4IV3B

Crystal structure of recombinant foot-and-mouth-disease virus a22-h2093c empty capsid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
207
structure length
207
Chain Sequence
DRILTTRNGHTTSTTQSSVGVTYGYSTQEDHVSGPNTSGLETRVVQAERFFKKHLFDWTPDKAFGHLEKLELPTDHKGVYGCLVDSFAYMRNGWDVEVSAVGNQFNGGCLLVAMVPEWKEFTPREKYQLTLFPHQFISPRTNMTAHIVVPYLGVNRYDQYKKHKPWTLVVMVVSPLTTNTVSAGQIKVYANIAPTHVHVAGELPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational engineering of recombinant picornavirus capsids to produce safe, protective vaccine antigen.
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type a
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 41
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iv3B00
4FTEA 1RUF2 5L7OA 3J8F3 4CDXA 4IV1B 3DPRC 2HWB3 1D4M2 1NCQC 1VBE2 1RMU2 5FOJB 2DF7A 2HWD2 2RMU2 3JD72 1AR63 4JGZA 1HRI3 3ZFEB 5BNOB 1VBD3 1TME3 1VRH1 1AYM2 1R093 2RS33 2X5IA 4Q4W2 1AL23 4FTBA 1RUG1 5C9AC 4PDWB 3JBG3 1NCQA 1AR93 2XBO1 4CDWB 3CJIB 5C4WA 1HRI2 5K0UC 4YVWA 1OOPA 2XBO3 2RS31 1PGW1 5L7OB 1AR92 3VBUC 2RR13 1TME1 1VRH3 4YVWB 2WS92 1TMF3 1AR61 1VBB3 1AR81 2HWB1 3ZXAC 1RUI1 4RQPA 1E57A 1M06G 4FSJA 2HWF3 1NY71 4N43B 2R061 2WZR2 4CDUB 2RM22 3TN92 2RM21 1COV1 4NWWA 4CDXC 5L7OC 1AYM1 5BNNC 1MQTA 1NCRA 4Q4W1 1COV2 4GH4C 3NAPC 4QPGA 1VBA2 4RFT0 2WFF3 1MEC3 4CDUA 1QJU1 1ND3C 1AR71 3CJIC 4CEYC 1R091 4RR3C 4QPIA 1BMV1 2WS93 2BFUS 1FOD1 1AR83 1MEC1 1ZBE1 1R082 1ND2C 3VBHA 1RVF3 1PO21 1RUH1 4QPIC 2X5IB 1W39A 1PO12 1V9U3 4QPIB 3VDDC 4WM8A 4RS5B 4Q4V1 4IV1C 1RUG3 3VBHB 1HXS1 1VBC1 4GMP0 1QJU2 5J98B 1B35A 5C4WB 2WWSA 1AYN3 1PO23 1D4M3 1Z7S2 4N43C 1NY72 1RUJ2 1FOD2 2HWE3 3ZFEC 5BNOC 5CFCC 5A32B 1QJU3 4Y4YA 1OHFA 2FZ2A 1BEV2 4GB33 1D4M1 2RR11 4RS5C 3FBMA 2WLPA 1NCQB 1PO13 1ZBA3 4Y5Z0 1X33A 3VBFB 4WM7B 5AC93 2RS52 3JBG1 4Z92B 1OOPB 4N53C 1PO22 1TMF2 2PLV1 4YVWC 1NCRC 1RUD3 5K0UA 1TMF1 2PLV2 3VBFA 2MEV2 4JGYC 1ZBE3 1A6CA 1PVC2 5C9AA 2R042 4RR3B 4CEYB 1V9U2 1AUYA 1R1A3 1VBD2 4RQPC 1RUE3 5K0UB 1VBD1 5JZGA 4RQPB 1K5MA 1RUC1 1C8NA 1QJX1 1NG0A 4CDWA 2R062 2WZR1 2XPJA 5ACA1 1DDLA 1NA1A 1VAKA 1QJY3 1PVC3 4CDXB 2RM23 3DPRB 3ZFFB 1NA1C 1R1A2 5ABJB 4YVSA 1HXS2 4WM8B 5A33B 1VBA1 1AR62 2HWC2 4JGZB 4AEDC 1EV12 1RUC3 5BNPB 2MEV3 2HWC1 1ASJ2 1FPN1 1POV3 1RHI2 3VBRB 4RHV1 1V9U1 2TBVA 1R092 2FZ1A 3ZFEA 5BNOA 1AL22 4RHV2 3VBSC 2HWD3 1X36A 1RB8G 1PGL1 1R081 1IHMA 5A32A 5C9AB 1BBT3 1HRV1 2VQ0A 2MEV1 4N53A 2GSYA 2ZZQA 2BPA2 1ND3B 4WM8C 2R041 1QJZA 2HWE1 1K5MB 5CFDB 1MQTB 1C8M2 1CD3G 1QJY1 1H8TB 4WM7A 4Q4Y1 2R071 1OPOA 3TN91 2WFF2 1Z7S3 4Q4Y2 1RUH2 4SBVA 4Q4X2 5AC91 5ABJA 1EAH3 1RUE1 1ZBA2 2HWF1 4IV3A 5A33A 1PVC1 1R1A1 3NAPB 5BNPA 1ZBA1 2HWF2 1AR82 2WZR3 1VBE1 5BNPC 1RUI2 1AR72 1RVF2 4N43A 1PIV1 1BMV2 1QQP1 1MQTC 1RUD1 2HWC3 1PIV2 2BBVA 1ND2B 4QPGB 1PGL2 1VBA3 2RS51 3JBG2 2RMU3 4Q4V3 3VBUB 3ZFGA 4CDQA 1NA1B 5ABJC 3ZFFA 3TN93 3ZFGC 3S6PA 4CDQC 1AYM3 4YVSB 1RUH3 1EV11 1BEV1 1COV3 2XBO2 5C8CA 2RS12 1RUF3 4GMP3 3J8F2 1VBC2 2BUKA 1VB2A 1HRV3 2R063 3VBUA 5D8AC 4RR3A 3LOBA 1RMU3 5DDJ1 1H8TC 1VRH2 4CDUC 2R072 1QJX2 3VBSA 3NAPA 4GH4A 4QPGC 4EJRA 5CFCB 1RUG2 1GFF2 1F2NA 1TME2 4NWVA 1VB4A 4RHV3 4YVSC 2RR12 3JB4C 4CEWC 5CFDA 2RMU1 3J8F1 2Y26A 4AEDA 5LK7B 1QQP2 5FMOL 1RUC2 1ASJ3 1RHI3 5JZGC 1SMVA 1RUJ3 4CEWA 2R043 5C8CB 4FTSA 3IDEA 4CDWC 4JGYB 1QJX3 1C8M3 1BBT1 1K5MC 1QQP3 1RVF1 1HRI1 1BBT2 5GKAC 3VBFC 1ASJ1 1FPN2 1RHI1 4Q4Y3 4CEWB 5C4WC 2RS32 4Q4W3 4Q4X3 2RS13 1EAH2 1VBC3 3VBSB 5DDJ2 1EAH1 1AR91 5D8AA 3ZFGB 4CDQB 1B35C 1FMD1 2X5IC 2R073 5C8CC 1WCDJ 2RS11 1RUE2 1AYN2 1FMD2 4PDWC 4IV3B 3VDDA 4JGZC 1PIV3 4AEDB 2ZAHA 2HWE2 3VBOC 5CFDC 1MEC2 5ACA3 2HWD1 2QQPA 1NOVA 1QJY2 1RUI3 1AR73 1HQNA 1AL0G 1F8VA 1FPN3 3DPRA 2WFF1 4JGYA 4GB32 4GH4B 5CFCA 1RUF1 4GMP1 3M8LA 1R083 1HX6A 1EV13 1HRV2 4Q4V2 1H8TA 4IV1A 4IV3C 1AYN1 2GH8A 3VBRA 3VBOB 5BNNA 1Z7S1 1HXS3 1FMD3 2ZTNA 1AL21 1RUD2 5D8AB 5FMOS 4RS5A 4WM7C 1CJDA 1VBB1 2BFUL 4N53B 3ZFFC 1B35B 1VBE3 4Q4X1 5AC92 1FOD3 4BCUA 3VDDB 3VBOA 5BNNB 5DDJ3 4GB31 3JB8A 1ND2A 1RMU1 3VBHC 1ND3A 1POV0 3JD73 4PDWA 3HAGA 5J96B 1POV1 2WS91 2PLV3 3JD71 1C8M1 1ZBE2 4CEYA 2HWB2 1BEV3 3CJIA 2IZWA 1RUJ1 3VBRC 1PGW2 5JZGB 4LLFA 1OOPC 5ACA2 1NCRB 1PO11 1VBB2 2RS53
chains in the Genus database with same CATH superfamily
4HKLA 1UF2C 4DINB 4Q2FA 4IGPA 4CDXA 3BUCA 2WN3A 3N7MA 3CLPA 4AE2A 4I09A 4IXLA 4BJ0A 3SEEA 1VBE2 2DUQA 3QLQA 2VPVA 2AEZA 3EJKA 5FOJB 1QOSA 2Q8DA 3VD3A 4XIKA 5FYTA 2PHTA 1S2BA 2EIGA 2RMU2 3RZLA 2VM9A 1XE0A 4CCLA 1XYPA 3C8XA 1G86A 2X10A 5IUQA 2WAAA 3ST7A 1OUSA 1VBD3 3I3DA 3OSDA 3ZYBA 1J3PA 5LBBA 3ZYRA 3M4FA 1GBGA 3CZUA 3TEWA 4NUBA 3RG0A 1TE1B 1RUG1 2QE3A 5FZHA 1AXZA 4PDWB 3GJBA 1NCQA 3VL9A 4BMBA 2PAEA 3ZDVA 5C71A 2XBO1 5IT6A 1Y3TA 3O0XA 2WT0A 3C2UA 1MS1A 1ZA4A 2RJLA 3GM8A 4UYBA 3AVSA 1LHOA 1US3A 5FQ0B 4GIQA 4YVWA 2VNRA 2AYHA 3WNLA 5JUVA 4CUCA 1H6YA 1AX0A 4RA0A 3GBGA 1QDOA 4Y1UA 1PGW1 1HB3A 4QKFA 4JDOA 5FZOB 3OUIA 2UY9A 3UL2A 4QDSA 1VMJA 1PM7A 4LIUA 1UZ0A 3N7KA 4Z07A 2Y0OA 2VG9A 4QX0A 5FBZA 1D2SA 2XUEA 1WWYA 1TME1 1U12A 1I3HA 2ZGPA 3T2TA 4NAMA 3I3BA 1XU1A 1WW5A 2DTWA 3OGRA 5EJ1B 