4IV3C

Crystal structure of recombinant foot-and-mouth-disease virus a22-h2093c empty capsid
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
b'GIVPVACSDGYGGLVTTDPKTADPVYGMVYNPPRTNYPGRFTNLLDVAEACPTFLCFDEGKPYVVTRTDEQRLLAKFDVSLAAKHMSNTYLSGIAQYYAQYSGTINLHFMFTGSTDSKARYMVAYVPPGVETPPDTPEKAAHCIHAEWDTGLNSKFTFSIPYVSAADYAYTASDVAETTNVQGWVCIYQITHGKAEQDTLVVSVSAGKDFELRLPIDPRSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Rational engineering of recombinant picornavirus capsids to produce safe, protective vaccine antigen.
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type a
molecule tags Virus
total genus 37
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iv3C00
4CDWC 1VBB2 4WM8B 4FSJA 1C8M3 3JB4C 1R1A2 2RM23 3VBSB 1BEV1 3ZFEC 3DPRB 1ND3B 3VBHA 5ABJC 4WM8C 1TMF2 4CEWA 4Q4Y1 1ND3C 2R041 1RUG2 4QPGB 2WZR3 1B35A 1OOPB 4CDQA 1RUI1 1QJU2 1VAKA 1TME1 1AYN1 4Q4Y2 2R042 1VB4A 3CJIA 4QPGC 1COV3 1OOPC 1PGL1 2HWC2 2HWD3 3LOBA 2Y26A 1NCQA 1PO21 1TME2 1AYN2 4NWVA 1VBE3 3ZXAC 4GMP0 1WCDJ 5FMOL 5D8AB 1QJZA 1EV11 4AEDB 2PLV1 1VBB3 1QJX2 5C4WB 1R1A3 5D8AC 4YVSB 1EV12 2PLV2 4IV1A 1A6CA 5BNNB 4Q4X2 1NCRB 2XBO1 4GH4B 5C8CB 1PVC1 1BEV3 5BNNC 5GKAC 1MQTB 2WS91 1NCRC 3NAPA 5CFDA 1K5MB 5C9AB 4N43A 1PVC2 4GB31 1QJU3 4Q4Y3 2R043 4PDWB 1CJDA 1K5MC 4Y5Z0 5A32B 5FOJB 1RUI3 4GB32 1HRV2 1TME3 1AYN3 1SMVA 4JGYC 1H8TA 1RUC1 4PDWC 1NA1A 1HQNA 3NAPC 3JBG1 5CFDC 1ASJ1 1PO23 4N53A 4YVWB 3VBUB 1F8VA 1RUC2 1EV13 2PLV3 4JGZB 3JBG2 1VB2A 4CDXC 1NY71 1FPN1 1ASJ2 5BNOB 1AR91 4YVWC 4CDWA 4JGZC 1RUD1 3VBRB 4WM7B 1NY72 1FPN2 1NA1C 5BNOC 1ND2B 1OPOA 3VBFC 1F2NA 3ZFEA 2XBO3 5CFCB 5ABJA 3VDDB 1PVC3 4WM8A 1RHI1 1RUD2 1QJY1 3VBRC 4WM7C 1AR81 2WS93 2MEV1 3ZFGB 4CEYB 5L7OB 3DPRA 2DF7A 2WFF2 1ND3A 1OHFA 3VDDC 