4IUKA

Crystal structure of nrea of staphylococcus carnosus with bound nitrate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
143
structure length
143
Chain Sequence
b'FDYQDALDEIRETEKFDFAAIALPEDGLHSAVIKWKYASGNINYRYRMIVLRPGKGLAGLVIRTGSRKIVEDVDAELSQNDKLGYPIVLSEALTAMVAIPLWKNNRVYGALLLGQREGRPLPEGSTTFRINQRLGSFTDEINK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NreA protein
molecule tags Nitrate-binding protein
source organism Staphylococcus carnosus subsp. carnosus
publication title The NreA Protein Functions as a Nitrate Receptor in the Staphylococcal Nitrate Regulation System.
pubmed doi rcsb
total genus 33
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4iukA00
4Y5FA 2W3HA 3C2WA 3OBFA 5DFXA 5K5BA 2W3DA 4Y3IA 5HPFA 3KO6A 4Q0HA 4IUHA 1MC0A 3KSGA 2VJWA 2VZWA 4QPRA 3TRCA 3S7NA 2O99A 3IBJA 3KSFA 3S7QA 2IA2A 4YNRA 2XROA 3IBRA 3VV4A 2KLIA 4MCWA 3DBAA 2Y8HA 3HCYA 3K2NA 5AJGA 2M7VA 3E0YA 2O9BA 4IJGA 2ZMFA 2O9CA 2W1TA 2W3GA 2QYBA 4FOFA 4Q0IA 1F5MA 4Z1WA 5DFYA 1TF1A 1VHMA 3OOVA 4O01A 5I5LA 5HSQA 4RQ9A 2G7UA 2XSSA 3NOUC 4R6LA 1ZTUA 2O0YA 1TD5A 3O5YA 3S7PA 2GX5A 1MKMA 3R4KA 3E98A 2XRNA 4G3VA 2Y79A 3MF0A 3KSHA 3MMHA 3D3OA 4Q0JA 4LRYC 2LB5A 2W3FA 2W3EA 3NHQA 3G6OA 4R70A 3BJNA 5HPIA 5C5KA 4BWIA 3MQ0A 4ZRRA 5TJJA 4O8GA 4GW9A 3NOPC 1YSQA 4G3WA 3KSIA 1YKDA 4CQHA 5HL6A 2B18A 4DMZA 2K2NA 4LRZE 4EU0A 2W1TB 4MN7A 4ETZA 3W2ZA 2O9AA 2HGVA 2K31A 4EUVA 4IUKA 4MDZA 2LB9A 3LFVA 4PAUA 2KOIA 4MMNA 3RFBA 4LRXC 3NOTC 3CITA 4GLQA 2VKSA 4G3KA 4YOFA 4ME4A 4Y2FA 1YSPA 2VEAA 5LBRA 3ZQ5A 5L8MA 3S7OA 2W1RA 2M7UA 4ETXA 4E04A 2OOLA 1STZA 4O0PA 3CI6A 4DN0A 3EEAA
chains in the Genus database with same CATH superfamily
3A3FA 3RH8B 1LHYA 4EXOA 1MZUA 1TS0A 3DTKA 3UPNA 2O99A 1YM1A 1MKIA 3IBRA 4GJ4A 5A91A 3HCYA 4HJ4A 4WMCA 3E0YA 1PZOA 4QU3A 4IJGA 4U0XA 5FQQA 3F1OA 3MJQA 1TF1A 3ZG8B 3EQUA 3CAXA 2HDUA 2GX5A 1W5DA 3PAEA 2OWHA 1I5QA 3IF5A 4WMCD 1NRFA 4N1HA 1LT0A 5DJUA 1WYBA 3UN7A 3IH9A 3UO9A 5GHZA 5HPIA 3KYZA 2Y2HA 3PHYA 5C5KA 4EERA 4IBRA 5TJJA 5E2HA 1E3UD 3HBRA 3M6HA 3N7WA 5F1FA 2B18A 4NG2A 4EBLA 1D1JA 2BASA 3HLBA 2ZBBA 3BM6A 3B33A 1ONGA 4ETZA 3IF6C 3PAGA 4QB8A 2K31A 4IUKA 2KOIA 1TS6A 2Z2MB 3VP3A 4WN5A 1L3LA 2V8CA 4KZ3A 2A24B 5GLBA 4OPYA 2HP6A 5F82A 1W7FA 1JNUA 5GL9A 2Q9NA 3A0SA 1AWIA 2Y2MA 3CUEC 4HH2A 5K5BA 4WELA 5HPFA 3G30A 4IUHA 4MN6A 1TS8A 5AQ7A 4DXBA 3V50A 4OPQA 4QY6A 4LPZA 3L9KA 4WEJA 3NY4A 3HUNA 1W63M 2M7VA 1XPBA 5CRFA 3NCKA 5E2FA 2XDMA 4I5SA 1VM1A 2Z6DA 3UNWA 5HSQA 3IF6A 2G7UA 2OAP1 3BFFA 4PKYA 3IXDA 2PYRA 2ZOHA 2Y2OA 2J7VA 4N9KA 5EE8A 2X71A 5E2GA 4HBTA 4QY5A 4Q0JA 2W3EA 2ZQDA 1K25A 2Z6CA 2PU4A 4S2NA 2MJ6A 3VOYA 3S22A 3NBLA 3SW1A 3VMAA 4JXVA 4N9LA 2BLSA 2IWBA 2PT7A 1K6RA 2JN7A 3QP2A 1KE3A 3T1QB 4MN7A 1H8MA 5FSRA 3VP4A 1BYWA 1LI9A 4OOMA 1S1YA 1PI5A 3C7UA 1LL9A 2WKEA 4DE3A 4P6ZS 4KZ9A 3W4QA 3LR4A 1O7EA 1S4SA 1FCOA 4Q8IA 4I3AA 4LCLA 3S7OA 3HL9A 1K54C 4JKTA 1IFQA 3C2WA 3PYPA 1YLTA 3LI8A 3WS4A 3RTYA 1K38A 4HP9A 4KZAA 2R9XA 2J8YA 4GS9B 3BEBA 5FI2A 5KIZA 4QHCA 3EOIA 1N4OA 1FIKA 4MBKA 4JGQA 3TJZC 2O9CA 3T4SA 2HP5A 3ZVTA 2KDKA 4GKUA 5FDHA 5MC7A 1T1BA 4KG5A 1K4FA 2EX9A 3F1NB 5DF9A 4JXSA 1GA9A 5FQIA 2C6WB 4OP5A 5CEDA 3M6BA 3NECA 3AGEA 1FCMA 2J9OA 3P98A 3OPRA 1PW8A 4BBVA 1HTZA 2LB5A 2W3FA 3NHQA 1JWPA 3BFGA 4LENA 5DKKA 3F1OB 4Y7PA 1JTDA 4LLOB 1H8YA 5EOOA 4UA9A 4OH0A 3JVUA 3QP6A 3VOZA 1JVJA 3IWIA 1BLHA 1F2KA 2EXAA 5HD3A 1SZVA 2YKHA 4Y0OA 3LYXA 4UQIM 2R9WA 4EBNA 3T4TA 4MMNA 4FH2A 3MS6A 5FQKA 2VGLS 1KE4A 1YSPA 3RXXA 4R3BA 4PM7A 1MXOA 2ZC6B 2L1MA 4KQDA 3NC8A 4H6JA 5M1AA 4Y5FA 3SZTA 2R78A 2VV7A 4JPMA 3LY4A 3S7NA 4KENB 3S7QA 3ZG9B 1ZC2A 1F9IA 5HDDA 4KZ7A 3DBAA 4LV2A 4CLCC 3IWQA 4IEDA 4PHTA 4BL2A 5DFYA 1LSWA 1WE4A 2FFFB 3UB7A 1G6AA 4LV1A 4CLCB 2XSSA 1DP9A 4I38A 5FAQA 3K3DA 5DKLA 4GDBA 4D60A 1EI5A 5HDCA 4BENA 1L0FA 1YMSA 1ZKJA 5CGXA 3T4LA 5HZHA 4B4XA 2ZMVA 4X53A 4LFUA 2B02A 1LLBA 1D06A 2VLGA 5EPHA 2JKRI 2WGWB 1YLJA 3WS5A 4OQHA 1FILA 2VK3A 1NLZA 5FDSA 3LEZA 3MFXA 1LL8A 3NIAA 5HAQA 1OMEA 4B4ZA 2WKPA 3C5AA 1RGZA 3A3DA 1ES2A 2XK1A 3UB9A 4RVAA 1XFNA 1E4DA 4LV3A 1I2SA 1Q2QA 3CITA 4MEZA 4GB7A 3LIFA 1RCJA 3UPOA 2Y2KA 4D2OA 1OT6A 2OLUA 2BTFP 1DJAA 1JWVA 2Y59A 3LIEA 2W3HA 5FQJA 4DRTA 4CLCA 1L0DA 3HLFA 3FZCA 3MFDA 1J3WA 1OTIA 2D02A 4HI4A 4H6JB 4IBXA 2KLIA 2XA7S 3T50A 3Q81A 2CC1A 1K57C 2G2UA 3FYZA 4E6XA 4OQIA 3KYQA 3OOVA 1G5UA 4OP8A 5J4EA 1K57A 4C75A 3S7PA 2PRFA 3MZDA 3UB8A 3IT9A 5EVEA 3CMZA 1UWNX 2J3TD 2EX2A 3IXGA 1IKIA 1GSWA 2M1CA 4E3JA 5FAOA 1JWZA 1ERQA 4ARZA 1CK3A 2XEPA 4K0XA 4UA6A 3N8RA 3FPWA 3S1YA 4O8GA 4ZJ3A 1YSQA 2Y91A 5J8XA 5EUAA 4NXEA 3GMWA 1KOUA 1IKGA 2Q9MA 3UE6A 4WF0A 4XUZA 1CEFA 3CUEA 4ESPA 2BG1A 2Y2JA 3U4LP 1HZOA 1PNEA 3TOIA 3V67A 3T12B 4E6WA 4EV4A 