1AR61 1W6QB 1HB4A 5J36A 1UY3A 4MXWB 5E6HA 2HWB1 3OPWA 3ABZA 5E89A 2PAKA 3WF1A 1E57A 4UXAA 3IB3A 1RXFA 1VALA 2B46X 2VC9A 3RGBA 2HWF3 5LBCA 3VKOA 4IEPA 2KXLA 5CYYA 4PI2A 3LEIA 3QCWA 2VAUA 1XSRA 4J1XA 1NX9A 1ZZ8A 3APBA 1DU3D 4OHWA 1J1LA 5JOZA 1JH5A 4GJZA 1QH7A 3BTXA 2B39A 1PX3A 2WL1A 3HOBA 3AYAA 4OUEA 3RMYA 3UK9A 4AW7A 1VBA2 3VD4A 4YZ3A 2JIGA 4M3CF 3UV9A 3PUQA 5DZEA 4XFHA 2FDFA 1ND3C 3KHCA 2DU0A 2P5BA 3PU8A 2DCKA 1US2A 3LE0A 3CL1A 4QPIA 3RI8A 5GZGA 5HCFA 1TQ5A 4O9GA 5IJRA 2BFUS 2E7TA 3VZMA 3AP4A 2ARAA 4B4RA 1YHFA 1NE6A 1ZBE1 3KT1A 1NAEA 4WZCA 4IE7A 5A3WA 2VW2A 5JOWA 3EXUA 1WCSA 4Q1PA 1O4YA 1Q8PA 4L9BA 4K1YA 5FV3A 2E32A 1W2UA 4BWOA 5JR2A 1RUH1 1GNHA 1KXGA 1UIJA 1WD3A 5FIXA 4F8AA 4NOTA 4SLIA 3TAYA 4QU2A 3OYWA 1O5UA 1PO12 2FDKA 4S2DA 3VDDC 3WW3A 1TEIA 2CDPA 4WM8A 3KQ4B 2XL9A 4MSVA 2ZHKA 2HJIA 2XJUA 1HXS1 5EIYB 4GMP0 2BJSA 3OPZA 2GN3A 2D93A 2WWSA 2ZGOA 4ISRA 1D4M3 1C5IA 4QXHA 4BYYA 5T5JA 1LU1A 1RUJ2 3POJA 4D6QA 1FOD2 5DXDA 5I8YA 4CCJA 1JU3A 1EYBA 4I30A 3ETPA 3WLUA 2XJVA 3ACHA 1XC6A 3H3LA 5C3RA 2XKPA 1NQJA 4IE6A 5A3NA 5CFCC 4UW4A 1W8UA 4M3CA 2P17A 1SG3A 3I59A 3LDRA 1QXPA 4OI0A 1OHFA 2B45X 3MIDA 4J25A 1D2QA 4CPBD 1D4M1 1OLME 1W3VA 4OHVA 5KWRA 2RR11 3ZR6A 2C1FA 4NIHA 2BNOA 4AEKA 1PO13 5CKQA 1K42A 1H2LA 1HN0A 2IVIB 4K20A 5LCWL 2W46A 3PU3A 3CEWA 1GNYA 2Q1ZB 3WW1A 1A8MA 4INDA 4WM7B 2RS52 5FYUA 4MO3M 3UKVA 5HI0A 2DVFA 1UW8A 2VMEA 3LD8A 4N9IA 4NHYA 5EJZB 2XLAA 3VHPA 1EPWA 1ODNA 3LEKA 3VV1A 2PLV1 3AJZA 5K0UA 2VH9A 4M4RA 5A3MA 2PLV2 2ET7A 1WCKA 1UXXX 5FZIA 1GU3A 1A6CA 4YM2A 5FR3A 2G1MA 4XUPA 5C9AA 4HN1A 3HBZA 1OVPA 1V9U2 1BLZA 1ACCA 2WFPA 1MS3A 1ZRRA 3WCSA 4CXYA 4AI9A 3RZHA 3ON7A 1JOPA 3R4DB 4IEWA 5KHKA 1IKQA 4GWNA 4A6OA 5JZGA 2AC1A 2JG8C 4RQPB 3VZNA 2BU9A 2VGDA 1C8NA 4MGQA 4QXKA 3KT4A 5F3CA 2DUOA 4O7XA 1S0BA 2R062 5JR7B 4XHXA 3B01A 1HV1A 4IGQA 4YGBA 3AP5A 1IKPA 2X29A 2ZAAA 1X8MA 4KU8A 1YQCA 2GP5A 5IVFA 2Y6JA 4GKXA 1AF9A 4XJWA 1HIXA 5LW9A 5FP8A 3G6JB 1JZ2A 1TNRA 4AWDA 4JGZB 5BNPB 5CNAA 1RHI2 3VBRB 3OF1A 1EPZA 4ISQA 4ONUA 5FUNA 2JE9A 2A3WA 1JTZX 2J1SA 1XJAA 4LBLA 2P2KA 4S2GA 2QUOA 3FN9A 5KXBA 2ZMNA 1CZVA 2WDBA 1GKBA 3A0KA 1PGL1 2DCTA 1H8VA 3ETQA 4ZS3A 3WG4A 4W8JA 2Y6LA 4LPLA 3O14A 1H1AA 2VMHA 1DQ4A 5DABA 5F3IA 2VTXA 3AL6A 4GXLA 1BBT3 5DAQA 3I2FA 4E2GA 5LB6A 5JXIA 4Q26A 4Q0SA 4UF0B 3WHUA 2DVDA 2B8MA 4CPBA 1I6XA 2AENA 2ZZQA 1VLNA 2VD7A 1MQTB 1NZIA 2BP6A 2TNFA 3LA7A 1O3SA 4KMQA 4R9CA 4XUOA 4QB6A 3D0SA 4YSFA 3V0BA 3T0DA 4AHWA 5C7GA 3HMYA 3VHNA 4RL7A 4WM7A 4AI2A 4ES8A 5FZ7A 1Y9MA 4Q4Y1 1OPOA 3TN91 3JQWA 1Y7BA 1Z7S3 2RV9A 3OGVA 4Q4Y2 4XAEA 1JW6A 4SBVA 4Q4X2 3LPFA 5BV6A 1OPMA 5ABJA 1O4TA 2RDRA 2VQTA 4KH9A 4QM9A 5FZLA 1SEFA 1RUE1 1ZBA2 1NXD1 1UNBA 3SITA 1PVC1 1MZEA 2R49A 1ZBA1 3T1MA 1AR82 3I59B 5GLUA 2IXCA 1TG7A 3N9NA 1RUI2 2LALA 4E2SA 1JU4A 5KXCA 4N43A 4DO0A 3FX3A 1PIV1 3U11A 4AHXA 4NAOA 4Y1XA 2WQ8A 1AHSA 1MQTC 1QQP1 2CWMA 1ST8A 3PJQA 2Q8OA 4CP9B 1PIV2 5D1IA 2WA3A 2D5HA 2D6PA 2ZX2A 1HB2A 3O0WA 4JAAA 4ET7A 3D0JA 1PGL2 2HYXA 1UPIA 2EXJA 5GZEA 4P00B 5JWPA 5ABJC 3ZDSA 4Y5SA 1D0GA 5HXMA 2WYSA 3ZFFA 5GALA 2ZBJA 4QX5A 2JICA 1FNYA 1AYM3 1KDKA 2WWUA 4BQ1A 3ATGA 3U0ZA 2VNGA 4WBBA 3S7EA 4GMP3 3IKWA 4MGKE 3JCIA 3T0AA 1VBC2 4CZSA 1UPSA 4OCTA 2LRPA 3VBUA 3AM2A 5EYXA 5FQ0A 2BDRA 1ZA7A 5DUUA 3UT0A 4QKDA 5A3TA 1H8TC 3QBQA 4MLOA 4CDUC 1WMEA 4H55A 1PMHX 3WNNA 1UOFA 3AZXA 1QHDA 4XDPA 1W06A 1V6NA 3NAPA 1HJFA 4KWUA 1RUG2 5SV5A 1FV3A 5JMCA 1J3QA 5IK5A 4U36A 1XRUA 2OQ7A 2KM2A 4P9GA 4A7KA 3O0VA 5A6YA 2PHRA 2A71A 2X53S 4H3WA 5H9SA 1JBCA 1VB4A 4H7LA 4RHV3 3I54A 4YVSC 3JB4C 2D98A 3M3CA 5ERLA 1CX1A 3MIEA 3AXDA 2BBAA 5CFDA 5FYMA 1SLIA 1H0BA 4HOOA 3ZPYA 3V0AB 2A6ZA 3L2YA 1M4WA 5JXHA 1XYNA 4P9XA 1QQP2 1UMZA 4IEUA 3O1OA 2ZHNA 1UL9A 1VJ2A 2QQVA 3BB6A 1GQGA 3I2HA 1ASJ3 2DDUA 4ZU4A 1JUHA 4QX3A 4DB5A 2XDVA 2E7QA 2LS6A 2PXJA 3R6SA 1DQ6A 4JHZA 1SMVA 4KWKA 1RUJ3 2VOXA 2Y64A 5GLTA 1QJFA 2GNDA 1OUXA 3A7QA 3GGLA 5FCCA 3W58A 4WVVA 5C8CB 4FTSA 3HVDA 3IDEA 4R52A 1PK6B 1OFNA 1S0EA 2OXBA 3KWVA 4MOAA 4JKKA 5C3PA 4OI2A 5FZ8A 2R6QA 1Q5OA 4XJ9A 5KR7A 5GKAC 5DAPA 1RC6A 1ASJ1 3KQRA 2DYCA 4HETA 2BTVC 2Z5WA 2P3IA 4Q4W3 2D44A 3EYPA 5FZ1A 3VBSB 1LOGA 3ZXJA 1CVNA 2JDHA 4B1LA 5A7WA 4J1WA 1V00A 1Z78A 4Q8LA 3H8UA 1MVQA 3T4HB 1A8DA 1CZTA 2PHLA 4XFIA 2XKOA 3EB7A 3QH7A 1V70A 2AUYA 3WF4A 4A45A 4G9SB 2X5IC 5CB7A 5C8CC 3MZHA 3E97A 2DV9A 2OUJA 2RS11 4AFCA 5A3UA 4CA9A 4Y1VA 5BYNA 1ULEA 3ACGA 4JVAA 3ZVXA 3Q8CA 4AEDB 1WCUA 2Q0AA 2XWBB 3OUJA 3X29B 1TNFA 1RIRA 2HWE2 4OQ9A 4LHSA 5IHRA 1S0GA 5CFDC 1DLLA 3KF3A 5DMYA 2EXKA 2ES3A 1G6NA 4YARA 2WT2A 1W9TA 5KHJA 3BKZA 1NLSA 4UW5A 3NKGA 2CGNA 1LAJA 1QJY2 4I0WB 2CAVA 3NV4A 4LJHA 1XBFA 1F8VA 4XIOA 1SBDA 2G9ZA 2QQJA 3DPRA 4JGYA 4GB32 5CFCA 3IPVB 4Z2AA 1R083 1GANA 2PMWB 4FO9A 4A41A 1EV13 3W59A 5JIUA 4AK3A 1H8TA 1IS3A 1ZRFA 3WNKA 3K3NA 4LNVA 4IV1A 3W20A 4MH0E 3MUY1 4P9IA 3CBNA 4ARXA 5ANNA 5FFOC 2ZS6B 2D6KA 2VUJA 3VBOB 3J4UH 3AX4A 5H9RA 5BNNA 1LU2A 4KBZA 1XE8A 2ZTNA 4P5HA 1AL21 1W99A 2ZHMA 4ZXKA 5F1RA 4CP2A 1RUD2 5D8AB 3WP3A 2JG9B 4QU1A 4PLMA 3T0BA 4HVQA 2BOIA 4LLOA 1HB1A 1T6BX 1VBB1 1ZZBA 2A6YA 2BFUL 4FQ4A 5FXXA 4N53B 