5BNPB 1AL0G 5CFCC 1RHI2 4GB33 1HRV3 1QJY2 1AR71 1GFF2 4LLFA 1AR82 2R071 1RUJ1 1VBA1 2MEV2 5L7OC 4QPIC 1VRH2 1TMF1 1AR72 2GH8A 4QPGA 2R072 1OOPA 1RUJ2 1VBA2 1RUG1 1RUC3 3VBSC 1AR62 1QJU1 3JBG3 3DPRC 1ASJ3 2GSYA 1PIV1 3TN91 2HWC1 4RQPB 1FPN3 5D8AA 1AR93 1PIV2 3TN92 4RQPC 1RUD3 1POV0 3FBMA 5C4WA 5LK7B 4FTSA 1QJX1 1R092 1POV1 1RUH2 4YVSA 5BNNA 1RB8G 3J8F1 1NCRA 1RHI3 1QJY3 4Q4X1 1AL21 1AR83 4GH4A 2MEV3 2FZ2A 4AEDC 1MQTA 1VRH3 3J8F2 1AR73 1PGW1 2X5IB 1AL22 2R073 1K5MA 2RMU1 5C9AA 1B35B 1RUJ3 1VBA3 4CDQB 5C4WC 4Q4V1 1HXS1 4YVSC 1CD3G 1TMF3 1BBT1 4JGYA 1PGW2 2X5IC 3CJIB 1ZBA2 4PDWA 2RS32 2RMU2 2IZWA 1RUG3 4Q4V2 2ZAHA 1HXS2 2RS11 4GH4C 5C8CC 4IV3B 5K0UB 4FTEA 1RVF1 1BBT2 1HRV1 1MQTC 3HAGA 4CDXA 2HWE1 1PIV3 1MEC1 5DDJ2 2RS12 3TN93 5C9AC 5K0UC 1M06G 2HWC3 1RVF2 4YVWA 3VBUA 1RUH3 4RFT0 1NOVA 4JGZA 1V9U2 2HWE2 1MEC2 5BNOA 2R061 3VBFA 1QJX3 1POV3 2BBVA 1RMU2 3VBRA 4WM7A 1X36A 3J8F3 2R062 4Q4X3 1AL23 1AYM1 5CFCA 3S6PA 3VDDA 5AC91 4RR3B 3VBUC 2RM22 5A33B 2BUKA 3ZFGA 4CEYA 1IHMA 5L7OA 2RS33 2RMU3 4QPIA 1AYM2 5AC92 5BNPA 4RR3C 4Q4V3 1HXS3 2WFF1 1E57A 1BBT3 2HWB1 3VBSA 3VBOB 1FOD1 1ND2C 4RS5B 2RS13 1VRH1 1EAH1 5ACA1 1RVF3 4N53B 2WZR2 5JZGB 1ZBE1 2HWB2 1V9U3 1FOD2 3VBOC 3ZFGC 3IDEA 4CEYC 4RHV1 2HWE3 4CDUB 1MEC3 4RS5C 3M8LA 1AR61 1EAH2 2HWF1 5ACA2 5BNPC 2XPJA 1VBC1 1COV2 3JD71 1ZBE2 2RS51 1FMD2 2ZTNA 2HWD2 4CDWB 3ZFFB 4RQPA 1D4M1 4NWWA 1C8NA 1VBE2 4RHV2 2HWF2 2R063 1VBC2 3JD72 2RS52 3ZFFC 5ABJB 1D4M2 1HRI1 4EJRA 1RUH1 1R091 1AYM3 4AEDA 1Z7S1 5AC93 2QQPA 1HRI2 2RR11 1BEV2 4FTBA 1Z7S2 5FMOS 2X5IA 2WFF3 3VBHB 2VQ0A 2RR12 5C8CA 2HWB3 1FOD3 5ACA3 1EAH3 4CEWB 3VBHC 2FZ1A 1ZBE3 1ZBA1 1RUI2 1FMD3 2RS31 5K0UA 4IV3A 5J96B 4RHV3 1AR63 2HWF3 4CEWC 2ZZQA 4Q4W1 1PO11 1VBC3 4GMP1 3JD73 1PGL2 2RS53 