4IV3B

Crystal structure of recombinant foot-and-mouth-disease virus a22-h2093c empty capsid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
207
structure length
207
Chain Sequence
DRILTTRNGHTTSTTQSSVGVTYGYSTQEDHVSGPNTSGLETRVVQAERFFKKHLFDWTPDKAFGHLEKLELPTDHKGVYGCLVDSFAYMRNGWDVEVSAVGNQFNGGCLLVAMVPEWKEFTPREKYQLTLFPHQFISPRTNMTAHIVVPYLGVNRYDQYKKHKPWTLVVMVVSPLTTNTVSAGQIKVYANIAPTHVHVAGELPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational engineering of recombinant picornavirus capsids to produce safe, protective vaccine antigen.
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type a
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 41
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iv3B00
1FOD3 1ND3C 1RUD2 2BUKA 1RVF1 3ZFFA 1AL0G 4CDWC 5BNPC 1QQP2 2ZTNA 5FOJB 1EV13 1Z7S2 4GB33 5ACA2 1EAH2 1RUI2 1VRH3 1VBB3 1H8TB 2HWB3 4N43A 1C8M1 5CFCA 4CEWA 2X5IC 1RUJ1 1ASJ3 1VBA2 1AL22 3NAPA 5ABJB 2BFUL 2HWE1 2XBO3 2PLV2 1OOPA 1QJX3 1R082 4AEDA 4JGYA 1V9U2 1RUC2 2HWE2 3VBOC 4GB31 1VAKA 1R1A2 1QQP3 1NA1A 1RUF2 2BPA2 4YVWC 5C4WC 2ZAHA 1VB2A 4WM7A 5D8AC 1NCRC 1BBT2 1MQTC 4RHV2 1Z7S3 4GB32 1PO11 1K5MC 3CJIA 3JB8A 1VBE2 1AYM3 3VBUC 5CFCB 2R071 1AR73 1V9U1 1QJU1 3DPRA 4N43C 4N53A 5BNNC 2HWC1 3FBMA 1AR81 4RR3C 1RUH3 4QPGB 5J98B 3TN93 2RS53 1OOPC 1FMD1 3NAPC 1VBD3 5DDJ1 2PLV3 3ZFFB 1V9U3 1R083 4Y5Z0 4WM8A 1NA1C 4CDQC 2WLPA 5A32B 5CFDA 1RUF3 4Q4Y2 1COV1 1PO22 1NCRA 1PVC2 2TBVA 2RS32 1MEC1 1SMVA 1K5MA 5BNPB 4Q4V2 4CDQB 1H8TC 4IV3B 4CDXB 1NCQA 1PIV3 1PGL1 1D4M1 2BFUS 1ZBA3 4GH4C 5JZGB 3TN92 1AR92 5J96B 2XPJA 4Q4W3 1TME2 2RS52 4CEYB 3NAPB 1AUYA 1BEV2 1WCDJ 4CDXA 1DDLA 4FTBA 1AR72 2WS91 4QPGC 4CDQA 1NY72 4RQPC 3CJIB 4FSJA 4JGYC 2HWC2 2RS13 2MEV1 1RUH2 2RS33 1MQTB 4Q4Y3 1QJY1 5JZGC 5GKAC 1EAH3 4YVWA 1NCQB 5C4WA 3J8F2 1BEV1 1HXS1 1RB8G 5D8AB 1RHI3 4NWWA 2RM21 1PO23 1PVC3 3VBOB 1AR93 2BBVA 4Q4W2 4CEWB 1RUG1 1VBD1 5C8CC 1QJX2 4RS5C 4WM7C 1AR63 3VBHB 1TMF1 1PIV2 4YVSB 5K0UC 4FTSA 3CJIC 1RMU2 2R042 1M06G 3VBUA 4RQPA 1QJZA 1RUG2 3J8F3 4CDUC 2QQPA 1F2NA 4QPIA 2WFF1 2R041 1NCQC 4IV3C 1NA1B 1RUC1 1TMF3 1FMD2 2HWD2 4RHV1 1NOVA 4GH4A 1C8NA 4RQPB 4CEYA 3VBFB 4GMP1 1BBT1 2R063 1MEC3 3JBG2 1H8TA 2RR13 5C9AC 5BNNB 1VB4A 2WFF2 1VBB1 4RS5B 5ACA3 2WZR1 3JBG1 1RUE3 1RUI3 1VRH2 1IHMA 4Q4V3 1OHFA 2RS51 5BNNA 2RM23 1HRV3 3JD71 2MEV3 1NG0A 1AL21 1AYN2 1TMF2 1PIV1 3VBRC 2WS93 2ZZQA 4JGZA 1FMD3 4PDWB 5ABJC 5BNPA 4FTEA 1AR61 4WM8C 2RS31 1PO12 1X36A 4CDWA 3VDDC 1QJY3 4Q4X1 3HAGA 1W39A 5A33A 4LLFA 4RR3B 1RVF3 1PGL2 1HRI3 1RUE2 1VBE3 5AC92 4PDWC 2R062 5A33B 2HWE3 2RR12 1D4M3 2MEV2 1RUH1 1VBA1 5C8CA 1HRV2 1AYN3 1AR82 1C8M3 2WS92 4IV3A 1VRH1 2XBO1 1AYM2 5A32A 1OOPB 1F8VA 3VBSB 2WZR2 1ND3B 3VBHA 4CEYC 1COV3 3LOBA 1HXS2 1X33A 1PGW1 2HWB1 1FPN1 3S6PA 1GFF2 4N53C 1QJX1 4Q4V1 5FMOL 5BNOA 1PO13 1AYN1 1RUD3 4PDWA 3ZFEA 1POV0 1B35B 1ASJ1 1AR83 1AR71 1ZBE1 4N53B 1AR91 3ZFGB 1NY71 1R093 1R1A1 2HWF1 2PLV1 2R073 1R091 2HWD3 4CDWB 2FZ1A 4YVWB 4EJRA 1R081 5C4WB 3VBOA 3VBSC 1QQP1 5ABJA 2HWC3 1EV12 2RS12 3VBFA 3JD73 2WFF3 4CDUB 1QJU2 5D8AA 5AC91 1RUD1 2VQ0A 3VDDA 1AYM1 1VBE1 1Z7S1 5C8CB 2WZR3 5BNOC 3ZFEC 4JGZC 1R1A3 2RM22 1VBA3 1B35C 1RUJ3 4CDXC 2RMU1 5L7OB 4IV1A 1HQNA 3VDDB 1HX6A 1BMV1 1NCRB 1RUE1 3JD72 1RMU1 5BNOB 1ZBE2 4Z92B 1ND2C 4JGYB 5LK7B 5CFDC 2HWF2 1HRI2 4QPIB 3JB4C 1POV1 1EAH1 1FOD2 1TME1 1RMU3 4Q4X2 1ND2B 1EV11 5L7OA 1HRV1 4YVSA 3DPRB 1B35A 1FOD1 2X5IB 4IV1B 1RUG3 4WM7B 1VBC1 1HRI1 2Y26A 4Q4W1 4QPGA 1ZBA2 2WWSA 3VBRB 1RUJ2 1COV2 1PO21 1PVC1 1ZBE3 5K0UB 1HXS3 1ND2A 5C9AB 1RUI1 3IDEA 1MQTA 1A6CA 4RFT0 3VBSA 3J8F1 1VBC2 3VBFC 2IZWA 5ACA1 4AEDB 3ZXAC 4NWVA 1AL23 2RMU2 1RHI1 1E57A 2R072 5C9AA 1RHI2 5K0UA 3VBHC 3ZFGA 4RS5A 2RS11 4IV1C 5FMOS 3ZFEB 1BBT3 2R061 4GMP3 1RVF2 1QJU3 2RR11 4CEWC 2FZ2A 1FPN3 5DDJ2 1R092 4RHV3 4WM8B 1POV3 2X5IA 1QJY2 4JGZB 4CDUA 4QPIC 4AEDC 2R043 1K5MB 4BCUA 1CD3G 2RMU3 3VBRA 1C8M2 4Y4YA 1OPOA 1VBD2 1ZBA1 4YVSC 1VBC3 1ND3A 3TN91 5L7OC 1AR62 3ZFFC 1VBB2 2GSYA 5CFDB 2HWB2 1PGW2 3ZFGC 5AC93 4GH4B 1D4M2 2GH8A 5JZGA 4SBVA 1FPN2 5DDJ3 4RR3A 2DF7A 3DPRC 4Q4Y1 3VBUB 5CFCC 1RUC3 1MEC2 1CJDA 3JBG3 4Q4X3 3M8LA 1RUF1 4N43B 1ASJ2 4GMP0 1TME3 2XBO2 2HWF3 1BMV2 1BEV3 2HWD1
chains in the Genus database with same CATH superfamily
4FPYA 1TE1B 1V6NA 3UKNA 4LKFA 1FOD3 4JVAA 4YZ4A 5A3UA 2XJUA 3AXEA 3ZFFA 3RZGA 3EMRA 1GP6A 2X29A 5FYBA 1O4TA 1LKNA 1EV13 3J7NA 5FZEA 2CTVA 4GB33 5E89A 4OI2A 4BK4A 1Y9MA 2JIJA 1WWYA 4NHMA 1SEFA 5CBLA 4LO6B 5CB7A 3RMXA 5A3PA 3U0ZA 4BLIA 4LLOA 4LXLA 1HW5A 5IK4A 2ZGRA 3PJQA 3BPZA 3WV6A 5H9PA 1H8TB 2HWB3 2A6VA 3FE5A 3LEKA 5DZEA 3SISA 4QX2A 2XONA 4KWKA 3ZYGA 1W9YA 4MGZE 4XMIA 3AZWA 3N7KA 1SACA 2WABA 2X5IC 1RUJ1 4A2UA 1VBA2 3RZJA 3FHIB 4BDVB 3ZIWA 3TEWA 2J1TA 4AFCA 2WO1A 2XBO3 1HN1A 1OOPA 4Y1VA 4QX5A 1Q8OA 1QJX3 5F8PA 1DQ0A 4ZY9A 2D6NA 2OIIA 3BU7A 4IEXA 2Q5TA 3DUIA 5T54A 4FBFA 2D3PA 2HWE2 1IKPA 3FLRA 2DWRA 1W8FA 2E26A 2YBPA 5FAXA 2VU9A 5FY5A 2GZWA 1KQRA 1F4AA 1VB2A 1W9TA 3KV6A 4Q27A 1BBT2 1MQTC 3VV1A 1F35A 5LRSA 2CY6A 1K5MC 4ASMB 1DQ2A 2W1UA 5JSPA 3FHQA 1AYM3 3VBUC 4IEWA 1Q8QA 1V9U1 