4IV3B

Crystal structure of recombinant foot-and-mouth-disease virus a22-h2093c empty capsid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
207
structure length
207
Chain Sequence
b'DRILTTRNGHTTSTTQSSVGVTYGYSTQEDHVSGPNTSGLETRVVQAERFFKKHLFDWTPDKAFGHLEKLELPTDHKGVYGCLVDSFAYMRNGWDVEVSAVGNQFNGGCLLVAMVPEWKEFTPREKYQLTLFPHQFISPRTNMTAHIVVPYLGVNRYDQYKKHKPWTLVVMVVSPLTTNTVSAGQIKVYANIAPTHVHVAGELPSKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Rational engineering of recombinant picornavirus capsids to produce safe, protective vaccine antigen.
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type a
molecule tags Virus
total genus 41
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iv3B00
3VBHB 1AR81 4N53B 2WFF2 2HWE2 5CFDB 4JGYC 1RUJ2 1VBE2 5L7OC 1FPN1 4RS5B 1FOD1 2FZ2A 4CDXB 2ZZQA 1OPOA 2HWB1 2RM23 4CDWC 1H8TB 3ZFEC 2ZAHA 1PVC3 3CJIC 4IV1C 3JB8A 5L7OA 3VBFC 1EAH3 1RUF3 1PGW2 1AYN1 4CEWC 1NCQC 3J8F1 1ND3B 4Q4W1 4RHV2 1AR61 4CDWA 5D8AB 2RS52 2X5IC 3VBRC 3ZXAC 3VBSC 4GB31 3CJIA 4IV1A 4FSJA 2MEV3 4Q4V2 1Z7S2 1RUI3 4N43C 3VBFA 4YVSB 1RUC2 4CEWA 2XBO1 3ZFGB 1NCQA 5C8CB 2GSYA 5FMOL 4QPGC 3ZFFC 3VBRA 5DDJ3 1NY71 1RHI2 4JGZC 5J96B 1DDLA 1ND2B 1QJY2 3IDEA 1VBB3 5GKAC 4CDUB 4N43A 1QJU1 1RUD3 2RMU2 2HWD2 2RR13 5A32B 2R072 4QPGA 3ZFFA 1RVF3 5ABJB 4JGZA 3NAPC 1OOPC 1ZBE3 4GMP1 1BEV3 4EJRA 1HRV2 1RUG2 5CFCA 1MQTA 1R082 3JBG3 1RB8G 1VRH2 4CDQA 1PIV3 3NAPA 1C8NA 4RQPC 1OOPA 4Q4X3 1COV3 1AYM3 1FMD2 5A33B 2HWF2 2WFF1 2HWE1 3S6PA 1RMU3 1ZBA3 1POV3 1VBE1 2HWC3 5AC93 1AR92 1AL21 1RUE2 1HX6A 4RS5C 5K0UC 4RQPA 1QJX3 1NA1B 4QPIB 1M06G 5ACA3 1GFF2 4GMP0 3TN92 1PGW1 4RHV1 5BNOB 1EAH2 2PLV3 3JB4C 5J98B 5K0UA 1PO13 4Q4Y2 2RS12 2WZR2 3VDDC 1D4M3 4Q4V1 1ASJ3 3DPRC 1Z7S1 1R1A2 4GH4B 1CJDA 1RUC1 1RUI2 5JZGC 4WM7B 1VBD3 1QQP3 1RHI1 1EV13 3JD73 1QJY1 1C8M2 3VDDA 3DPRA 5CFCB 2R043 4AEDB 1OHFA 2FZ1A 5JZGA 2HWD1 4CDQB 1AR83 2R071 5C9AC 3VBOC 1E57A 1HRV1 4CEYB 1FPN3 1RUG1 1FOD3 1R081 1VRH1 2R062 3VBOA 1PO22 1FMD1 4JGYA 1NCRC 1TME2 2HWF1 4YVWC 4Q4X2 1PGL2 1AYN3 2WWSA 1AR91 2HWC2 1VBA2 1AR63 1RUE1 4WM8B 1K5MB 3ZFEA 2Y26A 5BNNB 5C4WB 1NCRA 4IV3C 1V9U1 5ACA2 2XPJA 2XBO3 3TN91 2X5IA 1B35B 2WS92 3VBSA 4Q4Y1 2PLV2 2RS11 2WZR1 1PO12 1MEC2 4IV3A 4Z92B 1HRI2 1CD3G 1QJU3 1R1A1 1NG0A 1AR72 1RUI1 1BBT2 1TMF3 1VBC3 2RS33 1NOVA 1RUH2 1C8M1 1BMV2 1A6CA 3VBUC 4PDWC 4RR3C 1EV12 5BNPC 4LLFA 2BBVA 2DF7A 5LK7B 5L7OB 2WFF3 2HWE3 4Y5Z0 1RUJ1 3VBUA 3VBHC 1VBE3 4N53C 4PDWA 4RR3A 5BNPA 5CFDC 1AL23 2TBVA 1FOD2 4CDWB 2R061 4CDXC 2RM22 1HXS3 3CJIB 4IV1B 1PO21 1PVC2 3VBFB 1H8TC 4N53A 1TME1 4CEWB 1PGL1 1WCDJ 1R093 1NCQB 4Y4YA 4FTBA 5CFDA 1W39A 1RUF2 1VBA1 2HWC1 3VBRB 4RS5A 2RS51 5FOJB 4CDXA 1ND3C 4Q4V3 4N43B 1Z7S3 1H8TA 5D8AC 2MEV2 1RUC3 5ACA1 5BNNC 4QPGB 3ZFFB 4JGZB 4YVSC 4NWVA 2WS91 1RHI3 3ZFGC 1QJY3 5C8CC 5DDJ2 5D8AA 1B35C 1PO11 1MEC1 2VQ0A 1VBB2 1MQTB 1ND2C 1HRI1 1AL0G 1AR71 2RMU1 2HWD3 1F8VA 1BBT1 1QJU2 1RUD2 2R073 4CDUC 4YVSA 1POV0 3NAPB 1OOPB 2RR12 4BCUA 5C8CA 1RVF2 1RUH1 1TMF2 1VBC2 5ABJC 1HRV3 1BMV1 1RUG3 2RS32 1HQNA 1ZBE2 1ND2A 1BEV2 1VB2A 1R083 2HWB3 4CDUA 1VRH3 3JBG2 5C9AA 4RQPB 1FMD3 5A32A 1PIV2 5ABJA 2HWF3 1COV2 1AYM2 1QJZA 1RMU2 1ZBA2 3J8F3 4Q4W3 1AR93 5AC92 1RUE3 5K0UB 2WLPA 1AL22 4GB33 2RM21 4FTEA 4YVWA 1QJX2 1HXS2 1PVC1 5A33A 2IZWA 1V9U3 1NA1C 4QPIC 3TN93 1R092 1EAH1 1RUF1 2BFUS 4RFT0 3VDDB 4Q4Y3 2RS13 2WZR3 3DPRB 5BNOC 1D4M2 1NA1A 1R1A3 3HAGA 1SMVA 4QPIA 2MEV1 5JZGB 1ASJ2 1X36A 1IHMA 4GH4C 1AUYA 1VBD2 4GMP3 4WM7C 1C8M3 5BNOA 1QQP2 5DDJ1 3JD72 1VBB1 2R042 5C9AB 3VBOB 3M8LA 5CFCC 4GH4A 1MQTC 1RUD1 3FBMA 4AEDC 1VB4A 2RR11 4JGYB 1AR82 4WM7A 4CDQC 1RVF1 1RUJ3 1TMF1 1VBC1 2BUKA 2RS31 1ZBE1 1BEV1 1FPN2 4CEYC 2GH8A 3ZFEB 2R063 3JBG1 4AEDA 2HWB2 1PO23 1NCRB 4YVWB 3VBHA 1PIV1 1TME3 4Q4X1 1COV1 1AYM1 1RMU1 4RHV3 1ZBA1 1POV1 2BFUL 4CEYA 2X5IB 1VBA3 1AYN2 3VBSB 5AC91 2RS53 3J8F2 4Q4W2 1AR62 1F2NA 2BPA2 4WM8C 1K5MC 4IV3B 1QJX1 4GB32 1HXS1 2ZTNA 3LOBA 1VAKA 5C4WC 1V9U2 2XBO2 1R091 2WS93 1ND3A 1NY72 2PLV1 2QQPA 4WM8A 1K5MA 1MEC3 1X33A 4FTSA 1HRI3 1D4M1 5BNNA 2RMU3 1AR73 5C4WA 1ASJ1 1BBT3 4SBVA 3ZFGA 1VBD1 1RUH3 3VBUB 4NWWA 4PDWB 4RR3B 1B35A 1QQP1 5BNPB 1EV11 3JD71 5FMOS 2R041
chains in the Genus database with same CATH superfamily
2A6VA 2VBDA 3DV8A 3MUZ1 1MVEA 4HETA 2VECA 1AR81 2ORXA 1QXPA 3WP3A 1OA4A 5IAXA 4YG0A 2C6SA 5KXDA 1Q8SA 1V6MA 2NN8A 4H55A 3I59B 2FHRA 3HPNA 1VBE2 3WG3A 4JX0A 2GNBA 1H0BA 4PQ9A 3BALA 3SITA 2X29A 4FFFA 2O8OA 1GYKA 1K3IA 3KT4A 4QX1A 3WF1A 5JI9A 3T4VA 1OD3A 1JU4A 1G8WA 1OPOA 1HKDA 4FPFA 2WT0A 3MLLA 4QPWA 3SC7X 4G9SB 2YV8A 1GANA 4DUWA 3AZYA 1UL9A 5FZ7A 3N7LA 3VBFC 2OVUA 2ZGPA 1RUF3 3BPSA 1AYN1 1QDOA 2ILMA 2YXSA 4A3ZA 2XJTA 2ENRA 4Q4W1 1ND3B 5GZCA 4QB6A 3WNLA 4CDWA 1G9FA 3ZXAC 4ZZ5A 3POSA 3CJIA 4FSJA 1CESA 4EE2A 2H0BA 1Z7S2 1REFA 1GLHA 2NZ9A 5LY1A 4QKNA 4YVSB 2P3JA 1JS9A 3WNXA 4CEWA 2ATFA 2VTFA 1NCQA 2K46A 5IVEA 5J3UA 3OOXA 3MIDA 2C1FA 2F6BA 4M4PA 5GM0A 3VBRA 2P6CA 1QOOA 2GP3A 2KA3A 2VXRA 4IDZA 3IN9A 2GZWA 3IDEA 3MI8A 3HNYM 1VBB3 2W91A 4Y3OA 5FTTC 2VG9A 3H1MA 4FPLA 4CUGA 1Q8PA 5KBFA 2ORZA 3POWA 