4IV3B

Crystal structure of recombinant foot-and-mouth-disease virus a22-h2093c empty capsid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
207
structure length
207
Chain Sequence
DRILTTRNGHTTSTTQSSVGVTYGYSTQEDHVSGPNTSGLETRVVQAERFFKKHLFDWTPDKAFGHLEKLELPTDHKGVYGCLVDSFAYMRNGWDVEVSAVGNQFNGGCLLVAMVPEWKEFTPREKYQLTLFPHQFISPRTNMTAHIVVPYLGVNRYDQYKKHKPWTLVVMVVSPLTTNTVSAGQIKVYANIAPTHVHVAGELPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Rational engineering of recombinant picornavirus capsids to produce safe, protective vaccine antigen.
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type a
molecule tags Virus
total genus 41
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iv3B00
2X5IA 5AC91 1VRH1 2RS11 4WM7B 1PO11 4WM8B 1TME1 1NA1C 1D4M3 1VBD1 1HXS3 1AYM2 1AUYA 3VBOC 2HWB1 3VBUB 2RS31 4QPGB 5BNPA 1HRV2 3J8F2 1AR62 1BEV3 5DDJ2 1HRI3 2Y26A 1C8M2 1RHI1 1FMD1 1VBC3 4CDUB 5ABJC 1TMF1 4GB33 5ACA1 1IHMA 4JGZB 1AYN2 3ZFGB 1QJU3 1PIV3 1PVC2 1ND3A 2ZZQA 1OOPC 1AR82 4Q4Y2 3VBSB 2XPJA 3CJIC 1VAKA 1RUJ3 4WM8A 4RR3B 1H8TC 1RUG3 5A32B 3VBHC 1FOD1 4N53A 1ZBA1 1ZBE1 5BNOB 3VBUA 3JD71 4QPGA 4JGYC 5BNNA 2BBVA 4GMP1 4RQPC 3HAGA 4QPIA 1D4M2 1AYM1 5L7OB 1AL21 1R081 5C9AC 4RS5A 2RS51 3ZFEA 1AR61 3ZFGA 3TN93 1X36A 3DPRB 4CEWA 1BEV2 4CDXC 1HRI2 1EV12 1K5MB 2R072 1FPN2 4Q4X3 4RR3A 4GB32 1PVC1 4AEDC 4Q4V3 2HWD3 3ZFFB 3VBFA 1QJU2 2RR11 4IV1C 2XBO3 2PLV3 5BNOA 2MEV3 2WS93 4PDWA 5A33A 4YVSC 1Z7S1 1RUJ2 1QJX1 2HWF2 5D8AC 4FTBA 1DDLA 2X5IB 4FTEA 4YVWC 3VDDA 4Z92B 4BCUA 1NOVA 3J8F3 1BBT2 5DDJ3 1C8M3 1PO23 1HXS1 1K5MA 4SBVA 1PGW1 1EAH3 4JGZC 3ZFFA 1HRI1 5BNPB 1MQTA 1OPOA 2RM22 1PGL2 1ND2B 1RUH1 3FBMA 1VBC1 1RMU1 3JBG2 3VBOA 4GB31 2RMU2 1QJU1 1PIV1 1NG0A 1B35C 1POV0 1WCDJ 1ND3B 1POV1 5K0UC 1VBB2 2XBO2 1AR92 2PLV2 2MEV2 2WS92 1RUG1 2BFUS 1RUE1 1VBE1 1OOPA 4CDQB 4N53B 3CJIA 1W39A 5CFCC 1RUC1 3VBRB 2HWE1 5BNNB 1AR72 1NY71 4Q4W3 5CFDC 1ND2A 3NAPC 1COV2 1QJY3 1A6CA 1RUF2 4QPIB 1OHFA 1EV13 1PO22 2BUKA 2R073 2FZ2A 5JZGB 1ASJ2 1FPN3 4RS5B 3TN91 3ZFEB 1PGL1 4RQPA 1RVF3 1EAH2 2BFUL 4N43C 4IV3A 1NCQB 4CEWB 4CEYC 1RUI3 1C8NA 2WLPA 4Q4X1 4GH4C 1R093 4Q4V1 2HWD1 2HWC1 1QQP3 5J98B 3VBFB 2XBO1 1HX6A 2HWF3 4CDQA 4FTSA 2MEV1 4AEDA 2X5IC 3VBRA 5J96B 1NCRB 1RUD3 4GMP0 4PDWB 4CDWC 5A33B 5C8CC 1BBT3 1MEC2 2R043 4Y4YA 5JZGA 1AL0G 1VBA2 2RS13 1HRV1 3J8F1 3VDDB 5DDJ1 5FMOS 1NCQA 1C8M1 1PO21 2RM23 4Q4W2 4NWWA 1QJY2 2R063 4YVWA 1F8VA 3JBG3 2BPA2 1AYN1 2RMU3 1R1A2 1CD3G 1NA1B 1V9U2 5C4WC 1RVF2 1MQTB 1AR81 4Q4Y1 1RUI2 3S6PA 1VBB3 1AR93 2WFF2 3VBOB 2VQ0A 1NCRA 1SMVA 1R092 4WM7C 4WM8C 5FMOL 2FZ1A 1QQP2 5ABJB 4EJRA 3LOBA 1B35A 3VBUC 1AR73 1RUD2 3M8LA 1D4M1 4QPGC 5BNNC 1COV3 1RUF3 5K0UA 2R042 1OOPB 1ASJ3 1ZBA3 1ZBE3 3CJIB 4CDUC 5AC92 1H8TB 1VRH2 2RS12 1NA1A 1VB2A 3ZFGC 2ZAHA 1BEV1 1QJY1 1TME2 1EV11 2R071 1FPN1 1F2NA 2R062 5CFCA 1VBD2 4JGYB 1RVF1 3VBSC 2HWB2 3NAPA 4RR3C 4RQPB 2RS32 2QQPA 4IV3B 5GKAC 3ZXAC 4LLFA 5ABJA 4FSJA 4RHV3 1R091 4Y5Z0 1RHI2 1RUJ1 5BNOC 2GH8A 1TMF2 1MEC3 5ACA2 2HWF1 4CDXB 4GH4A 1VBA3 5L7OC 3JB4C 4AEDB 1H8TA 1BBT1 3VBHA 1Z7S3 4IV1B 1QJX3 1QJZA 3DPRC 1FOD2 1RB8G 1K5MC 4CDWA 5C8CA 4JGYA 1ZBA2 4YVSB 1ZBE2 1R1A3 1V9U3 2RM21 3JD72 3ZFFC 2R061 5D8AB 1MQTC 3JBG1 5FOJB 1HQNA 5C9AA 4YVWB 2WFF3 2RMU1 1AL22 1R082 2RS52 4CDXA 5LK7B 1VBB1 1AR91 1RUH3 1X33A 2PLV1 2WS91 1RMU3 4RHV2 5C4WA 2WZR3 4IV1A 2RR12 1POV3 5AC93 4YVSA 4WM7A 1VRH3 1AR71 1CJDA 1PO13 1B35B 1COV1 1RUF1 1TME3 1Z7S2 5BNPC 1QJX2 1RUE3 5D8AA 1ASJ1 1VBE3 5K0UB 1ND2C 1VBD3 2WWSA 1EAH1 1RUC3 2HWB3 2RS33 2HWE3 4IV3C 1GFF2 4CDUA 1ND3C 1RHI3 1HXS2 2ZTNA 5CFCB 1FMD3 4JGZA 1TMF3 1PGW2 5ACA3 5CFDB 1BMV2 3NAPB 2DF7A 4RHV1 1RUH2 4CDQC 1VB4A 3JB8A 4N53C 3VBSA 1VBC2 1RMU2 1MEC1 4N43B 5A32A 3VBRC 2WZR2 4CEYB 1PIV2 3IDEA 2HWC3 2IZWA 1FOD3 1VBA1 4QPIC 4GH4B 5JZGC 4RS5C 1E57A 3ZFEC 4Q4W1 3JD73 3VBHB 1PO12 1RUG2 4GMP3 1NCQC 1RUE2 4CEWC 5L7OA 1VBE2 2TBVA 1AYM3 1AL23 1R083 1R1A1 1V9U1 4CDWB 5C8CB 2RS53 1HRV3 1AR63 5CFDA 3DPRA 1RUC2 1RUI1 2HWE2 1NY72 3VBFC 4NWVA 1M06G 2WFF1 5C9AB 4RFT0 1BMV1 1AYN3 1FMD2 2GSYA 4N43A 1NCRC 1QQP1 4PDWC 1PVC3 3TN92 4CEYA 2RR13 1AR83 4Q4Y3 4Q4X2 1RUD1 2WZR1 5C4WB 3VDDC 4Q4V2 2R041 2HWD2 2HWC2
chains in the Genus database with same CATH superfamily
1XU2A 1Q8VA 2BYVE 1OH4A 1UXXX 3AXEA 3GBWA 5B2GB 4XETA 4RD7A 3IPVA 1UY3A 1ENSA 4WM8B 1TME1 5FYIA 1UKRA 1EUTA 2DTYA 2OZJA 3ZYHA 1WZXA 4W8JA 4HL0A 2QQOA 3AZWA 4LHKA 4PBOA 3RPQA 4EN9B 1UYXA 5IVFA 4JVAA 1OD5A 1W2TA 1AUYA 1GUIA 1UYZA 4ZXKA 1GWMA 2HEYF 2B8MA 5TSWA 1BEV3 4XF4A 4QQLA 1X9PA 1W6PB 2Y26A 4Y33A 3ZMOA 1XB9A 2WNUA 1IQAA 4XTPA 5LRRA 1JU3A 1K12A 3HIFA 1NX9A 1ENQA 4GB33 4JGZB 1UX6A 3M3IA 1IPKA 4ZHNA 1UWWA 3Q8AA 1QJFA 2ILMA 1ND3A 3T2OA 4A3ZA 2QCSB 5JPNB 3DECA 5BUVA 4COZA 4Q4Y2 1TNRA 4FQ4A 5LBEA 3UGFA 1KEXA 2VUAA 4MSVA 2XPJA 3CJIC 4UAPA 1H8TC 5A32B 4HLTA 1YQ5A 4E4HA 2ZABA 2QQNA 2LRPA 4IEVA 3HR9A 1YIPA 2UWAA 2W3JA 4N53A 5EJ1B 3BIEA 4IGQA 2VQTA 1SLIA 3WCRA 2PMWB 3A23A 2HLEA 3ZPYA 3B94A 1ZRFA 1PNFA 3VBUA 3JD71 2C5DA 1P8JA 1PX3A 1UMIA 4ZU5A 2A6YA 4LA2A 1H1IA 1SFNA 1W9WA 2WZEA 4RQPC 2BVVA 1D4M2 2C6SA 