2A5ZA 4UAPA 1QJU1 2WINB 5FMCA 4LBQB 1ODMA 4JAAA 2DUOA 4F8AA 2WRAA 4EN0A 2FDJA 2JJ6A 4JRAA 3UJOA 4B4RA 2ZGTA 4RR3C 4XFGA 5J98B 2I2SA 3SKJE 3ZSLA 2A70A 2RVAA 5FOBB 1C1FA 5FZ9A 2ARCA 4YG6A 1FMD1 1X8MA 2BU9A 5A1AA 2ORXA 2ERFA 1ONAA 1OLME 2FMDA 2DYCA 5F5AA 1GOFA 4Q0VA 4UW4A 2K0GA 4FQ4A 3V65A 2OX0A 1BLZA 1F31A 1W0OA 4CDQC 4LO7A 5FWJA 3HN3A 1PVC2 1NCRA 2RS32 2AEYA 3RQ0A 1CZVA 4JCKA 3RZMA 4CP2A 2C4XA 2J22A 1H8TC 3OBZA 2PAEA 4IV3B 2XJQA 2BW8A 4XJ9A 1W3VA 1NCQA 4HFSA 1PIV3 5FP4A 2GDFA 2DCZA 4GH4C 1DZRA 4KWJA 3HBZA 4WZCA 1AXYA 5C3QA 5FDBA 2RDQA 3U4XA 4OUSA 3FJSA 4KMQA 2NPIA 3HQRA 2UY8A 1RINA 2VQUA 1O7FA 4Q4W3 2VXJA 3OD4A 3WZ1A 1AUYA 1X7NA 4W6YA 5FK8A 3POIA 4GJYA 4O9EA 1AR72 2CGNA 2WS91 5JXIA 4QPGC 3TEYA 1SPPA 4RQPC 4JDNA 1S0EA 3IKWA 4XCBA 4Y4RA 5F3EA 2MEV1 1RUH2 2OKXA 2RS33 3VKMA 2ES3A 4NHKA 4LIVA 4YM2A 2Y60A 3QLQA 5A3MA 4Y1UA 3OY8B 1XPWA 3EHKA 1EAH3 2YGMA 1NCQB 4W8JA 4Y5TA 2FD8A 1H0BA 4X8PA 1BEV1 3USSA 2QCSB 5HXMA 3ELNA 4BXSV 3WT3A 3BGAA 2E33A 4LBQD 3AFGA 4L2NA 1D2SA 4AI9A 2OA2A 1HB1A 4XQ4A 3URFA 3VBOB 3DKWA 5F2WA 5F2SA 4INDA 1BHGA 2VMEA 4PF5A 5E88A 4Q4W2 3VDCA 4MSVA 5BV6A 5JWPA 4CEWB 3NW4A 4OZXA 3M7AA 5A6ZA 4XILA 1GZCA 5C8CC 1XSQA 2BVBA 4RS5C 4WM7C 4QDQA 4CA9A 2WJSA 3GJBA 4XTPA 2EIGA 2P5BA 3EO6A 1V6MA 3KGLA 5K0UC 2JKBA 1DU3D 2R0HA 2WYSA 4ZPIA 1RMU2 3W9AA 5J7MA 4RQPA 2GMEA 4BXFA 5JMCA 4S2DA 4BQ2A 4XFHA 1LGBA 2VO5A 2RG4A 1QJZA 5L9VA 4FPHA 4MYEA 3GBGA 4FP2A 4ARXA 5DABA 4HK9A 4KI5M 1RUG2 2WR9A 2ZA9A 2WNVC 4CDUC 2BTVC 3EJKA 5FZHA 4DRRA 4ORFA 2Q1ZB 4L92A 4AVVA 5FZFA 4GWMA 1PK6B 2VULA 1LHVA 2IVIB 3AYDA 4GJZA 3B93A 4V2WA 2ID4A 4ASLA 2R041 1NCQC 3NNMA 5DAVA 3ZMNA 4KBZA 3D5OA 4KU7A 4COZA 3ZN6B 4P5YA 1OA3A 5E6HA 1EP0A 1Q8VA 3OGRA 4UOJA 1BK0A 4AWDA 3Q8AA 1NOVA 1QDOA 2JWPA 3OB8A 4HG6B 4RQPB 4MGYE 2C24A 2VMFA 2XHNA 2IVJA 4KL1A 3AMQA 3VZOA 3HBKA 5FZGA 3B9IA 3JBG2 1H8TA 1WW5A 2JD4A 2RR13 2DVFA 5CYYA 3WW3A 4AI8A 4BQYA 4Y26A 4YW7A 1S0IA 3IDAA 1FNZA 4UFHA 4IERA 5FUPA 1VBB1 1M4WA 3LFMA 4MVTA 2PHTA 3ECQA 3B69A 2IXLA 2WZR1 3O0XA 3TYJA 2JDNA 3OTFA 5FPLA 4DXSA 1RUE3 2F17A 1OKOA 3I7DA 1H4HA 3H1WA 4GKXA 5GLTA 4P9GA 4QMAA 3CZJA 1W90A 3A21A 4PF1A 5FZ7A 1Q8PA 5FPZA 5FXWA 4EWEA 4OUEA 4DB5A 1QH7A 3HMYA 4LBJA 5ANNA 5IYYA 1HRV3 3EXUA 3IIAA 4F3JA 1AL21 1AYN2 2J1UA 4XC9A 5IAVA 1LNSA 3POSA 4HVOA 2E31A 1GR3A 2LM3A 4DINB 1UOFA 2WQZC 4JGZA 3OYWA 3O7OA 2XLFA 5BNPA 4UW3A 2Z2SB 1AR61 2DURA 5DAXA 3N7MA 1MS5A 5F5QA 4CDWA 3LA7A 4UXAA 2CL2A 4JV4A 3SEEA 3AX4A 3ZXJA 3KF3A 3ZYHA 4WBBA 3RFRA 1EUTA 1WD4A 3POEA 5DUUA 1LB2A 1RVF3 3C7HA 5FP9A 2Z69A 3KT7A 5EJ1B 3LPGA 1VBE3 5KHIA 4MX3A 2Q0AA 2DV9A 1DIWA 1H1IA 3HT2A 2R062 4MH0E 4XYXA 1TZOA 2PELA 3EB7A 1MS1A 3FN9A 2HJIA 1RUH1 4HPKB 3RSJA 4QXHA 4AFMA 5C8CA 5LZ6A 3MF6A 1AYN3 3NKTA 1PM7A 1UF2C 4LIUA 5G05L 2XL9A 4ZZ8A 4EZHA 1OBNA 2D6PA 4CP1A 4Q2FA 2Q1FA 2ZPXA 1NQDA 2Y6FA 5CVRA 3RVHA 1IG3A 1N1TA 3VZLA 1PHMA 5A32A 5C33A 4EN6B 2VMDA 4IEZA 1LOBA 2WT2A 1ND3B 2WNVA 3VBHA 1GZ9A 1R64A 3WHTA 1OPMA 2WZ8A 2BGOA 4AI0A 3LOBA 1V6KA 5G04L 3WDYA 4I0WB 2RJLA 2CWSA 1PGW1 3U4SA 2HWB1 5E16A 4CPBA 1B09A 2OQ6A 1H9WA 1HQLA 3D4KA 2FHRA 4ZS2A 3WQ7A 5F3IA 4Q4V1 1AVBA 5FMOL 2XL7A 4I01A 4CXWA 5KXBA 1PO13 1AYN1 1J1LA 2K9ZA 1LEDA 2N7GA 3FFZA 2JKXA 1UOGA 4QPWA 2QTWB 1HLCA 3ZYPA 4YZ3A 3AM2A 2B9VA 5IATA 3ZFEA 4DXTA 1AHSA 2E7TA 2DU1A 4CSWA 4A44A 2Z5WA 4Z2WA 3M3EA 1NY71 2VZ3A 1N3QA 4Y1XA 1KD7A 5F5CA 5T52A 4LK7A 2HWD3 3IN9A 1C57A 1J3PA 1DLLA 1AXZA 1YNAA 4BWOA 3BUCA 4PLMA 2GMPA 3HJRA 3MO4A 2D3RA 2ZBJA 4XFBA 3VBSC 4QB1A 2VOKA 5FQ0A 1XYPA 2R7EB 1EV12 2W68A 1AX2A 2WFF3 4AFBA 2ZX1A 2C9AA 1U12A 3PNAA 1DQ6A 2V09A 2BP6A 5D8AA 4CYDA 5FREA 1RUD1 4A42A 4FAGA 1AZDA 3KCCA 1S2BA 1VJ2A 1AYM1 4LHKA 5EXOA 4GZ9A 4CU8A 2XJSA 1XNKA 1BZWA 2WFPA 1V6JA 3W59A 3THCA 4XQWA 3I4IA 2WZR3 3MIHA 5BNOC 5FKCA 1QWRA 2VOWA 1R1A3 2E53A 1LJ7A 5EZWA 1VBA3 3A4UA 4YM0A 1XNTA 3ZSJA 4BQWA 4OLLA 4TSVA 1BQPA 2QDRA 5FZ4A 3SH4A 4QB2A 3CQOA 4BK5A 1G9CA 4LBMA 2VCBA 4ZZ5A 1D0HA 4DRVA 3CNAA 4MV2A 1HX6A 1DHKB 1YFUA 4JDMA 1NCRB 5I8YA 2VC9A 5FRAA 4AQ6A 1SFYA 2X8KA 4YSFA 5BNOB 3POJA 1ZBE2 5DUWA 5H9RA 2R6QA 5FLJA 3RZZA 2UY9A 3MIBA 4J1WA 3H42B 4FPGA 5LK7B 2A3WA 3JXSA 2VZRA 1CAWA 4AVSA 4N9HA 3ZN6A 4UYBA 5LWBA 1POV1 5H9QA 2B8MA 1X9PA 4XF9A 3UK9A 2VM9A 1FOD2 1MVEA 1TME1 3BYWA 1RMU3 5FMBA 1ST8A 4Q4X2 1S0FA 5HV0A 2E9QA 1EV11 5IUQA 5L7OA 5IVBA 4OI4A 1W0NA 1W6PA 4GWJA 3PURA 1QXRA 4OVEA 1HDKA 1B35A 2CV6A 3U75A 2X5IB 4WVVA 1OF4A 1RUG3 4Q0UA 3AMNA 4XURA 4XF4A 3HD8B 1HRI1 2XG3A 3KCXA 4U36A 3H1MA 4CCKA 1JN2P 4PI0A 1W2OA 2YPJA 5A7SA 1O3QA 4CRQA 4QPGA 3OJBA 5AFBA 5F6KA 4IE0A 4FFFA 2EA7A 2VTXA 3CL1A 4QXKA 4YW3A 1ULEA 3D3AA 3VKOA 2XVLA 5FZ3A 5K0UB 3IZOA 4XTMA 4Y20B 1ND2A 3WY6A 3RWNA 3WF0A 4RD7A 2BGCA 3PTYA 1RUI1 1W8WA 4FFIA 3ZO0B 2HYXA 2WAAA 4RFT0 3EBRA 2P3JA 3J8F1 4PLNA 5F39A 1ZRDA 5FPBA 1IS6A 4BQXA 1TVGA 3OYWB 4BH9A 4B4QA 5ACA1 1L7RA 4Y1YA 3UKVA 3VLBB 4XBNA 3R4SA 1C5IA 2C0ZA 5K4LA 3CKHA 3NV1A 3W20A 2BOIA 2RMU2 4CCDA 2JDYA 4GQ7A 1DYOA 3OPWA 1AJOA 1HN0A 1VRBA 2XHKA 4K7JA 5A7QA 1KXGA 1ULFA 5FYYA 2R072 5C9AA 5TSWA 4AHYA 4K20A 1JZ4A 2QQOA 3CU7A 5IW0A 2VZOA 3CIHA 5K0UA 3VBHC 3OGGA 5HI0A 