZJ1 A;  2Q9N A;  2WK0 A;  2WGI A;  1LSW A;  3KSG A;  4GB7 A;  4K0W A;  3MXR A;  3PR6 A;  5DTK A;  2Q9M A;  3UB8 A;  4B88 A;  4EV4 A;  1T1A A;  2ZM8 A;  5A8B A;  5HZH A;  2VZW A;  3RFB A;  2M1C A;  4BJP A;  4KZA A;  3U2A A;  3BFF A;  4PM8 A;  1TS8 A;  3VMA A;  3HLB A;  4WZ5 C;  3V50 A;  3UPN A;  3OCN A;  1OTI A;  5FAO A;  4X56 A;  3MS6 A;  1KGG A;  3Q7V A;  2L1M A;  5L10 A;  4PM9 A;  5DJU A;  1GSX A;  3S7P A;  4E3N A;  5MC7 A;  1BLP A;  5HWV A;  2HV1 A;  2JBF A;  2HGV A;  3EGD C;  3R7W A;  3A3D A;  4WMC D;  2UWX A;  4OOL A;  1OTB A;  5G18 A;  3SH7 A;  2VK3 A;  1NZO A;  4Y7P A;  2VLG A;  3MBZ A;  4X53 A;  3JVV A;  3TOI A;  3ZGA B;  4IJG A;  4P85 A;  3IQA A;  4CJN A;  2ACG A;  4HJ3 A;  4DJ2 A;  2Z2M B;  4EW7 A;  1FCO A;  1Y28 A;  1K4E A;  1YMX A;  1G5U A;  2WAD A;  1K6S A;  1L2S A;  1NLY A;  3IS2 B;  3D4F A;  1OT6 A;  2AVX A;  4IBX A;  5G4Z A;  3IH9 A;  3MFX A;  5CGS A;  4R3A A;  4QHC A;  3OBF A;  5DF8 A;  4OPQ A;  2PAV P;  4K91 A;  3ZG0 A;  1E25 A;  1W63 Q;  5HAR A;  4JGQ A;  1SKF A;  5E2G A;  5FQK A;  4QPR A;  2Y91 A;  1SKO B;  3UPO A;  2B02 A;  2A24 A;  1BLS A;  1BT5 A;  2ZQC A;  1KVL A;  3TSG A;  3V39 A;  2OV5 A;  4ZTK A;  4E3L A;  2W3H A;  3LY3 A;  5IU1 A;  2O9A A;  2WKE A;  4N1H A;  1XJ3 A;  1YSQ A;  3VOY A;  3BJN A;  2Y2P A;  1KOU A;  2HDS A;  1C3B A;  2DCF A;  4Y2F A;  3BFG A;  4OKP A;  4DE2 A;  3VV4 A;  2VX8 A;  1K56 A;  4JXG A;  4KZ5 A;  1I2W A;  3A0V A;  2ZOI A;  4HHD A;  4RQ9 A;  4B4X A;  2ZM2 A;  3UMD A;  1KE0 A;  1TDG A;  4S2N A;  3BEC A;  1DY6 A;  2W3E A;  4IUH A;  1TEM A;  2D01 A;  1GA9 A; 
#chains in the Genus database with same CATH homology
 4L9E A;  4F3L B;  4HI4 A;  4ZRR A;  5I5L A;  4CLC D;  3MJQ A;  5KSH A;  2K31 A;  2HJE A;  2D02 A;  2KLI A;  2MJ6 A;  2LB5 A;  4R38 A;  2PT7 A;  5HPF A;  4ETZ A;  3FPW A;  1TD5 A;  2YKH A;  3W2Z A;  2ZBB A;  2V0U A;  3BY8 A;  2KDK A;  3LID A;  1DP9 A;  3CAX A;  4UEY A;  1F5M A;  4YOF A;  3TRC A;  1TS0 A;  3B47 A;  5IS1 A;  2I9V A;  1YSP A;  3BQA A;  2JKT M;  3KSI A;  2VGL S;  2FH5 A;  4FOF A;  3V67 A;  2PYR A;  3H82 A;  2GZA A;  3LIB A;  3LI9 A;  1IFQ A;  3OOV A;  4GJ4 A;  4BBU A;  3UB7 A;  4BMW A;  1H3Q A;  4CLC E;  4PKY A;  5LBR A;  4HQA A;  3H9W A;  2V0W A;  1S67 L;  4UQI M;  2PR5 A;  1W63 M;  3H82 B;  4IUK A;  5K5B A;  4P6Z S;  2VGL M;  5EFW A;  2PYP A;  2OWJ A;  1ODV A;  4JGR A;  4NXB A;  4WEJ A;  2M7V A;  2HJ9 C;  4HOI A;  