2QFEA 4A7KA 1AYM1 3J4UH 2LS6A 2VTXJ 2DWRA 1FAYA 1R081 2XJPA 4UW5A 4YRDA 3OGJA 3ZFEA 3LCPA 3ZFGA 2R49A 1LEDA 1NZCA 1X36A 2Q1FA 3SCGA 3ZYBA 4CEWA 2QQMA 2JKBA 2WO2A 4LOSA 3VD7A 5A1FA 3RZLA 1RINA 1CONA 1EV12 1ZZCA 2A6XA 4MGTA 3C7EA 2CGOA 2Y6KA 4XIKA 4YNIA 1QXJA 5IT6A 5CB7A 5DG1A 1H9PA 2ZCWA 4P9YA 4RR3A 4AG4A 1PVC1 2QQPA 4BE3A 1G7YA 1OLME 1QJU2 4U2AA 1UX7A 5FLHA 4CU9A 3VD5A 1POQA 2XBO3 1N3PA 1D0HA 3MI8A 4ASMB 2P3KA 4QX3A 3I49A 3K4AA 4HONA 1RUJ2 4Y4RA 3RJRA 1XSRA 1ONAA 4A7YA 2WWUA 4FTBA 1NYWA 2X5IB 2NMNA 4Q8KA 1MS0A 1UZWA 4YVWC 4YW4A 3I3MA 4FTEA 2ET1A 3NV1A 3NWKA 1WCSA 5J48A 3OCPA 3M3CA 4I09A 5FZEA 3O1SA 1E5HA 3JCIA 2YPDA 5C5TA 5C70A 1I5ZA 3NJVA 5DAQA 3LEIA 3ES4A 1JU4A 3TWIA 2GMMA 4JGZC 4CXWA 4BQWA 3ZFFA 1NQDA 3MLJA 1OPOA 4K1ZA 4H2AA 2VMIA 4Q0SA 3AJYA 1HJGA 4MO3M 4PIYA 3CNAA 4D6RA 1S0CA 1RMU1 3GZEA 3JBG2 2FCTA 4W6XA 3ZSEA 2JE9A 2E31A 5F3CA 4LO7A 4CXXA 5FPAA 1ENRA 4JV4A 4B29A 2B45X 2MNGA 1UO9A 3TEZA 1CAUA 2JDNA 4Q0QA 1UXZA 2V5DA 3BCWA 4O61A 1DGWA 4IESA 1RYYA 4B8EA 1F15A 3WF1A 1QNYA 1R1ZA 4Y20A 5FY8A 5FO7B 4KQ7A 1SLAA 3IWZA 3DKQA 4DO0A 2BOJA 2XVLA 4XHBA 2LROA 1QDCA 4FPCA 3GJAA 1VBE1 4Z1VA 1ZRIA 2EIDA 4D6SA 2VH9A 1G6NA 4MGSA 1DGLA 1WMEA 1SLLA 4LO8A 4PF5A 3CJIA 3FUQA 2PHUA 1V6NA 4LUMA 5BNNB 3E5XA 4YARA 4QMAA 3FUOA 4H55A 3LSDA 4R4XA 4F83A 1OQDA 3PVEA 4Z07A 1EV13 2FZ2A 2ARBA 3TNPB 4RS5B 2FDFA 3TN91 4BMEA 5JAXA 2GNTA 2P37A 4RQPA 2RDNA 3FHQA 3POGA 5T52A 3ZXJA 1JZ3A 4IV3A 4D7SA 3U4XA 4U36A 4QX7A 1SCRA 4CEYC 2DYCA 3OF1A 1XE8A 2Y0IA 3WP6A 1A78A 4WZFA 3MGUA 3BOWA 1FX5A 4MXVA 4Q4V1 1W04A 1KXGA 4AL9A 2OPKA 3SMHA 3I3EA 3FHIB 4DRRA 1QQP3 5J98B 4IL7A 4XF1A 3O1OA 4DNYA 2Y33A 2XMLA 1APNA 3B5LB 1Y7BA 3NJXA 4IE7A 4IE0A 3EQEA 2MEV1 3OUHA 5A6QA 1VPHA 2X5IC 4FOQA 2DFCA 3VBRA 2W39A 2LALA 3ORJA 5J96B 2J1RA 4PDWB 3USUA 1SEFA 3PMSA 3IAQA 5A33B 5C8CC 3MIGA 5FZAA 5FY5A 2R043 1GWKA 3WR0A 4DQAA 3SH5A 1LRHA 5FWEA 3VLBB 4QXHA 4C0BA 5F7UA 4NPRA 1CX4A 3NW4A 4RL7A 3FBYA 2WNVB 4P9IA 4XACA 1HB3A 4JC1A 5DDJ1 3H3ZA 3L2HA 1C8M1 1PO21 4CCMA 1RIRA 1ALYA 2GZWA 1GZWB 1NLRA 4TLFA 2O0OA 1JZ6A 4YVWA 1F8VA 3JBG3 3T3YA 1JYIA 3M7AA 1QEXA 2I45A 4YYOA 2DVGA 4KGQA 1O3QA 3WCSA 1NA1B 1V9U2 1DCSA 4XCAA 2XQXA 1K45A 3UT0A 2D97A 4KG0A 3ZN5A 1AR81 5LBBA 3PHMA 2CSGA 3GM8A 2G9FA 3KVAA 2GMEA 4QX0A 1VE0A 1S2BA 3AMNA 3CZJA 4XBQA 3VBOB 2VQ0A 4SLIA 1VMHA 4I0BA 5FZKA 1SMVA 2Z69A 4WM7C 2JJ6A 5HV0A 3AP9A 2C1FA 4FPOB 5FZ9A 3ALQA 1LOCA 3NNMA 3VHPA 4AVBA 2JXAA 3BB6A 1RJ8A 2JKXA 4QHOA 4FFIA 3ZM8A 5ABJB 1XNDA 5T5JA 5FYHA 3UV9A 4YW1A 4XILA 2VNRA 3D0SA 3P1IA 4S2DA 2WABA 4CCDA 3ACGA 3WNNA 1NXMA 4QDQA 4NN0A 4QPGC 5H9QA 1OQEA 5BNNC 1OFSA 2YFUA 3M3OA 2A6ZA 1W90A 3ECQA 2XL7A 1OOPB 3OD0A 5A6YA 5EV7A 1HB2A 1C1LA 2R1BA 3ZN6A 5AC92 4Y24A 3AK0A 2YROA 4WV8A 4AEMA 2BGCA 1HDKA 4K7JA 4DY3A 4HT1T 5I0DA 1QHDA 1VB2A 2ZAHA 5A7QA 1QJY1 4UW6A 4IEXA 2D6OX 3EHKA 3OYWA 3RQ0A 3I3QA 3OSDA 4BIFA 1M4WA 4WZCA 2JG9A 4FQZA 1JXNA 3FHAA 1Q8SA 4JGYB 1RVF1 5FY0A 3KVBA 3VD4A 1DZQA 3SKJE 4KBBA 1WA6X 3LSEA 2A75A 4HPKB 2OVUA 2PHFA 3OG2A 4NROA 2CDOA 5GKAC 4DS0A 3ZDVA 2VXRA 4GD4A 1PNGA 5FPVA 2R0FA 3D0JA 2AH2A 2HYKA 2RDRA 5DAPA 1YCIA 1KFXL 1Q56A 1R091 4BJ0A 1RHI2 5GLWA 5A3PA 1HKDA 2YDEA 5DN2A 1TMF2 2YBPA 4GQ7A 4LEJA 1V00A 5BNQA 4AQ2A 1N1YA 4GA9A 2K46A 2W52A 3WQBA 5LY1A 1J84A 2BTVC 4N8MA 5CA6A 4MOAA 1NLQA 5EJ3A 1JZ4A 1YHFA 3JB4C 4TN7A 1BBT1 3GBFA 1CAXA 2WNVC 2UWCA 4XZPA 3VBHA 3KWVA 2YXSA 4DXTA 4XTMA 5KBFA 2C9AA 2OZ6A 3U14A 1WKYA 3DPRC 5H9SA 4G4FA 3SQOA 2VQUA 4YM2A 4OHVA 1ULCA 5C71A 2X05A 3A0KA 5C8CA 3GZAA 1ZBE2 4UT5A 1TVGA 4FVVA 1HB4A 1V9U3 3RVHA 2Q8EA 1TEIA 5FO8B 2ZGSA 2IXLA 1ENXA 5D8AB 3WDYA 5C9AA 1H6XA 5FTTC 4EN7B 3DKWA 5FXZA 3RSJA 4AI8A 2RMU1 2VMDA 3AVSA 2QQUA 2PHDA 3NRUA 3ON7A 2ZMNA 3VGIA 1SQ4A 2VO5A 2WSUA 5K8SA 2GAUA 1VBB1 1G9BA 1AR91 5FR3A 1O5UA 3UJQA 2WS91 3LA7A 1RMU3 3LEKA 3POYA 1SBDA 2DVDA 5FZ3A 1Q5OA 4RHV2 3FLRA 2E51A 4MV2A 2JE8A 5LEJA 2OA2A 2DVBA 1WMFA 1XPWA 2VCBA 4MADA 4ONUA 2P3JA 2VUJA 4CA9A 1ULFA 4YW5A 5LATA 3IIAA 1LTEA 3OUIA 4HANA 5I8TA 3M1HA 2CDPA 5L9BA 3CF6E 3T2PA 5AC93 2W1SA 2PN5A 4WM7A 4YVSA 4Q29A 4DEQA 3NKTA 4BIOA 1CJDA 2ZEWA 3DYPA 3I7DA 3ILRA 5FZ8A 3V56A 1PO13 4BISA 4AEKA 4C1WA 4A7ZA 4NAMA 1GU3A 5LRSA 1JYVA 1PK6A 5BNPC 2VNGA 2WRAA 4FCAA 1VBE3 3V0AB 4DIQA 1ND2C 5K0UB 1LNSA 3THDA 4JTOA 4CP0A 2WWSA 2ZOEB 3AKQA 4AVVA 1SCSA 4DUXA 1W2NA 3Q9OA 4XFIA 5JOZA 1WGPA 4UFMA 2H0VA 5FCCA 1C1FA 1W6QB 3RI8A 3E6DA 1W8UA 1OA3A 4TYSA 1FT9A 2BNNA 4AVAA 5E8AA 3N4MA 1WLTA 1RHI3 1HXS2 5CFCB 2GALA 1R64A 2VOWA 4DXRA 5G05L 4F7ZA 1TMF3 3HBZA 4DUWA 5LB6A 4UF0A 1K5JA 2CWMA 2Q1ZB 2W95A 3K48A 5J3UA 1RUH2 4CDQC 3O1UA 1HQWA 1CAVB 2ZZJA 1FXZA 1VBC2 4LHNA 2BVBA 2W46A 3AMMA 2E26A 4LTAA 4XVHA 4FPKA 4N43B 5E89A 3M70A 3HQRA 3SH3A 1UN1A 4K21A 4DPNA 3LQCA 3R4DB 5GLTA 1QJEA 2WJSA 1VBA1 2CGPA 2D6KA 2X29A 2D6MA 3KV5A 2VL4A 4GH4B 4TXWA 4B1MA 2DCKA 1H2LA 4HSLA 3F2ZA 5JOYA 4NIAA 3Q8FA 2BP6A 3KT4A 1MACA 1CWPA 1YNAA 1RUG2 2Y8KA 3K75B 3QOPA 4AGGA 4TZDA 2ORXA 5I0UA 4FFHA 3IIIA 2XJRA 3FFZA 1JYNA 3RZHA 1ZZ9A 1NUKA 2OUJA 4HVQA 2ATFA 3PVNA 1R1A1 4V2WA 3V0BA 4QX5A 2GU9A 1XE7A 4MVTA 5CFDA 3DPRA 1RUC2 4LUKA 4QHBA 