5KHGA 2P3KA 4LULA 1HQWA 3KB5A 4YW6A 4GMP3 2W46A 3ALQA 2IXHA 1V6IA 3HQXA 4ZU7A 1MZ6A 4EZ4A 5JPMB 2JG9A 2ZX0A 5FP8A 5F9TA 1CZSA 5IAXA 2DBNA 1FPN3 4ATEA 2G9ZA 1I3HA 4A4AA 4FXGB 3OUJA 3C7EA 1XC6A 1O8SA 4ISRA 4DFSA 3C7GA 1LAJA 4ZS3A 4AEDC 1ZRCA 1PK6A 1ZA4A 4N9IA 1ENRA 5KBFA 3ZDVA 1IOAA 2Q8CA 2IXKA 1C8M2 2ZGUA 3T30A 5DG2A 1MZ5A 3AP7A 1MS4A 2IFRA 3OBTA 4BIFA 4P14A 2D3SA 3RNSA 1GICA 1QOTA 1VBC3 4BZ4A 2PTMA 3O1MA 5CFDB 3AVSA 1PGW2 1Z0HA 2ZGSA 1RJ8A 3W58A 4Q1PA 2HYKA 3T2QA 4NROA 4CCNA 3QCWA 4XBLA 2QNKA 4BQ4A 2LUWA 3ORJA 1SLTA 4BPZA 2V72A 3H3ZA 1K3IA 4MHRA 3PVEA 5JZGA 1CGPA 1FPN2 2I74A 3AMMA 4IEQA 4RR3A 1JI6A 3BIEA 2NP0A 5I0DA 1BCXA 5B4NA 3BN6A 2JENA 5JR2A 4P02B 2JDZA 3MLKA 4HKLA 3VBUB 3PVNA 2ZACA 1MEC2 3R4DB 4NRPA 3HNBM 5FIXA 1OC1A 1RUF1 1JYIA 4AYUA 4AI2A 3WUCA 1HJGA 1CAWB 4ET7A 3AYAA 5FK7A 4LBKA 1TME3 2OVUA 1GU3A 1XYNA 2HWF3 4J25A 4NMIA 5C70A 5FPAA 3LZZA 4LUKA 5LW9A 1REDA 4QQPA 2F6BA 1VLNA 5I0TA 5A7WB 2VZQA 1RUD2 2BUKA 1RVF1 3ZXFA 1AL0G 4CDWC 4HXCA 5IK7A 4UF0A 2AYHA 5GZGA 1X50A 1LOAA 2PMWB 1LCLA 1SLAA 5C3OA 2VOXA 1Y43B 4XJUA 2AC1A 3RGBA 2ZGNA 2C6SA 2ORZA 3IDBB 4NIDA 4AW7A 2WWUA 2FQPA 1NXD1 2YC2A 3NKGA 4IE6A 2BRTA 4KG0A 5FYCA 4QGMA 2YC0A 4JZRA 3BODA 3WCRA 3L2HA 3WD5A 3MIDA 4L0PA 5FXXA 3ZN5A 4KQ7A 1AL22 1ACCA 3NAPA 5E8AA 4YGDA 2BFUL 5ABJB 2FCVA 2HWE1 2V4VA 2DDUA 1GNZA 3LEMA 2PLV2 4UWDA 1IS3A 2OQ7A 2WT0A 4E9KA 1R082 2DUQA 5KC6A 4AE2A 5AVAA 4AEJA 4IDZA 3VBOC 5FY7A 1R1A2 1W8UA 2ZHMA 1MACA 4LOTA 4GD4A 1KFUL 4BJ0A 2D6MA 4YVWC 1A8DA 3AK0A 3ACIA 5D8AC 5JOWA 2EXJA 4GB32 5KC5A 4IW3A 1PO11 1Q56A 1HKDA 3N9LA 4ONUA 4E4ZA 1IPSA 1VBE2 1GBGA 3B01A 2Q8OA 3GYDA 2W1QA 5EQUA 4E2GA 3O1SA 2R16A 3CF6E 1XQNA 2GP5A 4OULA 3FHAA 1IZ3A 1LOEA 4QU2A 5EV7A 3ROUA 4QPGB 2VMGA 1YQ6A 3BI3A 3POWA 5LBCA 5C8WA 2RS53 1OOPC 4QD2A 4R52A 3NAPC 4XMAA 2D97A 3VZNA 4YW5A 3ZFFB 1XOYA 1W6NB 2W39A 5J37A 4Y5Z0 4C0HA 4FPEA 2RJKA 2XR4A 3WQ0A 5J09A 4HETA 3N9NA 4F7ZA 2VTXJ 2EALA 2Z42A 1IPJA 1UU4A 2YV8A 3H3LA 4PCRA 1MEC1 1OLQA 2ZHKA 1K5MA 4PIZA 2GNBA 2G9GA 1JMUB 4E4DX 1PX4A 4EWDA 5BNPB 3AXDA 5IFPA 4Q4V2 2IUWA 1LULA 4KNCA 2PA7A 3NRUA 3H7YA 2J1SA 2QQWA 1LOGA 2WA4A 1KS5A 3WF2A 4D0QA 2I45A 4H7LA 1SLLA 3MUZ1 3ZSMA 2P2KA 1ZBA3 2PQQA 3ZXLA 2VH9A 1H2NA 1I6XA 5JZGB 3BTAA 1AR92 5FPVA 3LE0A 2Q8DA 2XPJA 4P9XA 1O8PA 3QOPA 3T3YA 1US2A 3IIIA 4CEYB 3A0NA 1BEV2 1G9BA 3HPNA 1DDLA 1CAUB 3PUQA 2WZPP 2OZ6A 4XJWA 4CDQA 1KRIA 3SCHA 2JDHA 5JUVA 4FSJA 3I2IA 1LHWA 3POFA 1VALA 1S4CA 1GYKA 4W65A 1UXZA 4XFAA 4JRLA 5JZGC 5GKAC 3WOGA 1RYYA 1JHJA 1QF3A 4YVWA 4AI3A 4AK3A 1C3HA 4B4PA 5FLHA 1TNRA 1HXS1 4META 1GMMA 2VPVA 4U2AA 2HEYF 4BIOA 5DAPA 4QX0A 1RHI3 3LPFA 3RDIA 2WO3A 3E1F1 4Z82A 3THDA 1XNAA 1ULGA 5FV3A 1PO23 1AR93 2GALA 1AJKA 2WNUA 5A70A 5LEKA 3KSCA 1JYNA 1MS3A 5T5LA 2ZEWA 5A3TA 1RUG1 5IT6A 4R9BA 3LSDA 3NMBA 3GALA 3EYPA 5BYNA 3ZXEA 3U14A 5DAQA 1CIWA 3AKTA 3AC0A 4PIXA 2X10A 3SLIA 1QU0A 1W06A 3HNYM 5JXHA 4LTAA 3VBUA 2UWBA 2ZCWA 3J26N 5C6CA 2A6XA 4QQOA 4AGRA 4MUVA 2ZS6B 3FFQA 3M3QA 2D5HA 1SLBA 4COWA 2JE9A 2D6LX 4P9IA 3ZSEA 4W6WA 2YUEA 4LOSA 2H0BA 3Q8CA 1YFYA 4XAAA 1PMIA 3K75B 1YQCA 4FPOB 1V6LA 5JIUA 1OD5A 1IPKA 1QGLA 2XJPA 5KR7A 3RZKA 2VNGA 2GN7A 2PHFA 2J7MA 2PQSA 4IV3C 1NA1B 2QQVA 4KU8A 3C7FA 1YUDA 1T6BX 3BALA 3U10A 4EE2A 3S5AA 1X82A 1A8MA 3TOJA 1IKQA 4RHV1 3O1RA 1GKBA 5EFUA 2PYTA 4UBGA 5FO8B 1T6GC 1WA6X 3VBFB 1FATA 1JS9A 5A6YA 2JD9A 5ERLA 3BOWA 2WSUA 1CZTA 2B39A 3DYPA 4AQTA 4FI9A 2DUPA 1O4YA 3KV5A 2Q8EA 2VNVA 1PZ8A 4QQLA 2ZZJA 4XF1A 2XWBB 4XUOA 4JDOA 1VRH2 1IHMA 2QDNA 1OHFA 2WN3A 5FYZA 3ZR6A 1JODA 4CU7A 5BY5A 3A22A 1YC61 3AL6A 2KA3A 2PHWA 4AQSA 5JPNB 4HN1A 2VUJA 1PMJX 1JBCA 4NHXA 5EYXA 5T50A 3VHOA 1I5ZA 1SFPA 3GXUA 5LY2A 2ZZQA 2E6VA 2PHLA 4JKLA 1JTZX 2OS2A 4FTEA 4CU6A 3MI8A 3PU3A 3NVCA 2WKKA 3MIEA 3VKFC 1X36A 1UX6A 1QJY3 4MLOA 5K9YA 1QEXA 5JSOA 1G8WA 4RR3B 2VGDA 1PX3A 1HB3A 2A6ZA 3IPVA 1LHOA 1WLCA 1RUE2 2JEMA 1UIKA 4AVTA 3I49A 4QM8A 1JOJA 2Y6KA 2V5YA 3DV8A 4PDWC 2KR2A 3D6EA 1QHDA 4K3UA 4R9CA 5JI9A 4D6RA 4EYUA 4QX1A 2WO2A 1HRV2 5C3RA 4NPLA 3FBYA 4RA0A 2E51A 4QX3A 3GZEA 2PN5A 3BTYA 4YRDA 2BJSA 1C8M3 2CYFA 2WIIB 4GAZA 5F3CA 5LBFA 3O0VA 3I2FA 4I09A 3OGJA 2WC2A 4IV3A 1GSLA 1UKRA 5JIAA 1DGLA 2H0VA 1VMHA 2YHJA 1SHWB 2PFWA 3LOIA 2GNTA 4XEZA 4YM3A 1UU6A 4PQQA 2Q4SA 1H8VA 4M3CE 3JCIA 1COV3 3MEPA 1ULCA 1DG6A 1HB2A 2E63A 3IPVB 4IEUA 3GZUC 2DCTA 1R1ZA 4QX8A 2D44A 3WEZA 5CU1A 2YROA 5GZEA 4P08A 1FPN1 3ACLA 5LA2A 4O7XA 3H9AA 3ZXGA 4XXAA 3TNPB 5BNOA 3GDBA 3ZMOA 4L11A 5F7UA 5HBAA 2ZGOA 2XH6A 5F3GA 3WW2A 1J84A 2PHDA 4OHXA 4XACA 2NMNA 2EXHA 2B42B 2GNDA 4PDWA 1ZREA 4UFMA 2VZ1A 3RZLA 4N53B 2XQRA 3HEIA 2JG9B 3FC0A 4XAEA 4JHZA 1N1VA 2VBPA 2KXLA 4QPYA 4AAXA 4NE9A 5EJZB 4E4HA 2Z4FA 1TG7A 4CDWB 4XUNA 1JZ7A 2FZ1A 4YVWB 1R081 1SG3A 4TN7A 3AJYA 5I0RA 3I3MA 2JDMA 2XUEA 3VBOA 3KQ4B 4EN9B 1LOFC 1S0CA 2VUCA 4OI0A 1ENSA 1F15A 1IS4A 3GM8A 1RXFA 1Y4WA 3WDWA 4LKSA 5FYSA 1QJU2 4AI1A 3WR0A 3LA2A 3WF1A 1SQ4A 4M00A 2G19A 2W9XA 1UZZA 3MW2A 3VDDA 1WMEA 3IWZA 4YGCA 3K3NA 4Z1VA 2C1FA 4PT6A 1Z7S1 5C8CB 1JZ2A 1E5IA 3POBA 5FZ0A 5FZLA 2XDVA 3ZFEC 5JSRA 2OUHA 4JGZC 4D6SA 2RM22 3VD5A 1B35C 1RUJ3 1N3OA 