3ZFFC 4PIYA 2K2SA 2VMCA 2P37A 4NROA 4LO8A 3VDDB 1MZ6A 4H2AA 1IPKA 1UQXA 4OUSA 2JENA 3O1UA 1DFQA 3N7JA 2D3RA 1YQ5A 1OI6A 4MVTA 2VR4A 4XUNA 1TZOA 2G9FA 3GNEA 1RXGA 1MACA 2FDGA 1SPPA 1KFUL 3PUAA 1GWLA 3JD71 4GQ7A 4D94A 4XFFA 1VR3A 5JMOA 2ZGTA 4EYUA 3D6EA 4COZA 1SDDB 1ZBE2 2UWAA 3J7HA 2BNMA 3U14A 2ZGUA 2EIDA 1CAWA 1REDA 4LHKA 1JYTA 4XQDA 5IYYA 2VMFA 4LLFA 3U10A 3D4KA 2UYAA 2WO3A 4LTAA 1PO11 5J1XA 1UWWA 3KT7A 4KGQA 3H8RA 1W2OA 2VXJA 1YFXA 3VB9A 5EJ3A 1H2MA 4QX8A 4IV1B 3POYA 3LFIA 2GC3A 4QHZA 1OF4A 5I0DA 2CWSA 2IFRA 4BMEA 1RMU2 1CQ9A 1OD5A 4E4HA 2QQOA 3V56A 2HWD2 3KV6A 3SMHA 4PT6A 4E4DX 1GWMA 2BZDA 4N9HA 4Z82A 1W8NA 4GKYA 1AR63 4EN0A 3E6DA 3H3UA 4JGZA 4XUQA 1HRI3 2ZA9A 4UAPA 5BNOB 1HJGA 1ONAA 1SLCA 2FDJA 4K8RB 1E5SA 1YI7A 3OD4A 1R093 2RS33 1MS9A 2ZKNA 4COVA 1AL23 1CIWA 1DQ2A 4AQSA 1W8OA 3NNMA 4FTBA 5B4NA 3FLRA 2DBIA 1W8FA 2Y38A 4S2HA 1PM4A 5ISLA 2W68A 2K9ZA 3BGAA 4PF1A 4CXXA 1AR93 4UFJA 3FE5A 1XNKA 4Y3OA 3CU7A 4BZ4A 1UOBA 3CJIB 1SLTA 2QQWA 2PHFA 3SCGA 4EN7B 4YM3A 5FY9A 2FHRA 4HMZA 3MO4A 4ARYA 4L11A 3SISA 3WY6A 1JHJA 3O1TA 1F4AA 5FZFA 2RS31 5FYBA 3SXWA 2JB8A 1POQA 3OBRA 4D8MA 2XQRA 1J58A 1ZRIA 1YYNA 3BODA 3E5XA 1VPHA 2SBAA 4QQOA 4XJ8A 2W9XA 1UYXA 2JD4A 2QJVA 5HCBA 3ZYIB 2RR13 2LM3A 4CU9A 4FPGA 5KHGA 3BU7A 2B7YA 4WVZA 3WEZA 1W04A 4N8MA 2WS92 4COUA 5KC6A 1XOYA 1YWKA 5FREA 5HXVA 4ASMB 2R1BA 5C5UA 3WQ0A 3WV6A 1M06G 4BXSV 3WG1A 5FRAA 1LENA 2WQ4A 4HT1T 1W2TA 2R061 1UU5A 1GQHA 2AEYA 3N4MA 2VZSA 3TB0A 3TN92 3WOGA 4CDXC 4W6WA 3B93A 2W94A 2JG9A 3PUSA 4HONA 4M0HA 3RWKX 4LBQA 4A44A 2H0BA 2CU5A 5BNNC 1LGNA 1U5IA 3N3HA 1VP6A 1N1TA 4X8PA 4CCCA 4XILA 4GH4C 5J3UA 2J1AA 2KD7A 3AFKA 4TXWA 4Y33A 2UURA 1MEC3 1QJU1 3MDPA 4PQ9A 3M2MA 5I0UA 4M3CB 4LKFA 2OKXA 4YZ2A 2Y0IA 3CJIC 3IZOA 1Q8QA 4WVMB 5LA1A 1MS8A 1BJQA 1Q3EA 4RR3C 5GJ6A 4YWAA 2WS93 3LDBA 5LASA 3BN6A 3HNBM 3CKHA 4C1WA 2R16A 4QQHA 1CGPA 1W03A 2R32A 2D6NA 5A3LA 4AVBA 5GZFA 3USUB 2BRTA 2CDOA 2YV8A 3PIGA 4ZU7A 2CAUA 5FZEA 1IQDC 4XYXA 3B69A 2NYYA 5A7QA 3RYRA 2C9KA 4RS5B 5FMBA 2ZCWA 2AH2A 4Q4V1 2ZGSA 3A4UA 3I4IA 2VZOA 2Y6HA 4FPCA 3TWIA 4E2QA 4ES9A 1VBC1 1NE4A 2ZX1A 2D97A 1ZRCA 5B4XA 4D6RA 2W95A 4V2VA 5C4WB 1HV0A 1QU0A 3HEIA 1LODA 2OQ6A 4EZ4A 1JYVA 2CL2A 2ZGKA 4L0PA 5FY1A 3HWJA 4JDMA 2JXAA 1GV9A 2GP3A 4YZ4A 4P08A 3E6CC 2HWE3 3TNPB 4F7ZA 4FOWA 4RFRB 3DXTA 3F2ZA 3ZFEC 4W6YA 2AR6A 3GBFA 1RINA 3SCFA 5A32B 3O7OA 3N7LA 1GZCA 1PHMA 3IM0A 1QY4A 4X6QB 1LKNA 5FXVA 1BEV2 2WNUA 3P3NA 3MW2A 5TSWA 4GB33 2F4PA 4DXZA 1DIWA 4RS5C 4L97A 1BKZA 1ZBA3 2JDMA 4Y5Z0 1X33A 1BK0A 1VMHA 1X50A 2ZKLA 3NJZA 3RJ2X 2GMMA 2HBUA 3U1XA 1G9DA 1S0JA 3ZM8A 1SFPA 1WMXA 1SLAA 1QGLA 4WVWA 1O8PA 4FT8A 4PLNA 3WVJA 2DURA 1SBEA 3RDIA 1OOPB 3MIGA 2VMGA 2WAOA 5IAVA 3J7MA 4COWA 2W5FA 3VDCA 5FYIA 1TMF2 1RUD3 2X05A 4XTMA 3WG2A 1QMJA 1GMMA 4FPJA 1TMF1 2MEV2 5FPAA 5FPZA 3BTZA 2G4IA 4XFAA 2YC0A 1ZRDA 4LBMA 5FO9B 1CR7A 3VDBA 1LTEA 4P9YA 3GYDA 4NRPA 2VUAA 2QCSB 2R042 3LQCA 4XFCA 1FV2A 2ZGNA 4JCKA 1VBD2 1WGPA 5FYVA 4AFMA 1UD1A 3PIJA 1AZDA 4MYEA 3M70A 4Q0PA 1OBNA 5K0UB 1VBD1 2J1RA 3AMQA 3I49A 1NLQA 1RUC1 5F3EA 1PK6A 3DECA 3ELNA 5D21A 2Z79A 3WQBA 1T6GC 1A3KA 2VU9A 4Y4RA 2WZR1 5ACA1 2G9GA 5CKMA 1UYYA 1YLLA 3B3QE 1NA1A 1VAKA 2RM23 1U5XA 3GXUA 3USUA 1NA1C 2VZPA 4XE9A 3VD9A 4K3UA 4LBQB 3U07A 4NMIA 1YC61 3WF0A 2E26A 5DUXA 1UY0A 1OLQA 2WNEA 2B42B 3GCXA 5A7WB 5T5PA 5EPAA 3AZYA 3JXSA 1RUC3 3D82A 2MEV3 4LA2A 5M0TA 4U2AA 2VQUA 1POV3 4FP3A 4RHV1 1K5JA 1V9U1 2W52A 4Y24A 3S5QA 4E4ZA 4F83A 4AGVA 1YEWA 3S57A 1YO8A 2E7AA 1W8HA 4RHV2 3VBSC 2A75A 2HWD3 2XHNA 3GZAA 1D0HA 3K2OA 1N1VA 4Q0QA 5F5AA 1R081 3LEMA 4LBNA 1OKOA 3JQXA 5F37A 1IHMA 2NP0A 2WSUA 3WCRA 5FPLA 5C9AB 4KNCA 2WZEA 2YFUA 2VQ0A 2MEV1 3FHQA 3I2IA 1CAUA 3POIA 4DEQA 4E4SA 2HBTA 2ADDA 2R041 4Q1RA 1QJZA 3OD0A 2XVGA 1OQEA 1UKRA 2GNTA 4TZDA 5FYYA 5I93A 2ETEA 4IEOA 4JC1A 2VJXA 4YW3A 2Y34A 5JOXA 1ZM1A 2ZGLA 1UX7A 3MICA 2Q4SA 2R071 1J84A 2QTWB 2WNUC 3RNSA 3OGSA 4AAPA 2P34A 2EICA 5J7MA 4NHXA 2VQAA 1CX4A 1HQWA 3BIWE 3ZYPA 1JMUB 2WR9A 2C0ZA 5T54A 4B4QA 4FPHA 3WDXA 3ZSLA 4ATEA 4I0BA 3UKNA 3ZMNA 2HWF1 4QB2A 3RZGA 3KD4A 5T3NA 2Y6FA 1HN1A 2QZ2A 2VVFA 3NAPB 4RN5A 5BNPA 2UU8A 3ZLIA 2HWF2 3HQRA 4B29A 5JSPA 5A1FA 5D2AA 3O1SA 4XDQA 1U5ZA 1VBE1 5T5LA 3INAA 1AR72 2FCUA 2DCYA 2QQNA 2JDYA 5BNQA 2D5FA 2ARCA 1BMV2 4EWAA 2W1WA 2NQYA 4KL1A 4CU6A 5FPXA 2BBVA 4HXCA 3LDKA 3H3ZA 3WNOA 3D5OA 3GHMA 1VBA3 4XURA 2WYFA 1OFSA 5A7NA 1VAVA 4W4ZA 1WLCA 1GNZA 4QDRA 3VBUB 4CDQA 1RGSA 5LY1A 3POBA 1UKGA 3ZN4A 4IE0A 3Q9OA 3TN93 1GOHA 3PVEA 4W6XA 4CDQC 1D4VB 3S6PA 3MPPG 4XJZA 3MLKA 5JSOA 1EV11 1HQLA 1G9CA 2XBO2 5C8CA 3V0BB 5DPNA 1RUF3 1SHWB 5FMDA 3THDA 1WW4A 3C7GA 3J8F2 2GNBA 3N9OA 2V72A 1VB2A 4M00A 1APNA 1NXMA 2VUCA 5FZAA 1VAMA 4NRQA 3WXPA 5CEHA 2WINB 1A34A 4ORFA 2TEPA 2YHJA 2Z69A 4RR3A 5IVYA 5JXGA 3LOBA 2DWRA 4JKLA 3ZYGA 5LEKA 2JE7A 2V4VA 3A23A 1XNDA 4W65A 2YGLA 3ILNA 4ZONA 5DDJ1 1LEDA 1YFYA 4BLJA 4DUWA 4QD2A 2R072 4LBJA 4R4XA 2O8QA 4BM8A 5FY5A 1XNCA 3N9QA 4GA9A 4GH4A 1GOGA 4BQ4A 4JX0A 5JDBA 4FPEA 3KHBA 1NQDA 1GFF2 2GAUA 4ZXEA 4QX1A 1TME2 2E6VA 5I0SA 4P5YA 2OPWA 2YYOA 3T30A 4LOTA 4ZHNA 2BYVE 1GWKA 