4Q26A 5A3MA 1RUI1 3HWJA 1W8NA 2YHJA 2ZGOA 2VOTA 5GLVA 4O65A 4YM3A 3GYDA 1PM7A 4NAOA 1UZYA 1YI9A 4RFT0 3K4ZA 3N9PA 3NJZA 4XJ9A 3SC7X 4D3WA 4LK7A 2JDZA 3ELNA 1CQ9A 3KCXA 3ST7A 1ZNPA 1XNKA 1LOAA 4QB1A 1LGCA 3KHBA 5KHIA 2ET7A 4XXAA 5JI7A 1AR83 1U5YA 1S2EA 2B7YA 2WNUB 1YRZA 3NV2A 5A1AA 3WNLA 5G04L 4MLOA 4L9BA 3MO4A 2VCAA 4XFBA 2JG8C 5C4WB 2AZ5A 2V09A 3NNFA 4LKFA 3MYXA 4F8AA 4XDPA 1GICA 4Y1UA 1T6GC 5HXVA 4EYUA 1O8PA 1WCUA 3POFA 4KWUA 4E9KA 3BTYA 2F4PA 5IJRA 3MFCA 3PVBB 1JOJA 1JN2P 3PJYA 3ZXEA 4Q8LA 3QLQA 5IVYA 5JXIA 2H6CA 1XXNA 1S0FA 2D3PA 4Q5OA 1F5JA 2E7TA 4AVCA 2CGNA 1W6OA 1J3QA 4J1XA 4RFRB 1HXS3 4AW7A 4LBQA 4QM8A 4C91A 5FYTA 4XDOA 2HWB1 5D2AA 3VBUB 3POBA 3R0RA 3LFMA 5C3RA 5HBAA 5BNPA 1HRV2 4GULA 2LW8A 3O0WA 5IHRA 1AR62 4ZPIA 2V4VA 1GP4A 1HRI3 1REFA 4AGRA 1UIKA 1DHKB 3RDIA 2VXJA 4ET7A 1FMD1 1VBC3 4CDUB 2Q8DA 1US3A 5FZOB 5ACA1 5I0TA 1WLCA 1SZBA 3J26N 3ZFGB 3NO8A 5E1RA 2GC1A 3IDBB 4BH9A 2PQSA 2W08A 2Y64A 3Q8CA 1I3HA 4Q27A 5I91A 1W8HA 4ES9A 4E4ZA 3I4IA 3H1MA 2WT2A 1DYPA 4XQDA 3ZLIA 1GP5A 5FQ0A 2JIGA 2WLQA 3E97A 4RR3B 1AVBA 4XJAA 3NVCA 1RUG3 2JDYA 4JCKA 3INAA 1BCXA 2J42A 1NLSA 2YV8A 2A1XA 5JLVA 3LD8A 1VIWB 1SLCA 1KDMA 2CYFA 3I8TA 4NIDA 4LXLA 3OTFA 5FYBA 4YM1A 1W3XA 2BBVA 4GMP1 3VD3A 5IAXA 3MUZ1 1H6YA 5F3IA 1W2OA 2PHXA 4W6WA 4XDQA 3H0OA 1YQ8A 3OY8B 4ZKTB 2DUOA 3TEYA 2FMDA 1F31A 2ZGPA 4I01A 3VZKA 2XKOA 2ZEXA 2R32A 4BK5A 5FZIA 1BEV2 4CDXC 2EVXA 3U10A 2JICA 3JQXA 4ISQA 1N3QA 2R072 2XLAA 1WW5A 4K9SA 4QGLA 5HV4A 4GB32 2X10A 2EXIA 5BV6A 1XC6A 4Y26A 3ZFFB 1GP6A 4BLJA 2DCJA 2CV6A 4IV1C 2VVEA 4LULA 1JOBA 5BNOA 1LOFA 2VPVA 2WS93 3WQ0A 5FZHA 2E6VA 3FX3A 4C8DA 4JQTA 3PNAA 3CKHA 2OIIA 4QPWA 4OUSA 2CY6A 1UYPA 2DTWA 3BALA 2HWF2 3KT7A 3HD8B 1DDLA 3VB9A 3ZYGA 2AYHA 2ADEA 2JG8A 2VVFA 4PQQA 2CNAA 4LE3A 2YY1A 4M3CE 4QXKA 4Y20B 1V6JA 1YFUA 4BCUA 5C3QA 1NOVA 4Z92B 1UU5A 4BXFA 1J83A 5F39A 3WG3A 2W9XA 3O1MA 2Q4SA 3D6EA 5IK8A 1DZTA 1K5MA 2XJVA 4E2QA 4C0HA 4L97A 5EP9A 5IK4A 1MPXA 1RJ7A 3IB3A 3WF3A 3RZGA 1PGW1 2UURA 5FP9A 3RJ2X 4Y3OA 1UY1A 5IFPA 4KU8A 5C8WA 2BWAA 2PQQA 4OULA 2XG3A 3EYPA 3A22A 4JKKA 1A8DA 3U0ZA 4PLMA 3ZYFA 3GGLA 1DGRA 2ZGQA 4MHRA 2C0ZA 4Y22A 1QJU1 3CLPA 1PIV1 4B4QA 1JYCA 4CE8A 2P1BA 1NG0A 1B35C 1PGSA 2BGOA 1GKBA 1PZ9A 2RHPA 1C5HA 1WCDJ 1POV1 5A70A 2XBO2 5FZ0A 2G4IA 3QD6A 2FDGA 4GIQA 2UYBA 3JUUA 1JS9A 4I2OA 1W05A 1BHGA 2GC2A 1W8TA 2QE3A 3POSA 4NRQA 4EV0A 1KJRA 4P08A 1IKPA 3HOBA 5FP7A 1GSLA 5CKNA 5HCAA 4QKNA 1B09A 5D1IA 2WYSA 1X50A 1SLTA 4BB3A 5IATA 3VZMA 1SLBA 5KWRA 5FYUA 3VBRB 3ZDSA 3IDAA 3USUB 2HWE1 5EFUA 1DYKA 2EICA 1WW7A 1L7QA 2HEVF 2WWJA 3POWA 1YWKA 1A6CA 2IXIA 2OX0A 4QPIB 4AHXA 5FYSA 2A3WA 2OQ6A 3HBKA 1DYOA 2OW4A 2R073 4LHLA 4P9LA 5IYYA 1ZZBA 1NT0A 3LIHA 4ZS2A 1GZTA 3O0XA 2BFUL 5T55A 4IEZA 2QDRA 3MFAA 3RZKA 3NNLA 1RUI3 1UU6A 3WP4A 4E4SA 4UW3A 1CAWA 1C8NA 2VY0A 3MW3A 3HT2A 4BPZA 4Q4X1 1UPIA 1ST8A 4NHKA 5IVBA 2Y60A 2HWD1 5IVCA 3O1RA 5CYYA 4NIIA 3FC0A 2HWC1 1PHMA 2QQVA 1RXGA 3VBFB 2W1WA 3VKMA 2HWF3 4ES8A 1CPNA 4CU8A 4UFJA 3PVOA 1UZ0A 2BZDA 1MR5A 4CDWC 5F5IA 1MEC2 2VCCA 5LEKA 1OVPA 2VM9A 1OKOA 4P5YA 2CWSA 2A71A 4W4ZA 3T4HB 5JZGA 3CQOA 5GLUA 2JEMA 1JHJA 1GZCA 1LHUA 5FMBA 4AFMA 5DQ0A 2Y0OA 2VZ1A 3J8F1 3MW2A 5JVVA 3VDDB 4A6SA 2EIEA 4EWEA 2AREA 3K46A 1NCQA 3X29B 3W5NA 1AX0A 1KFUL 1S4CA 2VZSA 2BQPA 2R063 3UETA 5FMDA 1AYN1 5A3UA 1UQXA 3ZN6B 5C3PA 2XJQA 4YLZA 1DFQA 4LK6A 5FLIA 1MS5A 3TNQA 4DUVA 5IK7A 3POIA 3HNYM 2R16A 3D4KA 1MQTB 4JRLA 4NPLA 1GOGA 1SPPA 3OYWB 2ZHLA 4NHLA 4XOGA 3AB0A 1BVP1 2W94A 3ABZA 2FDKA 2JG9B 2LM3A 3J7NA 1F4HA 1UMHA 4XZUG 1NCRA 3RRDA 1YIFA 3MW4A 4R9AA 4WM8C 5FMOL 3HN3A 4FBFA 3T08A 1GQPA 5FKCA 1QQP2 4QU1A 1XYOA 1NE6A 5FZFA 2P6HA 2P34A 1XYPA 3WD5A 5JIUA 2GMPA 1ZZ6A 1GQHA 4FAGA 1B35A 2WSVA 3MUY1 4RGAA 3O12A 5L9RA 1Y3TA 4OI4A 2ZACA 4UOJA 4CU7A 2R042 5BPXA 2NMOA 2E7QA 3ZXLA 3CIHA 3Q8BA 4L2NA 1QH6A 4D8MA 4EN6B 5ERLA 2BGPA 2ZGKA 3ZXKA 1HW5A 1OQ1A 2D6PA 4PF1A 1YO8A 3OBAA 3ZVXA 1TME2 1US2A 4S2FA 4XJ8A 1OUXA 1XE0A 1FPN1 3KGLA 3BTZA 5KXBA 2W1UA 4AGVA 4ISRA 4XBLA 4J6GA 4GWJA 3FE5A 4B1LA 2ZGTA 3ZR5A 5FFOC 4MGYE 4R52A 3KMHA 2B9VA 2VUCA 4AHZA 4FSJA 3RMYA 4RSUA 2ZXQA 4XPVA 2UY9A 3PU8A 1WD3A 4HN0A 4XC9A 3WF2A 2GH8A 3ACLA 2WIIB 1MEC3 2VW0A 4OI1A 2BV4A 4XUOA 2VD7A 1W8FA 3N7MA 4HMZA 1LHWA 2Q30A 1UZVA 1OD3A 1JZ2A 1MS8A 4AFDA 3IN9A 3DL3A 1ULDA 2WQ4A 4PQ9A 4AEDB 4AE2A 1H8TA 1IKQA 1H8VA 1QU0A 2BW8A 3I2HA 3KM5A 4ATFA 5GLZA 2WA4A 2Y6GA 4COVA 4YZ1A 2EXJA 5JXJA 4LE4A 2VW1A 4XAAA 5FZGA 2MHFA 1G9AA 2KR2A 3L9JT 1DQ2A 2VTXA 2DV9A 3BU7A 1U5IA 1N1VA 3PDQA 2AENA 4YVSB 4CDWA 2BBAA 2IC1A 5CEHA 1JHNA 3H8RA 2RM21 5FUNA 4E2SA 3S30A 5APAA 5I8YA 3N7KA 3IT8A 3JD72 4FPGA 2VG9A 2ADDA 2PHLA 2QKDA 2ZGMA 4I02A 1PK6B 3ZPOA 1YLLA 1MQTC 4LORA 5FZLA 3VDCA 1V70A 1VLNA 2W2IA 2WN3A 1EPWA 4B3NA 3H8UA 5FZDA 2TNFA 1KJLA 3UKVA 4NIGA 1R082 4P9GA 4PIXA 3S0MA 1RTVA 2HJIA 2YC4A 2KM2A 3PUQA 3B7MA 1GV9A 1WW6A 4A3XA 3ZXDA 1X33A 2VZUA 2CAUA 1WW4A 2PLV1 2VMHA 3N9NA 4IEPA 4XCBA 2NYYA 2XH6A 5F5CA 4MGZE 3MF6A 4NPMA 3MIEA 1BVVA 5FY9A 2XXZA 3PL0A 4JKLA 2WZR3 2W87A 1Y43B 2PAMA 4UF0B 4HK9A 3P3PA 4YPJA 3JXSA 1YYNA 1A3KA 1EYBA 2K9ZA 4QX8A 