1MWUA 3WRTA 5DF8A 4P0MA 1K56A 1S4RA 3DW0A 3IQAA 4QJGA 4R4SA 3LEQA 4BD0A 1KGFA 1S1ZA 3ZG7B 1L0EA 4HNBA 5CHUA 3OBFA 4OLGA 1T1AA 4HQAA 2EX8A 2VGKA 1PWGA 1FSYA 3MQQA 2IA2A 1SDEA 3BY8A 3GTCA 4BMWA 4BJPA 3EQVA 2XH9A 2W3GA 3AGDA 1SHVA 4PM9A 3QP4A 2V9AA 4IVIA 3BLSA 4JGRA 4GS9A 1P9WA 4R6LA 4R4RA 4FTXA 4PKYG 5DF7A 3T1XA 1TD5A 1G68A 3HLWA 3E98A 4N1XA 5L10A 3G35A 3W4PA 2EWVA 1KGGA 1I2WA 2Q0OA 3VSLA 5AQ9A 2A3UA 2ACGA 4KQQA 2V0UA 2HZ5A 4KG2A 2WKIA 3C8CA 4R3JA 3DTMA 1NYMA 3BQAA 4PM6A 2PBDP 4EETB 5E2EA 4C3QA 1XA1A 5IHVA 4GD8A 5EVIA 4P6BA 2ZC5B 5HL6A 1T1CA 4GDNA 2XQZA 4PM5A 5E43A 3V3RA 1IEMA 4S2OA 4B93A 2Y4AA 5A8BA 3ZYTA 3MBZA 4RX3A 3IS2A 5AQAA 4X25A 3HREA 3LO7A 3RXWA 3ZFZA 1S66L 2WGWA 5KSCA 5EVIC 1LI0A 5CXWA 3Q07A 4GOGA 2V8FA 1KGEA 4DN0A 4XT2B 3EWKA 3M2KA 2IWDA 4GN2A 5G18A 2QJ5A 5EECA 4WEKA 1VETB 1N9LA 1ZHHB 1MC0A 2G2WA 4QPRA 3H82A 1X0OA 4YNRA 5EFWA 3VV4A 2ZM0A 5FQMA 1TEMA 4L9FA 1GA0A 2ZMFA 4UAAA 4OONA 3ZNTA 1VHMA 2ZOIA 3GDIA 2P04A 2Y2GA 1WA9A 3UMDA 3NOUC 4EESA 1W63Q 2D01A 1IYOA 4NEED 3DTIA 5D3OA 1L0GA 4G3VA 4S2NC 3BFEA 4YFMA 1DRMA 5TFQA 4P87A 3UDXA 1EROA 2RCXA 1C3BA 2DNSA 2WZXA 2WAFA 4WM9A 3NULA 3CG5A 4CJNA 4BWIA 3LUQA 1E25A 4Y0TA 4MBHA 4HIAA 2VX8A 2ZQ7A 4EEUA 1M6KA 2PD8A 4KG6A 3Q1FA 3RJUA 3VFFA 3UE1A 1S0WA 5HARA 3W2ZA 4ZAMA 3VOLA 4E3NA 3UB5P 2VGJA 3G4PA 3MZEA 4HBUA 4OLDA 2JKTI 2ZQAA 5HAPA 2FZ0A 1VQQA 1DJBA 1HLUP 2H0YA 4DXCA 5CTMA 3ZDJA 2W1RA 4ID4A 3WS0A 3FC7A 1FCNA 2W3DA 4BD1A 3PBRA 1MWSA 5CX7A 5A92A 2C5WB 4KZ4A 1XA7A 2XROA 4KQRA 3MXQA 1EW0A 3LR5A 3MXRA 2Y8HA 3G31A 3VSKA 4N92A 1PFLA 1F5MA 3QNBA 4R38A 5I94A 3C4PA 5JYPA 4KZ5A 1OJGA 3W8KA 5G4YA 3HUOA 5F68A 1DJCA 2O0YA 2WK0A 2ZC7A 3SS3A 3QP1A 5F1GA 4UHUA 3LCEA 3KX0X 1XJ2A 1S6RA 2WKRA 3BY9A 1J9MA 5F83A 3H7WB 1P9RA 2FFYA 3LICA 3OPLA 3V39A 3EGDC 5TBMB 4DDYA 2PR6A 4G3WA 1TVFA 4FSFA 2QZ6A 4IVKA 4R3AA 2PBYA 1PRQA 1IYQA 3H7WA 3CWFA 1IELA 3WS2A 3WWXA 2WYXA 1ACFA 3IWOA 1Y4OA 2XF3A 5J3WA 1H8ZA 3QNCA 3HJKA 5GHXA 1ZG4A 1H0MA 1TS7A 3E4OA 3O86A 3U2AA 1CI9A 4CLCD 4ZDXA 4LGWA 1K4EA 3IX3A 1CQAA 4ME4A 1JTGA 5J7EA 4U0TA 4EU0A 3G2ZA 3GVBA 5JYOA 1LSXA 4Y3IA 3L7HA 4Q0HA 4WYYA 5KMWA 1AXBA 3LIDA 1VETA 4H8RA 4X1LA 1NLYA 3N4IA 3T4JA 1ALQA 5DVAA 1DP6A 2EWWA 3ICYA 2XD1A 4HJ6A 4M4XA 3K2NA 2WGIA 1PW1A 1CI8A 4S2IA 3T4OA 4EQIA 4X1MA 1YPRA 4OVDA 1Y28A 5HFOA 3R4KA 3FKVA 3ZG5A 3PBNA 5AVFA 2UWXA 1YLWA 3KSHA 1N9NA 2ZM8A 3D3OA 5A93A 4XXRA 3Q82A 4S2MA 1YLPA 1MPLA 1W79A 5HDSA 2P9VB 3T4KA 1ES4A 2ZQ9A 2EXBA 4HOIA 5FEGA 5CERA 4GW9A 1BTLA 1K55C 4L9GA 4DMZA 2K2NA 2QHKA 4DJ2A 3A0RA 5GLCA 1MBLA 1TDLA 4II7A 4XUXA 2PAVP 1UGUA 2V1AA 3E2KA 1QMFA 2J3WA 5FI6A 3TG9A 3NJAA 3BLMA 4WZ4A 1NXYA 3F1PB 4JXWA 3HLDA 2H28A 2A2LA 5LBRA 1PWDA 2W27A 5DTKA 2P74A 1Z09A 4O0PA 4Y17A 1BZAA 4HH3A 3NDEA 4U3TA 3C30A 5KSHA 2I9VA 4S2LA 1BSGA 2OWJA 1BT5A 1YAXA 4PPRA 1XGIA 1PWCA 3UPPA 3PBTA 3T4QA 2VV8A 1ERMA 2Y2PA 3QP5A 4R23A 4I39A 4DF6A 3N8SA 3BQ8A 4PMAA 3G34A 2W1TA 4MLLA 3BFCA 4FOFA 1E3UA 1ONHA 1YT4A 2XFSA 5I5LA 1KE0A 3FPVA 3IS2B 2E8IA 3MKEA 3CJMA 1NY0A 3I7JA 4MNRA 2YKFA 3B42A 3QHYA 3GECA 4O7DA 2JCHA 4JXGA 1TDGA 5M18A 1ODVA 2PD7A 1P97A 5L07A 4NKPA 3IHAA 3D72A 1RGYA 1GSXA 4EQ1A 2ZQCA 1FQGA 2H5SA 1K54A 3NOPC 2A24A 4KZ8A 2E8JA 3T1SA 4DE0A 2L0WA 3LY3A 2JKGA 4LV0A 4P85A 4FCFA 3W4OA 3HLGA 2HGVA 5FL3A 1XP4A 2EX6A 3O87A 3ZNYA 2PYPA 4EUVA 2B95A 4GD6A 4I3JA 1K6SA 3V5MA 3E2LA 5IU1A 1W8QA 5FQ9A 3UE3A 3BYDA 4RX2A 5EVLA 5KZHA 2CMNA 3GSGA 3MXSA 5FA7A 3HVFA 4X55A 3ZG0A 2GZAA 1G28A 2ZLYA 3FWLA 4HHDA 2OOLA 4MBFA 5FAPA 4HY8A 4X56A 3E4PA 2WUQA 3JYIA 2ZQ8A 2PR5A 2L4RA 3B3XA 2V2FF 4RA7A 4YWZA 1XXMA 2JBFA 2DCFA 4R0QA 5L09A 4KZ6A 2GNXA 3NDGA 4OOLA 4B88A 4NK3A 2EFXA 3GRJA 4Q0IA 1Y54A 1BUEA 1ZG6A 5GLAA 2B5RA 3O88A 1MKMA 4E3IA 4NETA 3SS4A 2PU2A 4CPKA 2OSUA 2Y2LA 3MMHA 2ZL1B 4L0LA 5DJTA 2EFUA 5A90A 2HV1A 4KUKA 3KYEA 4Y0UA 1NZOA 1P0ZA 3B47A 3DAVA 2X01A 2VA0A 5EM0A 3SS5A 4K91A 1GHIA 1QMEA 4ARZB 4EBPA 5EM1A 3GV9A 5AQBA 1ESUA 3VE3A 4OQGA 4FH4A 3T1RA 4LCMA 5HX9A 4MDZA 5EOEA 2WGVA 3LFVA 3CLOA 2Y2IA 5IS1A 4FUWA 1BLSA 2VKSA 4G3KA 1OJ5A 3F1PA 3MQOA 1Z6FA 4JF6A 1SCWA 5L8MA 1VEUB 4KZBA 4HEFA 4A5RA 5GHYA 1YLYA 3VP2A 3CZDA 4JGOA 3HLEA 5DFXA 1KDWA 3KO6A 5GLDA 1FR6A 1GHMA 1PI4A 2RL3A 1ESIA 3CPTB 4DDSA 2VV6A 3Q7ZA 2QJ7A 4UA7A 1K0KA 2A49A 1KVLA 5F5YA 2O9BA 4NXBA 4DE2A 2XGNA 3S4XA 5L2FA 1KDSA 4OOYA 1XFQA 4FD8A 4JBFA 4JLFA 3PBOA 3HJIA 3M2JA 1Q2PA 3GQZA 1NWZA 3TE8A 1SKOB 4QD4A 1N9OA 5DTSA 2XRNA 2ZC4B 4X68A 3E4QA 5CECA 4ZTKA 1BULA 3HUMA 4WUJA 4WBGA 4EEPA 2ZL1A 3C38A 2KX6A 5HWTA 1HD8A 5FASA 1V9ZA 2XLNA 3MQ0A 4P6ZM 3F1NA 3FKWA 3PBSA 4BQMA 1LSVA 1G6OA 4LRZE 3BW6A 3VFHA 5HWVA 2V20A 2IWCA 3UDIA 4Y13A 4WZ5A 2QMIA 1U60A 4NXFA 5IT5A 3WS1A 5CGWA 2LB9A 1EWZA 4JF5A 5CHMA 5CHJA 5EVID 4GLQA 4YOFA 1T19A 