3WR0A 4QB1A 4PJYA 2V5YA 1LULA 3VDAA 1JUHA 4AVBA 3RZGA 1FAYA 4SLIA 4BHPA 1IS5A 3NAPC 4QAWA 5L9VA 1SBDA 2WZPP 1XNCA 4GMP1 4AFMA 4MGQA 2XONA 3V0BA 3CBNA 2Q8EA 3Q8AA 5A6YA 4M3CA 2DCJA 4JDOA 1NKGA 3BYWA 5FUIA 4OFGA 1S0GA 1RB8G 2ETEA 2DVDA 4JAAA 1VRH2 4QXHA 3O1MA 4FOWA 5A3MA 3WDVA 3WX5A 5FZ0A 5A33B 2LTNA 2OA2A 2VULA 2W08A 1HJFA 2V4VA 1RMU3 2V4AA 4KWLA 2WO2A 4Y5SA 4MHUA 2RDNA 3BTZA 5FUPA 1KJLA 4CU7A 4IE7A 2W68A 5AVPA 3WEZA 4WZFA 3ZYPA 3KS7A 2BDRA 2E53A 3THCA 4TTGA 1XNTA 5LBEA 3KT1A 1H2LA 3ZYIB 1NA1B 5BUVA 1WW4A 2Y8KA 1YJKA 3NJYA 4GJZA 1GFF2 2B46X 3EYPA 3LQCA 4GMP0 4XYXA 5F3EA 5A70A 4AYUA 1DYPA 5A1AA 4CPBD 2AGSA 5FPAA 5DZEA 1S0FA 3OPWA 2Z79A 2ZHLA 1CIWA 1EAH2 3WQ0A 1XNDA 5IATA 4XUNA 2VZQA 5LA9A 1PO13 3HN3A 4OHWA 1DGWX 1PK6A 3UL2A 5IVCA 3ZOIA 3GJBA 3Q8EA 1X50A 4D6SA 2UYBA 5A3NA 2CWMA 3M3IA 4EWAA 5FP9A 4YW6A 1CJDA 4RGAA 2FDGA 1RINA 4W4ZA 5FPXA 1VBD3 4IE0A 4M0HA 5EJ1B 2ZZJA 4K20A 5I0TA 5C3SA 4IEXA 5JLVA 4TZDA 4KG8A 2DWRA 4LEJA 3N35A 3ZPYA 1HB3A 5ANQA 3VDDA 1XB9A 1W0NA 3T4HB 3VDCA 4R9AA 4CP9A 1ZZ7A 4I30A 1OHFA 1O5UA 4X8NA 5JZGA 4CDQB 1XU1A 5GZEA 3VBOC 5FQ0A 5EZWA 4OMDA 3HN1A 1BLZA 3I2HA 5ERLA 2GU9A 1E57A 4NPLA 4OVEA 1PZ9A 1HRV1 4CEYB 5K7PA 1V6NA 4BQ3A 5FZGA 4M3CE 4BK5A 1BYHA 1JU3A 3FBYA 2PQQA 5FY5A 2W94A 2R062 4CP1A 2Y38A 3SKVA 4W65A 4P9XA 3H1YA 1CONA 4NIHA 2XJUA 4DXRA 2WBKA 2XH6A 3POGA 3W9AA 4BDVB 1TME2 1QH7A 1S0IA 3N7KA 1Q3EA 4QKDA 5FYTA 2J1RA 4YLZA 3ON7A 1AR91 1VBA2 1AR63 2VUDA 1ULDA 1RUE1 5JIUA 2ADDA 3ZFEA 4L0PA 4XEZA 3APBA 4QKBA 2P17A 2C9KA 5FY4A 4AWDA 4A6SA 1H2KA 1NCRA 4IV3C 2PAMA 5E1RA 1V9U1 3PVEA 4COUA 1GZTA 2EAAA 5ACA2 3M4FA 2FDKA 5FJKA 3WUCA 4FPCA 1OLME 1S2KA 3BTYA 2MHFA 5EFUA 2PHDA 4FBFA 3IPVA 1D0GA 3W58A 1MEC2 2V72A 4YG3A 4CUCA 1W8FA 1F31A 1QJU3 3UJOA 1QU0A 1T2XA 2J1AA 3ZYJB 1QOTA 2R6QA 1JZ5A 1K45A 2EALA 3MYXA 3LEMA 2BVBA 4R52A 5IK4A 1AXZA 1A8MA 5I8TA 3D3AA 1RXFA 5FDBA 1OKOA 2RS33 1RUH2 1UOGA 1BMV2 2OZJA 3WP5A 4OHYA 4PDWC 3ECQA 4IEVA 4HFSA 4FPEA 4YARA 2ZAAA 4PLOA 4KL1A 1MPXA 4LO8A 4BIFA 4C0BA 4ZKTB 2PMWB 2ARXA 4A42A 2DF7A 4IL7A 5HXMA 2RDRA 5J7MA 5LK7B 3KD4A 4IESA 3B5LB 3OGJA 3M3EA 2XL9A 5BV6A 3ZYBA 1BCXA 1CAUA 1VBE3 3MW4A 1N47A 4RR3A 4AE2A 2VM9A 4I0BA 1AL23 1ZRCA 1FOD2 1GOHA 3VZLA 2UURA 5A6QA 3WINE 2GP5A 2ZX3A 3RGBA 4Z1VA 1W8NA 3NNMA 4CDXC 2QJVA 2RM22 1HXS3 1SEFA 1UZ0A 1XSRA 2CDOA 3L2HA 4NROA 4GWMA 4PCRA 5IT6A 1QMJA 3VD4A 5FYIA 3SMHA 4N53A 3VBFB 4FXKB 5EJZB 3VKOA 4LE4A 4E4ZA 4FTBA 2Z69A 4PIZA 4OHXA 3ELNA 3FZ3A 2A71A 5DUXA 1I9RA 4RS5A 1W99A 5JR7B 5DN2A 5FOJB 2JENA 1VE0A 2RJ2A 4OLLA 3LEIA 5I8YA 2QE3A 5CADA 3FUQA 4ATEA 2LALA 3LDBA 1O4ZA 4FXGB 5D8AC 1Z7S3 4DUVA 3HT1A 1JYIA 3UGGA 1UKGA 1CIYA 2MEV2 2QDRA 3O7OA 5D21A 5FZ6A 3DGTA 4LMFA 2ZGKA 4XHXA 5BNNC 3RJRA 3B69A 3HIFA 1W6PA 4QHZA 1W6MB 4BOWA 3I2JA 4PF1A 1W8ZA 2Q5TA 4BMEA 3ZFGC 5JUVA 4XF4A 1UYZA 2FQPA 2QDNA 2ZKLA 4QU2A 1KEXA 2VTXA 1ND2C 2WNVC 2XOMA 1UZVA 1V00A 2HEVF 3M1HA 4TXWA 1QOSA 1TNFA 1AR71 3H7YA 5C3OA 1YFUA 1FATA 4F3JA 5T50A 1BBT1 3O0WA 4AXOA 1POV0 1WGPA 3NAPB 3P3NA 1LOEA 4ASKA 4P9WA 4XURA 4BCUA 4K7JA 5F6KA 1O8SA 1DGWA 4QWNA 1VAMA 5KXBA 1W04A 5FZ9A 4B1MA 4J6GA 2WAAA 3GCWA 1W6OB 5C6CA 4BJ0A 3BUCA 1GWMA 2VGDA 1ZZ6A 4QX3A 1VRH3 1XYNA 4CDUA 4DUXA 2DUQA 1UX7A 1VP6A 2JJ6A 3NKTA 4DNYA 2J1EA 4L11A 3ETPA 1CR7A 4FAGA 2D93A 4E4SA 3USSA 4XPVA 1XJAA 4Z07A 5ABJA 1LOFC 5JOYA 2WNEA 3VD3A 4E4DX 3E6CC 5FPUA 4IEYA 5GALA 1CGPA 1IQDC 1ZBA2 3D8CA 2D44A 2ZS6B 3PIGA 1D7PM 2CTVA 5AC92 2C26A 2YBPA 3RQ0A 4ASLA 5IVBA 5EPAA 3R4SA 1VALA 2ZX2A 1YNAA 1WCKA 4GB33 3DCQA 1H4HA 4Q26A 1W2TA 5B4NA 3D0JA 4ITCA 4KU7A 4YVWA 5KWRA 1QJX2 2XMLA 3DXUA 2P3YA 1PVC1 3GZTB 2FCVA 3NMBA 4CUBA 1W90A 3CZJA 4W6XA 5JMOA 1W9SA 2XKOA 4NIGA 3ZMOA 1DQ5A 1GP6A 4DRVA 4I02A 1EAH1 1R092 3OUJA 4CSWA 3URFA 2OYZA 2XL7A 2LS6A 2RV9A 1TEIA 3P3PA 3ZSLA 3VV1A 3LFMA 2AUYA 5BNOC 4LPLA 3O1OA 5DQ0A 3WY6A 2B42B 4AG4A 5D2AA 2HH9A 3T0AA 4JKLA 2CAVA 2Q0AA 4FOYA 1SMVA 2CYFA 3CMGA 4QPIA 1ASJ2 4MV2A 5FBZA 3T2OA 4EZ4A 1QNWA 3OCPA 1YQ2A 3GZEA 4PT6A 4EZHA 2OPWA 4GH4C 4PLMA 1W6NB 4YM0A 1WLDA 3IB3A 3RZMA 3HWJA 4WM7C 1H1IA 1F35A 2VO5A 1SLLA 5DDJ1 2VZ1A 1J3RA 2Y60A 3ACLA 3K46A 4G3YC 4JQRA 5F9TA 1SCRA 3UT0A 1W9YA 3AZXA 3GM8A 4ZXKA 1GR3A 1LOGA 5L9RA 1O3RA 3VBOB 1UOBA 4BQYA 1RUD1 3FBMA 4AEDC 4LJHA 4NPRA 2RR11 4LBMA 1AR82 4YW7A 5LB6A 4XBLA 1MS5A 4ZS2A 3U10A 1TMF1 1BHGA 1LHNA 4ISQA 3RFRA 4CCCA 2JG9A 2QBXA 1O3SA 4QGMA 1BEV1 2WZ8A 4B29A 3E5UA 1C3HA 4BXFA 4KNCA 3ZYRA 4IE5A 4XF1A 3WDWA 4CPBA 2R063 3JBG1 3IM0A 4S2DA 5LY2A 5KXCA 3U4SA 2WYFA 4WVZA 5IHRA 2J22A 1HLCA 3CLPA 4P02B 5ANNA 3THPA 1PIV1 1TME3 3AP7A 3S5QA 1COV1 3GHMA 2LW8A 1WCUA 2DCTA 4Y26A 3VZKA 1ZREA 4MVTA 3HD8B 4LO5B 4RHV3 1UIJA 3ACHA 5FJHA 1UMHA 3LPFA 1VBA3 1AYN2 2OQ7A 2VMEA 2D3PA 2WN3A 3BCWA 4N7UA 4Q4W2 1AZDA 4D6QA 1Q8VA 1SG3A 1WBFA 3O1RA 4QHBA 2X10A 2BPA2 1V6KA 4QXCA 5A7PA 3MPPG 2Y34A 4BMBA 1J3PA 2VAUA 3NJXA 4IV3B 4HK9A 2VCCA 1BXHA 2EXHA 2CDPA 5FO7B 5JR2A 3LD8A 3POEA 2A3YA 4E27A 5C4WC 1A34A 5FO8B 2JB8A 3E97A 3TOJA 2JXAA 1YFXA 1UOJA 2RJLA 1A78A 1WLWA 3E5XA 4NHKA 5FZOA 4IE4A 4UF0B 4CRQA 3WF0A 4MLOA 2CGNA 3OBZA 3ORJA 4XILA 5IVVA 4WM8A 3O1SA 1MEC3 1X33A 4XF9A 3O12A 1KJRA 1KD7A 5FZ3A 5GJ6A 1POQA 4MXWB 3BTXA 2ZGMA 4URAA 3MICA 1JYNA 2NPIA 2YC4A 4LBQB 4SBVA 4XFBA 4XTPA 5G04L 2R7EB 4K1ZA 4Z2AA 1RUH3 3AZVA 5J48A 3OD4A 5A7WA 2VQAA 4NWWA 5CIRA 4PDWB 1Y43B 3RZKA 1QQP1 5HCAA 2DVBA 4BQ2A 3GYDA 3SEEA 2DU0A 3K48A 1J58A 5I0RA 2XVKA 3OEAA 4IW3A 4R9BA 1ZNPA 2ZGQA 3WD5A 4AR2A 3T2PA 5HCHA 2W87A 3VUOA 1MS1A 2BP6A 4JVAA 3ZKYA 5JOZA 3ETQA 3RRDA 2QZ3A 3LSDA 4LKEA 1X9PA 4AHWA 2Y6HA 4BPZA 3O1PA 1Q5OA 4LBOA 3WCSA 4BQXA 5JVVA 1UN1A 2VTXJ 4K3UA 4KI5M 5FZFA 4H3WA 3SEPA 2PQSA 4R4XA 4Y1YA 1ULPA 5L7OC 1J59A 1QY4A 3HMYA 5FZAA 1FPN1 1FOD1 2QQJA 1KQRA 1DLLA 4CDXB 1W06A 3OJBA 1TNRA 4UFMA 5FYSA 2BZDA 2ZZQA 1HJGA 3OPZA 3O5SA 1YIFA 3HR9A 2RM23 4M3CF 4Q0SA 1Y3TA 2BGPA 2CSGA 3OYWB 3ZFEC 2GMPA 2ZAHA 1W0PA 1AX0A 3MW3A 4IV1C 1AJOA 2RVAA 2WA4A 3ZN5A 3I2KA 4P9JA 4EROA 1X7NA 1UW8A 2VW2A 1A8DA 1PZ8A 3J8F1 5FYHA 4MG2A 1W2UA 1AXYA 1L3JA 5KHKA 1DBNA 2WSUA 2ES3A 4QU1A 4UBGA 5D8AB 4XJUA 2NLRA 3NW4A 2BEOA 3QOPA 4I01A 2P4EA 3FN9A 4COZA 1VAVA 1TG7A 1WMFA 2MEV3 4FOVA 5KC6A 2FDFA 1RUI3 1KDMA 1Y4WA 4B7KA 4N43C 4O9EA 3CF6E 4MGKE 5LW9A 1C1FA 1OF4A 1G7YA 4IEUA 3ZFGB 2D5FA 1W2NA 3TRSB 1YUDA 5IJRA 1JZ7A 1UY4A 2ZHNA 3ZFFC 1SHWB 1NY71 1Q43A 4JGZC 4A41A 3V0AA 3FHAA 3WHTA 1ND2B 2WNVB 3IBMA 5FKCA 3WQBA 5EIYB 4AVCA 4EQVA 4PIYA 2P5BA 4Y22A 4M01A 4PLNA 3BVCA 3KGZA 3LKJA 3H8RA 1RITA 2JG8C 1KITA 3I2IA 5CZKA 3VL9A 2RMU2 2E33A 2K2SA 3POFA 4RL7A 4UW3A 3MO4A 3M3OA 3ZN6A 4H2AA 4QPGA 1SZBA 1YI7A 4Z82A 4YGDA 4AVSA 2DCZA 3B00A 1MVQA 1LAJA 4R8HA 5A7QA 3RZHA 4LOTA 5T55A 2CHHA 5KXEA 2ARAA 4WVVA 1O3TA 1HRV2 2D40A 4LBNA 5EYXA 2XJQA 4WVMA 2JIGA 3K51A 5FZIA 4NHXA 5F2WA 2XQRA 3D0SA 4DFSA 3I49A 4XOGA 1UU5A 3LDRA 4UFIA 3TBDA 1R64A 5F3IA 4JC1A 1NQDA 1K5JA 4RN5A 5F5IA 5JOXA 1C8NA 1OOPA 4Y5TA 4QQPA 4OZOA 5LA0A 3DKWA 5FY7A 5FZBA 2DTWA 2FMYA 2WFF1 4FPGA 5FZMA 1ZBA3 3Q8BA 4C0HA 4AI9A 1F9KA 2HWC3 2ZKNA 5A7OA 3UKNA 2IFRA 5AC93 1RL3A 1AR92 3IDBB 1SBEA 1RUE2 2JDHA 2E7TA 4M0NA 3CJXA 1I6XA 4RS5C 2VOKA 4FQ4A 3ZSMA 1YWKA 4RQPA 1QJX3 2VNRA 5LRSA 4GZ9A 4RGGA 4UFHA 1BQPA 3ILNA 5BY5A 1F5FA 4MGIE 2ZHKA 1WWYA 1JZ8A 4DOUA 1R1ZA 3VZJA 4HN1A 3ZR6A 3T09A 1Z78A 1QNYA 4UW6A 2FMDA 3HT2A 4GJYA 4GKYA 2PLV3 4Q1RA 4AHZA 5BNOB 3KCCA 5F8PA 5K0UA 3SLIA 4BA6A 5L36A 3WG4A 1UY2A 4K40A 2GC1A 5F39A 4QM9A 5FREA 2NMNA 5HPOA 1DZRA 3AKPA 1S0JA 1ASJ3 3ZXJA 3WNOA 4GH4B 2WNOA 3DKQA 1VRBA 3JQWA 3KSCA 1GZWA 5GZFA 2CAUA 2YC2A 2VNOA 4WM7B 4AGRA 5CKNA 4JHTA 3B9IA 1BKZA 5I8SA 3AJZA 2VUJA 2B7YA 1ACCA 1QJY1 3N9QA 1W6QA 3EB7A 3WVJA 3WW3A 4PF5A 1XU2A 1UNBA 1JI6A 3DPRA 2D43A 2G1MA 1REDA 4AEDB 1QIQA 1XE8A 2ID4A 3A22A 2VVDA 1RJ7A 4UOJA 2A6ZA 5B2GB 1AR83 1J83A 4YZ3A 2IXHA 4P14A 5DG2A 2YC0A 5C7GA 5B4XA 4NHMA 4XF0A 2WT2A 3T3YA 2VOTA 1N3PA 2BWCA 1S2BA 1RUG1 3IT8A 5IFTA 2XKPA 3PL0A 1WKYA 4A4AA 1P8JA 1T6BX 1UKRA 2AEYA 5FY8A 2VZPA 5SV8A 4LO6B 5I0DA 2VMGA 5FBJA 1CZVA 5EV7A 2BNMA 1JZ4A 3W5NA 1NZIA 2W5FA 1EYBA 4FPOB 3TNQA 5FY0A 1PMJX 2W47A 1FMD1 4JGYA 4LO7A 3I2OA 4JKMA 4YVWC 2HWF1 2IUWA 3BB6A 5CBLA 4Q4X2 4DIQA 2ZPXA 5DZGA 2E7QA 1OVSA 2E32A 1WD4A 1AYN3 3FLPA 3QH6A 5FIXA 4CCNA 3I97A 1UPSA 1OUSA 2BYVE 4DINB 1LRHA 1XYPA 3DYPA 1DU3D 5I93A 2TNFA 3X29B 2WIIB 3U14A 4EN7B 1QWRA 3CZUA 3J7NA 1OXCA 4XXPA 3D6EA 3LEKA 1OC1A 1CZTA 5C4WB 1B09A 2HEYF 3FWEA 4MOAA 3OGVA 1IS3A 2P2KA 3H7JA 1GV9A 5GLWA 3TN91 1UOFA 3N9PA 2AENA 1FX5A 2MNGA 2X5IA 1B35B 3KF5A 3VBSA 2YG0A 3GJAA 1PZ7A 4IEPA 4QDSA 2PHWA 1ULEA 5JAXA 5FP7A 4FPKA 1OKQA 2GN7A 1XC6A 1OLRA 2VQUA 5KHIA 1DP0A 2A6XA 3ZPOA 4XE9A 1LEDA 3AVSA 1AR72 3AZWA 1Y9QA 5JCTA 4CUAA 2OPKA 5C70A 1BBT2 2J1TA 1GNZA 3MBWA 3VHPA 3NNGA 4XETA 5IVFA 1MZEA 1VBC3 2XQXA 5FQ0B 2K0GA 3VGIA 2A6WA 3PHMA 4NR1A 1NOVA 3IIAA 3SISA 5DMYA 3OBAA 1C8M1 4CCDA 1UD1A 3C3VA 1EV12 5FUNA 4FO9A 3OY8A 4OUMA 2B8MA 4BQ1A 1Z0HA 3CNAA 5JWPA 1XRUA 2WJSA 2ERFA 2BBVA 3PVOA 3LFIA 4GD4A 1JH5A 5E89A 1MS9A 1REEA 4OUEA 1RXGA 5FXWA 5L7OB 1UU6A 3VBUA 3ZYGA 5CVRA 4YW2A 5LRRA 3VZMA 1GQHA 1HQWA 5BNPA 3ZDSA 2Y64A 4C90A 2B9VA 4RFRB 5D1IA 3LIGA 5C8WA 5CFDC 4K21A 4JCKA 2TBVA 2YGMA 1GSLA 1W9FA 4UFLA 1MS0A 1YQ5A 3VKFC 4RSUA 1ZRRA 1YRZA 4YSFA 4IV1B 1OA2A 2WFPA 3IWZA 3TYJA 1IG3A 4E2QA 1PO21 3A7QA 1UY0A 1V70A 1WCSA 2CNAA 1PVC2 3CQOA 1H8TC 3KMHA 4I0AA 5A1FA 5A32A 2R0HA 4Q8KA 1PMHX 1ENRA 2QQNA 4BE3A 2YGLA 1KGYA 1IS6A 3ZXKA 2Q4SA 4AEKA 3HEIA 5F5AA 2YDEA 5EXOA 3MIFA 4CXWA 4AF9A 1O8PA 2J1UA 4N43B 2Y0OA 3WNKA 1O91A 3MZHA 4NMIA 2DFBA 2GDFA 3LE0A 1PVXA 5A3UA 1EY2A 3ZFFB 3K2OA 4O61A 2Y6LA 2YPJA 1WMEA 4JGZB 3AMNA 4NWVA 3ZX7A 2H6BA 2WS91 5A7NA 3T1MA 3I3MA 4PI2A 5C8CC 3LF7A 3S7EA 3PDQA 5DDJ2 3ZSJA 2CGOA 3ITQA 2XVLA 3PJYA 4MUVA 1PO11 1LHOA 2JG8B 1MQTB 2VQ0A 2YB7A 5FP4A 1CQ9A 1F4HA 2ET7A 5JI7A 2RMU1 5A3PA 4MADA 5FZ4A 5H9RA 1F8VA 1OPMA 1RUD2 4CP0A 3SKJE 3O1VA 4YVSA 4L8QA 3HVDA 4YFZA 3I54A 3DEMA 2RR12 1ZM1A 4XJ9A 1LODA 5KHHA 1UYYA 2IWGB 1TMF2 2ZHMA 3LA7A 5DAPA 4K8FA 3AB0A 1HRV3 2JDZA 1PMIA 1C4RA 2VNGA 1HQNA 2XJVA 3ST7A 1LNSA 1BEV2 4YW4A 4D7SA 1JHJA 2O1QA 4LE3A 3S57A 3A4UA 3AMHA 5FOBB 3AKRA 2HWB3 2ARCA 4GWJA 3CKHA 3JBG2 4CA9A 4B4PA 2VUCA 2VZUA 3K3NA 4C8DA 1JYXA 4CTEA 4TYSA 5CKMA 2G9FA 1PIV2 2UWCA 1COV2 1GBGA 