2JECA 2QKDA 1WCUA 1ODNA 2DVAA 3UJQA 4AEKA 3SCFA 3M70A 2RMU1 3KLSA 4M01A 2QQLA 3FL7A 3NV4A 4ITCA 5FZOA 1W28A 1BMV1 1JZ3A 4XJAA 4LE3A 5FBZA 1RUE1 2JG8A 3VHRA 4NPMA 1RMU1 2VW0A 1ZZ6A 2BNNA 4XOGA 3AFKA 1Y7BA 1VIWB 1OQEA 2WQ8A 1W04A 5CG8A 3OD0A 2JB4A 3ABZA 1ALYA 5CFDC 2HWF2 4N90A 1HRI2 4QPIB 3WNXA 1MPXA 4ZKTB 3ILRA 4CUBA 2IXIA 3WCSA 2BYVE 3O14A 2GH2A 1NLQA 1ZRIA 4Z07A 1KJRA 4RSUA 2VZUA 4C8DA 3LFIA 1Y9GA 3DCQA 4I02A 4Y3OA 3TEXA 5L73A 4EV0A 1KDMA 4LBQA 3LDBA 4IE7A 1SDDB 4HMZA 1FOD1 2ARBA 3CHXA 4WM7B 1IG0A 3PIJA 1VBC1 5FUIA 1WD3A 1UY4A 2Y26A 3FUOA 3TB0A 1U5IA 2QE3A 4LBOA 2YMZA 4OMCA 1GP5A 2JG8C 1LESA 1JYTA 2WLQA 4P00B 5FJKA 3GF6A 4JTNA 3VB9A 3ZPOA 5CKNA 4YW4A 5I0UA 2VR4A 4CUCA 5JI7A 4KWUA 1ZBE3 1GP4A 1HXS3 1UPIA 5LASA 1W05A 3IDEA 3RPQA 1LU2A 2RHPA 2P6HA 1XRUA 4HONA 1OVPA 1S1AA 2V73A 2VMCA 2D43A 3UKTA 4I2OA 5GZFA 1JUIA 3CLPA 1SZBA 5HXVA 2TUNA 3I2GA 2ZMNA 1EY2A 4IEVA 1SFNA 4QB6A 4XABA 5EWSA 4QDSA 2ZEZA 4XUPA 4C0BA 4AFAA 1LRHA 3PUHA 2D6KA 1OUXA 1RHI1 3OPTA 4L9BA 4CP9A 1G7YA 3WDTA 4FT8A 1H9PA 3A0KA 4IEOA 2QQJA 4YYOA 2EF6A 3VL9A 4K1YA 5KHHA 2D93A 2ENRA 2RE9A 3DF0A 3NO8A 4QHOA 3VD7A 5FY1A 2EXKA 2IXCA 3DN7A 1YFWA 5E1RA 3O1VA 3LCPA 4BU2A 5I8TA 3D82A 2VCAA 4IV1C 1XYOA 5FMOS 5GJ6A 3WQBA 4MG2A 2Q1MA 1BBT3 2R061 2JB8A 5FPXA 3KCYA 1W6QA 1VMJA 1LR5A 3N9MA 2RR11 1F9KA 2XJVA 1WLDA 2YGLA 3MPBA 2FZ2A 1OSGA 3VGIA 1R092 2V4AA 4RHV3 1JU3A 3BVCA 1POV3 2VXRA 2W52A 4RYDA 2KM2A 1QJY2 4JGZB 4QT6A 4LR4A 2XLGA 3KT4A 3SXWA 1H1MA 3POGA 4WVMA 3ZN4A 3HNMA 3GBWA 1K5MB 2EAKA 1S0GA 3ZIXA 2ZGLA 1W2NA 3ACFA 3ZKYA 1K5JA 2RMU3 2VUAA 4AVCA 4Y4YA 1ULDA 1D2QA 1CJPA 1QMJA 3RYRA 4O65A 3N9OA 1J83A 2NMOA 1PMHX 2WSVA 4UT5A 5L9RA 1LHNA 5T5JA 2GSYA 4BQ1A 2HWB2 4LO8A 5AC93 4OZOA 1NZCA 1CPNA 2F4PA 4NPRA 5C5TA 1JH5A 4HOOA 3RJ2X 4XJZA 3W21A 4J6GA 3FWEA 2XKPA 3ZVXA 5CAZA 1OFSA 2VZVA 1W8HA 1EUUA 1W9SA 5D2AA 5EIYB 3M1HA 1RXGA 4AL9A 1CJDA 4JC1A 3JBG3 1K42A 1UNBA 4RL7A 1G86A 1QNYA 1V6OA 2VW1A 1XU2A 1LOCA 5EYYA 1G6NA 1NE6A 4B1MA 2JICA 4FOYA 4S2HA 5B2GB 1BK1A 4D69A 1BMV2 2A73B 1KITA 1S0BA 4JKMA 3AKSA 3V56A 1CX1A 2VZPA 2UWCA 1JZ8A 1QJEA 3TNQA 2Y33A 2ZX2A 1HIXA 2FDHA 2GAUA 3OY8A 1SPPB 1NXMA 4HL0A 3WNOA 2D5FA 5FOJB 1JXNA 4LHNA 4O61A 4ZONA 1V0AA 4K9SA 1UX7A 1Z7S2 1EAH2 4NRQA 2ARXA 4AR2A 1VRH3 1JYCA 5KXDA 5F6LB 2NYYA 3E5QA 5F5IA 1VBB3 3HWJA 2YXSA 4NOTA 2IFWA 1C8M1 1J1TA 1ZZ8A 3IMMA 4M3CB 4TZDA 4CEWA 4UFJA 1W6MB 1UZYA 3GCXA 3GBFA 4XPVA 4TWTA 3QACA 1QOOA 3UGFA 1W2AX 1XB9A 2EIEA 4Q8LA 3T4HB 2Y0IA 4E2QA 5KXEA 3I3DA 4G9SB 2VECA 5FUNA 1JYVA 1W8TA 2PHXA 1RUC2 5JVVA 1C4RA 3CDZB 3O1UA 2Y6JA 3GCWA 4GB31 3T0AA 4XIKA 4CCLA 3K51A 1NA1A 5IVCA 1RUF2 1ZM1A 3ATGA 3CZUA 3HVDA 2BPA2 2AENA 2ZAHA 2MPFA 4XUQA 3USUA 4E8DA 1I5PA 4Y5SA 1UN1A 1XE0A 2RDRA 4RHV2 1UIJA 4AGGA 1BYHA 1H2MA 2JDAA 3JB8A 4XQDA 3S7IA 5L19A 4M3CA 4HK8A 2AACA 1WLWA 1VAMA 1W6MA 5D1IA 1AR73 3C7OA 2W5FA 5FYVA 3DPRA 1E5HA 3PUSA 2YDEA 2J1EA 1GQGA 4N43C 4N53A 5B4XA 1G9DA 5BNNC 2HWC1 3FBMA 3MLJA 1RUH3 3H8UA 1VPHA 2EICA 2FBEA 3TN93 5C7GA 3V0BA 4Y24A 1VBD3 1RL3A 2PLV3 1UMHA 2DVBA 2NM1A 1HV0A 3J7LA 1R083 3VHPA 1QXPA 3WP3A 1QKQA 3OBRA 3H7JA 1NA1C 5FY0A 4QKDA 2WLPA 3TWIA 2W91A 5A32B 5BXXA 4Q4Y2 1L3JA 4I0AA 1GOHA 3N35A 1DYPA 4B7EA 5ISLA 3MGUA 4E8CA 2YPDA 1UMZA 4QM9A 2JXAA 3O1PA 4CP9B 4JTOA 2BEOA 3AMPA 4NJ4A 1MS8A 1GWLA 1D4M1 3PU8A 1N1YA 2BFUS 1W2TA 3DL3A 4DMIA 1K12A 2VG9A 5EHDA 3WF3A 5C71A 1LGCA 4XETA 3TN92 4XFIA 5T5OA 4QQHA 1ZA7A 3R05A 5GALA 2RS52 3NAPB 1IQAA 1CAVA 2UYAA 4BA6A 1WCDJ 4CDXA 5JOYA 4Y20A 1ZRFA 3ENRA 4FTBA 1DBNA 1LENA 1S0DA 1UYXA 2HEVF 1CAXB 1H4GA 1AX0A 3HQUA 1HJFA 1NY72 4YFZA 3CJIB 2BGPA 4Y1ZA 5HCAA 5FLIA 4C91A 5FO9B 3J4UH 2ZGPA 3ES4A 4DOUA 4D7YA 5HCHA 1I1EA 5GLVA 4UFLA 4EN8B 3WDVA 3K4ZA 4FVVA 2O0OA 5FZKA 3V0AA 3J8F2 2WQ4A 1WW4A 4GALA 2I07B 2ZABA 5D8AB 5JOXA 3AP9A 3LKJA 2RM21 2QBXA 1APNA 4FAHA 1PVC3 3WW1A 5FO7B 2FDFA 3AZYA 4RGKA 2GN3A 2XVGA 3VZKA 2YYOA 4B1LA 1QJX2 2XKOA 3POYA 3B3QE 1SCRA 4MGIE 3VBHB 2VZTA 5LA0A 1YIFA 2BWCA 1PIV2 1UOJA 4YVSB 5T3NA 1CESA 2BZDA 3LAGA 5CZKA 2QZ2A 4LNVA 5GLUA 4GA9A 2WWJA 1UOBA 1SBDA 4MOAA 1PVXA 1DGRA 3WG1A 3WNPA 3RZHA 1T2XA 2K2SA 3IMNA 5I91A 2QQPA 3WINE 1F2NA 4CCOA 4HZFA 1TNFA 2Y6LA 3DYOA 1YI9A 3B00A 3GGLA 4C90A 4DY3A 2HLEA 2Y64A 2HEWF 3AZZA 1TEIA 3UESA 3I54A 1S2EA 3RG0A 5FCCA 2PAKA 4NN0A 3S30A 3PLQA 1RUC1 1ZZ9A 3IDCB 3P3NA 1YYNA 1FMD2 3WG3A 4H2AA 4LHSA 4YG3A 1W0PA 2HWD2 2OT7A 1FT9A 4GH4A 1C8NA 5CNAA 3SKVA 4CEYA 2HBUA 2WZEA 1UPSA 1BBT1 1H6XA 1OI6A 2R063 2GC0A 3R4UA 5HV4A 3J9SA 2C5DA 4K6BA 3VHNA 1QDCA 2WFF2 2Z79A 3LDKA 4IETA 5ACA3 1UO9A 3PDQA 4TLGA 1RUI3 1REFA 5C5UA 2ZMLA 3WVJA 1P8JA 2KD7A 4FPLA 4QQ2A 4NRMA 1UY0A 2RS51 5DZGA 5BNNA 1DGRN 2B7YA 2OPWA 4AXOA 2AH2A 2G1MA 5DMYA 1QNWA 4FOVA 3JD71 2MEV3 5EPAA 1H30A 5A3LA 1PIV1 4YLZA 2VCCA 1UAIA 2VVFA 3VBRC 5IK8A 2WS93 5IJRA 3H50A 2ARAA 2H6CA 2WL1A 3H3UA 2WNEA 3IAQA 3Q9OA 4JX0A 4PDWB 2ZGQA 3K48A 5I8SA 3H8RA 1DQ1A 4Q0PA 2RS31 3RJRA 1PO12 2VQAA 1UYYA 3IB3A 1JUHA 3VDDC 4Q4X1 3HAGA 1DF0A 4KH9A 1F5FA 3BPSA 4QGNA 4YPJA 4GWNA 5FYIA 1JU4A 1OQDA 3SMHA 1CX4A 4XUTA 1VP6A 3KGZA 4FQZA 3RWKX 1RUNA 2EIBA 1GZWB 2P3YA 2YBKA 4LORA 