4Q0VA 3BTYA 4AVSA 1W6PA 4XHBA 1IPJA 1JXNA 2J1EA 2YMZA 3AK0A 3AKQA 3UETA 4HPKB 2RMU1 1S0FA 2PA7A 4B7KA 4FVVA 4C0HA 3FUQA 4AEDA 5LK7B 1TVGA 1IPSA 1UX6A 3SH4A 5DG2A 3LZZA 1F5JA 1GZWB 5LA9A 4QPWA 3GCWA 3NV2A 4OI4A 5FZ6A 5FZMA 1N1YA 1EP0A 3I2DA 2HKXA 3ITQA 5T5OA 4LUMA 5FUPA 4JGYB 5KXEA 4V1PA 5FWEA 1F9KA 2MHFA 3AZVA 5T52A 4OVEA 2ZMKA 3CHXA 1QQP3 3ENRA 4PIXA 1RVF1 1WMFA 2EF6A 2B9VA 4QKNA 2D7FA 1W6NA 4KI5M 3VBFC 3VDAA 4RGAA 3OGJA 4KGGA 4Y1YA 2WT1A 1FPN2 3WG3A 3GDBA 1V6JA 4IEYA 2QNKA 1FI2A 1X8EA 4XBLA 5FZ3A 3DYPA 3SH3A 1VBC3 2A5ZA 4FFHA 4QDQA 5DDJ2 3P3PA 3WP4A 5L19A 4MGTA 4GJYA 4QQPA 4AOCA 4MADA 3CZJA 4B3NA 3HT2A 4RSUA 3ZFGB 3QOPA 1EUUA 3NV3A 1JODA 3U37A 2Q5TA 3A22A 2O0OA 2EXHA 3ZN6A 1WCDJ 2IXLA 5F8PA 1DGRA 4XFBA 2CYFA 3AYDA 2VW1A 3GZTB 3VLBB 4PDWC 2JECA 4QQ2A 4HSJA 4JGZC 1PK6C 3NNLA 3VDDA 3ZKYA 3ZYJB 5LEJA 2CGOA 3W9AA 2DCJA 4YFWA 3FZ3A 3VBOC 2VUDA 4BK4A 4E27A 1AVBA 1IG0A 3MYXA 5ACA3 2NLRA 2QQPA 1HW5A 1KGYA 1RYYA 1UY4A 2E9QA 3KCCA 4H7MA 4NE9A 3O1VA 1HQNA 4P9LA 4LQRA 4UFHA 2JX9A 1C1LA 3CNAA 4FXGB 1D7PM 3MF6A 4JQRA 1FPN3 5DQ0A 3QD6A 2P1BA 2WQZC 2WFF1 3MIFA 1S0CA 2HYKA 3ZSKA 4DNYA 4GH4B 1H1IA 2NM1A 4GMP1 3M8LA 2VZUA 3KMHA 5JI7A 1FT9A 1QNWA 3AKSA 4R8HA 1W6QA 3I97A 3HBKA 1O3TA 4Q4V2 5LBEA 5I91A 1QIQA 4Y20A 3DYMA 3OBAA 4BXFA 4CCKA 5JPNB 1SBFA 2EA7A 3VD7A 2Y33A 2GDFA 2VBPA 3KV5A 1WW6A 4QGLA 1C1FA 5FZKA 5K7PA 3FLPA 5FPBA 4RS5A 2C24A 4WM7C 2D6OX 4C90A 5FZOA 4YPJA 3IDCB 4K9SA 4NPLA 5JSRA 2ORXA 2QQIA 3KGLA 4QGNA 4TLGA 5EV7A 1OA2A 3SH5A 4FAHA 1DQ1A 1W90A 1B35B 5AC92 2YROA 3FLTA 3VBOA 3WF2A 5BNNB 4GB31 4XAAA 5E8AA 3RS6A 3HN1A 1DZRA 4OMDA 1G9BA 1Y43B 1POV0 3JD73 3N9LA 3R4SA 4NPMA 4KQ7A 4PDWA 3UNPA 3SLIA 2YBKA 1NYWA 4YFZA 3W21A 3MV11 2ZXQA 4LO7A 1O91A 5EZWA 1C8M1 3MIBA 2ZABA 4A3XA 1YJLA 2HWB2 1UY2A 4N7UA 2J1VA 2IZWA 1MR5A 1RUJ1 3CF6E 4EN8B 4AHYA 5FYZA 3I2OA 1S55A 4URTA 4G4FA 1RTVA 4IE4A 5T50A 4DOUA 4BQYA 1VBB2 5CG9A 3C7FA 4F3JA 2O8OA 1R1ZA 1S0IA 1CAXB 3FUOA 4NIAA 4CSWA 3DPRC 2V09A 2YBSA 2E51A 2K46A 2DCZA 2ZGMA 3SEPA 3IDBB 3V64A 1D4M2 5JXJA 1NCQC 2GN7A 4CYDA 5CA6A 3AC0A 1UMHA 4RGGA 3B5LB 1F4HA 2DF7A 4HL0A 4IERA 1LHWA 4CP9A 2A70A 3JD72 4HK8A 4BB3A 3UJOA 5I8TA 1WMDA 1JYWA 3WDVA 2H0VA 4D7TA 2CGPA 2FCTA 2PHUA 1YUDA 1MZ5A 3LAGA 1VRH1 1GZ9A 3AB0A 3WW2A 4ZZ5A 2A3XA 2FQPA 4IEXA 4LITA 1AYM2 5HBAA 4MUVA 3CQOA 2X5IA 2YU2A 3LWCA 1UZZA 4QAWA 4KWLA 3IWZA 5FKCA 3IIAA 3SC7X 3VZOA 5C9AC 3RZZA 5KHIA 5DZFA 1DZTA 4CCNA 2HLEA 4DXSA 2Y8KA 3NVCA 1JI6A 4BIFA 3VKFC 1HRI2 4Y22A 4EQVA 5K0UC 2VCAA 3TNQA 2VNVA 1B09A 1S2KA 3CMGA 2JJ6A 5FOBB 2XJSA 3FC0A 3N9MA 5L73A 1KD7A 2DTYA 2H6BA 2XBO3 3AMMA 1WKYA 4NO4A 4XW3A 3H8XA 2YB7A 5FZGA 2E63A 3BOPA 4K7JA 1LGCA 1UAIA 1UY1A 5CZKA 5L7OB 1V0AA 5IK8A 3POFA 4K6BA 1AR92 4FPYA 4DFSA 1RITA 1WLDA 1CAXA 4LO6B 4OI1A 4BQWA 3D3AA 5LA0A 3G7DA 2PQQA 1PVXA 4YW7A 3GZEA 1TMF3 3OBTA 4JTOA 2ET1A 4AGRA 5LRSA 2BGOA 1AR81 5F32A 5GZCA 1LOBA 4DIQA 5A1AA 5C33A 3DEMA 3ZXAC 3HPNA 3ROUA 1RUI1 4RQPA 4FFIA 4IE5A 4QPYA 4XZUG 3RZJA 3LOIA 2R1DA 5K4LA 2BEOA 4MGYE 4E8DA 3LF7A 4HKOA 2PHDA 2WZR2 4O65A 4A7YA 1O6UA 3H1MA 2A1XA 3OOXA 4PBOA 3ACIA 3DL3A 4NWWA 1IG3A 3RVHA 2ZEZA 4DXRA 5L7OC 5CG8A 1AYM1 2VMDA 1NCRA 2VCBA 3UGGA 5T55A 1H30A 3NAPC 3N9PA 1CN1A 4CP1A 4LKSA 2WFF3 1V6LA 1W8WA 4Q8KA 4CDUA 3GJAA 3BU0A 2XLFA 2PELA 2W1UA 4D7YA 4LIVA 1AR71 3RQ0A 5LWBA 1O3RA 3T08A 3K4ZA 4Y1ZA 4CEYC 1LOEA 4CU8A 1ENQA 1BMV1 2ZX0A 2Q8CA 5F5CA 1STMA 4C91A 4XUTA 3OBZA 1OMIA 4EN6B 1FNZA 2WZPP 1R082 4MZUA 1ND2C 1W0OA 3AMNA 3VBHA 4XBQA 3JU9A 1RVF3 2K0GA 4YGEA 4E8CA 4XF9A 2RJ2A 1DQ0A 4FOVA 4QKBA 3ORJA 4QPIC 2N7GA 2X5IB 3J7NA 4R4ZA 4XACA 2A6XA 5SV8A 4YZ5A 5BXXA 2YPJA 3RMXA 1S2EA 4COYA 3URFA 3LEGA 2E53A 1BQPA 3C3VA 4FPLA 4MXWA 2EAAA 3B7MA 3WINE 4HK9A 4JV4A 3WUCA 4AXOA 1X7NA 1QJU2 5J98B 2P3KA 2VECA 5LK5A 1SFNA 4BLIA 2DBNA 1R64A 2WN2A 5FZ4A 4N43C 1Z7S2 2ZX3A 4LMFA 2QVSB 4UWDA 3BCWA 4HPKA 2OZ6A 3WQ1A 4CE8A 4LEJA 2XL7A 2WNUB 5LA2A 2OYZA 3MF9A 4A3ZA 1W6PB 2ADEA 3WR0A 4IGOA 4CUGA 4DY3A 1W6OB 1NUKA 2JE8A 4OHYA 4KG0A 2XHKA 2I74A 4HVOA 4AFBA 3B94A 4M01A 3TBDA 5JAXA 1CPMA 2PQSA 3IPVA 3RZMA 3KM5A 4L2NA 4OUMA 1GZWA 2OS2A 2XH6A 2ARXA 3BYWA 4GWIA 4ITCA 4UFIA 4ZU5A 1LOFC 3HNYM 2PHWA 4WVMA 2D3SA 2ZHLA 1O5LA 2W08A 2FZ2A 2YFZA 3DKQA 1RL3A 4DRRA 1NCQB 4IL7A 3MFCA 3RWNA 2L9LA 1OF3A 2IVJA 3KVBA 1PNGA 2YC2A 1UU6A 4Z8BA 1JZ4A 4BOWA 3ZPOA 3NMBA 4GD4A 3NJXA 4D69A 4AHZA 3DXUA 4QX2A 4IEZA 1CONA 3UJQA 1IOAA 2C4XA 2JWPA 4L92A 5FPVA 1W3XA 4YVWC 1N3PA 1ULDA 3O1PA 3WZ1A 3TEZA 2XJTA 3RJRA 1XB9A 2XR4A 3VBFA 3PHMA 4QXCA 4EV0A 4JGYC 3GZUC 1ZBE3 1J1TA 1BVVA 5EP9A 1AX1A 3BVCA 1PVC2 1WW7A 2YC4A 5AFBA 5FAXA 3OUHA 2EALA 4CEYB 2ZEXA 1AUYA 1R1A3 2PTMA 4FFFA 5C5TA 3LIHA 5CADA 3TOJA 4QGMA 1LR5A 4P02B 1RUE3 3C7OA 2I2SA 1GQPA 1SLBA 3KV9A 2VBDA 4OHZA 1K5MA 5FJKA 2PN5A 2WNVA 1KJLA 4Y5TA 2FD8A 1QWRA 2PFWA 4CDWA 4O61A 2XPJA 3AVRA 1DDLA 2MPFA 2ZEYA 5LY2A 1W28A 3KVAA 1H9PA 3KF5A 1G9FA 5APAA 5FZBA 1PMIA 1QEXA 2XGXA 3LPGA 2YXSA 4NIIA 3ZFFB 3ZMOA 1ULPA 3AL5A 5ABJB 2DVBA 3POSA 1T2XA 1ULOA 5HCAA 4ASLA 4BIOA 1HXS2 4WM8B 1ULCA 1IQAA 1LHUA 3DKWA 4DS0A 3DUIA 1AR62 2HWC2 5FYSA 3L9JT 3V0AA 4YW5A 2HWC1 