1Y7BA 3FUOA 4X6RB 5TSWA 2J7MA 2YY1A 3AXEA 1V6LA 1AR93 2JX9A 2C4XA 2VMIA 1OSGA 4BQWA 5FZDA 1RUE3 1T6GC 2DUOA 2DUPA 4Q1PA 4QKFA 3M2MA 1YFWA 4NAMA 3EJKA 3MF9A 4OQ9A 2BGCA 3RYRA 2WUHA 1NUKA 4D6RA 3OD0A 2QQUA 3QBQA 5FYVA 1MACA 3VZOA 1DG6A 5A33A 5FZHA 1V9U3 4MX3A 4S2FA 3AJYA 3ZYHA 1W2AX 1WUVA 2JDPA 1S55A 1SFNA 5IFPA 1EUTA 2BFUS 4RFT0 5IAVA 2EF6A 4RA0A 3BTAA 3PJQA 3W59A 3ZO0B 2FBEA 5FYZA 1NA1A 4AFCA 4MXVA 4WV8A 5A3OA 2GMMA 3NRUA 2KD7A 3OB8A 1AUYA 5GZDA 5JXIA 4AZZA 3I3BA 4META 3B7MA 2DFCA 1QQP2 2D6PA 4YWAA 1YIPA 2JB4A 1NE6A 4FPJA 4XF3A 4ET7A 2VVFA 1CPMA 4EN0A 2WA3A 4LHKA 4ARXA 1J1TA 2J1VA 4QQHA 2XHNA 4N9HA 3T30A 3M8LA 2G19A 4Y4RA 1W2OA 2WNUA 3CDZB 1FNYA 3MDPA 4L2NA 4YW1A 1IQAA 1VB4A 5LBFA 2P6HA 3PURA 4YZ2A 4N8MA 1RVF1 1I1EA 3LDKA 2BUKA 1H4GA 2RS31 2BNNA 1ZBE1 1X8EA 1ZA4A 1FPN2 1IG0A 2B45X 5FYCA 2WWJA 2VMHA 2GH8A 5FPZA 2VMCA 5FLHA 1MZFA 4LBJA 3FLRA 1VR3A 2D98A 2XB6C 4YVWB 1CAXB 5T52A 3VBHA 4A7ZA 3DECA 1YHFA 1H1AA 3MIBA 4P08A 4Q4X1 1AYM1 2ZMLA 3WF3A 4PIXA 3WG1A 3DF0A 4DMIA 2JIJA 1POV1 4CVUA 4CEYA 2ZGRA 3J8F2 4LBQD 3FHQA 4V2VA 3EQEA 3FHIB 3HQXA 1C5IA 2E63A 4FP2A 3USUB 1JODA 3UYJA 4KGQA 4LXLA 4Y1VA 4COVA 3I7DA 1K5MC 1C57A 2YU1A 5J36A 1HXS1 2JE8A 2ZTNA 4CXYA 1SDDB 1SLCA 1U5XA 1JXNA 4IEZA 5FO9B 3KCYA 2VZSA 1WMXA 5LEJA 4LK6A 2R32A 2WO7A 5DABA 4FQZA 4OHZA 3OUHA 1NY72 2ZEYA 2W0XA 3F2ZA 3MEPA 3AFKA 3HQRA 3WW1A 3U0ZA 3M3QA 1UXZA 2VCMA 1OA3A 2PELA 1OH4A 4KU8A 2Q8CA 5LBBA 3TEZA 1D4M1 1AR73 3J7HA 1BBT3 3VDBA 1OFNA 1PHMA 3WP4A 1PNGA 3H50A 1RJ8A 2B39A 3KV6A 4QD2A 2Y33A 4NO4A 4LT5A 4CCEA 4F8AA 2D7FA 3W5MA 2VH9A 4XABA 3ZVXA 1SBFA 3RWNA 1EV11 3JD71 2CL2A 2D6OX 4A7YA 4TLFA 4R4ZA 3DL3A 1G86A 1QJFA 1UZWA 1OH3A 2R041 4LO4B 1W03A 1V6OA 3RVHA 1AF9A 3WG2A 2Z42A 3ZKUA 4XXAA 4AVVA 1WZXA 5T5OA 1HN1A 1N1TA 2D6NA 2WFF2 1HB1A 4JGYC 1RUJ2 1ULFA 3OGRA 1W8UA 1V6IA 4PHZA 4BH9A 1DLCA 3T2TA 2G9ZA 4EN6B 2FZ2A 1DQ6A 1JYTA 4YFWA 2JKXA 2W46A 4IEOA 1CAWB 2P34A 4XQDA 1NXD1 5KHGA 4AI2A 3D4KA 4CDWC 1H8TB 2XWBB 2EVXA 4P5HA 4ISRA 1PVC3 3CJIC 3LEGA 1LGCA 2BTVC 3JB8A 3MFAA 4XIOA 1F15A 3L2YA 1CWPA 4Q27A 4FCAA 1EAH3 5IVJA 4MZUA 1L7RA 1SPPA 4CEWC 4E2SA 4ZPIA 1NCQC 4YZ1A 3KV4A 5IYYA 3VBRC 1OUXA 2RS52 2X5IC 3VBSC 4HPKB 1JOJA 4TN7A 4ZXEA 1YQ8A 3VHNA 3TEWA 4JKKA 4GB31 2VQTA 2KXLA 4XQWA 2QQLA 4HZFA 4AHXA 4LOSA 1I5ZA 1W0OA 2PAEA 3VBFA 1DFQA 4DZGA 4HKLA 3U1XA 2XBO1 5M0TA 2A1XA 5C8CB 5H9SA 2VC9A 1GMMA 5FMOL 5DDJ3 5J96B 5LK5A 4Q0PA 1QJY2 5FXZA 2W1UA 3V64A 4WZCA 1D2SA 1GP4A 3A0NA 1WLCA 2BBAA 2ZMKA 4IGQA 4XBQA 2UYAA 4I3PA 3A0KA 4ZHNA 3I2FA 4ASMB 1RUD3 1O6UA 2OQ6A 4FFGA 5A1LA 5CU1A 5LA1A 3PUSA 2O0OA 2RR13 3N3HA 5A32B 4QX8A 3OBTA 5FZCA 2Y6JA 2IVJA 3IDAA 3Q8FA 4LBKA 1BVP1 1W6MA 3MFCA 4HANA 5F5QA 2IVIB 3ZN4A 3R05A 3N9MA 4LHNA 4XZPA 5CKQA 3NL1A 5GLVA 4AAPA 1BEV3 1KFUL 3AVRA 2Y6GA 4EJRA 3KWVA 1RUG2 2QTWB 1QHDA 3MV11 4Q2FA 4Y20B 5CFCA 1UIKA 2HLEA 3B01A 3JBG3 4LUMA 4IETA 3Q8CA 3WDTA 2JDYA 4LULA 2A3XA 5L73A 1SQ4A 2XUMA 5JDBA 1UZZA 2W1QA 2P1BA 4C1XA 4DXTA 2AR6A 1PIV3 2A70A 3NAPA 4XIKA 1US2A 1COV3 1AVBA 1J84A 1FMD2 2VY0A 5FZ8A 4S2HA 3AM2A 2HWF2 5DUVA 2HWE1 5A7SA 1S0CA 2WL1A 3HNMA 2AH2A 3WT3A 4AGGA 3LSEA 5HCFA 1ZRIA 4B7EA 5JOWA 3DXTA 4EV0A 1W6OA 4B1LA 1FNZA 1LOBA 1H9WA 1UMZA 3GXUA 1G6NA 1ODMA 4JDNA 3JQXA 4MGTA 4E8DA 2ZABA 1GQGA 2W3JA 1PK6C 5CB7A 2JICA 4UBHA 5ACA3 3I3EA 3U78A 5AFEA 2EIBA 1XNAA 4BQ4A 2HKXA 4CP2A 1AHSA 1STMA 2D5HA 2YZ4A 4Q5OA 3TN92 3ILRA 1BZWA 1VPHA 1PGW1 3WXPA 4RHV1 5K8SA 2PHXA 3JB4C 2EXIA 4DEQA 3V0AB 1GNHA 1O4YA 3AL5A 3BPZA 3MUY1 3O14A 4BB3A 1N1VA 5FR3A 3VDDC 3M3CA 4Q4V1 4UFJA 5DAQA 4JTNA 5FMBA 4B4QA 4OQ8A 1WLTA 2YPDA 1RUC1 4PBOA 1W28A 1LEMA 3GNEA 5CYYA 5JZGC 3C7GA 1GUIA 4ES9A 3NV1A 3PU8A 2NMOA 3O1UA 1H6YA 1QQP3 5FZLA 4KBZA 1RHI1 3UGFA 1KRIA 1C8M2 4MGZE 4IGOA 1LENA 3TB0A 1OVPA 1E5RA 2CU5A 3T08A 4DB5A 2Q1FA 3WQ1A 1ONAA 3D82A 4CCOA 1SDWA 4YRDA 2HWD1 2VOXA 1US3A 3OTFA 4P9IA 4KG0A 2G9GA 2R071 2VZRA 2VZOA 2QQIA 3EHKA 3N36A 5DG1A 3WNNA 1JZ3A 1VLNA 2X05A 4DY5A 3POYA 4NJ4A 1W6NA 4XCAA 3TNPB 3FJSA 4QX5A 4RGKA 2O14A 2PTMA 1PX4A 2AACA 1FPN3 1YCIA 3AMMA 1FOD3 3WLUA 3H8OA 3OGGA 1QGLA 1KFXL 1W3XA 1R081 2D6LX 1LHVA 3KB5A 4FVVA 4XDQA 1CVNA 3VHOA 5KR7A 3QACA 3MPBA 1CAVB 3SCHA 2TUNA 4K9SA 2LM3A 3VBOA 3WW2A 3LIHA 3NKGA 4NIDA 3PUIA 4HXCA 1PO22 3H1WA 5C5TA 3C8XA 5HV4A 2Q30A 1NCRC 3M7AA 4I0WB 3B02A 1ENSA 2C24A 2PHLA 1HW5A 2WWSA 3RPQA 3FC0A 3ZLIA 3NNJA 2NM1A 1K5MB 1OF3A 2L9LA 2Y26A 4INDA 3POBA 1LR5A 1H6XA 2CV6A 2EAKA 5BNNB 3NV3A 5IK7A 4MGSA 4CU9A 2VMFA 3KF3A 4GIQA 2PAKA 3ROUA 1BVVA 4DY3A 3LAGA 1UO9A 2A3WA 4LK7A 5FZ1A 2IC1A 3RYKA 1GQPA 5JXJA 2PN5A 1RUOA 2ZJCA 2FD8A 4K1YA 1S2EA 3I4IA 4TLGA 2JDAA 2VZ3A 5ISLA 1O7FA 2D3SA 2WS92 1N3QA 5FZKA 2QQWA 2YYOA 4FT8A 1NLSA 2ADEA 4Q4Y1 5EHDA 3RZJA 2XUEA 2RS11 3NNLA 2WZR1 4H7LA 1PO12 1I5PA 3PMSA 2HJIA 4IV3A 5F1RA 4Z92B 1OT5A 3ZXEA 1CD3G 1MR5A 4HVOA 1R1A1 4AAXA 5F32A 5T5LA 5K9YA 1RUI1 1Y9GA 2W95A 5FAXA 3H8XA 1UCXA 2FCUA 3OG2A 1V0AA 2X53S 2E6VA 5BNQA 2WNUC 4J1XA 1CZSA 4UF0A 2BRTA 3ABZA 1A6CA 4KH9A 3PIJA 4RR3C 3FMGA 5FLJA 3WP6A 1M4WA 3POIA 3PVNA 4IQPA 4XJZA 1WMDA 4NE9A 4MXWA 1HV1A 2YMZA 4LITA 1DQ2A 1LOCA 1KS4A 1UX6A 