3KV9A 1W6NA 5FKBA 1UL9A 5FYMA 3WNKA 1NLSA 2CDOA 3AYEA 3FLTA 1WKYA 2VBDA 2VY0A 1W6PB 2OW4A 4WVWA 4XJ8A 5IFTA 1MS9A 5A33B 2HWE3 5DPNA 4P5HA 5A6QA 3CBNA 2V5DA 3I3BA 5H9SA 2RR12 4NHLA 2MEV2 1E5RA 1V70A 4KGGA 1YWKA 1NYWA 3T2PA 1NKGA 1BJQA 2X05A 4IGOA 1AR82 2C9KA 4K8FA 5FYUA 3KF5A 4JHTA 2WS92 4AOCA 2P17A 1XBFA 2A75A 1VRH1 4OMDA 2AUYA 3ZM8A 2FMYA 1MR5A 2ZHLA 2L9LA 1AYM2 3UT0A 1X9TA 3ACGA 2BQPA 5JLVA 1F8VA 4TLFA 2Y0OA 4URTA 5BNQA 2OUJA 3G7DA 4Z8BA 2WZR2 1KS4A 2W47A 4NIAA 3NNLA 2DVGA 4BE3A 4CEYC 1LEMA 4E4SA 2PHUA 4MZUA 4IE5A 2XGXA 4HSJA 4NO4A 1W03A 3IM0A 1OA4A 2AREA 3KVBA 1Y3TA 1XNCA 2VD7A 3LEGA 4YM1A 4XE9A 1GFF2 1UY3A 4N53C 1QJX1 1CIYA 5J36A 2XLAA 4X8NA 1RUD3 5LK5A 5C3PA 2RDSA 1JOPA 4P9LA 2VE1A 4GKYA 5FYTA 4IGPA 1POV0 3SITA 1AR83 3K2OA 3KHBA 2NN8A 1D4VB 1OH4A 1UYPA 3MV01 1AR91 3ME2A 1YRZA 3WQ1A 4OYUA 3ZFGB 3H0OA 4UI9L 5CKMA 4BB3A 1R1A1 3L9JT 2W1SA 4MGTA 4NIGA 2DTWA 1OFNA 1Q3EA 1RGSA 2HWF1 3P5BA 2EIDA 2R073 4FPKA 4S2GA 5AVPA 2JDPA 1MS0A 4XW3A 4OQ8A 4EJRA 2D6OX 1O5UA 1UYZA 2NLRA 1GANA 4KWLA 1CONA 5CKQA 2VUDA 5CG9A 1OURA 3KMHA 2EVXA 2VCMA 4P9WA 5LATA 1FI2A 3WHUA 2HWC3 2RS12 5FZAA 1OD3A 3JD73 3MW3A 1XU1A 4FP3A 2Q30A 2R1BA 4QXCA 3BKZA 3W5MA 3KZ4C 2J42A 1WZXA 4XXPA 5AC91 2W3JA 3OG2A 4CCMA 4O9GA 4D3WA 4XCAA 2W1WA 2W0XA 2CGOA 2B45X 3UNPA 3ACHA 5DZFA 2B46X 2CNAA 2EAAA 5IVJA 3MPPG 4BHPA 1CAUA 2JDKA 5FXZA 1Q43A 3GHMA 4W4ZA 2FDKA 2G9FA 5EJ3A 1EPZA 4B7KA 3MIGA 1NUKA 2ZOEB 2XWJB 5FZ6A 3C8XA 4E27A 2VOVA 2VZSA 4AHZA 4IE4A 2BOJA 2TEPA 5LEJA 2GNMA 2YB7A 1JZ6A 5L7OB 1OMIA 1D0GA 4IV1A 2GC2A 3SQOA 4XF0A 2LRPA 1GQPA 2R1DA 1YQ2A 4CUGA 3JD72 3MLLA 2ZKLA 5T5PA 2SBAA 1OLMA 3OGVA 1UMIA 3M4FA 2A1XA 3RI9A 4R9AA 3VD3A 5I0SA 4JGYB 2YC4A 1HV1A 3NNFA 1CVNA 2VW2A 3O1TA 3D8CA 3JB4C 3TRSB 5JMOA 2DTYA 4A7YA 4HVQA 5CA6A 3N9QA 1G9AA 2JE8A 4UW5A 3VZMA 4Y22B 3NWKA 1ND2B 3T4VA 5CADA 2B4KA 1DZQA 3ETPA 3I2HA 4Q26A 2QVSB 4AGVA 4XF3A 3OSDA 1BKZA 2MNGA 4L99A 4HPKA 2YZ4A 4IV1B 5DQ0A 4DZGA 3JU9A 3KVAA 4LA3A 4L97A 5A3WA 3ETQA 4LITA 4XIOA 4Q4W1 1X8EA 1ZBA2 3BCWA 3TAYA 2WWSA 2VL4A 3ZSKA 4DXZA 4YZ1A 2UURA 4CCCA 2ZGKA 5JXGA 3OCPA 5FZIA 4BYYA 5A1FA 1RJ7A 1PVC1 3PTRB 5DAWA 5LB6A 5FFOC 4YFWA 5C9AB 2P3IA 2J1VA 1RTVA 1KGYA 4B3NA 2OXBA 1VBC2 3CMGA 4AVBA 2E7AA 3VBFC 1GQHA 2A3XA 2IZWA 4IQPA 4FPCA 1DCSA 3ON7A 4AEDB 5APAA 3LD8A 2ADEA 1QY4A 4FPFA 3ZXAC 4NWVA 3WLUA 1AL23 4G4FA 3VKNA 3RYKA 3MBWA 3LB9A 4D94A 2ETEA 1UD1A 1YIPA 2XJRA 3K46A 4D6QA 1OUSA 5I93A 4LO4B 1UU5A 2GC3A 4XHBA 3SCGA 1NZIA 4HVRA 2GP3A 5FBJA 3M3OA 2UYBA 4PIYA 1C1LA 1RHI2 3UGHA 3VN4A 4AVAA 3S5QA 3MIFA 4NIIA 4EWAA 3ZFGA 4LEJA 4YARA 3WW4A 3E5UA 1W6OA 4RS5A 4QWNA 2RS11 4CZSA 3I3EA 5FQ0B 4V1PA 3NJZA 4IESA 5D21A 5DDJ2 3BU0A 3CO2A 1L7QA 2GC1A 4LE4A 5A7PA 1ENQA 1SBFA 3D0JA 3OGSA 4DUWA 3N7LA 4PHZA 4QPIC 3FMGA 3R0RA 2R043 1BVP1 5A6XA 3VKLA 4BCUA 1CD3G 2R32A 1ULOA 2WA3A 3VBRA 4E2SA 3CEWA 5AFEA 2WBKA 3AMHA 1OPOA 4ZXKA 1J3QA 2YY1A 5L9BA 5KHJA 1ND3A 2WNVB 5L7OC 1I9RA 4M4PA 2BNMA 4EROA 4NHYA 5IVYA 1XE7A 3HT1A 3T1LA 3ZFGC 1WMDA 4A7ZA 4GH4B 4TTGA 1DYKA 4YWAA 1FAYA 2JIGA 1U5ZA 3N4MA 2A6YA 4MGSA 3UGGA 4CE8A 1O91A 2P4EA 1CAVB 4A6OA 3T0DA 2WO7A 4SBVA 5DDJ3 3LQCA 4PLOA 2DF7A 3DPRC 4XDOA 5A80A 3T08A 3BIWE 5EP9A 4AF9A 3H1YA 4QGLA 1F4HA 2W92A 1GNHA 4MXVA 4FO9A 4Q4X3 4QKNA 4Q8KA 3KD4A 4N43B 4P9JA 2F4LA 3QH7A 1ASJ2 1E5SA 1W9WA 1KFXL 2DFCA 1DGWA 2LTNA 2XBO2 1A3KA 1ZZCA 4LBLA 2IXJA 4AFDA 1CR7A 1BEV3 2TNFA 2HWD1 1WLTA 1JYXA 3GHNA 4D7TA 2VOTA 5F37A 3A23A 3I59A 1GV9A 1UQXA 2QQUA 3K4AA 1ND3C 5JR7B 4Q29A 2JX9A 3I97A 5BNPC 1QQP2 3RRDA 3FZ3A 2ZTNA 4P9YA 4TXWA 4QXBA 3ST7A 5ACA2 4DUVA 2YFZA 3FUQA 4IL7A 1RUI2 2DCYA 4JQTA 3WUDA 5F1RA 1H2KA 1JHNA 4AZZA 3WNLA 2J1RA 4MO3M 1QXJA 2CU5A 4N43A 2UWAA 5IVVA 4PI2A 5CFCA 1OH3A 2JG9C 4GXLA 1C28A 4BMEA 1ASJ3 4BQ5A 4BQ3A 4H3WA 1XE8A 3ZDSA 4COYA 3RYPA 4AEMA 3NSTA 1XXNA 4CCEA 2RJ2A 3DEMA 4WVZA 4YZ2A 4OQ9A 2BWAA 5KHKA 4AEDA 1Q8SA 2O8QA 4JGYA 1V9U2 1LU1A 3MICA 4OUMA 3MF9A 4PBOA 5DN2A 3NNJA 1KJLA 1VAKA 1QQP3 4R4ZA 2AEZA 2VNOA 1U5YA 1MZFA 4W50A 4CU9A 3PVOA 1U0AA 5C4WC 3ILFA 5M0TA 1J3RA 2P37A 4WM7A 3WP4A 3VDAA 5IVFA 1NCRC 4M3CF 4N7UA 2BERA 1Z7S3 1YO8A 1DQ5A 4YW1A 3CJIA 1N47A 3P1IA 5FP3A 5CFCB 2R071 2ZHNA 2AGSA 4FCAA 4CXYA 3OOXA 3IBMA 3AP5A 3O12A 4FXKB 3QBQA 1YI7A 2H6BA 1WBFA 5LCWL 5FZBA 2D7FA 1AR81 5JAXA 4XFCA 2BVVA 2VMIA 3BTXA 1Y9QA 2XJTA 3D0SA 1FV2A 2QQNA 1GNYA 2RV9A 4DUXA 5J48A 3VD9A 1WCKA 5DDJ1 4A7KA 1ZYBA 3PJYA 1RUOA 1V9U3 1PZ7A 3F95A 4I3PA 4IUGA 4KBBA 2K46A 4NR1A 1SLCA 3I2KA 3BTZA 4WM8A 3JQXA 2ZEXA 4N7IA 3KS7A 3NNGA 1W99A 3WX5A 3N9PA 1RUF3 5CFDA 1COV1 1PO22 1UXXX 2TBVA 5A3NA 1JYWA 5JOZA 4GIQA 1SMVA 1XJAA 2X09A 4A3XA 2A3YA 3N3HA 4LQRA 4M4RA 4R4XA 4BISA 4CDQB 5IHRA 3ZOIA 2XUMA 1AXKA 3WP5A 4XVHA 4CDXB 1D7PM 3T2TA 1H2LA 1OLRA 3L2YA 3VD4A 1PGL1 5BPXA 4DEVA 3AP4A 1XNBA 2IC1A 3M2MA 3B02A 1O59A 4HKOA 3LSEA 3GJAA 1MVQA 2RDNA 1WMXA 5J96B 4OFGA 5DG1A 4A6SA 4MXWB 3APBA 1TME2 4BLJA 1W9FA 2WAOA 3T2OA 5GLZA 5A7WA 2XB6C 3FLPA 1ENXA 3HN1A 3WXPA 2OPKA 4UBHA 3PHMA 4YGBA 3IT8A 3M3CA 3AB0A 4JGYC 1YJLA 2HWC2 2RS13 2J1AA 3KQRA 3O5SA 1MQTB 1S55A 2JE7A 4Q4Y3 4H7MA 1QJY1 3F2ZA 3U07A 2ZEYA 2ILMA 