1O5LA 3DV8A 1POV3 1ODNA 1Z78A 3WNMA 1AX1A 1DQ4A 1WWYA 4LBNA 5GALA 4R8HA 1AR71 1VMJA 4C1XA 1VR3A 1D0GA 1OA4A 1COV1 1RUF1 1TME3 2V4AA 4DY5A 4QU2A 3JU9A 1LAJA 1HIXA 1GNHA 4Z8BA 1ASJ1 3HN1A 2VMEA 5L9VA 3WQ1A 4QQ2A 1YXWA 3SEEA 3AYCA 2YB7A 1VALA 5T54A 3BPSA 1EAH1 4NHXA 5F37A 3R6SA 3PMEA 1GR3A 1STMA 4BA6A 5L36A 1VJ2A 4ZZ8A 5J7MA 2HWE3 1JI6A 4XFHA 1ULGA 1W6PA 1VMFA 3ZXFA 4LITA 5FYCA 1TQ5A 1AJKA 1GFF2 4OYUA 4O9GA 2SBAA 4CP9B 2P3IA 1GNZA 3QCWA 4RA0A 3GHMA 1GBGA 2A73B 4JGZA 2I07B 2Z5WA 5HCBA 4AAPA 5HXMA 1BLZA 4X6QB 4OUMA 5CFDB 1ULPA 2V72A 2WT0A 1UY4A 2P5BA 2XLFA 1LGNA 1QOTA 3LA2A 3NAPB 1UY0A 4LBOA 4X6RB 2G9ZA 2D3RA 2AGSA 1MS4A 3ENRA 3ETPA 4RHV1 4CTEA 3B93A 3ZSLA 2QUOA 1RMU2 2EAAA 2Y34A 2QVSB 4B4PA 4K3UA 4L92A 2CL2A 4PCRA 3N36A 4YM0A 5A32A 3P5BA 1W9SA 3T0BA 4CCOA 5FWJA 3DGTA 4FPLA 2HWC3 3ZKUA 2WDBA 2IZWA 4CUCA 3A0NA 3QACA 3KD4A 4OI0A 4J1WA 4FOVA 1GYKA 4XW3A 4ZS3A 4RS5C 4CUBA 2IFWA 3ACIA 4Q4W1 3JD73 2XDVA 3I2DA 3K3NA 4XQWA 1PO12 1N3OA 5JPMB 1F35A 4XQ4A 4Q0VA 4R9CA 1LGBA 2P3YA 1W6NB 4M3CF 1VBE2 2TBVA 1BK0A 1AYM3 1FNYA 3DUIA 4A45A 1R083 3W5MA 3CO2A 4MXWA 5FPUA 2ZHNA 3MEPA 3AP5A 2JD9A 2UYAA 3WX5A 2A3XA 3BI3A 1IPJA 2WL1A 3MV01 2VTFA 3KSCA 3VDBA 2VUDA 2WFF1 2PHWA 3MLLA 5J36A 2LUWA 3H1YA 5LBFA 4AHYA 2NP0A 1T6BX 1SFPA 2AR6A 5FUPA 4EZHA 1IOAA 1AYN3 3GJBA 2GSYA 4J25A 4D0QA 3TN92 4K6BA 1PVC3 4LOTA 4PDWC 4CEYA 5C3OA 1NZIA 2X8KA 2E32A 1W9FA 2YC0A 2ZHKA 2PHRA 4QX2A 5GJ6A 4YZ2A 5GZDA 4KL1A 3DF0A 1RUD1 1SHWB 4AFCA 4QQHA 4HOOA 2Y6JA 2DUQA 2EIBA 4Q4V2 4AZZA 4QHZA 2QQLA 3LWCA 4XE9A 4DOUA 1J59A 3OGRA 4CCLA 3PU3A 3WSOA 5JCTA 3EB7A 4AI0A 2AEZA 4PI0A 2X5IA 2JDAA 4ASLA 2VMGA 1VRH1 2RS11 2Y38A 5FQ0B 2D5FA 2OS2A 4XF9A 2Q8OA 2BOIA 1DQ5A 3VZLA 1V6IA 5T3NA 3S57A 1KRIA 1NA1C 3JQWA 2P17A 2YU1A 2VZQA 3K77A 5DABA 1HLCA 3D8CA 3WDXA 5F3EA 4AK3A 1VBD1 1DU3D 4XUQA 3D5OA 2ZGUA 3RI9A 1MVEA 3VBOC 2VBDA 4E8DA 2RS31 2NPIA 1OF4A 3B3QE 3FLTA 2CTVA 5KXCA 1DG6A 4S2HA 5CZKA 3THTA 5IVVA 2QDNA 5DDJ2 2GN7A 1C8M2 4KWJA 2X53S 3KQ4B 1Y9QA 4KG8A 4FPFA 3UGHA 3R4UA 3WXPA 5ABJC 3PUHA 1OBNA 4ASKA 3C7FA 4AFBA 4A6OA 3HQUA 2J1VA 3AKRA 3CHXA 1CVNA 3DN7A 2YMZA 3P3NA 3VDAA 4F3JA 2IUWA 3PUSA 1Y9MA 2VZTA 3AM2A 2ZKNA 2ZZQA 4XAEA 2EIGA 5FJHA 2AEYA 2H6BA 3BTXA 3MDPA 4A44A 1OOPC 1AR82 3RWKX 2ZS6B 3VBSB 1QOOA 3PTYA 1BJQA 1J3PA 3IBMA 3IMNA 5EWSA 3P6BA 1JYXA 3PURA 5HI0A 1UU4A 1FOD1 1Z0HA 3WW4A 4TTGA 4ZONA 3U4SA 1ZBA1 1XBFA 3TB0A 3WG2A 5A7WA 3THPA 3URFA 1JUHA 2FCUA 1U5ZA 3WDUA 5BNOB 2J1TA 4AQSA 1LB2A 5DZFA 1SBEA 2IXKA 4V1PA 2Y6FA 4JGYC 4QPGA 4ARYA 3RG0A 5BNNA 3ZMNA 4B7KA 4LBQD 5FOBB 1Y9GA 5FPZA 3HAGA 3ETQA 2XQRA 3AP6A 3I59A 4GKXA 1EP0A 1QMJA 1YC61 3APBA 3FWEA 4AR2A 2FHRA 3AFKA 1AL21 5L7OB 3MF9A 3FZ3A 3WHTA 3LFIA 2ZJCA 4P9XA 3CZUA 2RS51 4RS5A 5SV5A 4A4AA 1AR61 1O3TA 1SFYA 3RWNA 1CESA 4CPBA 3TN93 3BN6A 2NN8A 2VNOA 2J1SA 4M3CB 4KWLA 4NE9A 4UXAA 1HRI2 4OFGA 1K5MB 2GC3A 3UYJA 5LCWL 3AKPA 3N7LA 5KHJA 3HVDA 1RL3A 4AVTA 1K42A 2WA3A 5E16A 2WT1A 4Q4V3 5FIXA 1X8MA 1XSQA 3QH6A 2R0HA 1LENA 5JI9A 1YFWA 1WLDA 2RR11 2WZPP 2F17A 2C24A 4EN0A 3TEXA 2PLV3 4H14A 4QM9A 2MEV3 1MZEA 2VR4A 5FZBA 5HCHA 4PDWA 1BYHA 5A33A 4Y22B 1Z7S1 1QJX1 3H42B 3VHOA 3VKLA 3ZN4A 5M0TA 2VU9A 1O6UA 3SISA 5D8AC 3HEIA 4BQ3A 1GWLA 1CIYA 3I2FA 2WNVA 4BQYA 4P02B 4FP2A 3IPVB 3ZYIB 1TE1B 2PYTA 1LODA 1BBT2 2HEWF 1L7LA 3OPZA 2WFPA 3HJRA 1OKQA 5DDJ3 3ME2A 3SEPA 1C8M3 1PO23 2VZVA 4WBBA 2D98A 1WBLA 2WQ8A 1GZ9A 5FO9B 5F6LB 1KITA 4YG0A 4D69A 2WKKA 1LCLA 1JZ8A 5FAXA 1EAH3 1OPMA 4LKSA 5ANQA 1JZ7A 2Q5TA 3KGZA 4RN5A 1XJAA 1W9YA 3A7QA 4MYEA 4OMDA 4P9WA 5A7OA 4Y1YA 1PGL2 2OUHA 4NUBA 1F9KA 1IG3A 4BM8A 2DUPA 1S0IA 1GQGA 3VBOA 4GB31 1ZVFA 2RMU2 5DG2A 3ZYJB 3H3LA 2XB6C 3RYKA 4JTNA 1ZREA 2YYOA 3F95A 5LBCA 3U75A 1POV0 2BJSA 3N9MA 3BOPA 1ND3B 2ERFA 1UIJA 4NIHA 1ZA7A 5K0UC 3G7DA 1OF3A 1QY4A 1VBB2 2WNOA 1AR92 4MH0E 3WNKA 2AUYA 4CU6A 2F6BA 4UI9L 3I2IA 2WS92 4Y5SA 1ZYBA 3WUDA 3AYEA 2XLGA 1RXFA 3S5QA 5CG9A 1YJKA 1MS3A 1LU2A 1RUE1 1OOPA 3E5UA 1ZRDA 5F9TA 4HFSA 1PZ8A 4N53B 1CX1A 5I93A 1RUNA 2ZEZA 5FDBA 5CFCC 4NJ4A 4LBKA 1AZDA 3C7OA 4LNVA 5FY7A 1AXKA 1NY71 3G6JB 4Q4W3 4XURA 4CCCA 4CUAA 4FPEA 1ND2A 4OI2A 4P00B 4YFWA 1QJY3 3ZSJA 4XF0A 2WBKA 3D82A 3UGGA 1OHFA 4AQ6A 1Q8QA 2BUKA 2FBEA 5JZGB 1MS9A 1W03A 3AMHA 4P9JA 4HKWA 2DU0A 3ZFEB 3M4FA 2K2SA 2D5HA 2ZX4A 1RVF3 4HPKA 4E4DX 4N43C 4LKEA 5KHHA 1NCQB 1V6MA 4CEWB 2GP3A 1O59A 4CUGA 4MGIE 3IM0A 2WLPA 1O91A 1XNCA 4YGDA 3ACFA 3V65A 5H9PA 4GH4C 1F4AA 1R093 2BRTA 1LESA 4XFFA 5CIRA 4COWA 5JOWA 5F2SA 2JX9A 1LECA 2YGMA 1L7RA 2JENA 4GXLA 4META 5JOXA 2XBO1 4M0NA 1Q3EA 4CDQA 1SDDB 4LJHA 5B4NA 1ZRCA 5FP3A 2R7EB 2I74A 4FXKB 5K4LA 1NCRB 1RUD3 2C26A 1KD7A 3PTRB 3MBWA 3MIDA 2FD8A 1BBT3 4LPLA 2P4EA 3KV4A 1N47A 5LZ6A 4JZRA 1QXPA 1YEWA 3N9QA 1PX4A 3TRSB 3AP7A 1DIWA 2DVFA 3GBGA 4Y4YA 1ACCA 3T0AA 2ENRA 4RYDA 2A7AA 3WP3A 3ZR6A 2E33A 1AL0G 1VBA2 3LDKA 3MIFA 2RS13 5FZ7A 1QXRA 2A3YA 2D6NA 5LK5A 5FV3A 3BGAA 3B01A 5GZCA 5KHGA 1FV2A 3H7JA 2O14A 4XMAA 5JWPA 2FQPA 1EY2A 5FP8A 5BY5A 2BPA2 3B02A 1CN1A 2WNUC 2D43A 2RMU3 1R1A2 3MIHA 4L0PA 5F2WA 1UKGA 5C4WC 4CCEA 3USSA 2VMFA 1W3VA 1CR7A 4BQ1A 2DFBA 4LIUA 2XUMA 