3DYOA 1S0BA 3A23A 4LBQA 4XAEA 3ALQA 4I3GA 1EUUA 3LPGA 4BLIA 2WYSA 1J1LA 2DCYA 2WFF3 4Y5Z0 1RUJ1 3VBHC 1UYPA 2DTYA 4N53C 4PDWA 4Y1UA 2QVSB 1PNFA 1YEWA 4XUQA 3T0DA 4EN9B 1JBCA 2RDSA 5HXVA 4OI0A 3PNAA 4V2WA 3RG0A 3ZM8A 1DGLA 5EYYA 4UYBA 4CDWB 3E6DA 3AYCA 3JXSA 1SFYA 1XBFA 3RDIA 3CJIB 4XUOA 2ZX1A 5FPVA 1OMIA 3UK9A 4YZ4A 2GC0A 1RIRA 2JKBA 4S2GA 5I0SA 2UWAA 2JWPA 1KDKA 3F95A 3ZDVA 4CEWB 1PGL1 1WCDJ 1R093 3VD5A 1NCQB 2H0VA 4UFKA 4Y4YA 1S0EA 1W39A 1W3VA 3IMMA 4FI9A 3AK0A 3CO2A 5LWBA 2HWC1 2X09A 3S7IA 3VBRB 4L99A 5E88A 3HJRA 3HNBM 2RS51 4V1PA 5C3PA 4CDXA 2RDQA 3MW2A 2R30A 3ZXGA 4C1WA 5FK8A 1WW6A 1DHKB 4MHRA 1OQ1A 3RMXA 2OXBA 4NIIA 1JYVA 1IPSA 1DQ4A 3OYWA 2ZX4A 3OGSA 5DAXA 4LKDA 3U75A 3U07A 3K75B 1XE7A 4YGEA 4F83A 3AKSA 3C7HA 1NLRA 2ZBJA 1CN1A 4JHZA 3CL1A 5FYMA 3LA2A 4QX2A 2OZ6A 3VB9A 1OFSA 4QMAA 1AX1A 1QJY3 2DURA 5FYUA 4LIUA 3V0BB 4IEWA 2Y6FA 4IEQA 5D8AA 5BPXA 1O3QA 4M3CB 1YC61 1H9PA 1EPWA 4XJWA 1HRI1 4JDMA 3KV5A 1AL0G 2VR4A 3BU0A 1ULOA 2ZGSA 2IXIA 3FFZA 3QLQA 1QJU2 2W1SA 3J4UH 4CDUC 2VW0A 4AHYA 2W92A 1RVF2 5FXVA 4XFAA 3WDYA 3JCIA 2DBNA 5DUWA 5E6HA 5ABJC 4MGYE 1RUG3 2ZOEB 2RS32 4N9IA 1ZBE2 3RI9A 1ND2A 2VZTA 2WNVA 3NNFA 3O0XA 4XFFA 5J09A 4HSLA 4AW7A 2BGOA 2BJSA 5C9AA 1L7QA 4NRMA 4JRAA 4YPJA 1N3OA 4XFCA 3AP4A 1FMD3 1LKNA 5FK7A 3FL7A 4Q0VA 2YBKA 2HWF3 4N7IA 5F3CA 3CEWA 4ZZ8A 1AYM2 2D97A 2WINB 2XDVA 3MV01 3BI3A 3UKTA 3IDCB 4NAOA 4UXAA 3NWKA 1QJZA 4Q4W3 4BLJA 5CA6A 3MF6A 4HK8A 1JN2P 2XWJB 3RMYA 1WW5A 4GKXA 3TAYA 3I8TA 1MS4A 1E5SA 3BKZA 2WLPA 3PLQA 4ZS3A 1AL22 3H3ZA 1PK6B 4KWUA 3MLJA 2ZGLA 1O4TA 4ZONA 4UI9L 1LOFA 2E9QA 2XJRA 1HXS2 3IIIA 3LGRA 2DVAA 3QD6A 4W6YA 1TVGA 4QPIC 3VD9A 3TN93 2Q8OA 1XNBA 2AREA 5G05L 3MIHA 2ZGUA 4ONUA 5FMCA 1RUF1 2BW8A 4OZXA 4LTAA 3VDDB 2EICA 2B4KA 4XCBA 5C71A 4QGLA 1VIWB 2JE9A 4Z2WA 2JE7A 3BGAA 3ACFA 5IVYA 1N1SA 4A2UA 4XJ8A 4CP9B 4EWEA 4FFHA 3V65A 1D4M2 2A5ZA 1GWKA 3AP5A 3HAGA 1JTZX 5HI0A 3ES1A 5JZGB 5L19A 2ARBA 4QGNA 1X36A 4CXXA 1IHMA 1ZZ8A 4AI8A 1EP0A 2DVFA 2F17A 1YQ6A 3ENRA 1XYOA 1LECA 5C5UA 2I45A 1SACA 4QQ2A 2WZEA 5CG9A 4AQ2A 4GMP3 5AFBA 1C8M3 4HT1T 4NIAA 5BNOA 2B9UA 1XXNA 4WBBA 1HQLA 2VCBA 3JD72 2E7AA 3KQ4B 2JG9C 3LOIA 1V6JA 1VBB1 2Q1ZB 3J9SA 4YZ5A 3H0OA 4HMZA 4NHYA 4LORA 4GA9A 1IOAA 5SV5A 3R4DB 5DPNA 1NX9A 1LOAA 4DPNA 2R042 4HKOA 1OD5A 1GZ9A 5CFCC 2WWUA 4GH4A 4D7TA 1NLQA 1AX2A 4OI2A 4LNVA 5EP9A 4AGVA 4OI4A 2BVVA 1HB2A 2YU2A 3IMNA 4WM7A 2IXKA 3ILFA 5JXHA 1VBC1 2PHFA 2VZVA 2W39A 3B94A 5CEHA 4Z8BA 5HV0A 1JOPA 2BQPA 2UU8A 3KLSA 1CPNA 4LIVA 5K4LA 2OUJA 4BYYA 3EXUA 1K42A 3VLBB 3PVBB 4MYEA 2Z2SB 4XVHA 3WDUA 3I3QA 3ZFEB 4AEDA 4XFIA 3W20A 2CY6A 5JSOA 2Q1MA 4QXBA 3GCXA 1PO23 1NCRB 1G9DA 3J7LA 4E8CA 4RYDA 3EO6A 1FV2A 4W6WA 5A80A 3I59A 1ULGA 2ZCWA 3C7OA 1RMU1 4YGCA 4YGBA 4L97A 2FDIA 2PHRA 3WW4A 3HBKA 1QEXA 2X8KA 1X82A 1TZOA 1VMHA 4Q29A 3ASIA 1F2NA 2ZX0A 3IKWA 4NRQA 3AKTA 3IPVB 2ZGTA 4WM8C 1RUNA 4GB32 2WKKA 5LATA 4GXLA 1UU4A 1DIWA 3UETA 1VAKA 1W05A 2GNMA 2R1BA 5FY9A 2XGXA 3OEBA 4Q0UA 5F37A 1YXWA 4XDOA 4D8MA 2XBO2 1JHNA 3UKVA 5A6ZA 3AMQA 1HB4A 2WS93 4JZRA 1NAEA 4PI0A 3SNMA 3H9AA 2W52A 1ND3A 4R9DA 4DXZA 4JTOA 4JQTA 3R6SA 2LUWA 4WVWA 4Y1ZA 1OLMA 1JYCA 4GWNA 3AYEA 1ULCA 2O8QA 4ZU5A 3RS6A 4FTSA 4L9BA 2RMU3 1IS4A 2D3RA 1GICA 1TQ5A 2Z4FA 1FYUA 3OF1A 4P9YA 4TWTA 5C4WA 3KHCA 4U2AA 2VU9A 4ZU7A 2WNUB 1Q56A 4YW3A 1WBLA 3I3DA 3I2DA 4HLTA 3NV2A 5J1XA 3AKQA 1L7LA 1VBD1 1W9TA 4QM8A 5H9PA 5H9QA 4FOQA 1CAUB 2FDHA 4RR3B 1B35A 3PU3A 4LKFA 1XQNA 4KWJA 4W50A 5JIAA 3GBWA 4YM2A 1ENXA 4TSVA 1W8WA 1W8OA 4E4HA 1SLAA 1UAIA 3K4DA 3AZZA 2C0ZA 2A7AA 2XR4A 3E6BA 3ZXDA 2EA7A 1XPWA 4BM8A 2NYYA 4FAHA 4G4FA 3VBHB 4AEMA 4HONA 1YYNA 4N53B 4CU6A 2MPFA 1W8TA 2J42A 3THTA 4IXLA 1ALYA 2HWE2 1GOFA 1X9TA 4QQLA 4RS5B 4XUTA 2SBAA 2ZACA 2QQMA 4Y1XA 2N7GA 1CX4A 2JDUA 4GWIA 3HBZA 2HWB1 1SLIA 1S0DA 2DCKA 2GN3A 2D6KA 5BYNA 1FT9A 2KM2A 1K12A 4OULA 3HQUA 4C91A 2UY9A 4P5YA 2VMDA 2DDUA 4LKSA 5FLIA 4LLOA 4PBPA 4E9KA 5L7OA 1HN0A 3U4XA 1GZCA 1W6PB 3VKMA 3CIHA 2WABA 1PGW2 1UY3A 4NVPA 4RHV2 2OS2A 2Y6KA 3GBGA 3ZSEA 2F4LA 2GMEA 2I2SA 1AR61 5FWEA 4XMAA 2ZEWA 4GALA 4AQTA 2QQVA 4IV1A 1E5IA 1WCQA 4Q4V2 4O7XA 2A75A 4XUPA 5APAA 2WLQA 3SHRA 5CG8A 1DYOA 1SLTA 2RG4A 2W1WA 4JV4A 1RUC2 3RI8A 1JUIA 5FPLA 3R0RA 3R4UA 3LCPA 1N1YA 3AP6A 1LESA 4XACA 4DS0A 1O59A 2GSYA 4QPGC 4O65A 2QQOA 4KQ7A 4XZUG 2ZGNA 1RHI2 3OSDA 1DDLA 2P37A 3ZXLA 1GOGA 2K9ZA 3KHBA 2WDBA 2WT1A 3QCWA 3K3OA 3FFQA 5GKAC 4CDUB 4N43A 2ZGOA 2BWAA 4KBBA 1QJU1 2YUEA 3T0BA 4XAAA 3KVAA 2HWD2 1ZVFA 1LU1A 3BIEA 1ZRDA 5I91A 4CCKA 2R072 3ZFFA 3H3LA 4OMCA 1RVF3 5ABJB 3WSOA 1PM4A 1IZ3A 4JGZA 4AOCA 3H3UA 1OOPC 1IKQA 2JDKA 3MLKA 3UV9A 5EWSA 2J1SA 1ZBE3 4D3WA 2W9XA 4D7YA 1MS8A 4O9GA 1SFPA 4YW5A 1RYYA 3FE5A 3SXWA 3RJ2X 1GWLA 1MQTA 1R082 2JG8A 5IUQA 4A6OA 4BK4A 2E26A 2CWSA 1D2QA 2GALA 4CDQA 1H1MA 4HN0A 4XTMA 2AZ5A 5A3WA 4AFDA 1NE4A 4RQPC 4BXSV 1DCSA 4Q4X3 1AYM3 5T5JA 5CAZA 1JZ2A 2EXJA 4BISA 3S6PA 2C9AA 3VKNA 3RZLA 1POV3 1JMUB 1VBE1 2PA7A 1Q8QA 2QFEA 3PMEA 3RNSA 5F7UA 3UNPA 1SPPB 1XNKA 3SH3A 1AL21 1IPJA 3GHNA 3WF4A 1JYWA 2VBPA 3C7FA 1HX6A 3NJZA 5K0UC 4RD7A 3AYAA 3B3QE 2GC2A 4QPIB 1M06G 