4UF0B 3V64A 5C4WA 3MDPA 3H8OA 3X29B 4ARYA 1VAVA 2PAMA 3HOBA 1RB8G 2WYFA 1TQ5A 2LROA 3NV2A 2XMLA 5FY8A 3B5LB 1VR3A 1NX9A 4NWWA 1H6YA 1V00A 1S2KA 3JUUA 4MXWA 2XXZA 1ZVFA 4FFHA 4I0BA 4OHVA 2BBVA 1ZX5A 3WNNA 2DU0A 3ASIA 1WW6A 3BB6A 1WCQA 1VBD1 1CWPA 3VUOA 4C1XA 5FZMA 5FYHA 1A78A 4QKBA 1AR63 3C2UA 3WDUA 1TMF1 3AKRA 2WDBA 4FTSA 3ZPYA 1YQ8A 3GZAA 4A41A 3CJIC 4C1WA 4DQAA 1EPWA 2R042 2D98A 1M06G 4QKFA 3LDRA 3MZHA 4OHYA 4DPNA 4URAA 4ATFA 4DIQA 3PIGA 4WVMB 3OPZA 2IWGB 2LALA 2B9UA 3MW4A 3J8F3 4LJHA 4IEYA 2HH9A 5FTTC 3CJXA 1W8ZA 3ES1A 1O6UA 4M0HA 3LEIA 4QPIA 5J1XA 2WFF1 3WP6A 1NT0A 4I30A 3WNMA 4OHZA 2DCJA 1RIRA 3AZXA 3DXTA 4NVPA 5IVEA 2XQXA 1QJFA 4QHBA 5FY9A 4ZXEA 1F5JA 2ZAAA 3PMEA 4ES9A 1TMF3 1PGSA 5BUVA 1J58A 1CQ9A 4SLIA 3OUIA 4BM8A 2FDGA 3LA3A 4D8MA 1OF3A 4R8HA 1DP0A 3NL1A 5FMDA 4QHZA 1W6OB 1O3SA 1WCSA 4GMP1 4ISQA 4ES8A 4S2FA 1MEC3 1CPMA 1IGOA 2CAVA 3E97A 3ILNA 4HKWA 5A7NA 5C9AC 5BNNB 1VB4A 2A7AA 5GM0A 4IEPA 1OQ1A 2PXJA 4R9DA 2O14A 5FP7A 3VL8A 5KXCA 5HCFA 4RS5B 5JXJA 4LBNA 4H14A 4H55A 4XDPA 2ZKNA 1C5HA 3JBG1 4DXRA 4Q4V3 5K7PA 1YJKA 3B94A 3U37A 2B5HA 3LGRA 4PJYA 4AG4A 3V0AB 3THPA 1A34A 4J1XA 4Q0QA 3P3PA 3ZR5A 2RM23 4MADA 4YW2A 1RC6A 3TBDA 3I2JA 2MHFA 3LF7A 4RFRB 4CXXA 5FJHA 1NG0A 2WUHA 3QD6A 5HCBA 5HPOA 1XSRA 1LECA 1TMF2 1WMFA 3U1XA 4EN7B 3J7HA 1LOFA 5FZ8A 4HN0A 1PK6C 3ZXDA 3MYXA 4EQVA 1FMD3 1N1SA 1QOSA 1UZVA 1UWWA 2UU8A 5ABJC 2P1BA 5LA1A 4CPBD 4WM8C 3PUAA 2O8OA 3KHCA 2Y6HA 5JDBA 4CP0A 1K45A 1G9FA 5A1LA 4FOWA 3PVBB 4QAWA 1W39A 1WGPA 2ATFA 4LKEA 2VJXA 4LLFA 5A33A 1NE4A 1OXCA 5LA9A 4AQ2A 1PZ9A 1FX5A 4I3GA 4CUAA 4AHXA 2VVDA 4LUMA 2A6WA 4W6XA 4XBQA 5SV8A 5F32A 4K1ZA 1PGL2 1HRI3 3RI8A 5DUVA 3B7MA 4DS0A 2W08A 3GZTB 1LODA 3JZVA 1YXWA 5AC92 3SHRA 4K40A 3SH5A 1VMFA 2WNUB 2FCTA 5FZ1A 1D4M3 1VBA1 2CSGA 2Y8KA 1ZZ7A 4DNYA 3LIGA 1W8OA 2LW8A 5FZDA 3SNMA 3OUHA 2E32A 3NQHA 1O5LA 5K8SA 3M3IA 2ET1A 4MGQA 2XBO1 3USUB 4B8EA 3I59B 2FDIA 2HBTA 3U11A 2D40A 3KT1A 1OOPB 3O0WA 4CCJA 4OHWA 1UZWA 3IAPA 3VBSB 5FY4A 1WBLA 1YQ5A 1ZZBA 2G4IA 1WW7A 4LA2A 3G6JB 1DLCA 3I2DA 4JQRA 3PMSA 3UL2A 1HXS2 1X33A 1KDKA 4RGGA 4YGEA 3AJZA 2ZJCA 3FX3A 4NIHA 5A7OA 1NLRA 2ZGMA 4L8QA 3S6PA 1OVSA 2W94A 3ZYRA 4Q1RA 2P6CA 2ZMKA 3S0MA 2JDUA 2R49A 4CTEA 1O4ZA 1UZ0A 4QU1A 3K4DA 4Q5OA 1AX1A 3RMYA 1B35B 1ASJ1 4PQ9A 2SLIA 4UFKA 1AR71 2QJVA 1ZBE1 3ZXKA 4YZ5A 3JQWA 2BNOA 4HANA 4COVA 1UW8A 4G3YC 2YG0A 2PLV1 1FYUA 1R091 3KWVA 3E6CC 5C4WB 5GLWA 1STMA 2CDPA 4NUBA 2BBAA 4FFGA 3AP6A 1UY1A 1QQP1 2P34A 3OF1A 3PL0A 4UFIA 5ABJA 1W6QB 1YCIA 1O3TA 3VBFA 3ZYJB 4A45A 2E7QA 1UKGA 4CDUB 5CISA 2QQMA 2W87A 2QQIA 3INAA 2AR6A 2VQ0A 5FPUA 5C3SA 3H8XA 1XNDA 5FZOB 2BDRA 1VBE1 1GUIA 1QH6A 1WUVA 4DY5A 1YEWA 3TEZA 2HKXA 3O1OA 4UW6A 4AHWA 2WN2A 1BXHA 2VBBA 3BOPA 2C26A 4QX7A 2YU1A 4X6QB 4XZPA 4CDXC 3ZX7A 3I2OA 3SEPA 3DECA 4ZU5A 3DXUA 3WDXA 1Z78A 1SLIA 5GZCA 3DGTA 2Y34A 4GULA 4N8MA 1VE0A 2XVKA 3NJVA 1JW6A 1HQNA 1SDWA 3VDDB 1DFQA 1RITA 1W8NA 4Z2AA 2LS6A 1N3PA 4IGQA 3OBAA 4ZU4A 4DO0A 4FPJA 2VAUA 4PBPA 2ET7A 5LRRA 2W2IA 4Z92B 1IS5A 3AVRA 3Q8EA 2BV4A 4X6RB 2QZ3A 1WA4A 3I3QA 1GLHA 1ND2C 1YHFA 2CWMA 3GNEA 4M0NA 2CAUA 4XHXA 2VNRA 2AZ5A 4LO5B 1AF9A 4LKDA 1QIQA 1PNFA 1EAH1 1ZNPA 3DKQA 4YG0A 4HLTA 3SC7X 3ITQA 1US3A 2DBIA 2YBSA 1O3RA 4OI1A 3B9CA 4GWIA 1HRV1 2WT1A 3C3VA 3QH6A 4YVSA 5LBEA 3OEBA 3DPRB 2JG8B 4IXLA 3WSOA 3WG2A 1OKQA 3E6DA 2GMMA 3HR9A 1EYBA 1MZEA 4MGKE 1OT5A 1U5XA 1YFXA 4KGQA 2OYZA 2FCUA 5FZCA 1PNGA 3WG4A 3ZYFA 5IK5A 4XDQA 3S57A 4WV8A 1GOGA 1FNYA 3VBRB 4RGAA 1POQA 3N36A 1S0JA 4LHLA 1RUJ2 5DUXA 1COV2 1PO21 1GWMA 2VTFA 5FWEA 3AL5A 1W2UA 3NJYA 3MFCA 3K77A 3T0BA 3THTA 1MQTA 3N7JA 1A6CA 1KEXA 3VBSA 4COUA 1OA2A 1GWKA 3MV11 2GU9A 1ULPA 3LWCA 3P6BA 3A7QA 4ASKA 1HB4A 1SBEA 3K3OA 1FXZA 1DGWX 2XOMA 3EQEA 1LHUA 3VZJA 2ZX4A 4NAMA 1GZWA 2WNOA 5L36A 1UCXA 2YFUA 4CVUA 4F83A 2QUOA 4ZHNA 4A3ZA 4HT1T 3PUIA 1W3XA 3VDBA 2WNUC 5CIRA 2DFBA 1NQJA 1E57A 2NQYA 5KWRA 4AAPA 1ZRRA 1Q5OA 1GZTA 5IWFA 3ZYBA 1JZ5A 1IQDC 4LMFA 4K8RB 3E5XA 1H1AA 1DQ4A 2DCKA 3J7MA 2DVDA 1CAXA 5GZDA 3MFAA 3ZFEB 3MHZA 4TYSA 3DYMA 1RVF2 3R6SA 3HIFA 1QJU3 4K21A 4KG8A 1PM4A 1DZTA 2VVEA 4CEWC 3W5NA 4LPLA 2A71A 1CN1A 2PHRA 3ZLIA 2Y6GA 3AYCA 4Y22A 4WM8B 2X5IA 3S7EA 2X53S 3I8TA 3RS6A 3ZYIB 5LY1A 1NAEA 3Q8FA 4CDUA 1JOBA 4BOWA 3MUY1 3E6BA 4Y33A 5A3OA 5CEHA 1SCSA 1REEA 5DXDA 3SH3A 3AKPA 3T09A 2CGPA 3UYJA 4MHUA 4LK6A 4QDRA 3AKQA 4XZUG 1VBD2 2Y38A 5ANQA 1ZBA1 4YVSC 2NZ9A 3AZVA 3KV4A 3LIHA 3Q8BA 3V0BB 5SV5A 3TN91 4HBNA 1AR62 3OEAA 4RN5A 3ZFFC 1VBB2 2ADDA 5J3UA 2R30A 4JKKA 4V2VA 1D4M2 3NJXA 2QFEA 5JCTA 4DEQA 4NAOA 4Q0SA 1J59A 2GH8A 2O1QA 4YNIA 5T55A 4LT5A 3WF4A 1BVVA 5LBBA 4B29A 4HSLA 2QQKA 1L7LA 2EXIA 2ZXQA 3U78A 3UETA 4BMBA 5FR3A 1UY2A 2ZX3A 4Q4Y1 1LTEA 4WZFA 4XFFA 5CFCC 1RUC3 3ZKUA 4FOQA 1FV3A 1URXA 2OZJA 2YU2A 3M8LA 5FXVA 2W95A 2CHHA 3NV3A 3UV9A 4D7SA 4GMP0 1LGNA 2VQTA 3T1MA 3KM5A 1R093 1YLLA 2VMHA 2R0FA 4OCTA
chains in the Genus database with same CATH topology