3LGOA 2ZD8A 4EWFA 4F3LB 4E3MA 3EEAA 2OV5A 5CTNA 4EUZA 1O07A 2XR0A 2JKRM 3SH7A 2HDSA 2VJWA 2VGLM 4QWOA 3PBQA 1F98A 5BOHA 3UY6A 5F69A 2I72A 2H0TA 5TBMA 1VEUA 3UE0A 3JVVA 2JHEA 1OTBA 4Z1WA 3CPTA 3MR0A 1NJ4A 4O01A 4S2KA 2WKHA 1ES3A 2FH5A 1M40A 2V1ZA 3QP8A 2NUTC 4AFIA 4LRYC 1IYPA 4R70A 3D9YA 3NI9A 2Z2LB 4JF4A 2X02A 5M19A 4BBUA 5HL1A 3P09A 4K08A 4IHQA 3PXPA 3EEHA 4CQHA 1GHPA 3A0VA 1D7EA 2W0NA 4PM8A 4DKIA 3H82B 1YLZA 2HP9A 3ZCZA 2W1TB 1L2SA 3UDFA 3N8LA 1V9YA 3DTEA 2EA9A 2J3TC 4GHIA 5TR7A 1OPXA 4B9OA 4LRXC 3LI9A 3IX8A 3A3JA 4Y2FA 3GR2A 4EW7A 3ZQ5A 3IXHA 3H9WA 3OPHA 4E04A 3TSGA 3C7VA 3K3CA 2QKPA 4OQ0A 2WADA 3R7WB 2XD5A 2P08A 3FV7A 2GDNA 3KSGA 3P7NA 3UB6A 5HWWA 1MY8A 4BL3A 2V1BA 1DY6A 1CJFA 3CHWP 2WZZA 4MCWA 4KQOA 3BFDA 1YMXA 3ISGA 3UMEA 1BLPA 2UV0E 1SDNA 4ZJ2A 3MSHA 3LIAA 4BBTA 5CEBA 1ZTUA 4WLAA 2OLVA 1IYSA 2P9VA 1OT9A 3WRZA 1XJ6A 2K7SA 2HF6A 1FSWA 1DP8A 2QWSA 5HD5A 2JKTM 1PYYA 3BJNA 2DMWA 4F3LA 4WL9A 3OCNA 4ZRRA 3OZHA 2HPBA 5HAIA 1YKDA 3MZFA 2DRWA 2JE5A 4UQIS 4F94A 3LR3A 4DE1A 1PIOA 3BECA 3R7WA 3OC2A 3VP0A 1YQSA 1S67L 3NOTC 4BLMA 1NYYA 2ZJ9A 4CLCE 2HDQA 3ZHHA 1XX2A 3P01A 3VE4A 1XGJA 3CI6A 4GCZA 1RP5A 3PR6A 4Z9QA 1MWTA 4M3KA 2WAEA 4K0WA 3IF6B 4HP4A 3TRCA 2AVXA 3V3SA 4X6TA 5EVIB 4C6YA 3G2YA 4GZBA 3FG8A 5FI7A 1HVBA 3Q7VB 2INWA 4DJ3A 1H5XA 2QYBA 4ZBEA 1VB6A 4ZJ1A 5EV0A 1GSVA 2ZMAA 3N6IA 3MKFA 5TGFA 2Y2QA 1N9BA 3OPPA 4UEYA 2GJ3A 3MF0A 3SOIA 1ES5A 4YINA 1BLCA 2Y2NA 3IX4A 3G6OA 5CGSA 5G4ZA 1FOFA 4NXGA 1W8YA 3LR0A 2WKQA 2H10A 3PTEA 1FR1A 1IOUA 3KSIA 1XKZA 2HJEA 4RYEA 3EGXC 1KVMA 1K56D 1XJ4A 2ZM2A 2QPNA 4HJ3A 4OKPA 2O9AA 2HJ9C 2XA7M 2JC7A 4PAUA 4GNUA 1T18A 3ZGAB 3DWKA 4L9EA 1SKFA 4KUOA 2J80A 1PZPA 4OPRA 5U47A 2VEAA 3ITBA 2M7UA 4GHIB 4HESA 1OTAA 4E3OA 3LIBA 5HW3A 4X69A 4E3KA 2VZWA 2NUPC 4Y15A 4S2JA 3JPUA 2PDRA 3IBJA 3KSFA 1UWPX 1SKOA 2ZC3B 5DTTA 2OAQ1 5AJGA 2PHYA 5AVEA 1CF0A 3A3EA 4S2PA 3ZVWA 3SH8A 2J9PA 4WZ5C 3IHBA 1K55A 1NRJA 4RQ9A 3O5YA 3BRMA 2JKFA 1LL5A 3ULFA 3OLOA 1XJ3A 2Y79A 1MWRA 5FATA 3TW8A 3D4FA 1CEGA 3ITAA 1OTDA 5F6AA 3BWLA 4R1GA 1OTEA 2Y55A 3VP1A 4E3LA 4OPZA 2P7JA 4I3IA 3HLCA 2HDRA 3OCLA 1NZUA 2V0WA 3IXBA 3G32A 1GCEA 3Q7VA 3DWZA 5FEFA 3O3VA 2XFTA 1A0KA 3RFBA 3AGFA 1WYCA 1H3QA 3IH8A 4MN5A 4XT2A 4ETXA 4JGPA 3C4OA 3SH9A 1STZA 3A3IA
chains in the Genus database with same CATH topology
3LIEA 3RH8B 2W3HA 1LSXA 4Y3IA 2JKRM 4Q0HA 4EXOA 1MZUA 4CLCA 1TS0A 2VJWA 3LIDA 2VGLM 3PBQA 1F98A 2O99A 1NLYA 3T4JA 1OTIA 2D02A 1DP6A 4HI4A 3IBRA 4H6JB 2EWWA 5F69A 3ICYA 4M4XA 4HJ6A 2KLIA 4GJ4A 2XA7S 3T50A 3HCYA 3K2NA 4HJ4A 5TBMA 3E0YA 3JVVA 4IJGA 3T4OA 2JHEA 1OTBA 3F1OA 4Z1WA 3MJQA 1TF1A 3KYQA 3MR0A 3OOVA 3EQUA 4O01A 3CAXA 5J4EA 1Y28A 3S7PA 2GX5A 3R4KA 3UB8A 2FH5A 3PBNA 2OWHA 5AVFA 1UWNX 3KSHA 2J3TD 2NUTC 1N9NA 1LT0A 3D3OA 4AFIA 5DJUA 4LRYC 1GSWA 2M1CA 4R70A 5HPIA 3KYZA 4ARZA 5HDSA 3PHYA 3T4KA 5C5KA 4EERA 3FPWA 4HOIA 5TJJA 4BBUA 4O8GA 4GW9A 1YSQA 4K08A 4IHQA 3PXPA 3EEHA 4CQHA 3A0VA 1D7EA 2B18A 2W0NA 4L9GA 4DMZA 2K2NA 4NXEA 2BASA 2ZBBA 1KOUA 3H82B 3B33A 2QHKA 4DJ2A 2W1TB 4ETZA 3UE6A 3A0RA 4WF0A 1V9YA 2K31A 3CUEA 4II7A 1UGUA 4IUKA 2EA9A 2J3TC 2V1AA 2J3WA 4GHIA 2KOIA 1OPXA 4B9OA 4LRXC 3NJAA 1TS6A 3LI9A 3V67A 3F1PB 4WN5A 4Y2FA 2H28A 4EW7A 2A2LA 5LBRA 2A24B 3ZQ5A 2W27A 1S4RA 3H9WA 4E04A 1JNUA 4O0PA 1S1ZA 3K3CA 2QKPA 4HH3A 3A0SA 3C30A 4HNBA 5KSHA 2I9VA 3CUEC 4HH2A 3R7WB 3OBFA 5K5BA 4WELA 1T1AA 2OWJA 1YAXA 5HPFA 2P08A 4HQAA 4IUHA 3KSGA 4MN6A 1TS8A 3MQQA 3P7NA 3UB6A 3PBTA 3T4QA 2IA2A 2VV8A 5HWWA 4LPZA 4WEJA 2V1BA 4MCWA 3BY8A 4I39A 4BMWA 4BJPA 1W63M 3EQVA 3BQ8A 4KQOA 2M7VA 2W1TA 2W3GA 4FOFA 3UMEA 2V9AA 4I5SA 4JGRA 3LIAA 4GS9A 4BBTA 2Z6DA 5I5LA 5HSQA 1P9WA 2G7UA 2OAP1 1ZTUA 4R6LA 4PKYG 4WLAA 3FPVA 4PKYA 3IS2B 1TD5A 2PYRA 3E98A 2ZOHA 1OT9A 1XJ6A 2YKFA 2K7SA 2EWVA 2HF6A 3B42A 1DP8A 3GECA 2QWSA 5HD5A 2JKTM 4Q0JA 2W3EA 2V0UA 1ODVA 2PD7A 2Z6CA 1P97A 3BJNA 2DMWA 4NKPA 2MJ6A 3D72A 3C8CA 3BQAA 1GSXA 4EQ1A 4EETB 4WL9A 3OCNA 4ZRRA 4F3LA 3SW1A 3NOPC 2A24A 1YKDA 2PT7A 5HL6A 2L0WA 2JN7A 1T1CA 4UQIS 3LR3A 4MN7A 1H8MA 2HGVA 5FL3A 1BYWA 3R7WA 2PYPA 4B93A 4EUVA 3OC2A 4I3JA 4OOMA 5A8BA 3ZYTA 1S1YA 1S67L 3IS2A 5IU1A 3NOTC 3UE3A 2CMNA 4P6ZS 1S66L 3LR4A 1S4SA 4CLCE 2GZAA 1G28A 4I3AA 3S7OA 3P01A 4HHDA 2OOLA 3VE4A 3CI6A 4DN0A 4HY8A 4XT2B 3E4PA 3EWKA 1IFQA 4GCZA 3C2WA 3PYPA 2PR5A 3PR6A 3LI8A 2QJ5A 4WEKA 3RTYA 2L4RA 1N9LA 1ZHHB 4HP9A 1MC0A 4HP4A 4QPRA 3H82A 4GS9B 3TRCA 1X0OA 4YWZA 4YNRA 5KIZA 5EFWA 3FG8A 3EOIA 3VV4A 2GNXA 4OOLA 4L9FA 2INWA 4JGQA 3TJZC 2ZMFA 2O9CA 4DJ3A 2QYBA 3T4SA 2KDKA 4Q0IA 1VHMA 2ZOIA 3GDIA 5MC7A 2P04A 1T1BA 1WA9A 1VB6A 3F1NB 3UMDA 3NOUC 5DF9A 4EESA 1GSVA 1MKMA 1W63Q 2D01A 4NEED 4G3VA 2GJ3A 4UEYA 3MF0A 1DRMA 3MMHA 4BBVA 2LB5A 2W3FA 4L0LA 5DJTA 