4OYUA 4AK3A 5IW0A 2WSVA 1U5IA 1LHUA 1DF0A 3AP9A 3BOWA 2RHPA 2C5DA 2NQYA 3POJA 5F2SA 4FPYA 5EQUA 3G7DA 4EN8B 1DGRA 2P3IA 4E2GA 1NYWA 2VVEA 3INAA 5J98B 1H8VA 2R16A 5KC5A 1ZZ9A 4Q4Y2 1HIXA 2V73A 2RS12 4ARYA 2WZR2 4QDQA 3SCGA 1D4M3 1GKBA 1QH6A 4K6BA 3VN4A 4OUSA 3DPRC 2P3KA 1Z7S1 1PGSA 3D5OA 4H7MA 4XQ4A 3RYPA 1R1A2 2WQ4A 2ZEXA 3L9JT 4HKWA 1UXXX 3M70A 1RUI2 1RC6A 2HYKA 5FKBA 3H8UA 4HBNA 4AVTA 4U36A 4DRRA 3TEXA 3KT7A 4OCTA 2IXCA 4AEJA 2JG9B 2PXJA 3ACGA 4CZSA 3N4MA 1EV13 3JD73 1Q8OA 1HDKA 2XLGA 2DBIA 1VMJA 1H2NA 3WOGA 5GZGA 5CFCB 2R043 4LQRA 3AXDA 2FZ1A 5FRAA 1D0HA 5FXXA 2NP0A 2XVGA 3JUUA 4QT6A 3FLTA 4CYDA 2BU9A 4QPYA 4XDPA 2PHUA 3KV9A 3T1LA 5C9AC 4DO0A 2QZ2A 4BWOA 4HL0A 4K8RB 4LHSA 5IWFA 2LRPA 1FI2A 5DZFA 4P00B 5E16A 1NXMA 1UMIA 1S4CA 1URXA 4QDRA 5C3QA 1VJ2A 4M00A 3BIWE 1VRH1 4YM3A 1KXGA 1WW7A 3AL6A 2JD4A 1E5HA 2DVGA 3DUIA 4AI1A 2WQ8A 2DYCA 4KWKA 4CCJA 4BU2A 1O5LA 1GU3A 1PGL2 4QHOA 3QH7A 3K4AA 5FZOB 2FDJA 1G9BA 1LGNA 2HWC2 3N7JA 4AFAA 1CJPA 3PUQA 3IAQA 4J1WA 2PFWA 2GH2A 4WM8B 4D94A 1ZYBA 5IK5A 2YHJA 3P1IA 1LJ7A 1CAXA 4X6QB 1UF2C 1SCSA 3WQ7A 5FCCA 2BOIA 2EXKA 2GNDA 2HBUA 2XBO3 4YNIA 2TEPA 3VL8A 3VD7A 5IK8A 2XPJA 5J37A 3KCXA 5A7WB 4GULA 1JW6A 4XW3A 3S0MA 1J3QA 1NZCA 4AQ6A 5T54A 4HVQA 3GZUC 1D4VB 5DAWA 2FCTA 5T5PA 2PLV2 1ZRFA 3GF6A 3THDA 3USUA 1UPIA 2WR9A 1TE1B 1NQJA 2E31A 2EIDA 4I2OA 4AFBA 1HRI2 2AC1A 2R1DA 1U0AA 4CE8A 1NG0A 3N9LA 1XOYA 1IPKA 2XJSA 1LHWA 4LA3A 2I07B 3GBFA 2KR2A 3H42B 5FWJA 2EIGA 1C28A 4YG6A 1TMF3 2Y0IA 2JEMA 3AFGA 3KQRA 4B8EA 1WA6X 5A3TA 3RWKX 2VE1A 2W2IA 5FV3A 2ET1A 1RTVA 4P9LA 5LBCA 1LCLA 2YROA 3VBUC 1JZ6A 3ATGA 3LWCA 4FFIA 3JZVA 5LA2A 5BNPC 4H14A 1DGRN 2HYXA 3ZMNA 4N90A 1S1AA 4LLFA 1MZ5A 4OI1A 2AEZA 3VHRA 2CGPA 3S30A 3KGLA 4NN0A 1ZZCA 2WAOA 4R9CA 4XFGA 3AC0A 2JECA 5A3LA 5LEKA 3LZZA 3K77A 3WV6A 2QQKA 2DU1A 1QKQA 2HWE3 5LASA 1PM7A 4NRPA 5GLZA 4CCLA 2ZXQA 4QQOA 1W8HA 4BIOA 3NO8A 3ZYFA 4NHLA 2R0FA 2HEWF 3J26N 3NSTA 1YFYA 3EMRA 1FXZA 4EYUA 4ZY9A 4JRLA 2R061 1ZZBA 1YQCA 2UY8A 4B4RA 4UAPA 3MIEA 2A6YA 2D6MA 1GP5A 3VKLA 5F5CA 3I2GA 2OIIA 1LB2A 1TME1 1UQXA 4A3XA 5CFDA 3NVCA 1AXKA 3P5BA 3AX4A 3BU7A 3UJQA 3V56A 1RUF2 1VBA1 4QX0A 4A7KA 3WNMA 3MIGA 1DQ0A 1CAWA 1ND3C 2VBBA 3G6JB 2XG3A 1VMFA 4Y22B 4Q4V3 3B9CA 1H8TA 4UW4A 3CHXA 3ZIWA 3N9NA 1MZ6A 1RUC3 1YO8A 5ACA1 3ZN6B 2F4PA 4QPGB 1APNA 1A3KA 3K4ZA 1SLBA 2XHKA 3C7EA 3PTYA 2RE9A 3AMPA 1QF3A 3OBRA 4XBNA 1QDCA 3HOBA 4YVSC 3A21A 2H6CA 1RHI3 1IGOA 1QXJA 2OT7A 4AI0A 1G9AA 2ZMNA 5BXXA 4NPMA 2RJKA 3B93A 1UWWA 2VCAA 4WVMB 1B35C 1MEC1 5FP3A 1VBB2 4X8PA 4HPKA 5F6LB 2PHTA 4NOTA 1DYKA 3U11A 2VUAA 2VL4A 3BODA 4UWDA 2XXZA 4FP3A 2HWD3 4FPHA 3WNPA 2SLIA 1Y9MA 4DQAA 3W21A 4IGPA 2R073 2VPVA 3PUHA 2VD7A 4ATFA 2VOVA 1OOPB 3LB9A 2QNKA 2XLAA 5DXDA 4ZU4A 5C8CA 2XJPA 4HOOA 1ENQA 1RUH1 1VBC2 1BK0A 4DXSA 2GNTA 4EWDA 1BMV1 2A73B 2B5HA 2AYHA 1VB2A 1R083 4XMIA 1F4AA 5HBAA 1DZQA 2IFWA 1F5JA 2V5DA 4I09A 1OQDA 3NJVA 3PUAA 2GC3A 4PQQA 2OKXA 3DN7A 3IZOA 4P9GA 4RQPB 5FPBA 3SH5A 4COYA 4IE6A 2WC2A 4NUBA 2JDMA 5I0UA 4CCMA 2VNVA 2V09A 1IKPA 5DAVA 1RGSA 4QXKA 2VJXA 3MHZA 5FP8A 4LBLA 4KMQA 4A44A 4AQSA 1XSQA 3RZZA 3S5AA 2YBSA 1OBNA 2ZEZA 4XFHA 1RMU2 1YI9A 3J8F3 4L92A 5JMCA 4IUGA 5FFOC 3OUIA 4Y20A 3TEYA 3T2QA 5K0UB 2BERA 5E8AA 5FZEA 1EPZA 4AVAA 2RM21 3E1F1 5L9BA 1FV3A 4FTEA 3NV4A 4W8JA 1ZA7A 3KVBA 3RSJA 1YLLA 5DUUA 2IZWA 1GZWB 4XJAA 1ST8A 1NA1C 4LR4A 1QJEA 5C33A 3GZAA 2WRAA 1ZX5A 3WDXA 4QB2A 5CISA 2OUHA 1OQEA 3ZR5A 3ME2A 1W6QB 4Q4Y3 2RS13 1G9CA 1UYXA 2WZR3 3DPRB 4HG6B 3GALA 3TWIA 1H30A 2ZA9A 3UESA 4Y33A 1U12A 1R1A3 1U5ZA 5T3NA 2WO3A 2MEV1 3MGUA 1ODNA 1LGBA 3NQHA 3CU7A 3OPTA 4LUKA 5CFDB 2XLFA 1LTEA 4HSJA 4URTA 1VBD2 1HV0A 2PYTA 2JD9A 2WO1A 5A6XA 4Q0QA 2QCSB 2LROA 3GDBA 5JPNB 2GAUA 3P6BA 4IERA 3VZNA 3IAPA 2UWBA 2YFZA 2I74A 3N9OA 5C9AB 2YFUA 3ZXFA 2BV4A 1MQTC 2HBTA 4LA2A 3JU9A 5GLTA 2Z5WA 4AL9A 5JXGA 1CX1A 1OLQA 1WA4A 2E51A 4JGYB 1NT0A 5FY1A 4CDQC 4XC9A 1I3HA 3WCRA 5FMDA 5C3RA 1RUJ3 2VOWA 2WQZC 3WUDA 5FYBA 3WF2A 4ORFA 1H2MA 1YJLA 5JPMB 2WN2A 3J7MA 4CEYC 5LCWL 1GNYA 3KZ4C 3Q9OA 5LZ6A 3ACIA 4QX7A 3KM5A 2HWB2 3C2UA 1OURA 3SQOA 5EJ3A 5GLUA 5JSRA 5AVAA 3BOPA 3WZ1A 1BJQA 4M4RA 3UGHA 1AJKA 3O1TA 1OI6A 5JSPA 1ZBA1 5HCBA 2BFUL 2QKDA 2X5IB 1QXRA 3VBSB 4XHBA 4A45A 4D0QA 2BOJA 2RS53 2R49A 5AC91 4YM1A 4Q8LA 3E5QA 3ES4A 4AI3A 3FX3A 1AR62 2G4IA 1UY1A 1JOBA 2IXLA 3SH4A 1CAVA 1PX3A 2OW4A 5FYYA 4CU8A 1QJX1 3GGLA 1UZYA 3DYMA 3BN6A 2Q8DA 3LOBA 2VXJA 1U5YA 4OHVA 4YYOA 1X8MA 1V9U2 4KGGA 4MO3M 2OX0A 1R091 2JDNA 5CNAA 4ES8A 4D69A 4BZ4A 3N7MA 2PLV1 1XE0A 2QQPA 1K5MA 4GQ7A 4UW5A 2DV9A 3OY8B 2EIEA 3LA3A 1HRI3 4DEVA 1LU2A 1DZTA 4MH0E 4MSVA 4COWA 5BNNA 5KHJA 1DQ1A 2VW1A 1ASJ1 3O0VA 3PTRB 4B3NA 3SCFA 2IXJA 4HVRA 4Y24A 3ZFGA 4UT5A 4LHLA 2BNOA 2QUOA 3VBUB 4GAZA 1BK1A 3ZIXA 3WHUA 5F3GA 1WD3A 3AYDA 5BNPB 1W9WA 5FMOS 4BQ5A 1KS5A 3ZSKA 1C5HA 1MS3A 1C1LA 3U37A 4F7ZA 4J25A 3EBRA
chains in the Genus database with same CATH topology