1S4S A;  1YAX A;  4DN0 A;  2GX5 A;  3NHQ A;  3NOU C;  3MMH A;  2V9A A;  3CIT A;  3KO6 A;  1XJ2 A;  2W3F A;  2JKR I;  1N9O A;  3KYZ A;  2K7S A;  5DFY A;  5L8M A;  3NJA A;  3EEA A;  5DKL A;  5AVF A;  5DF9 A;  5HD3 A;  2JKT I;  3PBO A;  4NXG A;  1OTE A;  2OAP 1;  2V1A A;  3LR3 A;  1JNU A;  1MZU A;  4GW9 A;  2WKP A;  1TS6 A;  3BW6 A;  1P97 A;  2ZMV A;  3C38 A;  1UGU A;  1S66 L;  1LSV A;  3UB6 A;  1DP8 A;  2KOI A;  3E4O A;  2OWH A;  1UWP X;  4MCW A;  4MN6 A;  4CLC C;  3LIA A;  4Y3I A;  4OOM A;  1OJG A;  4Q0I A;  5F6A A;  2W3G A;  2L0W A;  3LR4 A;  4EES A;  3T50 A;  3S7N A;  1VHM A;  3EEH A;  3T4J A;  4KQD A;  1MKM A;  1NWZ A;  4O01 A;  4HH2 A;  3F1P A;  3EQV A;  2WKR A;  2A2L A;  3BY9 A;  3ULF A;  4Q0H A;  1T1C A;  4G3V A;  3VE4 A;  1WA9 A;  5IT5 A;  5TBM A;  3F1P B;  1P9R A;  1NLZ A;  3LR5 A;  2ZMF A;  1T19 A;  3FC7 A;  2P04 A;  4JGP A;  4HP4 A;  3B33 A;  5TBM B;  4EER A;  3F1O A;  4HIA A;  3F1N A;  5J7E A;  3CLO A;  3PBN A;  2R78 A;  3IBR A;  4I38 A;  4MN5 A;  1VB6 A;  4I3I A;  1G6O A;  4IHQ A;  3SW1 A;  2O9C A;  2WKQ A;  4KQO A;  2H28 A;  4B93 A;  1TF1 A;  2G7U A;  1XJ4 A;  2J3T D;  2LB9 A;  4BWI A;  4LRZ E;  2Z6C A;  1DRM A;  3NOT C;  4YNR A;  5HDS A;  3JVU A;  1P0Z A;  4G3W A;  4Z1W A;  3ZYT A;  5CX7 A;  1STZ A;  2KX6 A;  1MC0 A;  1XFQ A;  1S4R A;  2VKS A;  2YKF A;  4K08 A;  4DMZ A;  1YKD A;  4BBT A;  2NUT C;  1NRJ A;  3TE8 A;  2JKR M;  4L9G A;  2BAS A;  2EWV A;  2QJ7 A;  4NXF A;  3D72 A;  3PYP A;  5J3W A;  3CUE A;  1D7E A;  3T4K A;  3B42 A;  2XSS A;  2B18 A;  3KSF A;  4GS9 A;  4I3A A;  1IOU A;  2QJ5 A;  2JHE A;  5F68 A;  1LL8 A;  4EEP A;  3LYX A;  4Q0J A;  5HL6 A;  2Z6D A;  3LR0 A;  4GS9 B;  4II7 A;  2V1B A;  5HWT A;  2JN7 A;  1OTA A;  2VV7 A;  4HH3 A;  5HPI A;  1V9Y A;  1TS7 A;  1V9Z A;  2W27 A;  4MN7 A;  3H7W A;  4AFI A;  4I39 A;  5AVE A;  2Y8H A;  1ZHH B;  5TJJ A;  3PXP A;  4P6Z M;  3H7W B;  2IA2 A;  4MDZ A;  5DKK A;  3EGX C;  3OCL A;  2QHK A;  1G28 A;  5KIZ A;  4NKP A;  3MXQ A;  4NXE A;  4LRX C;  4EUV A;  2ZOH A;  1F9I A;  3T4T A;  2GNX A;  2W3D A;  3MF0 A;  1GSW A;  5HD5 A;  2GJ3 A;  2XRN A;  3FPV A;  4WF0 A;  3LUQ A;  3GEC A;  3PHY A;  1P9W A;  1X0O A;  1BYW A;  1XFN A;  4GLQ A;  3RH8 B;  3T4O A;  4I3J A;  3S7O A;  4O8G A;  4L0L A;  4BBV A;  1N9L A;  3T4Q A;  4L9F A;  2O0Y A;  2P7J A;  1OJ5 A;  3E98 A;  4R70 A;  1DP6 A;  2PD7 A;  2FZ0 A;  2J3T C;  1T1B A;  2INW A;  2QWS A;  5HSQ A;  4WEL A;  1LSW A;  3E0Y A;  3KSG A;  2VJW A;  2EWW A;  3A0S A;  5C5K A;  3PR6 A;  3KYQ A;  5AJG A;  3UB8 A;  3EOI A;  4WUJ A;  5FL3 A;  3MQQ A;  1T1A A;  3S7Q A;  5A8B A;  5HZH A;  2VZW A;  3OC2 A;  3C8C A;  3K3D A;  2M7U A;  2M1C A;  3RFB A;  1EW0 A;  1H8M A;  4HJ6 A;  4WLA A;  4BJP A;  1OPX A;  5F69 A;  5G4Y A;  3LIE A;  3U2A A;  3C30 A;  4HJ4 A;  4E04 A;  4EU0 A;  3CI6 A;  3ZQ5 A;  4ETX A;  4WL9 A;  3F1O B;  1TS8 A;  3F1N B;  1LT0 A;  2VV8 A;  2L4R A;  3MQ0 A;  3OCN A;  3UE6 A;  1OTI A;  3HJI A;  4O0P A;  3ICY A;  2L1M A;  2OOL A;  4EXO A;  4DJ3 A;  5DJU A;  1GSX A;  3S7P A;  5MC7 A;  1S1Z A;  4LPZ A;  5HWV A;  3D3O A;  2HV1 A;  4HNB A;  3G6O A;  2HGV A;  3EGD C;  3R7W A;  3T4L A;  2K2N A;  3CWF A;  4XT2 A;  2VEA A;  4OOL A;  1OTB A;  3KSH A;  4NEE D;  2HF6 A;  3R7W B;  3K2N A;  4XT2 B;  4PKY G;  5J4E A;  3R4K A;  4FSF A;  2W1R A;  2PD8 A;  4KUK A;  5F5Y A;  4EET B;  2J80 A;  2VLG A;  3JVV A;  4Y5F A;  4CQH A;  3CUE C;  3PBR A;  4IJG A;  3HCY A;  3UME A;  3KX0 X;  4HJ3 A;  5HDD A;  4DJ2 A;  4EW7 A;  4H6J A;  1Y28 A;  3UE3 A;  4LLO B;  4UQI S;  3MQO A;  3IS2 A;  3LIC A;  5DJT A;  3A0R A;  1LSX A;  4H6J B;  3K3C A;  3T4S A;  3DBA A;  2VV6 A;  1NLY A;  2EA9 A;  3IS2 B;  3VE3 A;  3PBQ A;  3E4Q A;  1OT6 A;  3TJZ C;  4HP9 A;  4WEK A;  5G4Z A;  2OAQ 1;  4GHI A;  1S1Y A;  3MFX A;  3TW8 A;  4R3A A;  3OBF A;  2XRO A;  3EQU A;  4JGO A;  1OT9 A;  2PR6 A;  3OLO A;  1GSV A;  4GHI B;  1W63 Q;  4JGQ A;  2O99 A;  2O9B A;  2Y79 A;  1XJ6 A;  3LFV A;  3P01 A;  3P7N A;  4QPR A;  3UB9 A;  5HWW A;  1OTD A;  2B02 A;  3VOL A;  2W0N A;  4EQ1 A;  4YWZ A;  2A24 A;  3LI8 A;  4ME4 A;  4B9O A;  4EEU A;  4KUO A;  2QKP A;  4I5S A;  2A24 B;  2QYB A;  1F98 A;  2CMN A;  3FG8 A;  5HDC A;  5DFX A;  4HY8 A;  2PDR A;  2W3H A;  1UWN X;  4GCZ A;  5IU1 A;  2O9A A;  3GDI A;  2PHY A;  1XJ3 A;  2XA7 S;  3EWK A;  2W1T A;  1YSQ A;  1T18 A;  4R6L A;  3HJK A;  3BJN A;  1ZTU A;  2DMW A;  3MR0 A;  2J3W A;  3PBS A;  1KOU A;  4M4X A;  4CLC A;  2W1T B;  4Y2F A;  1D06 A;  3PBT A;  3VV4 A;  2VX8 A;  2XA7 M;  1N9N A;  4CLC B;  4WN5 A;  2P08 A;  4PAU A;  4ARZ A;  3IBJ A;  3BQ8 A;  3C2W A;  2VA0 A;  4ARZ B;  3A0V A;  4MMN A;  4G3K A;  2ZOI A;  3RTY A;  4HHD A;  4RQ9 A;  4LRY C;  3UMD A;  4F3L A;  3LIF A;  3NOP C;  3BWL A;  3E4P A;  2W3E A;  4IUH A;  3O5Y A;  2NUP C;  2D01 A;  4PHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...