3ECQA 1ASJ2 3B00A 2WNOA 3MLJA 2TBVA 1IGOA 2ZACA 3OJBA 1R092 4A4AA 3ZFEA 1CAUB 1AL22 5IK7A 2PHXA 3GALA 1RB8G 1X36A 2J22A 2VOWA 4I2OA 3HJRA 1LHVA 5C6CA 4FPFA 3I2KA 3AZWA 2D6MA 4MHRA 1WUVA 3EMRA 1W6MB 3AZZA 4I3GA 5GZDA 3THPA 1W2AX 2XOMA 1W0PA 2D43A 4FCAA 3B9CA 4LXLA 1MPXA 2F17A 2BPA2 1ND3B 4LUKA 1NT0A 1W0NA 2HWE1 5DAVA 5CFDB 4V2WA 3ME2A 3LKJA 4I3PA 5F2SA 2Z42A 5FP7A 4Z1VA 5ANQA 5FO8B 1CD3G 1K45A 4I01A 5C3OA 1QJY1 2W1QA 1IZ3A 2D40A 2TUNA 1JZ5A 2IUWA 4XMAA 1VMFA 5AVAA 2VMIA 3AKRA 2D6LX 1RUH2 3SCHA 1BXHA 2IXHA 3IBMA 4A7ZA 5AC91 3WDYA 2KR2A 5E1RA 3F95A 5J48A 1ULFA 4AR2A 2VNOA 1U5YA 3MEPA 4XF1A 3IDAA 4XVHA 4AGGA 4DXTA 4LBOA 3Q8AA 4HN0A 2W87A 1OSGA 1C4RA 1XQNA 3FJSA 4XABA 2NMNA 4FI9A 1ZYBA 5FZ0A 3USSA 3LB9A 5BNPC 1DG6A 3DN7A 2BVVA 4FQZA 1KFXL 1YCIA 3KCYA 4YW4A 5C70A 3LA3A 1E5IA 1QH6A 5K9YA 3I2GA 2ZJCA 4XF0A 4CP0A 1KQRA 2LROA 2J42A 1PGSA 2CHHA 4C1XA 1BYHA 1RUD1 5F6KA 2G19A 2JG9C 4JTNA 4LK7A 4FOQA 1GR3A 1SFYA 1WBFA 2KA3A 4LHNA 1BCXA 4QPGB 3RI9A 2WKKA 4QQLA 4FXKB 4AI0A 3P6BA 2RE9A 1X9PA 2RMU3 2ZPXA 3JBG2 3ZSMA 4W50A 5L9BA 4YRDA 2ERFA 4YLZA 1OQDA 1KS5A 4ZY9A 4A6SA 4OQ8A 1OA4A 2OUHA 1GP6A 1XE7A 1RUH3 3LGRA 3R4UA 4EWDA 1J59A 4AYUA 5FBJA 2RS12 4MX3A 5DN2A 3PMSA 4XJAA 4AVCA 1DGWX 2BUKA 3MIHA 4JZRA 1PNFA 2FBEA 3MUZ1 4P14A 4YW6A 4AQ6A 4DQAA 5D8AC 4BE3A 2VVDA 2CSGA 4LK6A 4CRQA 1JOBA 4AI8A 1DQ5A 4TTGA 3AYEA 2VW0A 5DAWA 1C5HA 1VRH2 4UI9L 4GAZA 4AL9A 2RVAA 3A21A 1L7RA 1QJX2 2ZGRA 3RPQA 3VBSA 5CISA 5IFTA 2JKXA 5CFCB 2XXZA 1CAVB 5CU1A 4XBNA 5FXZA 1IS4A 2BW8A 1WA4A 3NSTA 1F2NA 4LA3A 3PVBB 5FZ9A 4XJUA 4M0NA 4NWVA 4I02A 1F15A 3NO8A 4QXBA 4B7EA 1AJOA 1QXJA 2J1UA 2P6CA 2DU1A 2XVLA 3HQXA 4BQ5A 3MW3A 2VE1A 4AQTA 2OA2A 4CEWC 3KCXA 4PHZA 3WNXA 4PCRA 2RG4A 3J8F1 2Y26A 3KV4A 1ALYA 5DAXA 3HIFA 2ENRA 2VTXJ 2F4LA 5FMOL 5A3OA 5E88A 1I9RA 2BNNA 1RHI3 2XVKA 3IT8A 3T2OA 4KBBA 4N7IA 2IXIA 3NQHA 4Y22B 3O12A 2R043 2BWAA 4FFGA 3T2QA 2JDPA 4URAA 3E1F1 2QQMA 4PIZA 4CDWC 1QJX3 1MS0A 1C8M3 4XFGA 3ZO0B 3O1RA 1BBT1 1C3HA 1K5MC 5A7OA 1JZ7A 3O1MA 3I3MA 2VO5A 1ODMA 5BNOA 3MBWA 1KRIA 1BBT2 4YNIA 4S2FA 1GICA 5F3GA 5L36A 1WBLA 2DUPA 1KJRA 2YG0A 3FBYA 5FLIA 1RHI1 1WLTA 5HV0A 4CEWB 4LE4A 2RS32 4Q27A 2LTNA 3C7HA 3K75B 3U4SA 2IFWA 2EIBA 3QACA 1EAH2 4ZKTB 3ZXFA 4XETA 1EAH1 4AI3A 1O59A 4AAXA 4PJYA 1B35C 4AVTA 3GBWA 4HLTA 2R073 2JIJA 4QB1A 1OXCA 1AYN2 3VKMA 1SDWA 2I07B 4R9AA 1XNTA 1PX4A 1ZX5A 1JUIA 3PTRB 4JRLA 5EXOA 2VZRA 4FAGA 2JG8A 3KB5A 3T1LA 5FY4A 5FPUA 3VKNA 4CUAA 3HR9A 3H8OA 1E5HA 1UN1A 2HWD1 4WZFA 5I0RA 1JZ8A 2VCCA 1UIKA 1UZVA 1F31A 1NOVA 5CVRA 5IVVA 2YUEA 1RUI3 2UWCA 4LOSA 3PMEA 4TN7A 4ZPIA 4GALA 1UXZA 5F9TA 3ZOIA 4XZPA 3IIIA 4B8EA 1ULGA 5KC5A 1RUF1 2WZ8A 3ZXKA 1HX6A 1DLCA 1YI9A 1DZQA 2QQKA 1HRV2 1V6KA 3BPZA 2OIIA 2XJQA 4FP2A 1UO9A 1YFWA 2XMLA 4GWMA 4JKMA 4OMCA 4EWEA 4BK5A 3GHNA 1LECA 3OTFA 4IV3C 3FFQA 4LO4B 4Q5OA 3VZJA 1Q8SA 3HN3A 1DGLA 4HVRA 3SKVA 1Z7S1 2JD9A 1HXS3 1HKDA 3OYWB 1NLRA 1Y9GA 2JDNA 5FMOS 3OGGA 4CXWA 3M3IA 2C6SA 3UGFA 2GC2A 3ZN6B 1OURA 4UT5A 4ATFA 4IEVA 1ZNPA 1FOD3 5IK4A 5FP3A 1N3QA 3NNJA 4YG6A 4QWNA 4BCUA 2WA4A 5DDJ3 4BU2A 3POEA 1YQ8A 5FUIA 1ND2A 4JDNA 3VBHC 1UOGA 1OKQA 4XCAA 2FDIA 4OZOA 4OHXA 1LJ7A 3VUOA 1LEMA 2RJKA 2WS91 2PLV3 1S0DA 3IMMA 4MGZE 2YZ4A 1O7FA 4CEYA 4K40A 5FDBA 2GNMA 2HEVF 2BERA 3VBRC 2GC0A 3MLLA 5JZGB 1JYNA 1SCSA 2WABA 1KS4A 3WP6A 1OOPC 1XYOA 1QKQA 2QZ3A 2RHPA 5ACA2 1RJ7A 3UGHA 3RYPA 2CNAA 2RS53 4B1MA 4FTEA 1RUF2 2XG3A 5L7OA 2QQUA 2W1SA 3HT1A 3J8F3 4IEQA 1A78A 3WT3A 3I7DA 3IAPA 2HWB3 3ZKUA 2VZ1A 5J37A 2A3YA 5EHDA 3PUIA 4NHMA 1DGWA 1KDMA 2Y6GA 4QHBA 3ZSEA 2H6CA 2XB6C 2ZEWA 3RYKA 2XJRA 3M3EA 1OLMA 5EWSA 2LW8A 1CESA 5IATA 3H0OA 1XXNA 4D0QA 2A73B 2ATFA 4TYSA 4BA6A 1YNAA 2YU1A 3FHAA 1DBNA 5CBLA 2C26A 4XXPA 3ZFEB 3GF6A 5F6LB 1TME3 3SNMA 2VZVA 3NJVA 5A80A 4Q0UA 1VE0A 5A3PA 4Q4W2 3H7YA 1S1AA 3N35A 4X8NA 1L3JA 3JBG3 4RYDA 4XCBA 3O5SA 5GM0A 3EHKA 2WNVB 1W8TA 3LA2A 1OC1A 4LBKA 4CDWB 4ASKA 4CCEA 2BOJA 3IAQA 3S30A 3ZIXA 3VHOA 5C4WA 4HSLA 4NIDA 1BZWA 2F6BA 2IXJA 2W3JA 5GLZA 5FJHA 3ZR5A 1LESA 2VTFA 1OOPA 2GALA 4BPZA 4XTPA 3K48A 5DG1A 4DPNA 2ID4A 1XNBA 2GMEA 2V5YA 3CJXA 3PVOA 1K12A 1N3OA 1SZBA 2VZTA 4K21A 1G7YA 4XXAA 1OT5A 1W6NB 3ILFA 1ZZ7A 3VBUC 3K3OA 1VRH3 3AP6A 3MV01 3PURA 4HFSA 4YVWB 5F5IA 4A2UA 3OPTA 2VBBA 4D6SA 1YFUA 3H7JA 2WNVC 1HLCA 1VBB3 2WUHA 3SQOA 5IVCA 3M3QA 4EROA 2B4KA 1SLLA 3CO2A 4TLFA 4FSJA 3SHRA 3C7EA 5F2WA 1NY71 1AXYA 3DF0A 4N43B 4XEZA 4CDUB 1O4ZA 2IWGB 5GLVA 2RM22 4IUGA 1V6IA 1CWPA 2X8KA 4LKEA 5FY8A 1H2KA 5IVJA 4CCMA 2RM21 1COV1 1OVSA 4YG0A 1MQTA 2ORZA 3W5NA 4Q4W1 1COV2 3T09A 2OVUA 2W2IA 3PDQA 2E31A 3VKLA 3ASIA 5A6ZA 3KLSA 1UZYA 4QPGA 4FOYA 4RFT0 2YY1A 1URXA 2BGPA 5BUVA 3ZIWA 2QDNA 2DVAA 5K8SA 1XNAA 2WRAA 3ZYHA 1R091 4YM1A 4A42A 3MGUA 4CTEA 4MG2A 2YDEA 1FOD1 1AR83 2W92A 1MEC1 2BGCA 4DMIA 2VY0A 2NMOA 3R05A 4Y26A 4E9KA 2VZQA 4Y20B 1FYUA 3BPSA 4LT5A 2HEWF 4BH9A 1PO21 5A7PA 1GP4A 1LOFA 3AP9A 3OEBA 4Q29A 1UU4A 4UFKA 4BHPA 5DUVA 3WUDA 1YQ6A 1W39A 3U78A 2W39A 3MW4A 1N1SA 4QPIB 1V9U3 1LHNA 2CV6A 3MFAA 5AVPA 4DEVA 4UFMA 2P3JA 2WO2A 2Q1FA 3R0RA 4IV1C 1RJ8A 1RUG3 1JHNA 3VBHB 4AI1A 4C0BA 1X82A 