3G6OA 3NHQA 5G4ZA 4NXGA 2HV1A 3LR0A 5DKKA 4KUKA 3F1OB 2WKQA 1P0ZA 4BWIA 3B47A 4LLOB 3LUQA 2VA0A 4HIAA 1IOUA 2VX8A 3KSIA 3JVUA 4ARZB 4EEUA 2HJEA 2PD8A 3EGXC 1XJ4A 4HJ3A 3W2ZA 2O9AA 2HJ9C 5HD3A 3VOLA 3VE3A 2YKHA 3LYXA 4MDZA 2XA7M 4UQIM 3LFVA 4PAUA 3T4TA 4MMNA 3CLOA 1T18A 5IS1A 2JKTI 4L9EA 2FZ0A 2VGLS 2VKSA 4G3KA 4KUOA 2J80A 1OJ5A 1YSPA 3F1PA 3MQOA 2VEAA 5L8MA 2W1RA 2M7UA 4GHIB 1OTAA 2L1MA 4KQDA 3FC7A 3LIBA 4H6JA 4JGOA 4Y5FA 2R78A 5DFXA 2VV7A 2W3DA 3KO6A 3PBRA 2VZWA 2NUPC 5CX7A 3S7NA 2PDRA 3IBJA 3KSFA 3S7QA 2VV6A 2XROA 1UWPX 3MXQA 1EW0A 3LR5A 1F9IA 2QJ7A 5HDDA 2OAQ1 3DBAA 2Y8HA 5AJGA 4CLCC 5F5YA 2O9BA 4NXBA 2PHYA 5AVEA 1F5MA 4PHTA 4R38A 5DFYA 1LSWA 3UB7A 1OJGA 5G4YA 1XFQA 1NRJA 4RQ9A 5F68A 4CLCB 2XSSA 1DP9A 2O0YA 3PBOA 3HJIA 3O5YA 4I38A 3K3DA 1NWZA 5DKLA 3TE8A 1N9OA 2XRNA 3ULFA 3E4QA 3KX0X 3OLOA 1XJ2A 1XJ3A 2WKRA 3BY9A 2Y79A 5HDCA 3H7WB 4WUJA 4EEPA 3TW8A 1P9RA 3T4LA 5HZHA 3C38A 2KX6A 1OTDA 5F6AA 5HWTA 3BWLA 3LICA 1OTEA 2ZMVA 3EGDC 1V9ZA 3MQ0A 5TBMB 4P6ZM 2P7JA 2B02A 2PR6A 3F1NA 4G3WA 1D06A 3PBSA 4FSFA 4I3IA 2VLGA 1LSVA 3OCLA 4R3AA 1G6OA 2JKRI 4LRZE 3BW6A 2V0WA 5HWVA 3H7WA 1NLZA 3MFXA 1LL8A 3CWFA 2WKPA 4NXFA 5J3WA 5IT5A 3UB9A 2LB9A 3HJKA 3RFBA 1XFNA 1TS7A 3E4OA 1H3QA 3U2AA 3CITA 4CLCD 4GLQA 4YOFA 1T19A 3LIFA 4ME4A 4MN5A 5J7EA 1OT6A 4XT2A 4ETXA 4JGPA 1STZA 4F3LB 4EU0A 3EEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y5F A;  2W3H A;  3C2W A;  3OBF A;  5DFX A;  5K5B A;  2W3D A;  4Y3I A;  5HPF A;  3KO6 A;  4Q0H A;  4IUH A;  1MC0 A;  3KSG A;  2VJW A;  2VZW A;  4QPR A;  3TRC A;  3S7N A;  2O99 A;  3IBJ A;  3KSF A;  3S7Q A;  2IA2 A;  4YNR A;  2XRO A;  3IBR A;  3VV4 A;  2KLI A;  4MCW A;  3DBA A;  2Y8H A;  3HCY A;  3K2N A;  5AJG A;  2M7V A;  3E0Y A;  2O9B A;  4IJG A;  2ZMF A;  2O9C A;  2W1T A;  2W3G A;  2QYB A;  4FOF A;  4Q0I A;  1F5M A;  4Z1W A;  5DFY A;  1TF1 A;  1VHM A;  3OOV A;  4O01 A;  5I5L A;  5HSQ A;  4RQ9 A;  2G7U A;  2XSS A;  3NOU C;  4R6L A;  1ZTU A;  2O0Y A;  1TD5 A;  3O5Y A;  3S7P A;  2GX5 A;  1MKM A;  3R4K A;  3E98 A;  2XRN A;  4G3V A;  2Y79 A;  3MF0 A;  3KSH A;  3MMH A;  3D3O A;  4Q0J A;  4LRY C;  2LB5 A;  2W3F A;  2W3E A;  3NHQ A;  3G6O A;  4R70 A;  3BJN A;  5HPI A;  5C5K A;  4BWI A;  3MQ0 A;  4ZRR A;  5TJJ A;  4O8G A;  4GW9 A;  3NOP C;  1YSQ A;  4G3W A;  3KSI A;  1YKD A;  4CQH A;  5HL6 A;  2B18 A;  4DMZ A;  2K2N A;  4LRZ E;  4EU0 A;  2W1T B;  4MN7 A;  4ETZ A;  3W2Z A;  2O9A A;  2HGV A;  2K31 A;  4EUV A;  4IUK A;  4MDZ A;  2LB9 A;  3LFV A;  4PAU A;  2KOI A;  4MMN A;  3RFB A;  4LRX C;  3NOT C;  3CIT A;  4GLQ A;  2VKS A;  4G3K A;  4YOF A;  4ME4 A;  4Y2F A;  1YSP A;  2VEA A;  5LBR A;  3ZQ5 A;  5L8M A;  3S7O A;  2W1R A;  2M7U A;  4ETX A;  4E04 A;  2OOL A;  1STZ A;  4O0P A;  3CI6 A;  4DN0 A;  3EEA A; 
#chains in the Genus database with same CATH topology
 3A3F A;  3RH8 B;  1LHY A;  4EXO A;  1MZU A;  1TS0 A;  3DTK A;  3UPN A;  2O99 A;  1YM1 A;  1MKI A;  3IBR A;  4GJ4 A;  5A91 A;  3HCY A;  4HJ4 A;  4WMC A;  3E0Y A;  1PZO A;  4QU3 A;  4IJG A;  4U0X A;  5FQQ A;  3F1O A;  3MJQ A;  1TF1 A;  3ZG8 B;  3EQU A;  3CAX A;  2HDU A;  2GX5 A;  1W5D A;  3PAE A;  2OWH A;  1I5Q A;  3IF5 A;  4WMC D;  1NRF A;  4N1H A;  1LT0 A;  5DJU A;  1WYB A;  3UN7 A;  3IH9 A;  3UO9 A;  5GHZ A;  5HPI A;  3KYZ A;  2Y2H A;  3PHY A;  5C5K A;  4EER A;  4IBR A;  5TJJ A;  5E2H A;  1E3U D;  3HBR A;  3M6H A;  3N7W A;  5F1F A;  2B18 A;  4NG2 A;  4EBL A;  1D1J A;  2BAS A;  3HLB A;  2ZBB A;  3BM6 A;  3B33 A;  1ONG A;  4ETZ A;  3IF6 C;  3PAG A;  4QB8 A;  2K31 A;  4IUK A;  2KOI A;  1TS6 A;  2Z2M B;  3VP3 A;  4WN5 A;  1L3L A;  2V8C A;  4KZ3 A;  2A24 B;  5GLB A;  4OPY A;  2HP6 A;  5F82 A;  1W7F A;  1JNU A;  5GL9 A;  2Q9N A;  3A0S A;  1AWI A;  2Y2M A;  3CUE C;  4HH2 A;  5K5B A;  4WEL A;  5HPF A;  3G30 A;  4IUH A;  4MN6 A;  1TS8 A;  5AQ7 A;  4DXB A;  3V50 A;  4OPQ A;  4QY6 A;  4LPZ A;  3L9K A;  4WEJ A;  3NY4 A;  3HUN A;  1W63 M;  2M7V A;  1XPB A;  5CRF A;  3NCK A;  5E2F A;  2XDM A;  4I5S A;  1VM1 A;  2Z6D A;  3UNW A;  5HSQ A;  3IF6 A;  2G7U A;  2OAP 1;  3BFF A;  4PKY A;  3IXD A;  2PYR A;  2ZOH A;  2Y2O A;  2J7V A;  4N9K A;  5EE8 A;  2X71 A;  5E2G A;  4HBT A;  4QY5 A;  4Q0J A;  2W3E A;  2ZQD A;  1K25 A;  2Z6C A;  2PU4 A;  4S2N A;  2MJ6 A;  3VOY A;  3S22 A;  3NBL A;  3SW1 A;  3VMA A;  4JXV A;  4N9L A;  2BLS A;  2IWB A;  2PT7 A;  1K6R A;  2JN7 A;  3QP2 A;  1KE3 A;  3T1Q B;  4MN7 A;  1H8M A;  5FSR A;  3VP4 A;  1BYW A;  1LI9 A;  4OOM A;  1S1Y A;  1PI5 A;  3C7U A;  1LL9 A;  2WKE A;  4DE3 A;  4P6Z S;  4KZ9 A;  3W4Q A;  3LR4 A;  1O7E A;  1S4S A;  1FCO A;  4Q8I A;  4I3A A;  4LCL A;  3S7O A;  3HL9 A;  1K54 C;  4JKT A;  1IFQ A;  3C2W A;  3PYP A;  1YLT A;  