2A6VA 3DV8A 4HETA 1MVEA 2VECA 1AR81 1QXPA 3WP3A 1OA4A 4YG0A 5KXDA 1Q8SA 1V6MA 2NN8A 4H55A 3I59B 2FHRA 1VBE2 3WG3A 2GNBA 1H0BA 4PQ9A 3BALA 3SITA 2X29A 2O8OA 1GYKA 3KT4A 5JI9A 1G8WA 1OPOA 1HKDA 4FPFA 2WT0A 3MLLA 4G9SB 2YV8A 1GANA 3AZYA 1UL9A 3N7LA 3VBFC 2OVUA 2ZGPA 1RUF3 1AYN1 1QDOA 2ILMA 2YXSA 5GZCA 2XJTA 2ENRA 4Q4W1 1ND3B 4CDWA 1G9FA 3ZXAC 3POSA 3CJIA 4FSJA 1CESA 2H0BA 1Z7S2 1REFA 1GLHA 2NZ9A 4YVSB 2P3JA 3WNXA 4CEWA 2ATFA 1NCQA 5J3UA 3MIDA 2C1FA 2F6BA 5GM0A 3VBRA 1QOOA 2KA3A 2VXRA 3IN9A 2GZWA 3IDEA 3MI8A 5FTTC 1VBB3 2VG9A 3H1MA 4FPLA 1Q8PA 5KBFA 3POWA 3WR0A 4PJYA 2V5YA 1LULA 1JUHA 4AVBA 1FAYA 4SLIA 4BHPA 1IS5A 3NAPC 1SBDA 2WZPP 1XNCA 4GMP1 4AFMA 3V0BA 4M3CA 2DCJA 4JDOA 4OFGA 1S0GA 1RB8G 2ETEA 2DVDA 4JAAA 1VRH2 4FOWA 5A3MA 3WDVA 3WX5A 5A33B 2LTNA 2OA2A 2VULA 2W08A 1RMU3 4KWLA 1KJLA 2W68A 5AVPA 3ZYPA 4WZFA 3KS7A 2E53A 3KT1A 1H2LA 3ZYIB 1NA1B 5BUVA 1WW4A 1YJKA 1GFF2 2B46X 4GMP0 4XYXA 4AYUA 1DYPA 2AGSA 5DZEA 1S0FA 2Z79A 2ZHLA 1CIWA 1EAH2 3WQ0A 1XNDA 1PO13 4OHWA 1DGWX 1PK6A 3UL2A 1X50A 2UYBA 2CWMA 3M3IA 4EWAA 1CJDA 4RGAA 1RINA 5FPXA 1VBD3 4M0HA 2ZZJA 4K20A 5I0TA 5JLVA 4IEXA 4TZDA 4KG8A 2DWRA 4LEJA 3N35A 3ZPYA 3VDDA 4R9AA 1ZZ7A 4I30A 1OHFA 1O5UA 4X8NA 5JZGA 4CDQB 1XU1A 5GZEA 3VBOC 5FQ0A 5EZWA 3HN1A 2GU9A 1E57A 4OVEA 1PZ9A 1HRV1 4CEYB 5K7PA 1V6NA 4M3CE 1BYHA 3FBYA 2PQQA 2R062 4CP1A 2Y38A 4W65A 4P9XA 3H1YA 1CONA 2XJUA 2XH6A 3W9AA 1TME2 1QH7A 1S0IA 3N7KA 1Q3EA 4YLZA 1AR91 1VBA2 1AR63 1ULDA 1RUE1 5JIUA 3ZFEA 4XEZA 3APBA 2P17A 4AWDA 1H2KA 1NCRA 4IV3C 2PAMA 5E1RA 1V9U1 3PVEA 4COUA 2EAAA 5ACA2 3M4FA 3WUCA 4FPCA 1S2KA 2MHFA 5EFUA 2PHDA 4FBFA 3IPVA 1D0GA 3W58A 1MEC2 4YG3A 1F31A 1QJU3 3UJOA 1QU0A 3ZYJB 2R6QA 1QOTA 2EALA 3MYXA 2BVBA 4R52A 5IK4A 1AXZA 1A8MA 5I8TA 5FDBA 2RS33 1RUH2 1BMV2 2OZJA 3WP5A 4OHYA 4PDWC 3ECQA 4IEVA 4HFSA 4FPEA 4YARA 2ZAAA 4PLOA 4KL1A 4LO8A 4BIFA 4C0BA 4ZKTB 2ARXA 2DF7A 4IL7A 5J7MA 5LK7B 3KD4A 4IESA 3B5LB 3OGJA 3M3EA 2XL9A 5BV6A 1BCXA 1CAUA 1VBE3 3MW4A 1N47A 4RR3A 4AE2A 4I0BA 1AL23 1ZRCA 1FOD2 3VZLA 2UURA 3WINE 2ZX3A 4Z1VA 4CDXC 2QJVA 2RM22 1HXS3 1SEFA 4PCRA 5IT6A 3L2HA 4GWMA 1QMJA 3SMHA 3VBFB 4N53A 4FXKB 3VKOA 4LE4A 4E4ZA 4FTBA 2Z69A 4PIZA 4OHXA 3ELNA 3FZ3A 2A71A 5DUXA 1I9RA 4RS5A 5JR7B 5FOJB 2JENA 4OLLA 5I8YA 2QE3A 5CADA 3FUQA 4ATEA 2LALA 1O4ZA 4FXGB 5D8AC 1Z7S3 3HT1A 1JYIA 1UKGA 3O7OA 2MEV2 2QDRA 3DGTA 5BNNC 2ZGKA 4XHXA 3RJRA 3B69A 3HIFA 1W6PA 1W6MB 4BOWA 2Q5TA 4BMEA 3ZFGC 4XF4A 2FQPA 2QDNA 2ZKLA 4QU2A 2WNVC 1ND2C 3M1HA 2HEVF 1V00A 1QOSA 1TNFA 1AR71 3H7YA 1YFUA 1FATA 4F3JA 5T50A 1BBT1 3O0WA 4AXOA 1POV0 1WGPA 3NAPB 3P3NA 1LOEA 4P9WA 4BCUA 4K7JA 5F6KA 1DGWA 1VAMA 5KXBA 4J6GA 1W6OB 5C6CA 2VGDA 1ZZ6A 4CDUA 1VRH3 1XYNA 2DUQA 1VP6A 3NKTA 2JJ6A 4DNYA 4L11A 1CR7A 4FAGA 2D93A 4E4SA 3USSA 4XPVA 4Z07A 5ABJA 1LOFC 5JOYA 2WNEA 4E4DX 3E6CC 4IEYA 5GALA 1CGPA 1ZBA2 3D8CA 2D44A 2ZS6B 2CTVA 5AC92 3RQ0A 4ASLA 3R4SA 1VALA 2ZX2A 1YNAA 1WCKA 4GB33 1H4HA 4Q26A 3D0JA 4ITCA 4KU7A 4YVWA 5KWRA 1QJX2 1PVC1 3GZTB 4W6XA 2XKOA 3ZMOA 1DQ5A 4DRVA 4I02A 1EAH1 1R092 3URFA 2OYZA 2XL7A 3ZSLA 1TEIA 3P3PA 3VV1A 2AUYA 5BNOC 3WY6A 2B42B 4AG4A 2Q0AA 2CAVA 4FOYA 1SMVA 2CYFA 4QPIA 5FBZA 1ASJ2 4MV2A 4BA6A 1QNWA 3OCPA 4GH4C 4PLMA 1W6NB 4YM0A 1WLDA 3HWJA 4WM7C 1H1IA 1SLLA 5DDJ1 1J3RA 4G3YC 3ACLA 4JQRA 5F9TA 1SCRA 3AZXA 4ZXKA 1GR3A 1LOGA 1O3RA 3VBOB 1RUD1 3FBMA 4AEDC 4NPRA 2RR11 4LBMA 1AR82 4XBLA 1MS5A 3U10A 1TMF1 1LHNA 4ISQA 2JG9A 1O3SA 4QGMA 1BEV1 4B29A 3E5UA 1C3HA 4KNCA 3ZYRA 4XF1A 3WDWA 2R063 3JBG1 3IM0A 4S2DA 5KXCA 4WVZA 3CLPA 1HLCA 3THPA 1PIV1 1TME3 3AP7A 1COV1 3GHMA 4Y26A 2DCTA 3VZKA 1ZREA 4MVTA 3HD8B 4LO5B 4RHV3 1UIJA 1VBA3 1AYN2 3BCWA 4N7UA 2D3PA 4Q4W2 1AZDA 1Q8VA 1WBFA 4QHBA 2BPA2 1V6KA 4BMBA 3MPPG 1J3PA 4IV3B 4HK9A 1BXHA 2EXHA 5FO7B 2A3YA 4E27A 5C4WC 5FO8B 3TOJA 3E97A 2JXAA 1YFXA 2RJLA 1A78A 1WLWA 3E5XA 4NHKA 4CRQA 4MLOA 2CGNA 4XILA 4WM8A 1MEC3 1X33A 4XF9A 3O12A 1KJRA 1KD7A 5GJ6A 4MXWB 2ZGMA 3MICA 2NPIA 4LBQB 4SBVA 4XFBA 4XTPA 4K1ZA 1RUH3 3AZVA 5J48A 3OD4A 2VQAA 4NWWA 5CIRA 4PDWB 1Y43B 1QQP1 5HCAA 2DVBA 3GYDA 2DU0A 3K48A 1J58A 5I0RA 2XVKA 4R9BA 3WD5A 1ZNPA 2ZGQA 3VUOA 1MS1A 4JVAA 5JOZA 3ETQA 3RRDA 2QZ3A 3LSDA 4AHWA 4BPZA 1Q5OA 4LBOA 3WCSA 5JVVA 1UN1A 4K3UA 4H3WA 4R4XA 4Y1YA 5L7OC 1J59A 1QY4A 3HMYA 1FPN1 1FOD1 1KQRA 1DLLA 4CDXB 3OJBA 1TNRA 4M3CF 2ZZQA 3OPZA 3O5SA 1YIFA 3HR9A 2RM23 4Q0SA 1Y3TA 3OYWB 3ZFEC 2GMPA 2ZAHA 1W0PA 1AX0A 3MW3A 4IV1C 1AJOA 2WA4A 3ZN5A 4P9JA 4EROA 1X7NA 1UW8A 2VW2A 1A8DA 1PZ8A 3J8F1 1W2UA 1AXYA 1L3JA 5KHKA 1DBNA 2WSUA 2ES3A 4UBGA 5D8AB 4XJUA 2NLRA 3NW4A 2BEOA 3QOPA 4I01A 4COZA 1VAVA 1WMFA 4FOVA 2MEV3 5KC6A 1RUI3 1KDMA 4B7KA 4N43C 4O9EA 3CF6E 4MGKE 1C1FA 1G7YA 4IEUA 3ZFGB 2D5FA 3TRSB 1YUDA 3ZFFC 2ZHNA 1NY71 1Q43A 4JGZC 3V0AA 3WHTA 1ND2B 2WNVB 3IBMA 4AVCA 4PIYA 4Y22A 4M01A 4PLNA 3KGZA 3LKJA 1RITA 2JG8C 1KITA 3VL9A 2RMU2 2K2SA 4RL7A 4UW3A 3ZN6A 3M3OA 4QPGA 1YI7A 4Z82A 4YGDA 4AVSA 2DCZA 3B00A 1MVQA 4R8HA 5T55A 5KXEA 4WVVA 1O3TA 1HRV2 2D40A 4LBNA 5EYXA 2XJQA 4WVMA 3K51A 3D0SA 4DFSA 4XOGA 1UU5A 3TBDA 4JC1A 1NQDA 5JOXA 1C8NA 1OOPA 4QQPA 3DKWA 2DTWA 2FMYA 2WFF1 4FPGA 1ZBA3 4C0HA 1F9KA 2HWC3 2ZKNA 3UKNA 2IFRA 5AC93 1RL3A 1AR92 3IDBB 1SBEA 1RUE2 4M0NA 2E7TA 3CJXA 1I6XA 4RS5C 2VOKA 4FQ4A 3ZSMA 1YWKA 4RQPA 1QJX3 2VNRA 5LRSA 4RGGA 1BQPA 