1RUI2 4Q4Y1 5AVAA 4BXSV 1VBB3 2VCMA 1AR93 2J1UA 4Y5TA 5IWFA 2OXBA 3VZJA 3VZOA 2GN3A 4RGKA 1WCQA 3LIGA 2JB8A 3GXUA 3UNPA 4ORFA 2FZ1A 1CAUB 2B5HA 1QF3A 3I2GA 3LPFA 1QGLA 3MZHA 2VNVA 3LPGA 2ARCA 4JKMA 3AL6A 2VC9A 3S7IA 3VBUC 4UFIA 3M8LA 1D4M1 4FI9A 4OZXA 4YW3A 2YFZA 2V5YA 3RZJA 1IS4A 5K0UA 4AAXA 2VZ3A 5D21A 4S2GA 3N3HA 3AX4A 4HZFA 1MZ6A 1H2NA 1ZBA3 4I3PA 3CJIB 4CDUC 1NAEA 5F32A 5FZCA 1H8TB 2QTWB 4KBZA 1YQ2A 5LWBA 2E63A 4IGOA 3WG1A 3ZFGC 2FDHA 1J1LA 4Y1XA 3LB9A 4M4PA 4CZSA 1EV11 4COYA 4AQTA 3WG4A 1J1TA 2QBXA 1S0EA 1QKQA 2DBIA 1F2NA 2R062 1W6MA 5DAXA 5CFCA 3WW3A 2BNOA 2ZAAA 2ZGRA 4I30A 4OQ9A 4BQ5A 1XRUA 2HWB2 3AMPA 4RR3C 2VMCA 4RQPB 1HJFA 4UYBA 5DUXA 3ZIXA 4KNCA 4IV3B 4DFSA 5F1RA 5F5QA 3HMYA 4FOWA 3WW2A 4LLFA 1XNBA 2VOVA 5KC6A 2I2SA 1AXZA 2Y6LA 4Y5Z0 3WT3A 2FDJA 4OHWA 1RUJ1 1UZZA 5C5UA 4Z2WA 2XJSA 3S5AA 2QZ2A 4CP1A 5ACA2 3VN4A 3B9IA 3N7JA 1LULA 4INDA 4GH4A 2VVDA 3PUAA 3QH7A 1VBA3 2DU1A 2IVJA 3LEMA 3U11A 1AHSA 1C28A 3U07A 5FBZA 5BYNA 2DVAA 1JYTA 2IXHA 4QPYA 2RG4A 3CU7A 5JXHA 4YZ5A 5LA1A 2N7GA 1Z7S3 1UAIA 5J37A 1QJX3 1PZ7A 2EXKA 3KV9A 1LR5A 4AF9A 2VOXA 2VJXA 3DYOA 1H4GA 4OHZA 5AFBA 1RB8G 2ZA9A 4DXSA 5A80A 3T1LA 1KDKA 4XFAA 1R1A3 4IW3A 4LO6B 3T4VA 4ZU7A 2GNDA 1W0PA 2IFRA 4Q1PA 5I8SA 2RVAA 2WO3A 3B9CA 5DAVA 5CVRA 4TSVA 3LAGA 4QXBA 3ZFFC 4LT5A 4IQPA 3JBG1 2JE7A 5FOJB 2DCTA 3OBRA 5DUUA 2KD7A 2BDRA 2Z42A 3A21A 3BODA 4HK8A 4YVWB 5DPNA 5CISA 5AFEA 1A34A 3RYRA 1I5PA 4MZUA 3GALA 4DINB 4TLGA 1WLWA 4YGEA 3OBZA 4YGCA 4K8FA 4CDXA 5LK7B 3VHRA 1WD4A 4IEUA 4XJUA 1IZ3A 3ITQA 3FLPA 1PMJX 1T2XA 1OLQA 1X9TA 3IZOA 4NVPA 5LA0A 5C3SA 5C4WA 5K9YA 3NQHA 2PAEA 4N9IA 4HVRA 4OVEA 4IV1A 2R1DA 3HNBM 1N1SA 2XJTA 4HSJA 1U5XA 2PXJA 4BQ4A 1FI2A 1DF0A 4AI2A 3O1VA 1X82A 1ZM1A 4WVMA 1ZX5A 4YZ3A 4LLOA 1DLLA 5KR7A 3BIWE 4IEOA 3BPZA 2VOKA 4OHYA 4AHWA 1D2SA 2XHKA 1G8WA 1RUE3 1PMIA 3OBTA 2L9LA 5I0SA 2NZ9A 3AC0A 5EYYA 3L2YA 3QBQA 4FPJA 4LQRA 4AI9A 4IDZA 4YW2A 3UJOA 2OT7A 1JH5A 2ORZA 2JDUA 1W2AX 2HWB3 3A4UA 4H7LA 4HKOA 3HQXA 4JRAA 4UBGA 4IV3C 1HV1A 1TZOA 2Q1MA 1OVSA 2Z79A 4CDUA 2VAUA 1IGOA 2WINB 3SCHA 5JR2A 2ZTNA 5FZOA 1FMD3 4JDNA 4MXWB 2EALA 4X8PA 3VKOA 1PGW2 2ZGNA 3VL8A 5ACA3 2TUNA 4UFKA 3K3OA 1BMV2 4JQRA 3VV1A 2DF7A 2ZMLA 3TYJA 3DXTA 1PMHX 1OXCA 4NRPA 4Q0UA 1VB4A 3JB8A 5FPBA 3WINE 3OD4A 5CU1A 3N9LA 3VBRC 5GZGA 2WZR2 2Q0AA 2WN2A 3AJZA 4HKLA 1PIV2 3IDEA 2G9GA 4CEYB 4CCJA 1I1EA 1LOBA 2QQKA 1AX2A 1AF9A 3EBRA 1C57A 3GCWA 1OLMA 4QPIC 1X8EA 1E5IA 4HG6B 2WO1A 4ZXEA 2QJVA 2BNMA 4PLOA 4IE4A 1CZVA 2RV9A 1O4ZA 3WNXA 1CAXB 2W5FA 4G9SB 3VBHB 4JHTA 4GMP3 4LMFA 4D7TA 1UYYA 4K8RB 1H2MA 4E2GA 2W0XA 4Y1ZA 4Z82A 1HN1A 4E8CA 4KH9A 5FK7A 4QDRA 3VZNA 3OY8A 1V9U1 3AYDA 2QNKA 5C8CB 5FK8A 3AKSA 2BERA 2GH2A 4HXCA 2ZHMA 5DXDA 5E88A 2HWE2 1UCXA 3UKNA 4NO4A 4XYXA 3VBFC 4NWVA 1M06G 5B4XA 3GZUC 1W9TA 2O8OA 4XFCA 5C9AB 2VZPA 2C9KA 4EROA 4X8NA 2DDUA 2J1AA 3T0DA 4K40A 1L3JA 1I9RA 5F3GA 5FZ1A 4BZ4A 4MX3A 4OHXA 3B00A 2B4KA 1CPMA 3WDWA 1G9DA 2TEPA 2XJUA 1S55A 2WNEA 4Q4Y3 2XUEA 5GZFA 3ZX7A 5JMOA 2Z4FA 2W1QA 4NRMA 3WDVA 2SLIA 2YC2A 1BKZA 2YBKA 2VBPA 4Q4X2 1NQJA 2RJ2A 4OZOA 1CGPA 1SG3A 2FMYA 3VDDC 4QXCA 1ZZ8A 2HWD2 2D6LX 1CZTA 1DZRA 2ZPXA 2JDKA 3M2MA 3KV6A 2HWC2 2VZRA 1YJLA 2QQIA 1NE4A 4CRQA 1U0AA 5AC91 1Q8OA 3U1XA 4BMBA 1H0BA 3T09A 4WM7B 1PO11 4YGBA 1YQ6A 2VBBA 4YW7A 1HV0A 1CZSA 4KMQA 1FV3A 3WLUA 1IG0A 3BVCA 5EQUA 1D4M3 3RGBA 1Y4WA 4LBMA 4A41A 5IUQA 1E5SA 1UNBA 1EPZA 4COUA 5A3TA 4IEYA 4KI5M 1AYM2 4XJWA 5LASA 5A7WB 2JG9C 3SNMA 1K3IA 1IS3A 4ITCA 3H50A 3ZKYA 3ZSKA 4LIVA 4QPGB 4YW6A 3J8F2 1JZ5A 2PFWA 1D4VB 3W58A 4TWTA 1VAMA 1OC1A 2D40A 3I59B 3ASIA 1G9FA 2JWPA 1RHI1 4HVOA 1JTZX 3KCCA 1GLHA 4RGGA 1Q43A 2A6WA 2YG0A 1U12A 1TMF1 4GALA 4OLLA 2Q8CA 4KWKA 5L73A 1IHMA 4EWAA 5CBLA 1AYN2 4PHZA 3JZVA 4Y1VA 4QX1A 3WEZA 4XF3A 1QJU3 1PIV3 1NKGA 3TOJA 1PVC2 4MGQA 4EWDA 1C5IA 3AVRA 3LA3A 3RZZA 4ZY9A 1CJPA 2Z2SB 1QIQA 3GNEA 4BOWA 3OPTA 2OYZA 4LR4A 4OQ8A 3E1F1 4K1YA 2G19A 3E6BA 1FYUA 3CDZB 1VAKA 1RUJ3 1UOGA 4WM8A 3SITA 2EF6A 3VBHC 1S0JA 2FCVA 3MPBA 3OB8A 1HQLA 4UFLA 3W20A 2E53A 5FKBA 5KXEA 4YFZA 1BK1A 1XQNA 1ZBE1 2R6QA 4N9HA 1OUSA 3O1TA 4BLIA 4HETA 1MVQA 3WV6A 3CL1A 1F5FA 3MPPG 4HN1A 2ETEA 4QPIA 3LF7A 3WY6A 2AACA 4C90A 1YI7A 5L19A 2UWBA 5ANNA 4M00A 2O1QA 4L11A 2K0GA 3ZIWA 2ARAA 5F8PA 4GKYA 5C9AC 3MIBA 3NNJA 4LKDA 1LHNA 3FN9A 1WUVA 3VKFC 3V0BB 2RJKA 3GHNA 3NV3A 1MZFA 1WCKA 5LA9A 2ES3A 2IWGB 2IXCA 3DPRB 3D3AA 3LGRA 3WNOA 3HNMA 3N35A 2ZBJA 1IPSA 4YZ4A 4FOYA 2WO7A 2J7MA 3K51A 1FPN2 5JMCA 4Q4X3 4UWDA 1GMMA 1GNYA 4CSWA 2VULA 4NOTA 1X7NA 5DUVA 4AEDC 3ES1A 2HWD3 1QDOA 3KT1A 4IGPA 3VBFA 1OFNA 2G1MA 4OMCA 4XUNA 5I0RA 5IW0A 1EUUA 4AVSA 2P2KA 1W0NA 5DZEA 4URTA 4A2UA 2JDHA 4P14A 5CNAA 1S2KA 1DLCA 5CKMA 4N7IA 1MZ5A 1REEA 4YVSC 1YFXA 5FZ6A 3AYAA 4EE2A 1JMUB 2W91A 1O4YA 2DURA 3I97A 2W92A 3POJA 3VUOA 1H9WA 4UBHA 1PK6C 3AZZA 3ILNA 1NXD1 3WUCA 1REDA 3O0VA 4LO4B 4XUTA 3SHRA 5FYZA 4AOCA 3SKVA 3VDDA 5A3WA 4PI2A 2ZX3A 5FZMA 3EJKA 1OH3A 3GZTB 3J8F3 3J7HA 4XXPA 3WVJA 3NNGA 3H8OA 2P6CA 3FMGA 3GCXA 1RGSA 3OOXA 4G3YC 2FDIA 3VL9A 5A1LA 1DGRN 1HXS1 1QH7A 1D2QA 2O8QA 4CPBD 5KHKA 1W6OB 1S1AA 5SV8A 