3LI8 A;  3WS4 A;  3RTY A;  1K38 A;  4HP9 A;  4KZA A;  2R9X A;  2J8Y A;  4GS9 B;  3BEB A;  5FI2 A;  5KIZ A;  4QHC A;  3EOI A;  1N4O A;  1FIK A;  4MBK A;  4JGQ A;  3TJZ C;  2O9C A;  3T4S A;  2HP5 A;  3ZVT A;  2KDK A;  4GKU A;  5FDH A;  5MC7 A;  1T1B A;  4KG5 A;  1K4F A;  2EX9 A;  3F1N B;  5DF9 A;  4JXS A;  1GA9 A;  5FQI A;  2C6W B;  4OP5 A;  5CED A;  3M6B A;  3NEC A;  3AGE A;  1FCM A;  2J9O A;  3P98 A;  3OPR A;  1PW8 A;  4BBV A;  1HTZ A;  2LB5 A;  2W3F A;  3NHQ A;  1JWP A;  3BFG A;  4LEN A;  5DKK A;  3F1O B;  4Y7P A;  1JTD A;  4LLO B;  1H8Y A;  5EOO A;  4UA9 A;  4OH0 A;  3JVU A;  3QP6 A;  3VOZ A;  1JVJ A;  3IWI A;  1BLH A;  1F2K A;  2EXA A;  5HD3 A;  1SZV A;  2YKH A;  4Y0O A;  3LYX A;  4UQI M;  2R9W A;  4EBN A;  3T4T A;  4MMN A;  4FH2 A;  3MS6 A;  5FQK A;  2VGL S;  1KE4 A;  1YSP A;  3RXX A;  4R3B A;  4PM7 A;  1MXO A;  2ZC6 B;  2L1M A;  4KQD A;  3NC8 A;  4H6J A;  5M1A A;  4Y5F A;  3SZT A;  2R78 A;  2VV7 A;  4JPM A;  3LY4 A;  3S7N A;  4KEN B;  3S7Q A;  3ZG9 B;  1ZC2 A;  1F9I A;  5HDD A;  4KZ7 A;  3DBA A;  4LV2 A;  4CLC C;  3IWQ A;  4IED A;  4PHT A;  4BL2 A;  5DFY A;  1LSW A;  1WE4 A;  2FFF B;  3UB7 A;  1G6A A;  4LV1 A;  4CLC B;  2XSS A;  1DP9 A;  4I38 A;  5FAQ A;  3K3D A;  5DKL A;  4GDB A;  4D60 A;  1EI5 A;  5HDC A;  4BEN A;  1L0F A;  1YMS A;  1ZKJ A;  5CGX A;  3T4L A;  5HZH A;  4B4X A;  2ZMV A;  4X53 A;  4LFU A;  2B02 A;  1LLB A;  1D06 A;  2VLG A;  5EPH A;  2JKR I;  2WGW B;  1YLJ A;  3WS5 A;  4OQH A;  1FIL A;  2VK3 A;  1NLZ A;  5FDS A;  3LEZ A;  3MFX A;  1LL8 A;  3NIA A;  5HAQ A;  1OME A;  4B4Z A;  2WKP A;  3C5A A;  1RGZ A;  3A3D A;  1ES2 A;  2XK1 A;  3UB9 A;  4RVA A;  1XFN A;  1E4D A;  4LV3 A;  1I2S A;  1Q2Q A;  3CIT A;  4MEZ A;  4GB7 A;  3LIF A;  1RCJ A;  3UPO A;  2Y2K A;  4D2O A;  1OT6 A;  2OLU A;  2BTF P;  1DJA A;  1JWV A;  2Y59 A;  3LIE A;  2W3H A;  5FQJ A;  4DRT A;  4CLC A;  1L0D A;  3HLF A;  3FZC A;  3MFD A;  1J3W A;  1OTI A;  2D02 A;  4HI4 A;  4H6J B;  4IBX A;  2KLI A;  2XA7 S;  3T50 A;  3Q81 A;  2CC1 A;  1K57 C;  2G2U A;  3FYZ A;  4E6X A;  4OQI A;  3KYQ A;  3OOV A;  1G5U A;  4OP8 A;  5J4E A;  1K57 A;  4C75 A;  3S7P A;  2PRF A;  3MZD A;  3UB8 A;  3IT9 A;  5EVE A;  3CMZ A;  1UWN X;  2J3T D;  2EX2 A;  3IXG A;  1IKI A;  1GSW A;  2M1C A;  4E3J A;  5FAO A;  1JWZ A;  1ERQ A;  4ARZ A;  1CK3 A;  2XEP A;  4K0X A;  4UA6 A;  3N8R A;  3FPW A;  3S1Y A;  4O8G A;  4ZJ3 A;  1YSQ A;  2Y91 A;  5J8X A;  5EUA A;  4NXE A;  3GMW A;  1KOU A;  1IKG A;  2Q9M A;  3UE6 A;  4WF0 A;  4XUZ A;  1CEF A;  3CUE A;  4ESP A;  2BG1 A;  2Y2J A;  3U4L P;  1HZO A;  1PNE A;  3TOI A;  3V67 A;  3T12 B;  4E6W A;  4EV4 A;  1MWU A;  3WRT A;  5DF8 A;  4P0M A;  1K56 A;  1S4R A;  3DW0 A;  3IQA A;  4QJG A;  4R4S A;  3LEQ A;  4BD0 A;  1KGF A;  1S1Z A;  3ZG7 B;  1L0E A;  4HNB A;  5CHU A;  3OBF A;  4OLG A;  1T1A A;  4HQA A;  2EX8 A;  2VGK A;  1PWG A;  1FSY A;  3MQQ A;  2IA2 A;  1SDE A;  3BY8 A;  3GTC A;  4BMW A;  4BJP A;  3EQV A;  2XH9 A;  2W3G A;  3AGD A;  1SHV A;  4PM9 A;  3QP4 A;  2V9A A;  4IVI A;  3BLS A;  4JGR A;  4GS9 A;  1P9W A;  4R6L A;  4R4R A;  4FTX A;  4PKY G;  5DF7 A;  3T1X A;  1TD5 A;  1G68 A;  3HLW A;  3E98 A;  4N1X A;  5L10 A;  3G35 A;  3W4P A;  2EWV A;  1KGG A;  1I2W A;  2Q0O A;  3VSL A;  5AQ9 A;  2A3U A;  2ACG A;  4KQQ A;  2V0U A;  2HZ5 A;  4KG2 A;  2WKI A;  3C8C A;  4R3J A;  3DTM A;  1NYM A;  3BQA A;  4PM6 A;  2PBD P;  4EET B;  5E2E A;  4C3Q A;  1XA1 A;  5IHV A;  4GD8 A;  5EVI A;  4P6B A;  2ZC5 B;  5HL6 A;  1T1C A;  4GDN A;  2XQZ A;  4PM5 A;  5E43 A;  3V3R A;  1IEM A;  4S2O A;  4B93 A;  2Y4A A;  5A8B A;  3ZYT A;  3MBZ A;  4RX3 A;  3IS2 A;  5AQA A;  4X25 A;  3HRE A;  3LO7 A;  3RXW A;  3ZFZ A;  1S66 L;  2WGW A;  5KSC A;  5EVI C;  1LI0 A;  5CXW A;  3Q07 A;  4GOG A;  2V8F A;  1KGE A;  4DN0 A;  4XT2 B;  3EWK A;  3M2K A;  2IWD A;  4GN2 A;  5G18 A;  2QJ5 A;  5EEC A;  4WEK A;  1VET B;  1N9L A;  1ZHH B;  1MC0 A;  2G2W A;  4QPR A;  3H82 A;  1X0O A;  4YNR A;  5EFW A;  3VV4 A;  2ZM0 A;  5FQM A;  1TEM A;  4L9F A;  1GA0 A;  2ZMF A;  4UAA A;  4OON A;  3ZNT A;  1VHM A;  2ZOI A;  3GDI A;  2P04 A;  2Y2G A;  1WA9 A;  3UMD A;  3NOU C;  4EES A;  1W63 Q;  2D01 A;  1IYO A;  4NEE D;  3DTI A;  5D3O A;  1L0G A;  4G3V A;  4S2N C;  3BFE A;  4YFM A;  1DRM A;  5TFQ A;  4P87 A;  3UDX A;  1ERO A;  2RCX A;  1C3B A;  2DNS A;  2WZX A;  2WAF A;  4WM9 A;  3NUL A;  3CG5 A;  4CJN A;  4BWI A;  3LUQ A;  1E25 A;  4Y0T A;  4MBH A;  4HIA A;  2VX8 A;  2ZQ7 A;  4EEU A;  1M6K A;  2PD8 A;  4KG6 A;  3Q1F A;  3RJU A;  3VFF A;  3UE1 A;  1S0W A;  5HAR A;  3W2Z A;  4ZAM A;  3VOL A;  4E3N A;  3UB5 P;  2VGJ A;  3G4P A;  3MZE A;  4HBU A;  4OLD A;  2JKT I;  2ZQA A;  5HAP A;  2FZ0 A;  1VQQ A;  1DJB A;  1HLU P;  2H0Y A;  4DXC A;  5CTM A;  3ZDJ A;  2W1R A;  4ID4 A;  3WS0 A;  3FC7 A;  1FCN A;  2W3D A;  4BD1 A;  3PBR A;  1MWS A;  5CX7 A;  5A92 A;  2C5W B;  4KZ4 A;  1XA7 A;  2XRO A;  4KQR A;  3MXQ A;  1EW0 A;  3LR5 A;  3MXR A;  2Y8H A;  3G31 A;  3VSK A;  4N92 A;  1PFL A;  1F5M A;  3QNB A;  4R38 A;  5I94 A;  3C4P A;  5JYP A;  4KZ5 A;  1OJG A;  3W8K A;  5G4Y A;  3HUO A;  5F68 A;  1DJC A;  2O0Y A;  2WK0 A;  2ZC7 A;  3SS3 A;  3QP1 A;  5F1G A;  4UHU A;  3LCE A;  3KX0 X;  1XJ2 A;  1S6R A;  2WKR A;  3BY9 A;  1J9M A;  5F83 A;  3H7W B;  1P9R A;  2FFY A;  3LIC A;  3OPL A;  3V39 A;  3EGD C;  5TBM B;  4DDY A;  2PR6 A;  4G3W A;  1TVF A;  4FSF A;  2QZ6 A;  4IVK A;  4R3A A;  2PBY A;  1PRQ A;  1IYQ A;  3H7W A;  3CWF A;  1IEL A;  3WS2 A;  3WWX A;  2WYX A;  1ACF A;  3IWO A;  1Y4O A;  2XF3 A;  5J3W A;  1H8Z A;  3QNC A;  3HJK A;  5GHX A;  1ZG4 A;  1H0M A;  1TS7 A;  3E4O A;  3O86 A;  3U2A A;  1CI9 A;  4CLC D;  4ZDX A;  4LGW A;  1K4E A;  3IX3 A;  1CQA A;  4ME4 A;  1JTG A;  5J7E A;  4U0T A;  4EU0 A;  3G2Z A;  3GVB A;  5JYO A;  1LSX A;  4Y3I A;  3L7H A;  4Q0H A;  4WYY A;  5KMW A;  1AXB A;  3LID A;  1VET A;  4H8R A;  4X1L A;  1NLY A;  3N4I A;  3T4J A;  1ALQ A;  5DVA A;  1DP6 A;  2EWW A;  3ICY A;  2XD1 A;  4HJ6 A;  4M4X A;  3K2N A;  2WGI A;  1PW1 A;  1CI8 A;  4S2I A;  3T4O A;  4EQI A;  4X1M A;  1YPR A;  4OVD A;  1Y28 A;  5HFO A;  3R4K A;  3FKV A;  3ZG5 A;  3PBN A;  5AVF A;  2UWX A;  1YLW A;  3KSH A;  1N9N A;  2ZM8 A;  3D3O A;  5A93 A;  4XXR A;  3Q82 A;  4S2M A;  1YLP A;  1MPL A;  1W79 A;  5HDS A;  2P9V B;  3T4K A;  1ES4 A;  2ZQ9 A;  2EXB A;  4HOI A;  5FEG A;  5CER A;  4GW9 A;  1BTL A;  1K55 C;  4L9G A;  4DMZ A;  2K2N A;  2QHK A;  4DJ2 A;  3A0R A;  5GLC A;  1MBL A;  1TDL A;  4II7 A;  4XUX A;  2PAV P;  1UGU A;  2V1A A;  3E2K A;  1QMF A;  2J3W A;  5FI6 A;  3TG9 A;  3NJA A;  3BLM A;  4WZ4 A;  1NXY A;  3F1P B;  4JXW A;  3HLD A;  2H28 A;  2A2L A;  5LBR A;  1PWD A;  2W27 A;  5DTK A;  2P74 A;  1Z09 A;  4O0P A;  4Y17 A;  1BZA A;  4HH3 A;  3NDE A;  4U3T A;  3C30 A;  5KSH A;  2I9V A;  4S2L A;  1BSG A;  2OWJ A;  1BT5 A;  1YAX A;  4PPR A;  1XGI A;  1PWC A;  3UPP A;  3PBT A;  3T4Q A;  2VV8 A;  1ERM A;  2Y2P A;  3QP5 A;  4R23 A;  4I39 A;  4DF6 A;  3N8S A;  3BQ8 A;  4PMA A;  3G34 A;  2W1T A;  4MLL A;  3BFC A;  4FOF A;  1E3U A;  1ONH A;  1YT4 A;  2XFS A;  5I5L A;  1KE0 A;  3FPV A;  3IS2 B;  2E8I A;  3MKE A;  3CJM A;  1NY0 A;  3I7J A;  4MNR A;  2YKF A;  3B42 A;  3QHY A;  3GEC A;  4O7D A;  2JCH A;  4JXG A;  1TDG A;  5M18 A;  1ODV A;  2PD7 A;  1P97 A;  5L07 A;  4NKP A;  3IHA A;  3D72 A;  1RGY A;  1GSX A;  4EQ1 A;  2ZQC A;  1FQG A;  2H5S A;  1K54 A;  3NOP C;  2A24 A;  4KZ8 A;  2E8J A;  3T1S A;  4DE0 A;  2L0W A;  3LY3 A;  2JKG A;  4LV0 A;  4P85 A;  4FCF A;  3W4O A;  3HLG A;  2HGV A;  5FL3 A;  1XP4 A;  2EX6 A;  3O87 A;  3ZNY A;  2PYP A;  4EUV A;  2B95 A;  4GD6 A;  4I3J A;  1K6S A;  3V5M A;  3E2L A;  5IU1 A;  1W8Q A;  5FQ9 A;  3UE3 A;  3BYD A;  4RX2 A;  5EVL A;  5KZH A;  2CMN A;  3GSG A;  3MXS A;  5FA7 A;  3HVF A;  4X55 A;  3ZG0 A;  2GZA A;  1G28 A;  2ZLY A;  3FWL A;  4HHD A;  2OOL A;  4MBF A;  5FAP A;  4HY8 A;  4X56 A;  3E4P A;  2WUQ A;  3JYI A;  2ZQ8 A;  2PR5 A;  2L4R A;  3B3X A;  2V2F F;  4RA7 A;  4YWZ A;  1XXM A;  2JBF A;  2DCF A;  4R0Q A;  5L09 A;  4KZ6 A;  2GNX A;  3NDG A;  4OOL A;  4B88 A;  4NK3 A;  2EFX A;  3GRJ A;  4Q0I A;  1Y54 A;  1BUE A;  1ZG6 A;  5GLA A;  2B5R A;  3O88 A;  1MKM A;  4E3I A;  4NET A;  3SS4 A;  2PU2 A;  4CPK A;  2OSU A;  2Y2L A;  3MMH A;  2ZL1 B;  4L0L A;  5DJT A;  2EFU A;  5A90 A;  2HV1 A;  4KUK A;  3KYE A;  4Y0U A;  1NZO A;  1P0Z A;  3B47 A;  3DAV A;  2X01 A;  2VA0 A;  5EM0 A;  3SS5 A;  4K91 A;  1GHI A;  1QME A;  4ARZ B;  4EBP A;  5EM1 A;  3GV9 A;  5AQB A;  1ESU A;  3VE3 A;  4OQG A;  4FH4 A;  3T1R A;  4LCM A;  5HX9 A;  4MDZ A;  5EOE A;  2WGV A;  3LFV A;  3CLO A;  2Y2I A;  5IS1 A;  4FUW A;  1BLS A;  2VKS A;  4G3K A;  1OJ5 A;  3F1P A;  3MQO A;  1Z6F A;  4JF6 A;  1SCW A;  5L8M A;  1VEU B;  4KZB A;  4HEF A;  4A5R A;  5GHY A;  1YLY A;  3VP2 A;  3CZD A;  4JGO A;  3HLE A;  5DFX A;  1KDW A;  3KO6 A;  5GLD A;  1FR6 A;  1GHM A;  1PI4 A;  2RL3 A;  1ESI A;  3CPT B;  4DDS A;  2VV6 A;  3Q7Z A;  2QJ7 A;  4UA7 A;  1K0K A;  2A49 A;  1KVL A;  5F5Y A;  2O9B A;  4NXB A;  4DE2 A;  2XGN A;  3S4X A;  5L2F A;  1KDS A;  4OOY A;  1XFQ A;  4FD8 A;  4JBF A;  4JLF A;  3PBO A;  3HJI A;  3M2J A;  1Q2P A;  3GQZ A;  1NWZ A;  3TE8 A;  1SKO B;  4QD4 A;  1N9O A;  5DTS A;  2XRN A;  2ZC4 B;  4X68 A;  3E4Q A;  5CEC A;  4ZTK A;  1BUL A;  3HUM A;  4WUJ A;  4WBG A;  4EEP A;  2ZL1 A;  3C38 A;  2KX6 A;  5HWT A;  1HD8 A;  5FAS A;  1V9Z A;  2XLN A;  3MQ0 A;  4P6Z M;  3F1N A;  3FKW A;  3PBS A;  4BQM A;  1LSV A;  1G6O A;  4LRZ E;  3BW6 A;  3VFH A;  5HWV A;  2V20 A;  2IWC A;  3UDI A;  4Y13 A;  4WZ5 A;  2QMI A;  1U60 A;  4NXF A;  5IT5 A;  3WS1 A;  5CGW A;  2LB9 A;  1EWZ A;  4JF5 A;  5CHM A;  5CHJ A;  5EVI D;  4GLQ A;  4YOF A;  1T19 A;  3LGO A;  2ZD8 A;  4EWF A;  4F3L B;  4E3M A;  3EEA A;  2OV5 A;  5CTN A;  4EUZ A;  1O07 A;  2XR0 A;  2JKR M;  3SH7 A;  2HDS A;  2VJW A;  2VGL M;  4QWO A;  3PBQ A;  1F98 A;  5BOH A;  3UY6 A;  5F69 A;  2I72 A;  2H0T A;  5TBM A;  1VEU A;  3UE0 A;  3JVV A;  2JHE A;  1OTB A;  4Z1W A;  3CPT A;  3MR0 A;  1NJ4 A;  4O01 A;  4S2K A;  2WKH A;  1ES3 A;  2FH5 A;  1M40 A;  2V1Z A;  3QP8 A;  2NUT C;  4AFI A;  4LRY C;  1IYP A;  4R70 A;  3D9Y A;  3NI9 A;  2Z2L B;  4JF4 A;  2X02 A;  5M19 A;  4BBU A;  5HL1 A;  3P09 A;  4K08 A;  4IHQ A;  3PXP A;  3EEH A;  4CQH A;  1GHP A;  3A0V A;  1D7E A;  2W0N A;  4PM8 A;  4DKI A;  3H82 B;  1YLZ A;  2HP9 A;  3ZCZ A;  2W1T B;  1L2S A;  3UDF A;  3N8L A;  1V9Y A;  3DTE A;  2EA9 A;  2J3T C;  4GHI A;  5TR7 A;  1OPX A;  4B9O A;  4LRX C;  3LI9 A;  3IX8 A;  3A3J A;  4Y2F A;  3GR2 A;  4EW7 A;  3ZQ5 A;  3IXH A;  3H9W A;  3OPH A;  4E04 A;  3TSG A;  3C7V A;  3K3C A;  2QKP A;  4OQ0 A;  2WAD A;  3R7W B;  2XD5 A;  2P08 A;  3FV7 A;  2GDN A;  3KSG A;  3P7N A;  3UB6 A;  5HWW A;  1MY8 A;  4BL3 A;  2V1B A;  1DY6 A;  1CJF A;  3CHW P;  2WZZ A;  4MCW A;  4KQO A;  3BFD A;  1YMX A;  3ISG A;  3UME A;  1BLP A;  2UV0 E;  1SDN A;  4ZJ2 A;  3MSH A;  3LIA A;  4BBT A;  5CEB A;  1ZTU A;  4WLA A;  2OLV A;  1IYS A;  2P9V A;  1OT9 A;  3WRZ A;  1XJ6 A;  2K7S A;  2HF6 A;  1FSW A;  1DP8 A;  2QWS A;  5HD5 A;  2JKT M;  1PYY A;  3BJN A;  2DMW A;  4F3L A;  4WL9 A;  3OCN A;  4ZRR A;  3OZH A;  2HPB A;  5HAI A;  1YKD A;  3MZF A;  2DRW A;  2JE5 A;  4UQI S;  4F94 A;  3LR3 A;  4DE1 A;  1PIO A;  3BEC A;  3R7W A;  3OC2 A;  3VP0 A;  1YQS A;  1S67 L;  3NOT C;  4BLM A;  1NYY A;  2ZJ9 A;  4CLC E;  2HDQ A;  3ZHH A;  1XX2 A;  3P01 A;  3VE4 A;  1XGJ A;  3CI6 A;  4GCZ A;  1RP5 A;  3PR6 A;  4Z9Q A;  1MWT A;  4M3K A;  2WAE A;  4K0W A;  3IF6 B;  4HP4 A;  3TRC A;  2AVX A;  3V3S A;  4X6T A;  5EVI B;  4C6Y A;  3G2Y A;  4GZB A;  3FG8 A;  5FI7 A;  1HVB A;  3Q7V B;  2INW A;  4DJ3 A;  1H5X A;  2QYB A;  4ZBE A;  1VB6 A;  4ZJ1 A;  5EV0 A;  1GSV A;  2ZMA A;  3N6I A;  3MKF A;  5TGF A;  2Y2Q A;  1N9B A;  3OPP A;  4UEY A;  2GJ3 A;  3MF0 A;  3SOI A;  1ES5 A;  4YIN A;  1BLC A;  2Y2N A;  3IX4 A;  3G6O A;  5CGS A;  5G4Z A;  1FOF A;  4NXG A;  1W8Y A;  3LR0 A;  2WKQ A;  2H10 A;  3PTE A;  1FR1 A;  1IOU A;  3KSI A;  1XKZ A;  2HJE A;  4RYE A;  3EGX C;  1KVM A;  1K56 D;  1XJ4 A;  2ZM2 A;  2QPN A;  4HJ3 A;  4OKP A;  2O9A A;  2HJ9 C;  2XA7 M;  2JC7 A;  4PAU A;  4GNU A;  1T18 A;  3ZGA B;  3DWK A;  4L9E A;  1SKF A;  4KUO A;  2J80 A;  1PZP A;  4OPR A;  5U47 A;  2VEA A;  3ITB A;  2M7U A;  4GHI B;  4HES A;  1OTA A;  4E3O A;  3LIB A;  5HW3 A;  4X69 A;  4E3K A;  2VZW A;  2NUP C;  4Y15 A;  4S2J A;  3JPU A;  2PDR A;  3IBJ A;  3KSF A;  1UWP X;  1SKO A;  2ZC3 B;  5DTT A;  2OAQ 1;  5AJG A;  2PHY A;  5AVE A;  1CF0 A;  3A3E A;  4S2P A;  3ZVW A;  3SH8 A;  2J9P A;  4WZ5 C;  3IHB A;  1K55 A;  1NRJ A;  4RQ9 A;  3O5Y A;  3BRM A;  2JKF A;  1LL5 A;  3ULF A;  3OLO A;  1XJ3 A;  2Y79 A;  1MWR A;  5FAT A;  3TW8 A;  3D4F A;  1CEG A;  3ITA A;  1OTD A;  5F6A A;  3BWL A;  4R1G A;  1OTE A;  2Y55 A;  3VP1 A;  4E3L A;  4OPZ A;  2P7J A;  4I3I A;  3HLC A;  2HDR A;  3OCL A;  1NZU A;  2V0W A;  3IXB A;  3G32 A;  1GCE A;  3Q7V A;  3DWZ A;  5FEF A;  3O3V A;  2XFT A;  1A0K A;  3RFB A;  3AGF A;  1WYC A;  1H3Q A;  3IH8 A;  4MN5 A;  4XT2 A;  4ETX A;  4JGP A;  3C4O A;  3SH9 A;  1STZ A;  3A3I A; 
#chains in the Genus database with same CATH homology
 3LIE A;  3RH8 B;  2W3H A;  1LSX A;  4Y3I A;  2JKR M;  4Q0H A;  4EXO A;  1MZU A;  4CLC A;  1TS0 A;  2VJW A;  3LID A;  2VGL M;  3PBQ A;  1F98 A;  2O99 A;  1NLY A;  3T4J A;  1OTI A;  2D02 A;  1DP6 A;  4HI4 A;  3IBR A;  4H6J B;  2EWW A;  5F69 A;  3ICY A;  4M4X A;  4HJ6 A;  2KLI A;  4GJ4 A;  2XA7 S;  3T50 A;  3HCY A;  3K2N A;  4HJ4 A;  5TBM A;  3E0Y A;  3JVV A;  4IJG A;  3T4O A;  2JHE A;  1OTB A;  3F1O A;  4Z1W A;  3MJQ A;  1TF1 A;  3KYQ A;  3MR0 A;  3OOV A;  3EQU A;  4O01 A;  3CAX A;  5J4E A;  1Y28 A;  3S7P A;  2GX5 A;  3R4K A;  3UB8 A;  2FH5 A;  3PBN A;  2OWH A;  5AVF A;  1UWN X;  3KSH A;  2J3T D;  2NUT C;  1N9N A;  1LT0 A;  3D3O A;  4AFI A;  5DJU A;  4LRY C;  1GSW A;  2M1C A;  4R70 A;  5HPI A;  3KYZ A;  4ARZ A;  5HDS A;  3PHY A;  3T4K A;  5C5K A;  4EER A;  3FPW A;  4HOI A;  5TJJ A;  4BBU A;  4O8G A;  4GW9 A;  1YSQ A;  4K08 A;  4IHQ A;  3PXP A;  3EEH A;  4CQH A;  3A0V A;  1D7E A;  2B18 A;  2W0N