4FPYA 1TE1B 1V6NA 3UKNA 1FOD3 4JVAA 4YZ4A 2XJUA 3AXEA 3ZFFA 2X29A 1O4TA 1LKNA 1EV13 2CTVA 4GB33 5E89A 4OI2A 4NHMA 1SEFA 5CBLA 4LO6B 5CB7A 3RMXA 3U0ZA 4BLIA 4LLOA 1HW5A 5IK4A 2ZGRA 3PJQA 3BPZA 3WV6A 5H9PA 1H8TB 2HWB3 2A6VA 3FE5A 5DZEA 3ZYGA 3SISA 4KWKA 4MGZE 4XMIA 3AZWA 3N7KA 1SACA 2X5IC 1RUJ1 4A2UA 1VBA2 3FHIB 3ZIWA 4AFCA 2XBO3 1OOPA 4Y1VA 4QX5A 1Q8OA 1QJX3 1DQ0A 2D6NA 2OIIA 3BU7A 4IEXA 2Q5TA 3DUIA 5T54A 4FBFA 2D3PA 2HWE2 1IKPA 3FLRA 2DWRA 5FAXA 2VU9A 2GZWA 1KQRA 1VB2A 4Q27A 1BBT2 1MQTC 3VV1A 5LRSA 2CY6A 1K5MC 4ASMB 1DQ2A 5JSPA 1AYM3 3VBUC 4IEWA 1Q8QA 1V9U1 2A5ZA 1QJU1 2WINB 4LBQB 4JAAA 2DUOA 4F8AA 4EN0A 2JJ6A 4JRAA 3UJOA 4B4RA 2ZGTA 4RR3C 4XFGA 5J98B 2I2SA 3ZSLA 2A70A 5FOBB 1C1FA 4YG6A 1FMD1 1X8MA 2ERFA 1ONAA 2FMDA 2DYCA 4Q0VA 4UW4A 2K0GA 4FQ4A 3V65A 1F31A 1W0OA 4CDQC 4LO7A 1PVC2 1NCRA 2RS32 3RQ0A 4JCKA 4CP2A 1H8TC 2PAEA 4IV3B 2XJQA 2BW8A 4XJ9A 1NCQA 4HFSA 1PIV3 2GDFA 2DCZA 4GH4C 1DZRA 4KWJA 3HBZA 4WZCA 1AXYA 5FDBA 3U4XA 4OUSA 3FJSA 2NPIA 2UY8A 1RINA 1O7FA 4Q4W3 3OD4A 3WZ1A 1AUYA 1X7NA 4W6YA 4O9EA 1AR72 2CGNA 2WS91 4QPGC 4RQPC 4JDNA 1S0EA 3IKWA 2MEV1 1RUH2 2RS33 3VKMA 2ES3A 4NHKA 4YM2A 3QLQA 5A3MA 4Y1UA 3OY8B 3EHKA 1EAH3 2YGMA 1NCQB 1H0BA 4X8PA 1BEV1 3USSA 2QCSB 3ELNA 3WT3A 4LBQD 3AFGA 4L2NA 1D2SA 2OA2A 4XQ4A 3URFA 3VBOB 3DKWA 4INDA 4PF5A 5BV6A 5E88A 4Q4W2 5JWPA 4MSVA 4CEWB 3NW4A 4OZXA 3M7AA 4XILA 1GZCA 5C8CC 2BVBA 4RS5C 4WM7C 2WJSA 4XTPA 2EIGA 5K0UC 3EO6A 1V6MA 3KGLA 2JKBA 1DU3D 2R0HA 3W9AA 5J7MA 1RMU2 4RQPA 2GMEA 5JMCA 4S2DA 4XFHA 1LGBA 1QJZA 4FPHA 4MYEA 3GBGA 4FP2A 4HK9A 1RUG2 2ZA9A 2WNVC 4CDUC 2BTVC 3EJKA 4DRRA 4ORFA 2Q1ZB 4L92A 4AVVA 4GWMA 1PK6B 2VULA 1LHVA 3AYDA 3B93A 4ASLA 2R041 1NCQC 3ZMNA 3D5OA 4KU7A 4COZA 3ZN6B 1OA3A 1EP0A 1Q8VA 4AWDA 1NOVA 1QDOA 4RQPB 4MGYE 4KL1A 3AMQA 3VZOA 3B9IA 3JBG2 1H8TA 1WW5A 2JD4A 2RR13 2DVFA 4AI8A 3WW3A 4Y26A 1S0IA 1FNZA 4IERA 1VBB1 1M4WA 4MVTA 3N4MA 2PHTA 3ECQA 3B69A 2IXLA 2WZR1 3O0XA 3TYJA 3OTFA 1RUE3 3I7DA 1H4HA 3H1WA 4GKXA 5GLTA 4P9GA 4QMAA 4EWEA 1Q8PA 5FPZA 4DB5A 1QH7A 3HMYA 4LBJA 1HRV3 3EXUA 3IIAA 4F3JA 1AL21 1AYN2 3POSA 4HVOA 4DINB 1GR3A 2LM3A 2WQZC 4JGZA 3OYWA 3O7OA 2XLFA 5BNPA 4UW3A 2Z2SB 1AR61 2DURA 3N7MA 1MS5A 5F5QA 4CDWA 3LA7A 4UXAA 2CL2A 4JV4A 3AX4A 3ZXJA 4WBBA 1LB2A 1WD4A 5DUUA 1RVF3 2Z69A 3KT7A 1VBE3 5KHIA 4MX3A 2Q0AA 2DV9A 1DIWA 1H1IA 3HT2A 2R062 4MH0E 4XYXA 2PELA 1MS1A 4HPKB 2HJIA 1RUH1 3RSJA 4AFMA 5C8CA 3MF6A 1AYN3 3NKTA 1PM7A 1UF2C 2XL9A 2D6PA 4CP1A 4Q2FA 2ZPXA 1NQDA 5CVRA 1N1TA 3VZLA 1PHMA 5A32A 5C33A 4EN6B 4IEZA 1LOBA 2WT2A 1ND3B 2WNVA 3VBHA 1GZ9A 3WHTA 1OPMA 4AI0A 3LOBA 1V6KA 3WDYA 4I0WB 2RJLA 2CWSA 1PGW1 2HWB1 5E16A 1B09A 3WQ7A 1H9WA 1HQLA 3D4KA 2FHRA 4Q4V1 1AVBA 5FMOL 2XL7A 4I01A 5KXBA 1PO13 1AYN1 1J1LA 2K9ZA 1LEDA 2N7GA 3FFZA 3ZYPA 1HLCA 4YZ3A 3AM2A 3ZFEA 1AHSA 2E7TA 2DU1A 4Z2WA 2Z5WA 3M3EA 1NY71 1N3QA 4Y1XA 1KD7A 5T52A 2HWD3 3IN9A 1C57A 1J3PA 1DLLA 1AXZA 1YNAA 4BWOA 4PLMA 2GMPA 2D3RA 2ZBJA 4XFBA 3VBSC 2VOKA 5FQ0A 1XYPA 2W68A 1EV12 1AX2A 2WFF3 4AFBA 2ZX1A 2C9AA 1U12A 3PNAA 1DQ6A 2V09A 5D8AA 4CYDA 5FREA 1RUD1 4FAGA 1AZDA 3KCCA 1S2BA 1VJ2A 1AYM1 4LHKA 5EXOA 2XJSA 1XNKA 1BZWA 2WFPA 1V6JA 3W59A 4XQWA 3I4IA 2WZR3 3MIHA 5BNOC 1QWRA 2VOWA 1R1A3 2E53A 1LJ7A 5EZWA 1VBA3 3A4UA 4YM0A 3ZSJA 4OLLA 4TSVA 1BQPA 2QDRA 3SH4A 1G9CA 4LBMA 1D0HA 4DRVA 3CNAA 4MV2A 1HX6A 1DHKB 1YFUA 4JDMA 1NCRB 5I8YA 5FRAA 4AQ6A 1SFYA 2X8KA 4YSFA 5BNOB 1ZBE2 5DUWA 5H9RA 2R6QA 5FLJA 3RZZA 2UY9A 3MIBA 4J1WA 4FPGA 5LK7B 2A3WA 1CAWA 4AVSA 4N9HA 3ZN6A 1POV1 5H9QA 2B8MA 4XF9A 3UK9A 1FOD2 1MVEA 1TME1 1RMU3 4Q4X2 1S0FA 2E9QA 1EV11 5IUQA 5L7OA 4OI4A 1W6PA 1QXRA 4OVEA 1HDKA 1B35A 2CV6A 2X5IB 4WVVA 1RUG3 4Q0UA 3AMNA 4XF4A 3HD8B 1HRI1 2XG3A 3KCXA 4U36A 3H1MA 1JN2P 2YPJA 1O3QA 4CRQA 4QPGA 3OJBA 5AFBA 5F6KA 2EA7A 3CL1A 4YW3A 4QXKA 3VKOA 1ULEA 2XVLA 5K0UB 4XTMA 4Y20B 3WY6A 1ND2A 3RWNA 4RD7A 2BGCA 3PTYA 1RUI1 3ZO0B 4RFT0 3EBRA 2P3JA 3J8F1 4PLNA 1ZRDA 1IS6A 4BH9A 3OYWB 4B4QA 5ACA1 3VLBB 4Y1YA 3UKVA 4XBNA 3R4SA 1C5IA 2C0ZA 3NV1A 2RMU2 4GQ7A 1AJOA 2XHKA 4K7JA 1KXGA 1ULFA 2R072 5C9AA 5TSWA 4AHYA 4K20A 3CU7A 5K0UA 3VBHC 3OGGA 5HI0A 5KHGA 2P3KA 4LULA 1HQWA 3KB5A 4GMP3 3HQXA 3ALQA 2IXHA 1V6IA 4ZU7A 5JPMB 1MZ6A 2JG9A 2ZX0A 5F9TA 1FPN3 4ATEA 1I3HA 4FXGB 4ISRA 4DFSA 4AEDC 1ZRCA 1PK6A 1ZA4A 4N9IA 1ENRA 5KBFA 1IOAA 2IXKA 1C8M2 2ZGUA 5DG2A 3AP7A 1MZ5A 1MS4A 2IFRA 3OBTA 4BIFA 4P14A 2D3SA 3RNSA 1GICA 1QOTA 1VBC3 4BZ4A 2PTMA 5CFDB 1PGW2 1Z0HA 2ZGSA 1RJ8A 3W58A 4Q1PA 2HYKA 3QCWA 4XBLA 2QNKA 2LUWA 1SLTA 4BPZA 3H3ZA 1CGPA 3PVEA 5JZGA 1FPN2 2I74A 3AMMA 4IEQA 4RR3A 2NP0A 1BCXA 2JENA 2JDZA 3MLKA 4HKLA 3VBUB 3PVNA 2ZACA 1MEC2 3R4DB 1RUF1 1JYIA 4AYUA 4AI2A 3WUCA 1CAWB 3AYAA 4LBKA 1TME3 2OVUA 1XYNA 2HWF3 3LZZA 4LUKA 1REDA 4QQPA 2F6BA 1VLNA 5I0TA 3ZXFA 1RUD2 2BUKA 1RVF1 5IK7A 1AL0G 4CDWC 2AYHA 5GZGA 1X50A 1LOAA 1LCLA 1SLAA 2VOXA 1Y43B 4XJUA 2ZGNA 3IDBB 4AW7A 2FQPA 1NXD1 3NKGA 4KG0A 4QGMA 2YC0A 3BODA 3WCRA 3L2HA 3WD5A 3MIDA 3ZN5A 4KQ7A 1AL22 3NAPA 5E8AA 4YGDA 2BFUL 5ABJB 2HWE1 1GNZA 2PLV2 1IS3A 2WT0A 4E9KA 1R082 2DUQA 5KC6A 4AE2A 5AVAA 4AEJA 3VBOC 1R1A2 2ZHMA 1MACA 1KFUL 2D6MA 4YVWC 1A8DA 3AK0A 5D8AC 5JOWA 2EXJA 4GB32 5KC5A 1PO11 1Q56A 1HKDA 4ONUA 4E4ZA 1VBE2 1GBGA 3B01A 2Q8OA 3GYDA 4E2GA 3CF6E 2R16A 1XQNA 4OULA 1IZ3A 1LOEA 4QU2A 5EV7A 