3TAYA 1DQ1A 4AI1A 3HPNA 4SBVA 4LBQB 4FFGA 5FRAA 1ZA4A 2PAKA 2ZX0A 3ZXGA 3KS7A 4B7EA 2GDFA 4MG2A 3H8XA 4XUPA 2EA7A 4H7MA 1UW8A 3MICA 1HRI1 5BNPB 1MQTA 2A6VA 2JECA 2JDPA 2RM22 3J7MA 5T50A 1ND2B 2ZEYA 1RUH1 3FBMA 4GJYA 5CG8A 3LZZA 4R9BA 1VBC1 3E5QA 3B69A 5KXDA 3MHZA 5K7PA 4WVZA 3SCFA 3LKJA 1IS5A 4AI3A 4PLNA 1QOSA 4OCTA 4XIOA 1LEMA 3TEWA 2YBSA 4R9DA 1DBNA 1IQDC 2WYFA 5JR7B 2PHTA 2B46X 1LOEA 1UF2C 4Q1RA 5FY4A 2PLV2 5IAVA 2MEV2 4QT6A 4AEJA 1RUG1 2NQYA 3WF0A 3OGVA 2XWBB 2BFUS 1TG7A 2ARXA 3THCA 3NV4A 2VE1A 2B9UA 4CDQB 1DQ0A 1WMXA 2W68A 1WBFA 1W39A 2AC1A 4WVWA 4D6QA 4BHPA 5FP4A 1RUC1 2VGDA 4URAA 4DZGA 1O7FA 2ZGLA 5A3NA 1AR72 5FZ4A 3EMRA 5CFDC 4W50A 3K2OA 3NAPC 1COV2 1RUF2 3DXUA 5AVPA 1PO22 2HH9A 2R30A 2E7AA 1ASJ2 3UK9A 1LJ7A 4PBPA 1FPN3 3RYPA 2RDQA 1V6KA 2ZX1A 4KGGA 3ZYRA 2VQAA 1PGL1 2XHNA 4EZ4A 1EAH2 5IVJA 1ODMA 2IVIB 4YWAA 4IXLA 2DCZA 4Q2FA 3NMBA 3LOIA 4QKBA 4YSFA 5KC5A 2WUHA 5LY2A 5A3LA 3UL2A 4O9EA 3MV11 4P5HA 3FJSA 2XL9A 4AFAA 3ATGA 3WNPA 4PT6A 3N9OA 1SACA 4GAZA 1HX6A 2KA3A 2A70A 3V64A 5FXXA 4FTSA 1IS6A 3IKWA 2D44A 3PJQA 3Q8EA 4AEDA 3OGGA 2JB4A 3O5SA 3PIJA 3W21A 2YZ4A 1LU1A 4GMP0 4CYDA 3SH4A 3E6CC 1H1MA 1W0OA 5FUIA 2HKXA 2E9QA 4YG6A 1S0GA 1FNZA 2CHHA 4QKFA 5FYVA 5A7PA 4NMIA 3FFQA 1UPSA 1RITA 3OJBA 5ISLA 2X09A 2JG8B 3DCQA 3NSTA 1HRV1 3C7GA 5FJKA 1QWRA 3UESA 4L8QA 5FMOS 3C7HA 2RM23 3RS6A 1W8WA 4Q4W2 5BXXA 5JSOA 4NWWA 3T1MA 2PTMA 5EJZB 3O1PA 1OT5A 1QJY2 1XNTA 3PIGA 3PUIA 5E6HA 2XKPA 4QAWA 3VD9A 4FFFA 3I3DA 3ACHA 4I0WB 4JX0A 2DCYA 4QD2A 5EXOA 1H4HA 5LA2A 1W99A 1O8SA 1CD3G 2BEOA 5FYMA 4CXYA 4A42A 1RVF2 4IERA 4LBLA 1SDWA 3H9AA 3RFRA 4IE5A 3WP5A 5A7NA 3RMXA 4W65A 3S6PA 1O3SA 1UD1A 5T5PA 1W6MB 2WFF2 4LHSA 2B42B 1SBFA 3I2OA 1C3HA 1R092 1BZWA 3AP4A 1V6OA 4ZU4A 5FMCA 5FXVA 3U37A 1W8OA 2YGLA 1UY2A 2OPWA 4LO5B 2J1EA 2XVGA 1FATA 2D93A 2VZOA 3AFGA 4FPYA 4M4RA 4KU7A 3I54A 4GWNA 5FXWA 3UKTA 4BU2A 2XVKA 4EJRA 3LOBA 1XOYA 3EO6A 3NL1A 4H3WA 1MS1A 4OUEA 1DP0A 1AR73 1RUD2 3ROUA 4GWMA 4BWOA 2YUEA 4CP2A 5CAZA 1COV3 1RUF3 1GZWA 5DZGA 2BWCA 1ASJ3 4QKDA 4DMIA 1BQPA 1KQRA 4BK4A 3POEA 2UU8A 1ZBE3 4CCKA 4IEQA 1VRH2 2RS12 5J09A 1NA1A 2RDSA 2RE9A 4I3GA 1BEV1 1YFYA 4XJZA 1KS4A 1OSGA 1D7PM 2R071 4CP9A 3T2QA 4NR1A 1VBD2 3VBSC 4R4ZA 3IAPA 2NLRA 4QWNA 1GOHA 3KCYA 3NAPA 3WF4A 4O7XA 4PIZA 1DGWX 2RS32 5JSPA 3IDCB 4DEVA 4QQOA 3R05A 4LA3A 3ZXAC 5H9RA 1UOJA 2OKXA 3BKZA 3ZOIA 5ABJA 1CAWB 2XGXA 5FYYA 4RHV3 1LKNA 3WOGA 1OURA 3J9SA 1LOFC 4YG3A 5BNOC 3EXUA 5EYXA 5A7SA 1GANA 1ULOA 4AXOA 3H3UA 2HWF1 1LOGA 4CDXB 3I2KA 5FPXA 5IFTA 2UY8A 3OEBA 2HYXA 2CAVA 5L7OC 5EIYB 5EPAA 2DBNA 2V73A 1JUIA 4UFHA 2WAAA 3AZXA 4XEZA 2PELA 4IV1B 4EN8B 1J3RA 1QJZA 2Y6HA 5EHDA 1W6NA 2VECA 4IEWA 3J7LA 1PM4A 1UL9A 1VAVA 1XNAA 1FOD2 2YPJA 5A6XA 2F4LA 1K5MC 4D94A 2J22A 2MPFA 3RZMA 1JOPA 3RNSA 4JGYA 1YUDA 1ZBA2 2XOMA 4HBNA 2LTNA 4FO9A 4WVMB 3WHUA 3CMGA 4AWDA 4DB5A 3OGSA 3BU0A 5T5LA 2B39A 2IXJA 1O4TA 1S0BA 3H7YA 3OUJA 4FT8A 5JUVA 1Q8PA 2R061 4FAHA 5DUWA 1HQNA 3PLQA 5HPOA 3KB5A 1V6LA 3WQ7A 4ARXA 2EAKA 2WFF3 4M0HA 3WDTA 1AL22 2OQ7A 1J58A 3KQRA 4GJZA 5A6ZA 2RS52 5J1XA 3W59A 1OLRA 1TNFA 3OPWA 2JD4A 3MLKA 1JBCA 1WA4A 1RUH3 1H1AA 3ZO0B 5JXGA 1SPPB 3DYMA 5JIAA 5C6CA 1AJOA 1HN0A 2HBUA 3CEWA 1W06A 5FBJA 4CVUA 1O3RA 3NKGA 4Q0PA 3AZVA 4JDMA 1LHOA 2RR12 4JHZA 3BUCA 4QB2A 1W8ZA 2JIJA 2GNBA 2VW2A 1VRH3 3BYWA 4PJYA 3LDBA 1ZRRA 2BU9A 4IE6A 1B35B 3K4DA 2CU5A 3WW1A 1N1TA 1GOFA 1VP6A 3WZ1A 1Z7S2 4FXGB 5JDBA 1QJX2 5D8AA 4NHMA 3BTAA 4M01A 1KS5A 3CJXA 1H30A 2QQJA 3AZYA 3GDBA 4XFGA 5DAWA 3SLIA 3IMMA 1VBD3 1YQCA 2YU2A 2GNMA 3W9AA 4DRVA 4DXZA 2GC0A 1ULEA 3SXWA 4LBJA 1RUC3 3KZ4C 2RS33 2XWJB 2W47A 2D3SA 3ZSMA 3FL7A 5FREA 1V0AA 4AYUA 3M3EA 2QQWA 1ND3C 1I6XA 3AMQA 5CKQA 3DEMA 5IVEA 3LEGA 4FPHA 2QZ3A 2ID4A 1RC6A 1S0DA 5CADA 3KHCA 2A5ZA 3H1WA 4W6YA 3C3VA 2WR9A 2D7FA 1OA2A 4MGKE 2WQZC 1DQ6A 4GZ9A 4I0AA 3KF5A 2EXHA 4JDOA 1A8MA 4N53C 4XMIA 5GZEA 3VBSA 3T2TA 4Z2AA 1MEC1 3NJYA 3O7OA 1LHVA 2WC2A 4BDVB 4QGNA 2XONA 4UW4A 2XR4A 3M3QA 1UOBA 2PA7A 3OEAA 1AXYA 3AKTA 3AL5A 4IETA 4BQXA 3V0AA 3KLSA 1FOD3 4BQ2A 4V2VA 3T30A 3TBDA 2ZX2A 3C2UA 1W2UA 5JZGC 4N90A 4NHYA 4QB6A 1W28A 1E57A 5FY1A 3ZFEC 3U78A 4WVVA 4BYYA 1JW6A 5C33A 1WMDA 4K20A 2KXLA 4E27A 1W6QA 2WAOA 3LE0A 4XBNA 1QNWA 1NCQC 2ZKLA 3O14A 1OMIA 3R4SA 1RUE2 4GWIA 1KGYA 1UOFA 4L99A 4EQVA 5F5AA 4CEWC 3ILFA 5L7OA 5DMYA 1AL23 1JODA 1ZZ7A 4ZZ5A 1G9CA 4FP3A 3HT1A 4CDWB 1XYNA 2RS53 1HRV3 1AR63 2ZMKA 5T5OA 2HBTA 3VHNA 4M3CA 5GM0A 3C8XA 5EZWA 5A3OA 1RUOA 4QQPA 3KF3A 4D7YA 4MUVA 4B4RA 1NY72 1VRBA 3VKNA 4IUGA 1E5RA 5JSRA 3GF6A 1CAVA 1OI6A 1BMV1 4CCNA 1FMD2 3S7EA 4N43A 4XHXA 4XABA 3I2JA 1NCRC 5F6KA 1QQP1 3I3BA 2NM1A 1PVXA 2WZ8A 5LW9A 1UMZA 4MHUA 4JAAA 1C4RA 1BXHA 2RR13 4ATEA 1H2KA 4QDSA 1G86A 5HCFA 2C4XA 1JYWA 2WZR1 3AXDA 2H0BA 1URXA 5FLJA 1XU1A 1CIWA 2GP5A 2JDMA 4QGMA 2R041 3CBNA 5C7GA 4N7UA 2RJLA 3LDRA 5IK5A 3ZYPA 5FPLA 1HB1A
chains in the Genus database with same CATH topology