1K3IA 2GMPA 1P8JA 1B35A 2XQXA 3WX5A 1GSLA 4XF3A 1FAYA 2YBPA 1AYN3 1PO23 4MGSA 4OFGA 4ZS2A 5LBFA 4Z2WA 4EE2A 3OY8A 2FMYA 1NY72 2VVEA 4L8QA 4K8FA 5FK7A 1PMJX 3AMHA 3H1YA 3NNGA 5FZCA 2VZ3A 1ENSA 1YRZA 2FCVA 2VL4A 3WF3A 1C57A 1BVP1 1MS4A 2A7AA 4AEMA 5BNOC 3V65A 2R0HA 3B9IA 3EO6A 4LO5B 5IW0A 2I45A 5FYHA 3VN4A 3E6BA 3LFMA 2ZOEB 3H42B 1QJU3 1JZ6A 3IN9A 1DCSA 4LE3A 5F5QA 4Y4YA 1PZ8A 1JN2P 4QM8A 2AACA 5JLVA 2NN8A 1DGRN 3K4DA 1QOOA 3FBMA 5I0TA 1X9TA 2WLPA 4BQXA 3ZSJA 2GU9A 2JEMA 3BALA 5C3QA 2W91A 4BQ2A 3VBFB 2VCMA 3I3QA 5H9QA 5FMCA 3J9SA 1MZFA 3VL8A 2P6HA 5AC93 3JBG1 3A0NA 1IS5A 5HCHA 4Z92B 4WV8A 4LHLA 2VOVA 4NN0A 2P3YA 4N53C 3TRSB 5A6QA 1PO22 3MHZA 2BQPA 1KEXA 3KGZA 4UBGA 3ZX7A 4J6GA 5H9PA 4LBQD 5FYCA 1NCRC 2CTVA 1H6XA 2ZMLA 3KZ4C 4D3WA 1AXKA 1H1MA 4OLLA 4IDZA 4PQQA 2Q1MA 4AZZA 1RUOA 3DYOA 4LKDA 4GWJA 2ZGQA 4XDOA 1EUTA 2AZ5A 2WSVA 2ZZJA 3Q8EA 4RR3B 2R7EB 2WC2A 3OY8B 4MGIE 2JG8B 2IXKA 4RQPC 1UYZA 1H2NA 4AF9A 3S5AA 3UYJA 2R30A 3H50A 3AMPA 4XOGA 1ZVFA 4H14A 4NR1A 2J1TA 1QJX1 2NPIA 2R0FA 5FO7B 1NG0A 4DZGA 3FFZA 2C9AA 3WHTA 5AFEA 3P5BA 1UMIA 1DYPA 1YJKA 5FP9A 4CCOA 1LB2A 3M3OA 1QJY3 1PVC3 3D8CA 3TEXA 3DPRB 4CDXB 4RD7A 4UBHA 5IWFA 3LSDA 4YGDA 4YZ1A 2XONA 1QOTA 1FXZA 1R1A2 1JOJA 1Z0HA 4YVSA 2B5HA 1CJPA 5KBFA 5A33B 1VBA1 1WD4A 1O8SA 2PYTA 3LCPA 3AFGA 4AEDC 4PBPA 1DYKA 1EV12 1JYXA 2Q8EA 4AQ2A 1FX5A 2EIEA 1FPN1 4XC9A 1CIYA 4PI0A 2DFBA 2FZ1A 1OA3A 1EY2A 2GC1A 2ILMA 4G3YC 1G8WA 3I2JA 3LSEA 4HANA 1NKGA 2SLIA 3WQ7A 1YQ2A 3N36A 5FP4A 1L7LA 3TEYA 5FK8A 3Q8BA 4C8DA 3L2HA 2YGMA 3IMNA 3K46A 5A32A 1HRV1 2D3PA 4XQWA 3K77A 4K1ZA 3WW4A 4N53A 3ZYFA 3VZLA 4EZHA 3I3EA 3NV1A 1W2NA 2GSYA 3EBRA 3POWA 3U75A 2VULA 4YW2A 4WM8C 5FXWA 3WD5A 4KWJA 4NVPA 2EVXA 3JUUA 3VGIA 1K5MB 1LNSA 2V5DA 1C8M2 1JYIA 3CIHA 1W8ZA 4UW6A 4CUBA 2AGSA 4UOJA 1OH4A 1G9AA 1GZTA 1OLRA 1VIWB 5G05L 3PNAA 1E5RA 2WO1A 1H8TB 1SPPB 3ES1A 1VRBA 2BV4A 5JIAA 1REFA 5KHHA 3BOWA 2WFF2 2QDRA 4GULA 4BISA 2E33A 3J7LA 1O3QA 5IFPA 3DV8A 3EQEA 1EAH3 1MS5A 5A1LA 4IV3A 4YG3A 3UESA 4YW1A 5A33A 1LRHA 4HZFA 1R1A1 3WDWA 2ARBA 3AKPA 2EXIA 1LGBA 2Z2SB 5FY7A 1U0AA 4YGCA 4TWTA 2PAMA 2WZR3 2V73A 5CKNA 3NL1A 5E16A 3BIEA 1DF0A 4LULA 1Q43A 3PVNA 1RVF2 5LATA 1N47A 4FBFA 3M7AA 4DRVA 5HPOA 2XWJB 2HWC3 2A6VA 4JRAA 1XSQA 2RDNA 1ND2B 3K4AA 1V6MA 3W5MA 5JI9A 4QT6A 1ZREA 2LUWA 4BDVB 1W6MA 2RS51 4KU7A 1H9WA 4Q4V3 3T2PA 2OPKA 1UCXA 3NJYA 3ZFGA 1NA1B 4UW3A 2WWJA 3B02A 5BPXA 3K51A 4NHKA 3FHIB 5EQUA 5C3SA 5I8SA 3ZFGC 2VOKA 4LR4A 1JS9A 4CVUA 3NWKA 3BTAA 1CAWB 1OH3A 3I8TA 2W47A 4YVSB 1BEV1 1COV3 1F35A 1CZSA 1WCQA 2BWCA 5C8WA 4CU7A 1HRV3 2R063 2NZ9A 4QHOA 1LOCA 4QX7A 4AEJA 3ZXLA 2OX0A 4NHLA 2OZJA 1L7QA 4DUXA 5HV4A 1S4CA 4O9EA 1RMU3 4XPVA 5DUWA 1HDKA 1QF3A 3QH6A 4DY5A 4OYUA 5A7SA 1BHGA 3NKTA 4XMIA 3ZXDA 5JCTA 3BI3A 4MXVA 3MI8A 5EFUA 3PTYA 4QPGC 3WNMA 4EJRA 2FDHA 1UZWA 2A6WA 5BY5A 3P1IA 4P9JA 5CIRA 3WP5A 4AFAA 1GLHA 1ZZCA 5JPMB 2Y6KA 4HG6B 4NIGA 2GZWA 1I5ZA 3VZKA 1V6OA 1C28A 2JKBA 3JZVA 2RR12 3PUHA 4FPKA 5F39A 3RFRA 1J83A 4YYOA 3UKTA 1I1EA 2OW4A 3PLQA 1DP0A 1PZ9A 2YPDA 3AYCA 3NRUA 1CAVA 4GZ9A 3WDUA 4AG4A 5IVEA 1GOFA 2J7MA 1W6OA 3THTA 4PLOA 2O1QA 4NRMA 5LRRA 1RUC2 2RDSA 3DCQA 4OZXA 5F7UA 4META 3HD8B 5JZGC 3E5UA 4RGKA 2Z4FA 1JZ3A 1QJEA 2P4EA 5GLWA 3U4XA 4CEWA 2WLQA 1F5FA 3KS7A 4P9WA 1SQ4A 4B4PA 1LULA 4X6RB 4AVVA 4NJ4A 4YM0A 4I0AA 1J3RA 1YIFA 3OCPA 1QDCA 2JDZA 4EN9B 1HRI1 4NPRA 3MPBA 2RDQA 2UY8A 1H4HA 5FLJA 3WNPA 1LCLA 3PL0A 3NNFA 3ZXEA 1QXRA 1NZCA 4Q4Y3 5FY0A 5C4WC 1AX2A 4Q4X3 2RS13 3ALQA 2OT7A 1H4GA 2ZX4A 4DUVA 4MHUA 2Q30A 4MV2A 3HQUA 1LOAA 2GH2A 2WIIB 4M4PA 5A70A 2B9UA 1SCRA 1AR91 5CAZA 5D8AA 4CDQB 3RSJA 2JDUA 5J09A 1W9SA 4HBNA 1W9YA 3SKJE 1FMD1 1OQ1A 1W9FA 5B2GB 1UOJA 2UWBA 2XUMA 1KITA 3DGTA 1RUE2 1IS6A 1FMD2 3LIGA 4PF5A 1REEA 1BK1A 4IV3B 2X09A 1YIPA 1PIV3 3TYJA 1Y9QA 2ZAHA 3AXEA 1UYPA 2QBXA 3E5QA 5JOYA 2WO7A 3VD5A 4IQPA 3ZXGA 1MEC2 1Q8VA 3AP7A 3PJYA 4LORA 5G04L 1JYCA 2QFEA 3OG2A 3RRDA 4FPOB 3T3YA 3RZKA 1MVEA 3POGA 1AR73 1AL0G 4BQ3A 3AJYA 4R9BA 5JVVA 2JDAA 3ACFA 2WJSA 2CY6A 2C5DA 2XJPA 3H9AA 4XQ4A 2QKDA 1WLWA 1SACA 4JQTA 3FL7A 3WDTA 4IETA 5EYYA 1XU2A 2JB4A 1Q8OA 3M1HA 1RUNA 1GYKA 2VOTA 5FTTC 1AYN1 1QNYA 2GH8A 2DVGA 3VBRA 4OULA 5DZGA 1ENXA 1GP5A 2DFCA 4XF4A 3FMGA 1DHKB 1FMD3 4TSVA 5IVBA 1W05A 4IESA 3ZN5A 2VXRA 3VHRA 4HKWA 2BVBA 2UYBA 4UFLA 2V4AA 1GUIA 3WSOA 1CJDA 3OEAA 2JDKA 1PZ7A 1Y4WA 2QQLA 3J26N 1ENRA 4KG8A 3FWEA 3ILRA 5FZDA 5L9VA 4D7SA 1VBE3 4Q4X1 4ZZ8A 1OD3A 1W9WA 1YXWA 1ZZ6A 1ZZ9A 4IW3A 5FLHA 1WA6X 4AVAA 1WZXA 2WBKA 3JB8A 3KSCA 4UF0A 4CCDA 5KXDA 1RMU1 3AKTA 4M3CE 1ND3A 5L9RA 3CDZB 5LZ6A 3HAGA 3THCA 5J96B 1POV1 2Y60A 3H1WA 3S7IA 3HNMA 5IAXA 1DYOA 1CPNA 2O14A 2HH9A 3OB8A 1AJKA 2EAKA 3ACLA 4QMAA 3T4VA 2IC1A 1I5PA 3NW4A 5A6XA 1BEV3 3S0MA 3CJIA 3Q8FA 4AFDA 5FKBA 3ES4A 5FWJA 2XLGA 4L99A 1PGW2 2W0XA 4N90A 1FATA 2AREA 2HEYF 4JHTA 1Q56A 1NCRB 2FMDA 2MNGA 4R9DA 1XPWA
chains in the Genus database with same CATH topology