5A32A 1B35C 1PO22 1D4M3 4CDQC 1RUF1 5DDJ1 1NCQB 1VBD1 4Q4W2 1PO12 3CJIC 1QQP1 1V9U1 1RUF2 1NCQC 4IV3C 1VBD2 1HRI3 1R093 1R081 1QQP2 1Z7S3 1RMU1 4IV1B 1DDLA 2WWSA 1RUE1 2XBO2 4SBVA 4RR3A 4Z92B 2RR13 1R082 1C8M1 4IV1C 2WS92 4JGYB 5A33A 1AUYA 1RUE2 3JB8A 2RM21 1ND2A 3NAPB 5CFDB 1W39A 4N43B 1C8M2 2BPA2 3VBOA 1ZBA3 2WLPA 4RS5A 4CDXB 4N43C 4Y4YA 5JZGA 2BFUS 2WZR1 4Q4W3 1PO13 4GMP3 1BMV1 1NG0A 4BCUA 4CDUA 1H8TB 1NA1B 1RUF3 5DDJ3 3VBFB 5J98B 1VBD3 3ZFFA 1COV1 1BMV2 1FMD1 2HWD1 1H8TC 1QQP3 1VBE1 1AR92 4N53C 5JZGC 2BFUL 1X33A 1R083 1VBB1 1RMU3 4CDUC 1HX6A 2TBVA 1R1A1 1RUE3 4QPIB 3ZFEB
chains in the Genus database with same CATH superfamily
4XQ4A 5T50A 4V2WA 4QKNA 4CDWC 3I2KA 1VBB2 3UL2A 1JOJA 2OQ7A 5E6HA 5AVPA 3C2UA 3ZN5A 3VGIA 1R1A2 4X8NA 1ULPA 1WZXA 2K2SA 1V70A 2C26A 2GC3A 3DPRB 4FPJA 5D2AA 1YRZA 3NSTA 3IAQA 5LBFA 3C7FA 5A3OA 3O0VA 2JJ6A 3ATGA 4FPFA 4UYBA 1O3QA 2YXSA 1O8SA 5FR3A 1O3SA 3OBZA 4FT8A 1JTZX 1MACA 4JQTA 3K4DA 2PFWA 3OF1A 3W5NA 4CEWA 3T2QA 2R041 3WEZA 1DP0A 1GOHA 2W0XA 2Q0AA 4LOSA 1UPSA 3T2PA 1FYUA 4QPGB 1B35A 3FZ3A 2VMGA 3Q8FA 4R9BA 2GC0A 3WDUA 4CDQA 1WLDA 4WVMA 5JUVA 1PVXA 3K48A 2ZEWA 3USSA 3ZOIA 2VQUA 4Q4Y2 1CJPA 3OCPA 4R4ZA 3OG2A 5JMCA 4UT5A 4QXCA 1OBNA 3GJBA 4GWNA 1IQDC 4OMCA 2D3SA 2HWC2 2Y26A 1TME2 1AYN2 1I6XA 4BMBA 4GMP0 3LOIA 1QJZA 3K4AA 5D8AB 2DTWA 3KCXA 2FD8A 4XCBA 3H0OA 3RJ2X 4AZZA 5LA0A 4BXSV 2ZMLA 1KJLA 2BDRA 2WNVC 3POBA 3JCIA 4UAPA 3RQ0A 1EV12 3A0NA 2PLV2 3PJYA 4P9GA 1A6CA 1XYOA 4DNYA 3IMNA 3H1WA 3LEKA 4FAHA 2DWRA 1FI2A 2ZGKA 3P1IA 4AGRA 2FDIA 4MGKE 2RV9A 1XB9A 4ORFA 1W0PA 2VNVA 1YI7A 1OUSA 4D6RA 4XTPA 5BV6A 4M4RA 4META 3DYPA 3UYJA 5GKAC 5E16A 4BQ1A 1MQTB 2Y60A 2WS91 2YBSA 2HLEA 3NAPA 3W21A 4QMAA 3NJXA 5C9AB 2XUEA 4PI0A 1PVC2 1QJU3 4DXSA 5C8WA 1IKPA 