1XU2A 1Q8VA 2BYVE 3AXEA 3GBWA 5B2GB 4XETA 4RD7A 3IPVA 1ENSA 4WM8B 1TME1 1UKRA 2DTYA 2OZJA 3RPQA 4HL0A 3AZWA 4PBOA 4LHKA 4EN9B 4JVAA 1OD5A 1AUYA 4ZXKA 2HEYF 2B8MA 5TSWA 1BEV3 4XF4A 4QQLA 1W6PB 2Y26A 3ZMOA 2WNUA 1IQAA 4XTPA 5LRRA 3HIFA 1ENQA 4GB33 4JGZB 1UX6A 3M3IA 1IPKA 2ILMA 1ND3A 2QCSB 5JPNB 5BUVA 4COZA 4Q4Y2 1TNRA 4FQ4A 2XPJA 2VUAA 4MSVA 3CJIC 1H8TC 5A32B 4HLTA 2ZABA 4IEVA 3HR9A 1YIPA 2UWAA 4N53A 3WCRA 1SLIA 3ZPYA 3B94A 1ZRFA 1PNFA 3VBUA 3JD71 2C5DA 4ZU5A 2A6YA 4LA2A 1H1IA 1SFNA 4RQPC 2BVVA 1D4M2 4A7KA 2QFEA 1AYM1 3J4UH 2DWRA 1FAYA 1R081 2XJPA 4UW5A 4YRDA 3OGJA 3ZFEA 3LCPA 3ZFGA 2R49A 1LEDA 1NZCA 1X36A 3SCGA 4CEWA 2JKBA 1RINA 1CONA 1EV12 1ZZCA 2A6XA 4XIKA 2CGOA 4YNIA 1QXJA 5IT6A 5CB7A 5DG1A 1H9PA 2ZCWA 4P9YA 4RR3A 4AG4A 1PVC1 4BE3A 1G7YA 4U2AA 1QJU2 5FLHA 2XBO3 1N3PA 1D0HA 3MI8A 4ASMB 2P3KA 1RUJ2 3RJRA 1ONAA 4A7YA 4FTBA 1NYWA 2X5IB 2NMNA 4Q8KA 1MS0A 4YW4A 4YVWC 4FTEA 2ET1A 3NV1A 3NWKA 1WCSA 5J48A 3OCPA 3M3CA 4I09A 3JCIA 1I5ZA 3ES4A 3TWIA 2GMMA 4JGZC 3ZFFA 1NQDA 3MLJA 1OPOA 4K1ZA 2VMIA 4Q0SA 3AJYA 4PIYA 3CNAA 1S0CA 1RMU1 3JBG2 3ZSEA 4W6XA 2JE9A 4LO7A 1ENRA 4JV4A 4B29A 2B45X 2MNGA 1CAUA 4Q0QA 4E2SA 3BCWA 4B8EA 1DGWA 4IESA 1QNYA 1R1ZA 4Y20A 5FO7B 4KQ7A 1SLAA 3IWZA 4XHBA 2XVLA 1QDCA 4FPCA 1VBE1 4Z1VA 2VH9A 1G6NA 4PF5A 1DGLA 1WMEA 1SLLA 4LO8A 3CJIA 3FUQA 2PHUA 1V6NA 4LUMA 5BNNB 3E5XA 4YARA 4QMAA 3FUOA 4H55A 3LSDA 4R4XA 4F83A 1OQDA 3PVEA 4Z07A 1EV13 2FZ2A 2ARBA 3TNPB 4RS5B 3TN91 4BMEA 5JAXA 2GNTA 2P37A 4RQPA 3ZXJA 5T52A 4IV3A 4D7SA 3U4XA 4U36A 1SCRA 4CEYC 2DYCA 3OF1A 1XE8A 2Y0IA 3WP6A 1A78A 4WZFA 3MGUA 3BOWA 1FX5A 4MXVA 4Q4V1 4DRRA 1KXGA 2OPKA 3SMHA 3FHIB 1QQP3 5J98B 4IL7A 4XF1A 4DNYA 1APNA 3B5LB 1Y7BA 3EQEA 2MEV1 2X5IC 4FOQA 2DFCA 3VBRA 2W39A 2LALA 5J96B 4PDWB 3USUA 1SEFA 3PMSA 5A33B 5C8CC 3MIGA 2R043 3WR0A 4DQAA 3SH5A 1LRHA 3VLBB 4C0BA 4NPRA 1CX4A 3NW4A 4RL7A 3FBYA 2WNVB 4P9IA 4JC1A 5DDJ1 3H3ZA 3L2HA 1C8M1 1PO21 1RIRA 1ALYA 2GZWA 1GZWB 1NLRA 4TLFA 2O0OA 4YVWA 1F8VA 3JBG3 1JYIA 3M7AA 2I45A 4YYOA 2DVGA 4KGQA 1O3QA 3WCSA 1NA1B 1V9U2 2D97A 4KG0A 3ZN5A 1AR81 3PHMA 2G9FA 2GMEA 4XBQA 1S2BA 3AMNA 3VBOB 2VQ0A 4SLIA 4I0BA 1SMVA 2Z69A 4WM7C 2JJ6A 3AP9A 2C1FA 4FPOB 3ALQA 1LOCA 3VHPA 4AVBA 2JXAA 3BB6A 1RJ8A 5ABJB 1XNDA 5T5JA 3UV9A 4YW1A 4XILA 2VNRA 3D0SA 4S2DA 1NXMA 4NN0A 4QPGC 5H9QA 1OQEA 5BNNC 1OFSA 3M3OA 2A6ZA 3ECQA 2XL7A 1OOPB 3OD0A 5EV7A 1C1LA 2R1BA 3ZN6A 5AC92 4Y24A 3AK0A 2YROA 4WV8A 4AEMA 2BGCA 1HDKA 4K7JA 4DY3A 4HT1T 1QHDA 1VB2A 2ZAHA 1QJY1 4UW6A 4IEXA 2D6OX 3EHKA 3OYWA 3RQ0A 4BIFA 1M4WA 4WZCA 2JG9A 4FQZA 1JXNA 1Q8SA 4JGYB 1RVF1 1DZQA 4KBBA 3LSEA 2A75A 4HPKB 2OVUA 2PHFA 5GKAC 4DS0A 2VXRA 1PNGA 2R0FA 3D0JA 2AH2A 2HYKA 1YCIA 1KFXL 1Q56A 1R091 1RHI2 5GLWA 1HKDA 2YDEA 1TMF2 4GQ7A 4LEJA 1V00A 5BNQA 4AQ2A 1N1YA 4GA9A 2W52A 2BTVC 5CA6A 5EJ3A 1YHFA 3JB4C 1BBT1 3GBFA 1CAXA 2WNVC 2UWCA 4XZPA 3VBHA 2YXSA 5KBFA 4XTMA 2C9AA 2OZ6A 3DPRC 5H9SA 4G4FA 4YM2A 4OHVA 1ULCA 5C8CA 3A0KA 3GZAA 1ZBE2 4FVVA 1V9U3 1TEIA 5FO8B 2ZGSA 2IXLA 1ENXA 5D8AB 3WDYA 5C9AA 5FTTC 4EN7B 3DKWA 3RSJA 4AI8A 2RMU1 2PHDA 3VGIA 2ZMNA 1SQ4A 2WSUA 5K8SA 2GAUA 1VBB1 1G9BA 1AR91 1O5UA 3UJQA 2WS91 3LA7A 1RMU3 3POYA 1SBDA 2DVDA 1Q5OA 4RHV2 3FLRA 2E51A 4MV2A 5LEJA 2OA2A 2DVBA 1WMFA 4ONUA 2P3JA 2VUJA 1ULFA 4YW5A 3IIAA 1LTEA 4HANA 5I8TA 3M1HA 3CF6E 5AC93 2PN5A 4WM7A 4YVSA 4Q29A 3NKTA 1CJDA 3I7DA 3ILRA 3V56A 4C1WA 1PO13 4AEKA 4A7ZA 5LRSA 1PK6A 5BNPC 2VNGA 4FCAA 1VBE3 3V0AB 5K0UB 1ND2C 4JTOA 4CP0A 2WWSA 2ZOEB 3AKQA 4AVVA 1SCSA 3Q9OA 4XFIA 5JOZA 1WGPA 5FCCA 2H0VA 1C1FA 1W6QB 3RI8A 3E6DA 1OA3A 4TYSA 1FT9A 2BNNA 4AVAA 5E8AA 3N4MA 1WLTA 1RHI3 1HXS2 5CFCB 2GALA 2VOWA 4F7ZA 1TMF3 3HBZA 2CWMA 2Q1ZB 3K48A 5J3UA 1RUH2 4CDQC 1HQWA 1CAVB 2ZZJA 1FXZA 1VBC2 4LHNA 2BVBA 3AMMA 4LTAA 4FPKA 4N43B 5E89A 3M70A 3SH3A 1UN1A 4K21A 4DPNA 3R4DB 5GLTA 2WJSA 1VBA1 2CGPA 2D6KA 2X29A 2D6MA 4GH4B 2DCKA 1H2LA 4HSLA 5JOYA 3KT4A 1MACA 1YNAA 1RUG2 4AGGA 3QOPA 4TZDA 5I0UA 2XJRA 3FFZA 1ZZ9A 2OUJA 4HVQA 2ATFA 3PVNA 1R1A1 3V0BA 4QX5A 2GU9A 1XE7A 4MVTA 5CFDA 3DPRA 1RUC2 4LUKA 4QHBA 4Q26A 5A3MA 1RUI1 3HWJA 2YHJA 2ZGOA 5GLVA 4YM3A 3GYDA 1PM7A 1UZYA 1YI9A 4RFT0 3NJZA 4XJ9A 4D3WA 2JDZA 3ELNA 1CQ9A 3KCXA 3ST7A 1ZNPA 1XNKA 1LOAA 1LGCA 5KHIA 2ET7A 4XXAA 5JI7A 1AR83 1U5YA 2B7YA 2WNUB 1YRZA 3NV2A 4MLOA 4L9BA 4XFBA 2JG8C 5C4WB 2AZ5A 2V09A 3MYXA 4F8AA 4Y1UA 1GICA 1T6GC 5HXVA 4E9KA 2F4PA 3MFCA 3PVBB 1JOJA 1JN2P 3PJYA 3ZXEA 4Q8LA 3QLQA 2H6CA 1XXNA 1S0FA 2D3PA 1F5JA 2E7TA 4AVCA 2CGNA 1W6OA 1J3QA 4J1XA 1HXS3 4AW7A 4LBQA 4QM8A 4C91A 2HWB1 3VBUB 3R0RA 5HBAA 5BNPA 1HRV2 4GULA 3O0WA 1AR62 1HRI3 1REFA 4AGRA 1UIKA 1DHKB 3RDIA 1FMD1 1VBC3 4CDUB 5ACA1 5I0TA 1WLCA 3J26N 3ZFGB 3NO8A 5E1RA 2GC1A 3IDBB 4BH9A 2W08A 1I3HA 4Q27A 5I91A 4ES9A 4E4ZA 3I4IA 3H1MA 2WT2A 1DYPA 4XQDA 5FQ0A 2WLQA 3E97A 4RR3B 1AVBA 4XJAA 3NVCA 1RUG3 4JCKA 3INAA 1BCXA 1NLSA 2YV8A 5JLVA 1VIWB 1SLCA 1KDMA 2CYFA 3I8TA 3OTFA 4YM1A 2BBVA 4GMP1 2PHXA 4W6WA 4XDQA 3H0OA 3OY8B 4ZKTB 2DUOA 2FMDA 1F31A 2ZGPA 4I01A 3VZKA 2XKOA 2R32A 1BEV2 4CDXC 2EVXA 3U10A 2JICA 3JQXA 4ISQA 1N3QA 2R072 2XLAA 1WW5A 4K9SA 4QGLA 4GB32 2EXIA 5BV6A 4Y26A 3ZFFB 4BLJA 2DCJA 2CV6A 4IV1C 2VVEA 4LULA 5BNOA 1LOFA 2VPVA 2WS93 3WQ0A 2E6VA 3FX3A 3PNAA 2OIIA 4OUSA 2CY6A 2DTWA 3BALA 2HWF2 3KT7A 3HD8B 1DDLA 3ZYGA 2AYHA 