4HKLA 1UF2C 4DINB 4Q2FA 4CDXA 3N7MA 3CLPA 4AE2A 4I09A 4IXLA 1VBE2 2DUQA 3QLQA 2VPVA 5FOJB 3EJKA 1QOSA 4XIKA 2PHTA 1S2BA 2EIGA 2RMU2 1XYPA 1G86A 5IUQA 3ST7A 1VBD3 1J3PA 3ZYRA 3M4FA 1GBGA 3RG0A 1TE1B 1RUG1 2QE3A 1AXZA 4PDWB 1NCQA 3VL9A 4BMBA 2PAEA 2XBO1 5IT6A 1Y3TA 3O0XA 2WT0A 3C2UA 1MS1A 1ZA4A 2RJLA 1LHOA 5FQ0B 4GIQA 4YVWA 2VNRA 2AYHA 1AX0A 4RA0A 3GBGA 1QDOA 4Y1UA 1PGW1 4JDOA 2UY9A 3UL2A 1PM7A 3N7KA 4Z07A 2Y0OA 2VG9A 5FBZA 1D2SA 2ZGPA 1TME1 1U12A 1I3HA 3T2TA 1XU1A 1WW5A 2DTWA 1AR61 1W6QB 5J36A 4MXWB 2HWB1 5E89A 2PAKA 1E57A 4UXAA 1VALA 2B46X 2HWF3 3VKOA 4IEPA 2KXLA 3QCWA 4J1XA 1ZZ8A 3APBA 1DU3D 4OHWA 1J1LA 5JOZA 1JH5A 1QH7A 2B39A 2WL1A 3AYAA 3RMYA 3UK9A 4AW7A 1VBA2 4YZ3A 4M3CF 3UV9A 5DZEA 4XFHA 1ND3C 2DU0A 2DCKA 3CL1A 4QPIA 3RI8A 5GZGA 5HCFA 1TQ5A 4O9GA 3VZMA 2BFUS 2E7TA 3AP4A 4B4RA 1YHFA 1NE6A 1ZBE1 3KT1A 4WZCA 5JOWA 2VW2A 3EXUA 1WCSA 4Q1PA 1O4YA 1Q8PA 4L9BA 4K1YA 4BWOA 1W2UA 1RUH1 1GNHA 1KXGA 1UIJA 1WD3A 4F8AA 4NOTA 4SLIA 3TAYA 4QU2A 3OYWA 1O5UA 1PO12 4S2DA 3VDDC 3WW3A 1TEIA 4WM8A 2XL9A 4MSVA 2ZHKA 2HJIA 2XJUA 1HXS1 4GMP0 3OPZA 2GN3A 2D93A 2WWSA 2ZGOA 4ISRA 1D4M3 1C5IA 4BYYA 5T5JA 1LU1A 1RUJ2 5I8YA 1FOD2 5DXDA 1EYBA 4I30A 3WLUA 2XJVA 2XKPA 1NQJA 5CFCC 4UW4A 4M3CA 2P17A 3I59A 1QXPA 4OI0A 1OHFA 2B45X 3MIDA 1D2QA 1D4M1 5KWRA 4OHVA 2RR11 2C1FA 2BNOA 4AEKA 1PO13 1H2LA 4K20A 3CEWA 2Q1ZB 3WW1A 1A8MA 4INDA 4WM7B 2RS52 3UKVA 5HI0A 2DVFA 1UW8A 4N9IA 2XLAA 3VHPA 1EPWA 3VV1A 2PLV1 3AJZA 5K0UA 2VH9A 5A3MA 2PLV2 2ET7A 1WCKA 1A6CA 4YM2A 5C9AA 4HN1A 3HBZA 3WCSA 1V9U2 2WFPA 1MS3A 1ZRRA 4IEWA 3R4DB 5KHKA 1IKQA 4GWNA 5JZGA 2JG8C 4RQPB 3VZNA 2VGDA 1C8NA 4QXKA 3KT4A 2DUOA 1S0BA 2R062 5JR7B 4XHXA 3B01A 1HV1A 4YGBA 3AP5A 1IKPA 2X29A 2ZAAA 1X8MA 4KU8A 4GKXA 1AF9A 4XJWA 1HIXA 3G6JB 1TNRA 4AWDA 4JGZB 5BNPB 5CNAA 1RHI2 3VBRB 3OF1A 1EPZA 4ISQA 4ONUA 2JE9A 2A3WA 1JTZX 4LBLA 4S2GA 4YW2A 2P2KA 5BNOA 2QUOA 5KXBA 3A0KA 2ZMNA 1PGL1 1GKBA 2DCTA 1H8VA 3ETQA 3WG4A 3O14A 1H1AA 2VMHA 1DQ4A 4GXLA 1BBT3 4E2GA 4Q26A 4Q0SA 3WHUA 2DVDA 2B8MA 1I6XA 2AENA 2ZZQA 1VLNA 1O3SA 1MQTB 3LA7A 2TNFA 4R9CA 3D0SA 4YSFA 3V0BA 4AHWA 3HMYA 3VHNA 4RL7A 4WM7A 4AI2A 4ES8A 4Q4Y1 1OPOA 3TN91 3JQWA 1Y7BA 1Z7S3 4Q4Y2 1JW6A 4SBVA 4Q4X2 5BV6A 1OPMA 5ABJA 1O4TA 4KH9A 4QM9A 1SEFA 1RUE1 1ZBA2 1NXD1 3SITA 1PVC1 1MZEA 2R49A 1ZBA1 3T1MA 1AR82 3I59B 5GLUA 2IXCA 1RUI2 2LALA 4E2SA 5KXCA 4N43A 3FX3A 1PIV1 3U11A 4AHXA 4Y1XA 3PJQA 1AHSA 1MQTC 1QQP1 2CWMA 2Q8OA 1PIV2 5D1IA 2WA3A 2D5HA 2D6PA 2ZX2A 3O0WA 4JAAA 3D0JA 1PGL2 1UPIA 2EXJA 5GZEA 5JWPA 5ABJC 3ZDSA 1D0GA 3ZFFA 5GALA 2ZBJA 4QX5A 2JICA 1FNYA 1AYM3 1KDKA 4BQ1A 3ATGA 3U0ZA 2VNGA 4WBBA 3S7EA 4GMP3 3IKWA 4MGKE 3JCIA 1VBC2 4CZSA 1UPSA 3VBUA 3AM2A 5EYXA 5FQ0A 5DUUA 1H8TC 3QBQA 4MLOA 4CDUC 1WMEA 4H55A 3AZXA 1QHDA 1V6NA 3NAPA 1RUG2 5SV5A 1FV3A 5JMCA 1J3QA 5IK5A 4U36A 1XRUA 4P9GA 2KM2A 4A7KA 3O0VA 2PHRA 2A71A 2X53S 4H3WA 5H9SA 1JBCA 1VB4A 4H7LA 4RHV3 3I54A 4YVSC 3JB4C 2D98A 3M3CA 3MIEA 3AXDA 5CFDA 1SLIA 1H0BA 3ZPYA 3V0AB 2A6ZA 3L2YA 1M4WA 1XYNA 4P9XA 1QQP2 1UMZA 4IEUA 2ZHNA 1UL9A 1VJ2A 3BB6A 1GQGA 4ZU4A 1ASJ3 1JUHA 4DB5A 2E7QA 3R6SA 1DQ6A 1SMVA 4KWKA 1RUJ3 2VOXA 5GLTA 2GNDA 3W58A 5FCCA 5C8CB 4WVVA 4FTSA 3IDEA 4R52A 1PK6B 1OFNA 1S0EA 4OI2A 2R6QA 1Q5OA 4XJ9A 5GKAC 1RC6A 1ASJ1 3KQRA 2DYCA 4HETA 2BTVC 2Z5WA 2P3IA 4Q4W3 2D44A 3VBSB 1LOGA 3ZXJA 1CVNA 4J1WA 1V00A 1Z78A 4Q8LA 3H8UA 1MVQA 1A8DA 2PHLA 4XFIA 2XKOA 3QH7A 1V70A 2AUYA 4G9SB 2X5IC 5CB7A 5C8CC 3MZHA 3E97A 2DV9A 2OUJA 2RS11 4AFCA 4Y1VA 5BYNA 1ULEA 3ZVXA 4JVAA 4AEDB 3X29B 2Q0AA 2XWBB 1TNFA 1RIRA 2HWE2 1S0GA 5CFDC 1DLLA 2EXKA 2ES3A 1G6NA 4YARA 2WT2A 5KHJA 1NLSA 4UW5A 3NKGA 2CGNA 1QJY2 4I0WB 2CAVA 3NV4A 1F8VA 4XIOA 1SBDA 3DPRA 4JGYA 4GB32 5CFCA 3IPVB 1R083 1GANA 4FO9A 1EV13 3W59A 5JIUA 4AK3A 1H8TA 1IS3A 1ZRFA 4LNVA 4IV1A 4MH0E 4P9IA 5FFOC 2ZS6B 2D6KA 2VUJA 3VBOB 3J4UH 3AX4A 5H9RA 5BNNA 1LU2A 1XE8A 2ZTNA 4P5HA 1AL21 2ZHMA 5F1RA 4ZXKA 4CP2A 1RUD2 5D8AB 3WP3A 2JG9B 4HVQA 4PLMA 4LLOA 1VBB1 1ZZBA 2A6YA 2BFUL 4FQ4A 4N53B 3ZFFC 4PIYA 2K2SA 2P37A 4LO8A 3VDDB 1MZ6A 4OUSA 1IPKA 2JENA 1DFQA 3N7JA 2D3RA 1OI6A 4MVTA 3GNEA 2G9FA 1MACA 1KFUL 3JD71 4GQ7A 4D94A 4XFFA 1VR3A 2ZGTA 3D6EA 4COZA 1ZBE2 2UWAA 2BNMA 2ZGUA 1CAWA 1REDA 4LHKA 4XQDA 4LLFA 3U10A 3D4KA 2UYAA 4LTAA 1PO11 3KT7A 4KGQA 1YFXA 5EJ3A 1H2MA 4IV1B 3POYA 2GC3A 2CWSA 2IFRA 4BMEA 1RMU2 1CQ9A 1OD5A 3V56A 2HWD2 3SMHA 4E4DX 4N9HA 4Z82A 4GKYA 1AR63 4EN0A 3E6DA 3H3UA 4JGZA 1HRI3 2ZA9A 5BNOB 1ONAA 1SLCA 3OD4A 1YI7A 1R093 2RS33 1MS9A 2ZKNA 4COVA 1AL23 1CIWA 1DQ2A 4AQSA 4FTBA 3FLRA 2Y38A 4S2HA 2W68A 2K9ZA 1AR93 3FE5A 1XNKA 3CU7A 4BZ4A 3CJIB 1SLTA 2PHFA 3SCGA 4EN7B 4YM3A 2FHRA 4HMZA 4L11A 3SISA 3WY6A 2RS31 3SXWA 3OBRA 1J58A 1YYNA 3BODA 3E5XA 2SBAA 4QQOA 4XJ8A 2JD4A 2QJVA 5HCBA 3ZYIB 2RR13 2LM3A 5KHGA 4FPGA 3BU7A 2B7YA 4WVZA 2WS92 4COUA 5KC6A 1YWKA 5FREA 5HXVA 4ASMB 2R1BA 3WQ0A 3WV6A 1M06G 3WG1A 5FRAA 1LENA 2WQ4A 4HT1T 2R061 1UU5A 1GQHA 3N4MA 3TN92 3TB0A 3WOGA 4CDXC 4W6WA 3B93A 4M0HA 2JG9A 4LBQA 5BNNC 2H0BA 1LGNA 1U5IA 3N3HA 1VP6A 1N1TA 4X8PA 4XILA 4GH4C 5J3UA 3AFKA 2UURA 1MEC3 1QJU1 3MDPA 4PQ9A 3M2MA 5I0UA 4M3CB 4YZ2A 2Y0IA 3CJIC 1Q8QA 4WVMB 1MS8A 1BJQA 1Q3EA 4RR3C 5GJ6A 2WS93 4C1WA 2R16A 4QQHA 1CGPA 2R32A 2D6NA 5A3LA 4AVBA 5GZFA 3USUB 2YV8A 4ZU7A 2CAUA 4XYXA 3B69A 2NYYA 