3ROUA 4QPGB 2VMGA 3POWA 5C8WA 2RS53 1OOPC 4QD2A 4R52A 3NAPC 4XMAA 2D97A 3VZNA 4YW5A 3ZFFB 1W6NB 2W39A 5J37A 4Y5Z0 4C0HA 4FPEA 2RJKA 3WQ0A 5J09A 4HETA 4F7ZA 2EALA 2Z42A 1IPJA 1UU4A 2YV8A 4PCRA 1MEC1 1OLQA 2ZHKA 1K5MA 4PIZA 2GNBA 2G9GA 4E4DX 4EWDA 5BNPB 3AXDA 4Q4V2 1LULA 4KNCA 2PA7A 3H7YA 2WA4A 1LOGA 1KS5A 2I45A 4H7LA 1SLLA 3ZSMA 2P2KA 1ZBA3 2PQQA 3ZXLA 2VH9A 1H2NA 1I6XA 5JZGB 3BTAA 1AR92 2XPJA 4P9XA 3QOPA 4CEYB 3A0NA 1BEV2 1G9BA 1DDLA 1CAUB 2WZPP 2OZ6A 4XJWA 4CDQA 1KRIA 3SCHA 4FSJA 1LHWA 1VALA 1GYKA 4W65A 4XFAA 4JRLA 5JZGC 5GKAC 3WOGA 1QF3A 4YVWA 4AI3A 4AK3A 1C3HA 4B4PA 5FLHA 1TNRA 1HXS1 4META 2VPVA 4U2AA 2HEYF 4BIOA 1RHI3 3RDIA 4Z82A 1ULGA 1PO23 1AR93 2GALA 1AJKA 2WNUA 5LEKA 3KSCA 1MS3A 5T5LA 1RUG1 5IT6A 4R9BA 3LSDA 3GALA 5BYNA 3ZXEA 1CIWA 3AKTA 4PIXA 3SLIA 1QU0A 4LTAA 3VBUA 2UWBA 2ZCWA 3J26N 5C6CA 2A6XA 4QQOA 4AGRA 4MUVA 2ZS6B 3FFQA 3M3QA 2D5HA 1SLBA 4COWA 2JE9A 2D6LX 4P9IA 3ZSEA 4W6WA 2YUEA 2H0BA 1YFYA 1PMIA 4FPOB 1V6LA 5JIUA 1OD5A 1IPKA 1QGLA 2XJPA 2VNGA 2GN7A 2PHFA 4IV3C 1NA1B 4KU8A 1YUDA 3BALA 3U10A 1X82A 1A8MA 3TOJA 1IKQA 4RHV1 1GKBA 5EFUA 2PYTA 4UBGA 5FO8B 1T6GC 3VBFB 1FATA 3BOWA 2WSUA 2B39A 4AQTA 2DUPA 1O4YA 1PZ8A 4QQLA 2ZZJA 4XF1A 2XWBB 4JDOA 1VRH2 1IHMA 2QDNA 1OHFA 5BY5A 2KA3A 2PHWA 4AQSA 5JPNB 4HN1A 2VUJA 1JBCA 5EYXA 5T50A 3VHOA 1I5ZA 2ZZQA 2E6VA 2PHLA 1JTZX 4FTEA 3MI8A 3NVCA 2WKKA 3MIEA 3VKFC 1X36A 1UX6A 1QJY3 4MLOA 5K9YA 5JSOA 1G8WA 4RR3B 2VGDA 3IPVA 2A6ZA 1LHOA 1WLCA 1RUE2 2JEMA 1UIKA 4AVTA 4QM8A 1JOJA 2V5YA 3DV8A 4PDWC 3D6EA 1QHDA 4K3UA 4R9CA 5JI9A 1HRV2 3FBYA 4RA0A 2E51A 2PN5A 4YRDA 1C8M3 2CYFA 2WIIB 3O0VA 4I09A 3OGJA 2WC2A 4IV3A 1GSLA 1UKRA 5JIAA 1DGLA 2H0VA 2YHJA 2PFWA 3LOIA 2GNTA 4XEZA 4YM3A 1UU6A 2Q4SA 1H8VA 4M3CE 3JCIA 1COV3 3MEPA 1ULCA 1DG6A 2E63A 3IPVB 4IEUA 3GZUC 2DCTA 1R1ZA 2D44A 5CU1A 2YROA 5GZEA 3ZXGA 1FPN1 3ACLA 3H9AA 4XXAA 3TNPB 5BNOA 3ZMOA 4L11A 5HBAA 2ZGOA 2XH6A 3WW2A 2PHDA 4OHXA 2EXHA 2NMNA 2B42B 2GNDA 4PDWA 1ZREA 4N53B 2JG9B 3FC0A 1N1VA 2KXLA 4QPYA 4CDWB 2FZ1A 4YVWB 1R081 3AJYA 5I0RA 3VBOA 4EN9B 1LOFC 1S0CA 4OI0A 1ENSA 1IS4A 3WDWA 1QJU2 4AI1A 3WR0A 3LA2A 1SQ4A 4M00A 3VDDA 3MW2A 1UZZA 1WMEA 3IWZA 4YGCA 4Z1VA 2C1FA 1Z7S1 5C8CB 3ZFEC 5JSRA 2OUHA 4JGZC 2RM22 1B35C 1RUJ3 1N3OA 2JECA 2QKDA 2DVAA 3UJQA 4AEKA 3SCFA 3M70A 2RMU1 3KLSA 4M01A 3NV4A 4ITCA 1BMV1 4XJAA 4LE3A 5FBZA 1RUE1 2JG8A 3VHRA 1RMU1 2VW0A 1ZZ6A 2BNNA 4XOGA 3AFKA 1Y7BA 1VIWB 1OQEA 5CG8A 3OD0A 1ALYA 5CFDC 2HWF2 4N90A 1HRI2 4QPIB 3WNXA 4ZKTB 3ILRA 2IXIA 3WCSA 2BYVE 3O14A 2GH2A 4Z07A 1KJRA 4RSUA 4I02A 5L73A 4EV0A 1KDMA 4LBQA 4HMZA 1FOD1 2ARBA 4WM7B 1VBC1 1WD3A 3FUOA 2Y26A 3TB0A 1U5IA 2QE3A 4LBOA 2YMZA 2JG8C 1LESA 2WLQA 3GF6A 4JTNA 4YW4A 5I0UA 5JI7A 1ZBE3 1HXS3 1UPIA 3IDEA 3RPQA 1LU2A 2RHPA 1XRUA 1S1AA 2V73A 2D43A 3UKTA 4I2OA 5GZFA 1JUIA 3CLPA 5HXVA 2TUNA 2ZMNA 1EY2A 4IEVA 1SFNA 5EWSA 4C0BA 4AFAA 1LRHA 2D6KA 1RHI1 4L9BA 1G7YA 3WDTA 4FT8A 1H9PA 3A0KA 4IEOA 4YYOA 3VL9A 2EF6A 4K1YA 5KHHA 2D93A 2ENRA 2RE9A 3DF0A 3NO8A 2EXKA 2IXCA 3DN7A 1YFWA 5E1RA 3LCPA 5I8TA 3D82A 4IV1C 5GJ6A 1XYOA 5FMOS 2Q1MA 1BBT3 2R061 5FPXA 3KCYA 1W6QA 1LR5A 2RR11 1F9KA 2XJVA 1WLDA 2YGLA 3MPBA 2FZ2A 1OSGA 3VGIA 1R092 4RHV3 1POV3 2VXRA 2W52A 2KM2A 1QJY2 4JGZB 4QT6A 4LR4A 2XLGA 3KT4A 3SXWA 1H1MA 4WVMA 3ZN4A 3GBWA 1K5MB 2EAKA 1S0GA 3ZIXA 2ZGLA 2VUAA 2RMU3 4AVCA 4Y4YA 1ULDA 1D2QA 1CJPA 1QMJA 3RYRA 2NMOA 2WSVA 1LHNA 5T5JA 2GSYA 4BQ1A 2HWB2 4LO8A 5AC93 1NZCA 1CPNA 2F4PA 4NPRA 1JH5A 3RJ2X 4XJZA 4J6GA 3FWEA 2XKPA 3ZVXA 5CAZA 1OFSA 3M1HA 1CJDA 4JC1A 3JBG3 4RL7A 1G86A 1QNYA 1V6OA 2VW1A 1XU2A 1LOCA 5EYYA 1G6NA 1NE6A 2JICA 4FOYA 4S2HA 5B2GB 1BK1A 4D69A 1BMV2 2A73B 1KITA 1S0BA 3AKSA 3V56A 2UWCA 3TNQA 2ZX2A 1HIXA 2GAUA 3OY8A 1NXMA 4HL0A 2D5FA 5FOJB 1JXNA 4LHNA 4K9SA 1Z7S2 1EAH2 2ARXA 1VRH3 1JYCA 5KXDA 5F6LB 2NYYA 3E5QA 1VBB3 3HWJA 2YXSA 4NOTA 2IFWA 1C8M1 1J1TA 1ZZ8A 4M3CB 4TZDA 4CEWA 1W6MB 1UZYA 3GBFA 4XPVA 4TWTA 3QACA 1QOOA 4Q8LA 2Y0IA 4E2QA 5KXEA 4G9SB 2VECA 2PHXA 1RUC2 5JVVA 1C4RA 4GB31 4XIKA 3K51A 1NA1A 1RUF2 1ZM1A 3ATGA 2BPA2 2AENA 2ZAHA 2MPFA 3USUA 1UN1A 4RHV2 1UIJA 4AGGA 1BYHA 1H2MA 4XQDA 3JB8A 3S7IA 5L19A 4M3CA 4HK8A 1WLWA 1VAMA 1W6MA 5D1IA 1AR73 3DPRA 2YDEA 1GQGA 4N43C 4N53A 1G9DA 5BNNC 2HWC1 3FBMA 3MLJA 1RUH3 3H8UA 2FBEA 3TN93 3V0BA 4Y24A 1VBD3 1RL3A 2PLV3 2DVBA 2NM1A 1HV0A 1R083 3VHPA 1QXPA 3WP3A 1QKQA 3OBRA 3H7JA 1NA1C 2WLPA 3TWIA 5A32B 5BXXA 4Q4Y2 1L3JA 4I0AA 3N35A 1DYPA 4B7EA 3MGUA 1UMZA 4QM9A 2JXAA 4JTOA 2BEOA 3AMPA 1MS8A 1D4M1 1N1YA 2BFUS 3DL3A 4DMIA 2VG9A 1LGCA 4XETA 3TN92 4XFIA 5T5OA 4QQHA 3R05A 5GALA 2RS52 3NAPB 1IQAA 1CAVA 2UYAA 4BA6A 1WCDJ 4CDXA 5JOYA 4Y20A 1ZRFA 3ENRA 4FTBA 1DBNA 1LENA 1S0DA 2HEVF 1CAXB 1H4GA 1AX0A 1NY72 4YFZA 5HCAA 3CJIB 4Y1ZA 5FLIA 4C91A 5FO9B 3J4UH 2ZGPA 3ES4A 4DOUA 4D7YA 1I1EA 5GLVA 4EN8B 3WDVA 4FVVA 2O0OA 3V0AA 3J8F2 2WQ4A 1WW4A 4GALA 2I07B 2ZABA 5D8AB 5JOXA 3AP9A 3LKJA 2RM21 1APNA 4FAHA 1PVC3 3WW1A 5FO7B 3AZYA 2GN3A 2XVGA 3VZKA 2YYOA 1QJX2 2XKOA 3POYA 3B3QE 1SCRA 4MGIE 3VBHB 1YIFA 2BWCA 1PIV2 4YVSB 5T3NA 1CESA 3LAGA 2QZ2A 4LNVA 5GLUA 4GA9A 1SBDA 1PVXA 1DGRA 3WG1A 2K2SA 3IMNA