3ILNA 5BY5A 1F5FA 4MGIE 2ZHKA 4DOUA 1R1ZA 3VZJA 4HN1A 1Z78A 1QNYA 4UW6A 2FMDA 3HT2A 4GKYA 4Q1RA 2PLV3 4AHZA 5BNOB 3KCCA 5K0UA 3SLIA 5L36A 3WG4A 4K40A 2GC1A 4QM9A 5FREA 2NMNA 1DZRA 3AKPA 1S0JA 1ASJ3 3ZXJA 4GH4B 3KSCA 3JQWA 1GZWA 5GZFA 2CAUA 2VNOA 4WM7B 4AGRA 3B9IA 1BKZA 5I8SA 3AJZA 2VUJA 2B7YA 1QJY1 1W6QA 3WVJA 3WW3A 4PF5A 1XU2A 3DPRA 2D43A 1REDA 4AEDB 1XE8A 2VVDA 1RJ7A 2A6ZA 5B2GB 1AR83 4YZ3A 2IXHA 4P14A 5DG2A 2YC0A 4NHMA 4XF0A 2WT2A 1N3PA 2BWCA 1S2BA 1RUG1 3IT8A 2XKPA 1UKRA 5SV8A 4LO6B 2VMGA 5EV7A 2BNMA 1EYBA 4FPOB 3TNQA 4LO7A 1FMD1 4JGYA 4YVWC 2HWF1 5CBLA 3BB6A 4Q4X2 2ZPXA 5DZGA 2E7QA 1WD4A 1AYN3 3FLPA 3QH6A 4DINB 1UPSA 2BYVE 1LRHA 1XYPA 5I93A 1DU3D 2TNFA 3X29B 2WIIB 4EN7B 1QWRA 4XXPA 3D6EA 5C4WB 1B09A 2HEYF 3FWEA 1IS3A 2P2KA 3H7JA 1GV9A 5GLWA 3TN91 2AENA 1FX5A 2MNGA 2X5IA 1B35B 3VBSA 1PZ7A 4IEPA 2PHWA 1ULEA 5JAXA 4FPKA 1OKQA 2GN7A 1OLRA 5KHIA 2A6XA 4XE9A 1LEDA 3AZWA 1AR72 1Y9QA 5JCTA 2OPKA 1BBT2 3VHPA 1GNZA 4XETA 1MZEA 1VBC3 5FQ0B 2K0GA 3VGIA 2A6WA 3PHMA 4NR1A 1NOVA 3IIAA 3SISA 1C8M1 1UD1A 3C3VA 1EV12 4BQ1A 4FO9A 3OY8A 4OUMA 2B8MA 1Z0HA 3CNAA 5JWPA 1XRUA 2WJSA 2ERFA 2BBVA 3PVOA 1JH5A 5E89A 1MS9A 1REEA 5L7OB 1UU6A 3VBUA 3ZYGA 5CVRA 4YW2A 5LRRA 3VZMA 1GQHA 1HQWA 5BNPA 3ZDSA 4C90A 5D1IA 5C8WA 5CFDC 4K21A 4JCKA 2TBVA 2YGMA 1GSLA 1MS0A 3VKFC 4RSUA 1ZRRA 1YRZA 4YSFA 4IV1B 1OA2A 2WFPA 3IWZA 3TYJA 4E2QA 1PO21 2CNAA 1V70A 1WCSA 3KMHA 1PVC2 4I0AA 1H8TC 2R0HA 4Q8KA 1ENRA 2YGLA 1IS6A 3ZXKA 2Q4SA 4AEKA 2YDEA 5EXOA 3MIFA 4AF9A 4N43B 2Y0OA 1O91A 3MZHA 2DFBA 2GDFA 1PVXA 1EY2A 3ZFFB 2YPJA 1WMEA 4JGZB 3AMNA 4NWVA 3ZX7A 2H6BA 2WS91 3T1MA 5C8CC 3S7EA 5DDJ2 3ZSJA 2CGOA 3PJYA 2XVLA 4MUVA 1PO11 1LHOA 2JG8B 1MQTB 2VQ0A 1CQ9A 2ET7A 5JI7A 2RMU1 5H9RA 1F8VA 1OPMA 1RUD2 4CP0A 4YVSA 4L8QA 4YFZA 3I54A 2RR12 1ZM1A 4XJ9A 1LODA 5KHHA 3LA7A 2IWGB 1TMF2 2ZHMA 4K8FA 3AB0A 1HRV3 2JDZA 1PMIA 1C4RA 2VNGA 1HQNA 2XJVA 3ST7A 1BEV2 4YW4A 4D7SA 2O1QA 4LE3A 3A4UA 3AMHA 5FOBB 3AKRA 2HWB3 3JBG2 4B4PA 4CTEA 4TYSA 2G9FA 1PIV2 2UWCA 1COV2 1GBGA 1Y7BA 3FUOA 4X6RB 5TSWA 2YY1A 3AXEA 1V6LA 1AR93 2JX9A 2VMIA 1OSGA 1RUE3 1T6GC 2DUOA 2DUPA 4Q1PA 3M2MA 1YFWA 3EJKA 3MF9A 3RYRA 2BGCA 3OD0A 3QBQA 1MACA 3VZOA 1DG6A 5A33A 1V9U3 4MX3A 4S2FA 3AJYA 1WUVA 1S55A 1SFNA 2BFUS 4RFT0 2EF6A 4RA0A 3BTAA 3PJQA 3W59A 3ZO0B 2FBEA 1NA1A 4AFCA 4MXVA 4WV8A 2GMMA 1AUYA 5GZDA 4META 3B7MA 2DFCA 1QQP2 2D6PA 1YIPA 1NE6A 4FPJA 4XF3A 2VVFA 1CPMA 4EN0A 2WA3A 4LHKA 1J1TA 4QQHA 4N9HA 3M8LA 2WNUA 3MDPA 1FNYA 4L2NA 4YW1A 1IQAA 1VB4A 4YZ2A 1RVF1 1I1EA 2BUKA 1H4GA 2RS31 2BNNA 1ZBE1 1X8EA 1ZA4A 1FPN2 2B45X 2VMHA 2GH8A 5FPZA 5FLHA 1MZFA 4LBJA 3FLRA 1VR3A 2D98A 2XB6C 4YVWB 1CAXB 5T52A 3VBHA 4A7ZA 1YHFA 1H1AA 3MIBA 4Q4X1 1AYM1 2ZMLA 4PIXA 3WG1A 3DF0A 4DMIA 1POV1 4CEYA 2ZGRA 3J8F2 4LBQD 3EQEA 3FHIB 3HQXA 1C5IA 2E63A 4FP2A 3USUB 4KGQA 4Y1VA 4COVA 3I7DA 1K5MC 1C57A 5J36A 1HXS1 2ZTNA 1SLCA 1U5XA 1JXNA 4IEZA 5FO9B 3KCYA 5LEJA 2R32A 4FQZA 4OHZA 1NY72 2W0XA 3MEPA 3AFKA 3WW1A 3U0ZA 3M3QA 1OA3A 2PELA 4KU8A 1D4M1 1AR73 1BBT3 1OFNA 1PHMA 3WP4A 1PNGA 3H50A 1RJ8A 2B39A 4QD2A 4NO4A 4LT5A 4F8AA 2D7FA 2VH9A 3ZVXA 1SBFA 3RWNA 1EV11 3JD71 2CL2A 2D6OX 4A7YA 4TLFA 4R4ZA 3DL3A 1G86A 2R041 4LO4B 1V6OA 1AF9A 3WG2A 2Z42A 4XXAA 4AVVA 5T5OA 1N1TA 2D6NA 2WFF2 5CFDB 4JGYC 1RUJ2 1ULFA 1V6IA 4BH9A 3T2TA 4EN6B 2FZ2A 1DQ6A 4YFWA 4IEOA 1CAWB 2P34A 4XQDA 1NXD1 5KHGA 4AI2A 3D4KA 4CDWC 1H8TB 2XWBB 2EVXA 4P5HA 4ISRA 1PVC3 3CJIC 1LGCA 2BTVC 3JB8A 3MFAA 4XIOA 3L2YA 4Q27A 4FCAA 1EAH3 4MZUA 4CEWC 4E2SA 1NCQC 4YZ1A 3VBRC 2RS52 2X5IC 3VBSC 4HPKB 1JOJA 3VHNA 4GB31 2KXLA 4XQWA 4HZFA 4AHXA 1I5ZA 1W0OA 2PAEA 3VBFA 1DFQA 4DZGA 4HKLA 2XBO1 5C8CB 5H9SA 5FMOL 5DDJ3 5J96B 5LK5A 4Q0PA 1QJY2 3V64A 4WZCA 1D2SA 3A0NA 1WLCA 2ZMKA 4XBQA 2UYAA 4I3PA 3A0KA 4ASMB 1RUD3 5CU1A 2O0OA 2RR13 3N3HA 5A32B 3OBTA 4LBKA 1BVP1 1W6MA 3MFCA 4HANA 5F5QA 3ZN4A 3R05A 5GLVA 4LHNA 4XZPA 3NL1A 1BEV3 1KFUL 4EJRA 1RUG2 4Y20B 1QHDA 4Q2FA 5CFCA 1UIKA 3B01A 3JBG3 4LUMA 4IETA 3WDTA 4LULA 5L73A 2A3XA 1SQ4A 2XUMA 5JDBA 1UZZA 4C1XA 2AR6A 1PIV3 2A70A 3NAPA 4XIKA 1COV3 1AVBA 1FMD2 2VY0A 4S2HA 3AM2A 2HWF2 5DUVA 2HWE1 1S0CA 2WL1A 2AH2A 3WT3A 4AGGA 3LSEA 5HCFA 4B7EA 5JOWA 4EV0A 1W6OA 1FNZA 1LOBA 1H9WA 1UMZA 1G6NA 4JDNA 3JQXA 2ZABA 1GQGA 1PK6C 5CB7A 2JICA 4UBHA 5ACA3 5AFEA 2HKXA 4CP2A 1AHSA 2D5HA 3TN92 2YZ4A 3ILRA 1BZWA 3WXPA 1PGW1 4RHV1 5K8SA 2PHXA 3JB4C 2EXIA 3V0AB 1GNHA 1O4YA 3O14A 3BPZA 1N1VA 3VDDC 3M3CA 4Q4V1 4JTNA 4B4QA 1WLTA 1RUC1 4PBOA 1LEMA 3GNEA 5JZGC 4ES9A 3NV1A 2NMOA 1QQP3 1RHI1 1KRIA 1C8M2 4MGZE 1LENA 3TB0A 4DB5A 3WQ1A 1ONAA 3D82A 1SDWA 4YRDA 2HWD1 2VOXA 4P9IA 3OTFA 4KG0A 2G9GA 2R071 4BE3A 3EHKA 3N36A 5DG1A 1VLNA 4DY5A 3POYA 1W6NA 3TNPB 3FJSA 4QX5A 2PTMA 1FPN3 1YCIA 3AMMA 1FOD3 3WLUA 3OGGA 1QGLA 1KFXL 1R081 2D6LX 1LHVA 3KB5A 4FVVA 4XDQA 1CVNA 3VHOA 3QACA 3MPBA 1CAVB 3SCHA 2TUNA 4K9SA 2LM3A 3VBOA 3WW2A 3NKGA 1PO22 3H1WA 2Q30A 1NCRC 3M7AA 4I0WB 3B02A 1ENSA 2PHLA 2WWSA 1HW5A 3RPQA 3FC0A 2NM1A 1K5MB 2Y26A 4INDA 1LR5A 2CV6A 5BNNB 2EAKA 5IK7A 3NV3A 4GIQA 2PAKA 3ROUA 1BVVA 4DY3A 3LAGA 2A3WA 2IC1A 3RYKA 2PN5A 1RUOA 2ZJCA 4K1YA 3I4IA 1O7FA