3RYRA 4RS5B 2ZCWA 2AH2A 4Q4V1 2ZGSA 3A4UA 3I4IA 4FPCA 3TWIA 4E2QA 4ES9A 1VBC1 1NE4A 2ZX1A 2D97A 1ZRCA 5C4WB 1HV0A 1QU0A 1LODA 2CL2A 2ZGKA 3HWJA 4JDMA 1GV9A 2JXAA 4YZ4A 3E6CC 2HWE3 3TNPB 4F7ZA 4FOWA 3ZFEC 4W6YA 2AR6A 3GBFA 1RINA 3SCFA 5A32B 3O7OA 3N7LA 1GZCA 1PHMA 3IM0A 1QY4A 4X6QB 1LKNA 1BEV2 2WNUA 3P3NA 3MW2A 5TSWA 4GB33 2F4PA 4DXZA 1DIWA 4RS5C 4L97A 1BKZA 1ZBA3 4Y5Z0 1X33A 1X50A 2ZKLA 3NJZA 3RJ2X 2GMMA 1G9DA 1S0JA 1SLAA 1QGLA 4WVWA 4FT8A 4PLNA 3WVJA 2DURA 1SBEA 3RDIA 1OOPB 3MIGA 2VMGA 4COWA 1TMF2 1RUD3 4XTMA 3WG2A 1QMJA 4FPJA 1TMF1 2MEV2 5FPZA 2G4IA 4XFAA 2YC0A 1ZRDA 4LBMA 5FO9B 1CR7A 1LTEA 4P9YA 3GYDA 2VUAA 2QCSB 2R042 4XFCA 1FV2A 2ZGNA 4JCKA 1VBD2 1WGPA 4AFMA 1UD1A 1AZDA 4MYEA 3M70A 4Q0PA 5K0UB 1VBD1 3AMQA 1RUC1 1PK6A 3ELNA 2Z79A 1T6GC 1A3KA 2VU9A 2WZR1 5ACA1 2G9GA 1YLLA 3B3QE 1NA1A 1VAKA 2RM23 1U5XA 3USUA 1NA1C 4XE9A 4K3UA 4LBQB 3U07A 5DUXA 1OLQA 2WNEA 2B42B 5T5PA 3AZYA 1RUC3 3D82A 2MEV3 4LA2A 4U2AA 1POV3 4FP3A 4RHV1 2W52A 1V9U1 4Y24A 4E4ZA 4F83A 4AGVA 1YO8A 2E7AA 4RHV2 3VBSC 2A75A 2HWD3 3GZAA 1D0HA 1N1VA 4Q0QA 1R081 4LBNA 3JQXA 1IHMA 2WSUA 3WCRA 5C9AB 4KNCA 2VQ0A 2MEV1 1CAUA 4E4SA 2R041 4Q1RA 1QJZA 3OD0A 2XVGA 1OQEA 1UKRA 2GNTA 4TZDA 5I93A 2ETEA 4IEOA 4JC1A 4YW3A 5JOXA 1ZM1A 2ZGLA 3MICA 2Q4SA 2R071 2WNUC 3RNSA 2P34A 5J7MA 2VQAA 1CX4A 1HQWA 3BIWE 3ZYPA 2C0ZA 5T54A 4FPHA 3WDXA 3ZSLA 4ATEA 4I0BA 3UKNA 3ZMNA 2HWF1 3KD4A 5T3NA 2QZ2A 2VVFA 3NAPB 5BNPA 2UU8A 2HWF2 4B29A 5JSPA 4XDQA 1U5ZA 1VBE1 5T5LA 3INAA 1AR72 2DCYA 5BNQA 2D5FA 1BMV2 4EWAA 2NQYA 4KL1A 5FPXA 2BBVA 3H3ZA 3D5OA 3GHMA 1VBA3 1OFSA 1VAVA 1WLCA 1GNZA 3VBUB 4CDQA 1RGSA 1UKGA 3ZN4A 3Q9OA 3TN93 4W6XA 3PVEA 4CDQC 1D4VB 3S6PA 3MPPG 4XJZA 3MLKA 5JSOA 1EV11 1HQLA 1G9CA 2XBO2 5C8CA 3V0BB 1RUF3 1WW4A 3J8F2 2GNBA 1VB2A 4M00A 1APNA 1NXMA 1VAMA 3WXPA 2WINB 4ORFA 2TEPA 2YHJA 2Z69A 4RR3A 3LOBA 2DWRA 5LEKA 3ZYGA 2JE7A 1XNDA 4W65A 2YGLA 3ILNA 5DDJ1 4BLJA 1LEDA 1YFYA 4QD2A 2R072 4LBJA 4R4XA 2O8QA 4BM8A 1XNCA 4GA9A 4GH4A 5JDBA 4FPEA 1NQDA 1GFF2 2GAUA 1TME2 2E6VA 5I0SA 2YYOA 2BYVE 4Q0VA 4AVSA 1W6PA 4XHBA 1IPJA 1JXNA 2YMZA 3AK0A 3AKQA 4HPKB 2RMU1 1S0FA 2PA7A 4B7KA 4FVVA 4C0HA 3FUQA 4AEDA 5LK7B 1UX6A 3SH4A 5DG2A 3LZZA 1F5JA 1GZWB 3NV2A 4OI4A 1N1YA 1EP0A 3I2DA 2HKXA 5T5OA 4LUMA 4JGYB 5KXEA 4V1PA 1F9KA 2MHFA 3AZVA 5T52A 4OVEA 2ZMKA 3ENRA 1QQP3 4PIXA 1RVF1 1WMFA 2EF6A 2D7FA 1W6NA 3VBFC 4RGAA 3OGJA 4KGGA 4Y1YA 2WT1A 1FPN2 3WG3A 1V6JA 4IEYA 2QNKA 1FI2A 1X8EA 4XBLA 3SH3A 1VBC3 2A5ZA 5DDJ2 3P3PA 3WP4A 5L19A 4QQPA 4B3NA 3HT2A 4RSUA 3ZFGB 3QOPA 3NV3A 2Q5TA 2O0OA 2EXHA 3ZN6A 1WCDJ 2IXLA 1DGRA 4XFBA 2CYFA 3AYDA 2VW1A 3GZTB 3VLBB 4PDWC 2JECA 4QQ2A 4HSJA 4JGZC 1PK6C 3VDDA 3ZYJB 5LEJA 2CGOA 3W9AA 2DCJA 4YFWA 3FZ3A 3VBOC 4E27A 1AVBA 3MYXA 5ACA3 2NLRA 2QQPA 1HW5A 2E9QA 3KCCA 4H7MA 1HQNA 4P9LA 2JX9A 1C1LA 3CNAA 4FXGB 3MF6A 4JQRA 1FPN3 3QD6A 2WQZC 3MIFA 2WFF1 4DNYA 1S0CA 2HYKA 3ZSKA 4GH4B 1H1IA 2NM1A 4GMP1 3M8LA 3KMHA 5JI7A 1FT9A 1QNWA 3AKSA 4R8HA 1W6QA 1O3TA 4Q4V2 5I91A 4Y20A 5JPNB 1SBFA 2EA7A 2GDFA 1WW6A 4QGLA 1C1FA 5K7PA 3FLPA 4RS5A 4WM7C 2D6OX 4C90A 3IDCB 4K9SA 5JSRA 4QGNA 3SH5A 3KGLA 4FAHA 5EV7A 1OA2A 1DQ1A 1B35B 5AC92 2YROA 3FLTA 3VBOA 5BNNB 4GB31 5E8AA 3RS6A 3HN1A 1DZRA 1G9BA 1Y43B 1POV0 3JD73 3R4SA 4PDWA 4KQ7A 3SLIA 1NYWA 4YFZA 4LO7A 1O91A 5EZWA 1C8M1 3MIBA 2ZABA 4A3XA 1YJLA 2HWB2 4N7UA 2IZWA 1MR5A 1RUJ1 3CF6E 4EN8B 4AHYA 1S55A 4URTA 4G4FA 1RTVA 5T50A 4DOUA 1VBB2 5CG9A 4F3JA 2O8OA 1R1ZA 1S0IA 1CAXB 3FUOA 3DPRC 2V09A 2E51A 2ZGMA 2DCZA 3IDBB 3V64A 1D4M2 1NCQC 2GN7A 4CYDA 5CA6A 4RGGA 3B5LB 2DF7A 4HL0A 4IERA 1LHWA 2A70A 3JD72 4HK8A 3UJOA 5I8TA 1WMDA 2CGPA 3WDVA 2H0VA 4D7TA 2PHUA 1YUDA 1MZ5A 3LAGA 1VRH1 1GZ9A 3AB0A 3WW2A 2A3XA 2FQPA 4IEXA 5HBAA 1AYM2 4MUVA 2X5IA 3LWCA 1UZZA 4KWLA 3IWZA 3IIAA 3VZOA 5C9AC 3RZZA 5KHIA 5DZFA 1DZTA 3NVCA 4BIFA 3VKFC 1HRI2 4Y22A 5K0UC 3TNQA 1B09A 1S2KA 2JJ6A 5FOBB 2XJSA 3FC0A 5L73A 4B4QA 1KD7A 2DTYA 2H6BA 2XBO3 3AMMA 4NO4A 4XW3A 2E63A 3BOPA 4K7JA 1LGCA 1UAIA 5L7OB 5IK8A 4K6BA 1AR92 4FPYA 4DFSA 1RITA 1WLDA 1CAXA 4LO6B 4OI1A 3G7DA 2PQQA 1PVXA 4JTOA 1TMF3 3OBTA 4AGRA 2ET1A 5LRSA 1AR81 5GZCA 1LOBA 5C33A 3ZXAC 3ROUA 1RUI1 4RQPA 4QPYA 3LOIA 2R1DA 2BEOA 4MGYE 4HKOA 2PHDA 2WZR2 4A7YA 3H1MA 4PBOA 3DL3A 4NWWA 5L7OC 5CG8A 1AYM1 1NCRA 5T55A 1H30A 3NAPC 1CN1A 4CP1A 2WFF3 1V6LA 4Q8KA 4CDUA 2XLFA 2PELA 4D7YA 3RQ0A 1AR71 1O3RA 4Y1ZA 4CEYC 1LOEA 1ENQA 1BMV1 2ZX0A 4C91A 1OMIA 4EN6B 1FNZA 2WZPP 1R082 4MZUA 1ND2C 1W0OA 3AMNA 3VBHA 4XBQA 3JU9A 1RVF3 2K0GA 4YGEA 4XF9A 1DQ0A 4FOVA 4QPIC 2N7GA 2X5IB 4R4ZA 2A6XA 5SV8A 4YZ5A 5BXXA 2YPJA 3RMXA 4COYA 3URFA 2E53A 1BQPA 3C3VA 4FPLA 4MXWA 2EAAA 3B7MA 3WINE 4HK9A 4JV4A 3WUCA 4AXOA 1X7NA 1QJU2 5J98B 2P3KA 2VECA 5LK5A 1SFNA 4BLIA 4N43C 1Z7S2 2ZX3A 3WQ1A 2QVSB 2NP0A 3BCWA 4HPKA 2OZ6A 4LEJA 2XL7A 2WNUB 2OYZA 3MF9A 1W6PB 3WR0A 4DY3A 1W6OB 4OHYA 4KG0A 2XHKA 2I74A 4HVOA 4AFBA 3B94A 4M01A 3TBDA 5JAXA 1CPMA 3IPVA 3KM5A 4L2NA 4OUMA 1GZWA 2XH6A 2ARXA 4ITCA 4ZU5A 1LOFC 2PHWA 4WVMA 2D3SA 2ZHLA 1O5LA 2W08A 2FZ2A 1RL3A 4DRRA 1NCQB 4IL7A 3MFCA 3RWNA 4Z8BA 1PNGA 1UU6A 4D69A 4AHZA 4IEZA 1CONA 3UJQA 1IOAA