2JG8A 2VVFA 2CNAA 4LE3A 2YY1A 4M3CE 4QXKA 4Y20B 1V6JA 1YFUA 4BCUA 4Z92B 1NOVA 1UU5A 3WG3A 2Q4SA 3D6EA 5IK8A 1DZTA 1K5MA 2XJVA 4E2QA 4C0HA 4L97A 5IK4A 1RJ7A 1PGW1 2UURA 3RJ2X 4KU8A 5C8WA 2BWAA 2PQQA 4OULA 2XG3A 1A8DA 3U0ZA 4PLMA 1DGRA 2ZGQA 2C0ZA 4Y22A 1QJU1 3CLPA 1PIV1 4B4QA 1JYCA 1NG0A 1B35C 1PGSA 2RHPA 1GKBA 1PZ9A 1C5HA 1WCDJ 1POV1 2XBO2 2G4IA 3QD6A 4GIQA 2UYBA 3JUUA 4I2OA 2GC2A 2QE3A 3POSA 4EV0A 1KJRA 1IKPA 1GSLA 5HCAA 1B09A 5D1IA 1X50A 1SLTA 3VZMA 1SLBA 5KWRA 3VBRB 3ZDSA 3USUB 2HWE1 5EFUA 1DYKA 1WW7A 2HEVF 3POWA 1YWKA 1A6CA 2IXIA 4QPIB 4AHXA 2A3WA 2OW4A 2R073 4LHLA 4P9LA 1ZZBA 3O0XA 2BFUL 5T55A 4IEZA 2QDRA 3MFAA 1RUI3 1UU6A 3WP4A 4E4SA 4UW3A 1CAWA 1C8NA 2VY0A 3MW3A 3HT2A 4BPZA 4Q4X1 1UPIA 4NHKA 2HWD1 3FC0A 2HWC1 1PHMA 3VBFB 3VKMA 2HWF3 4ES8A 1CPNA 3PVOA 1MR5A 4CDWC 1MEC2 5LEKA 2CWSA 2A71A 5JZGA 5GLUA 2JEMA 1GZCA 1LHUA 4AFMA 2Y0OA 3MW2A 3J8F1 5JVVA 3VDDB 4EWEA 2AREA 1NCQA 3X29B 1AX0A 1KFUL 2BQPA 2R063 1AYN1 3ZN6B 2XJQA 4YLZA 1DFQA 3TNQA 5FLIA 1MS5A 5IK7A 2R16A 3D4KA 1MQTB 4JRLA 3OYWB 4XOGA 2ZHLA 4NHLA 3AB0A 1BVP1 2JG9B 2LM3A 3RRDA 1NCRA 1YIFA 3MW4A 4R9AA 4WM8C 5FMOL 4FBFA 1QQP2 1XYOA 1NE6A 2P34A 3WD5A 1XYPA 5JIUA 2GMPA 1ZZ6A 1GQHA 4FAGA 1B35A 2WSVA 4RGAA 3O12A 1Y3TA 4OI4A 2ZACA 2R042 5BPXA 2NMOA 2E7QA 3ZXLA 4L2NA 1QH6A 4EN6B 2ZGKA 3ZXKA 1HW5A 1OQ1A 2D6PA 1YO8A 3ZVXA 1TME2 4S2FA 4XJ8A 1FPN1 3KGLA 5KXBA 4AGVA 4ISRA 4XBLA 4J6GA 3FE5A 2ZGTA 5FFOC 4MGYE 4R52A 3KMHA 4AHZA 4FSJA 3RMYA 4RSUA 4XPVA 2UY9A 1WD3A 4HN0A 2GH8A 3ACLA 2WIIB 1MEC3 2VW0A 4OI1A 3N7MA 4HMZA 1LHWA 2Q30A 1MS8A 4AFDA 3IN9A 3DL3A 1ULDA 2WQ4A 4PQ9A 4AEDB 4AE2A 1H8TA 1IKQA 1H8VA 1QU0A 2BW8A 3KM5A 4ATFA 5GLZA 2WA4A 4COVA 4YZ1A 2EXJA 4LE4A 2VW1A 2MHFA 1G9AA 3L9JT 1DQ2A 2DV9A 3BU7A 1U5IA 1N1VA 4CDWA 2AENA 4YVSB 2IC1A 1JHNA 2RM21 3S30A 5I8YA 3N7KA 3IT8A 3JD72 4FPGA 2VG9A 2PHLA 2QKDA 2ZGMA 4I02A 1PK6B 1YLLA 1MQTC 1V70A 1VLNA 1EPWA 4B3NA 3H8UA 2TNFA 1KJLA 3UKVA 1R082 4P9GA 4PIXA 3S0MA 1RTVA 2HJIA 2KM2A 3B7MA 1GV9A 1WW6A 4A3XA 3ZXDA 1X33A 4IEPA 2CAUA 1WW4A 2PLV1 2VMHA 2NYYA 2XH6A 4MGZE 3MF6A 3MIEA 1BVVA 2WZR3 1Y43B 2PAMA 4HK9A 3P3PA 1YYNA 1A3KA 1EYBA 2K9ZA 1O5LA 3DV8A 1POV3 1Z78A 1AX1A 1DQ4A 4LBNA 5GALA 4R8HA 1AR71 4C1XA 1D0GA 1OA4A 1VR3A 1COV1 1RUF1 1TME3 4DY5A 4QU2A 3JU9A 1HIXA 1GNHA 4Z8BA 1ASJ1 3HN1A 3WQ1A 4QQ2A 1YXWA 3AYCA 1VALA 5T54A 1EAH1 3R6SA 3PMEA 1GR3A 4BA6A 5L36A 1VJ2A 5J7MA 2HWE3 4XFHA 1ULGA 1W6PA 3ZXFA 1TQ5A 1AJKA 1GFF2 4O9GA 2SBAA 2P3IA 1GNZA 3QCWA 4RA0A 3GHMA 1GBGA 2A73B 4JGZA 2I07B 2Z5WA 5HCBA 4X6QB 4OUMA 5CFDB 2WT0A 2XLFA 3LA2A 3NAPB 1LGNA 1QOTA 4LBOA 4X6RB 2D3RA 2AGSA 1MS4A 3ENRA 4RHV1 4CTEA 3B93A 3ZSLA 2QUOA 1RMU2 2EAAA 2QVSB 4B4PA 4K3UA 4L92A 2CL2A 4PCRA 3N36A 4YM0A 5A32A 3DGTA 4FPLA 2HWC3 2IZWA 3A0NA 3QACA 3KD4A 4OI0A 4J1WA 4FOVA 1GYKA 4XW3A 4RS5C 2IFWA 4Q4W1 3JD73 3I2DA 4XQWA 1PO12 1N3OA 5JPMB 4XQ4A 4Q0VA 4R9CA 1LGBA 1W6NB 4M3CF 1VBE2 2TBVA 1AYM3 1FNYA 3DUIA 1R083 3CO2A 4MXWA 2ZHNA 3MEPA 3AP5A 2UYAA 3WX5A 2A3XA 1IPJA 2WL1A 3KSCA 2WFF1 2PHWA 3MLLA 5J36A 2LUWA 3H1YA 4AHYA 2NP0A 2AR6A 1IOAA 1AYN3 2GSYA 3TN92 4K6BA 1PVC3 4PDWC 4CEYA 2X8KA 2YC0A 2ZHKA 2PHRA 5GJ6A 4YZ2A 5GZDA 4KL1A 3DF0A 1RUD1 4AFCA 4QQHA 2DUQA 4Q4V2 4DOUA 1J59A 3LWCA 4XE9A 5JCTA 4AI0A 2X5IA 4ASLA 2VMGA 1VRH1 2RS11 2Y38A 5FQ0B 2D5FA 4XF9A 2Q8OA 3VZLA 1DQ5A 1KRIA 1V6IA 5T3NA 1NA1C 3JQWA 2P17A 1HLCA 3D8CA 3WDXA 4AK3A 1VBD1 1DU3D 3D5OA 2ZGUA 3RI9A 1MVEA 3VBOC 2RS31 2NPIA 3B3QE 3FLTA 2CTVA 5KXCA 1DG6A 4S2HA 3THTA 2QDNA 5DDJ2 2GN7A 1C8M2 4KWJA 2X53S 1Y9QA 4KG8A 4FPFA 3R4UA 3WXPA 5ABJC 4AFBA 3AKRA 3DN7A 1CVNA 4F3JA 2YMZA 3P3NA 3AM2A 2ZKNA 2ZZQA 2EIGA 2H6BA 3MDPA 1OOPC 1AR82 2ZS6B 3VBSB 1QOOA 3PTYA 1BJQA 1J3PA 3IBMA 3IMNA 5EWSA 5HI0A 1UU4A 1FOD1 1Z0HA 3WW4A 1ZBA1 3TB0A 3WG2A 3THPA 3URFA 3WDUA 1JUHA 5BNOB 1U5ZA 4AQSA 1LB2A 5DZFA 1SBEA 2IXKA 4V1PA 4QPGA 4JGYC 5BNNA 3RG0A 3ZMNA 4B7KA 4LBQD 5FOBB 5FPZA 3HAGA 3ETQA 3I59A 3AP6A 4GKXA 1EP0A 1QMJA 3APBA 3FWEA 2FHRA 3AFKA 1AL21 5L7OB 3MF9A 3FZ3A 3WHTA 2ZJCA 4P9XA 4RS5A 2RS51 5SV5A 1O3TA 1AR61 1SFYA 3RWNA 1CESA 3TN93 2NN8A 2VNOA 4M3CB 4KWLA 4UXAA 1HRI2 4OFGA 1K5MB 2GC3A 3AKPA 3N7LA 5KHJA 1RL3A 4AVTA 2WA3A 5E16A 2WT1A 4Q4V3 1X8MA 3QH6A 2R0HA 1LENA 5JI9A 1YFWA 1WLDA 2RR11 2WZPP 4EN0A 2PLV3 4H14A 4QM9A 2MEV3 1MZEA 4PDWA 1BYHA 5A33A 4Y22B 1Z7S1 1QJX1 3VHOA 3VKLA 3ZN4A 2VU9A 3SISA 5D8AC 2WNVA 4FP2A 3IPVB 3ZYIB 1TE1B 2PYTA 1LODA 1BBT2 2HEWF 3OPZA 2WFPA 5DDJ3 1OKQA 3ME2A 1C8M3 1PO23 4WBBA 2D98A 1WBLA 1GZ9A 5FO9B 5F6LB 1KITA 4YG0A 4D69A 2WKKA 1LCLA 5FAXA 1EAH3 1OPMA 2Q5TA 3KGZA 4MYEA 4P9WA 1PGL2 4Y1YA 2OUHA 1F9KA 4BM8A 2DUPA 1S0IA 1GQGA 3VBOA 4GB31 1ZVFA 2RMU2 5DG2A 3ZYJB 2XB6C 3RYKA 4JTNA 1ZREA 2YYOA 1POV0 3BOPA 1ND3B 2ERFA 1UIJA 5K0UC 3G7DA 1QY4A 1VBB2 1AR92 4MH0E 2AUYA 2F6BA 2WS92 1ZYBA 3WUDA 3AYEA 2XLGA 5CG9A 1YJKA 1MS3A 1LU2A 1RUE1 1OOPA 3E5UA 1ZRDA 5F9TA 4HFSA 1PZ8A 4N53B 5I93A 1RUNA 5FDBA 5CFCC 4LBKA 1AZDA 4LNVA 1AXKA 1NY71 3G6JB 4Q4W3 4FPEA 1ND2A 4OI2A 4YFWA 1QJY3 3ZSJA 4XF0A 3D82A 4AQ6A 1OHFA 1Q8QA 2BUKA 2FBEA 5JZGB 1MS9A 3AMHA 4P9JA 4HKWA 2DU0A 3ZFEB 3M4FA 2K2SA 2D5HA 2ZX4A 1RVF3 4HPKA