A;  4L9G A;  4DMZ A;  2K2N A;  4NXE A;  2BAS A;  2ZBB A;  1KOU A;  3H82 B;  3B33 A;  2QHK A;  4DJ2 A;  2W1T B;  4ETZ A;  3UE6 A;  3A0R A;  4WF0 A;  1V9Y A;  2K31 A;  3CUE A;  4II7 A;  1UGU A;  4IUK A;  2EA9 A;  2J3T C;  2V1A A;  2J3W A;  4GHI A;  2KOI A;  1OPX A;  4B9O A;  4LRX C;  3NJA A;  1TS6 A;  3LI9 A;  3V67 A;  3F1P B;  4WN5 A;  4Y2F A;  2H28 A;  4EW7 A;  2A2L A;  5LBR A;  2A24 B;  3ZQ5 A;  2W27 A;  1S4R A;  3H9W A;  4E04 A;  1JNU A;  4O0P A;  1S1Z A;  3K3C A;  2QKP A;  4HH3 A;  3A0S A;  3C30 A;  4HNB A;  5KSH A;  2I9V A;  3CUE C;  4HH2 A;  3R7W B;  3OBF A;  5K5B A;  4WEL A;  1T1A A;  2OWJ A;  1YAX A;  5HPF A;  2P08 A;  4HQA A;  4IUH A;  3KSG A;  4MN6 A;  1TS8 A;  3MQQ A;  3P7N A;  3UB6 A;  3PBT A;  3T4Q A;  2IA2 A;  2VV8 A;  5HWW A;  4LPZ A;  4WEJ A;  2V1B A;  4MCW A;  3BY8 A;  4I39 A;  4BMW A;  4BJP A;  1W63 M;  3EQV A;  3BQ8 A;  4KQO A;  2M7V A;  2W1T A;  2W3G A;  4FOF A;  3UME A;  2V9A A;  4I5S A;  4JGR A;  3LIA A;  4GS9 A;  4BBT A;  2Z6D A;  5I5L A;  5HSQ A;  1P9W A;  2G7U A;  2OAP 1;  1ZTU A;  4R6L A;  4PKY G;  4WLA A;  3FPV A;  4PKY A;  3IS2 B;  1TD5 A;  2PYR A;  3E98 A;  2ZOH A;  1OT9 A;  1XJ6 A;  2YKF A;  2K7S A;  2EWV A;  2HF6 A;  3B42 A;  1DP8 A;  3GEC A;  2QWS A;  5HD5 A;  2JKT M;  4Q0J A;  2W3E A;  2V0U A;  1ODV A;  2PD7 A;  2Z6C A;  1P97 A;  3BJN A;  2DMW A;  4NKP A;  2MJ6 A;  3D72 A;  3C8C A;  3BQA A;  1GSX A;  4EQ1 A;  4EET B;  4WL9 A;  3OCN A;  4ZRR A;  4F3L A;  3SW1 A;  3NOP C;  2A24 A;  1YKD A;  2PT7 A;  5HL6 A;  2L0W A;  2JN7 A;  1T1C A;  4UQI S;  3LR3 A;  4MN7 A;  1H8M A;  2HGV A;  5FL3 A;  1BYW A;  3R7W A;  2PYP A;  4B93 A;  4EUV A;  3OC2 A;  4I3J A;  4OOM A;  5A8B A;  3ZYT A;  1S1Y A;  1S67 L;  3IS2 A;  5IU1 A;  3NOT C;  3UE3 A;  2CMN A;  4P6Z S;  1S66 L;  3LR4 A;  1S4S A;  4CLC E;  2GZA A;  1G28 A;  4I3A A;  3S7O A;  3P01 A;  4HHD A;  2OOL A;  3VE4 A;  3CI6 A;  4DN0 A;  4HY8 A;  4XT2 B;  3E4P A;  3EWK A;  1IFQ A;  4GCZ A;  3C2W A;  3PYP A;  2PR5 A;  3PR6 A;  3LI8 A;  2QJ5 A;  4WEK A;  3RTY A;  2L4R A;  1N9L A;  1ZHH B;  4HP9 A;  1MC0 A;  4HP4 A;  4QPR A;  3H82 A;  4GS9 B;  3TRC A;  1X0O A;  4YWZ A;  4YNR A;  5KIZ A;  5EFW A;  3FG8 A;  3EOI A;  3VV4 A;  2GNX A;  4OOL A;  4L9F A;  2INW A;  4JGQ A;  3TJZ C;  2ZMF A;  2O9C A;  4DJ3 A;  2QYB A;  3T4S A;  2KDK A;  4Q0I A;  1VHM A;  2ZOI A;  3GDI A;  5MC7 A;  2P04 A;  1T1B A;  1WA9 A;  1VB6 A;  3F1N B;  3UMD A;  3NOU C;  5DF9 A;  4EES A;  1GSV A;  1MKM A;  1W63 Q;  2D01 A;  4NEE D;  4G3V A;  2GJ3 A;  4UEY A;  3MF0 A;  1DRM A;  3MMH A;  4BBV A;  2LB5 A;  2W3F A;  4L0L A;  5DJT A;  3G6O A;  3NHQ A;  5G4Z A;  4NXG A;  2HV1 A;  3LR0 A;  5DKK A;  4KUK A;  3F1O B;  2WKQ A;  1P0Z A;  4BWI A;  3B47 A;  4LLO B;  3LUQ A;  2VA0 A;  4HIA A;  1IOU A;  2VX8 A;  3KSI A;  3JVU A;  4ARZ B;  4EEU A;  2HJE A;  2PD8 A;  3EGX C;  1XJ4 A;  4HJ3 A;  3W2Z A;  2O9A A;  2HJ9 C;  5HD3 A;  3VOL A;  3VE3 A;  2YKH A;  3LYX A;  4MDZ A;  2XA7 M;  4UQI M;  3LFV A;  4PAU A;  3T4T A;  4MMN A;  3CLO A;  1T18 A;  5IS1 A;  2JKT I;  4L9E A;  2FZ0 A;  2VGL S;  2VKS A;  4G3K A;  4KUO A;  2J80 A;  1OJ5 A;  1YSP A;  3F1P A;  3MQO A;  2VEA A;  5L8M A;  2W1R A;  2M7U A;  4GHI B;  1OTA A;  2L1M A;  4KQD A;  3FC7 A;  3LIB A;  4H6J A;  4JGO A;  4Y5F A;  2R78 A;  5DFX A;  2VV7 A;  2W3D A;  3KO6 A;  3PBR A;  2VZW A;  2NUP C;  5CX7 A;  3S7N A;  2PDR A;  3IBJ A;  3KSF A;  3S7Q A;  2VV6 A;  2XRO A;  1UWP X;  3MXQ A;  1EW0 A;  3LR5 A;  1F9I A;  2QJ7 A;  5HDD A;  2OAQ 1;  3DBA A;  2Y8H A;  5AJG A;  4CLC C;  5F5Y A;  2O9B A;  4NXB A;  2PHY A;  5AVE A;  1F5M A;  4PHT A;  4R38 A;  5DFY A;  1LSW A;  3UB7 A;  1OJG A;  5G4Y A;  1XFQ A;  1NRJ A;  4RQ9 A;  5F68 A;  4CLC B;  2XSS A;  1DP9 A;  2O0Y A;  3PBO A;  3HJI A;  3O5Y A;  4I38 A;  3K3D A;  1NWZ A;  5DKL A;  3TE8 A;  1N9O A;  2XRN A;  3ULF A;  3E4Q A;  3KX0 X;  3OLO A;  1XJ2 A;  1XJ3 A;  2WKR A;  3BY9 A;  2Y79 A;  5HDC A;  3H7W B;  4WUJ A;  4EEP A;  3TW8 A;  1P9R A;  3T4L A;  5HZH A;  3C38 A;  2KX6 A;  1OTD A;  5F6A A;  5HWT A;  3BWL A;  3LIC A;  1OTE A;  2ZMV A;  3EGD C;  1V9Z A;  3MQ0 A;  5TBM B;  4P6Z M;  2P7J A;  2B02 A;  2PR6 A;  3F1N A;  4G3W A;  1D06 A;  3PBS A;  4FSF A;  4I3I A;  2VLG A;  1LSV A;  3OCL A;  4R3A A;  1G6O A;  2JKR I;  4LRZ E;  3BW6 A;  2V0W A;  5HWV A;  3H7W A;  1NLZ A;  3MFX A;  1LL8 A;  3CWF A;  2WKP A;  4NXF A;  5J3W A;  5IT5 A;  3UB9 A;  2LB9 A;  3HJK A;  3RFB A;  1XFN A;  1TS7 A;  3E4O A;  1H3Q A;  3U2A A;  3CIT A;  4CLC D;  4GLQ A;  4YOF A;  1T19 A;  3LIF A;  4ME4 A;  4MN5 A;  5J7E A;  1OT6 A;  4XT2 A;  4ETX A;  4JGP A;  1STZ A;  4F3L B;  4EU0 A;  3EEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...