3T2TA 4GKXA 5JIUA 4QM9A 1CR7A 1JUHA 4XZPA 4A6SA 3BTXA 2DCYA 4PDWB 2E6VA 4Y5Z0 2AUYA 4P5YA 4WVWA 1RUI3 5FZ7A 5ABJC 2Y34A 1JYWA 4XVHA 4BU2A 5F2SA 5LCWL 3V0BA 3UJQA 3U10A 1DGRN 2PHXA 2VZOA 2WAAA 5A7QA 4UF0B 2HYXA 3K2OA 1DF0A 5CFDC 3JBG1 3MLKA 1QKQA 3RZZA 5FO9B 5JSRA 2BGCA 2FMYA 3GZTB 3PUSA 4YVWB 3ZXKA 4HKLA 4FOYA 3GYDA 1RUC2 3GZUC 4DPNA 1DZTA 3POEA 4PBOA 1ZZBA 3O1PA 3SISA 3GF6A 1TVGA 3HNBM 3LIGA 1VB2A 1HLCA 1NY71 4OCTA 1GOFA 5ANNA 5H9QA 1UXZA 2P5BA 2Q1FA 4NIDA 4H2AA 3AP5A 5KXDA 4DRVA 3O1UA 2WA4A 1EYBA 2ZGTA 1W05A 4CDWA 3V0AA 2ZX3A 4XURA 3H50A 3ZN6B 2YC2A 2PAKA 1ZZ8A 3I59A 1FPN2 2LUWA 1NA1C 2CGNA 1Q8QA 4XJ9A 3L2HA 4GD4A 4QXKA 1J1LA 5C33A 2XXZA 5JXIA 4FBFA 1D7PM 4YYOA 4LQRA 3AKPA 3LEMA 4O61A 1RHI1 1RUD2 2ILMA 3AL6A 3GBGA 5IVYA 3WX5A 5CISA 2WN2A 4KWUA 2PHRA 2MEV1 5FLIA 1N47A 2IC1A 2BYVE 1O4ZA 4LKEA 4QB2A 4L11A 1AL0G 4KWKA 4LTAA 4ET7A 1HRV3 1AX1A 1H2NA 2JB8A 2XJPA 2QQOA 1NKGA 3EHKA 3SHRA 3NWKA 2EXIA 5A6QA 1RUJ1 1VRBA 3ZVXA 4Y1YA 4LE3A 2BNNA 3GHMA 1O6UA 1WBFA 5FMDA 3ZSMA 1H9WA 4GWIA 1T2XA 5FOBB 5HXMA 1QIQA 1CIYA 5JMOA 1A8DA 1VBA2 3LFIA 4Y1XA 4GXLA 4QKFA 4LHSA 1UU6A 1QJU1 4Y24A 3DPRC 4JRAA 5FZ4A 1UQXA 4R52A 3EB7A 1NE6A 1U5IA 3PIGA 2VCCA 2UURA 4E4DX 2BRTA 3ZYHA 1H2KA 3Q8BA 1DGWX 3MIHA 5IATA 2VW1A 5B2GB 1XNCA 2WNVA 3IMMA 3WUCA 4A41A 3MICA 3WT3A 2WUHA 4BPZA 4H7LA 4IE4A 4Y22A 4M3CB 1GLHA 1XNKA 2XOMA 4CSWA 3ZXGA 1UU4A 1H6XA 3CU7A 3EBRA 5C4WA 4B7KA 5FJKA 4CA9A 5GZEA 1O4TA 3TRSB 2UU8A 1AXZA 1X9PA 2AH2A 2RJ2A 4AI3A 1RB8G 2YPJA 2D44A 3AVRA 2W1QA 3ZYFA 1QJY3 1VALA 1AHSA 1GU3A 4YW1A 5EHDA 2H6BA 2Y6GA 4GH4A 2CHHA 4K1ZA 2C5DA 2FZ2A 1JMUB 4CP9B 2W46A 5CKQA 1ZM1A 4Q8LA 1VRH3 1UMHA 1S4CA 1W9TA 5KHKA 4XBQA 1AR73 1KRIA 2X5IB 1S2EA 3ZMOA 2R073 3QACA 2DBIA 1CX4A 1HXS1 5FZLA 3BU7A 3KV9A 1TMF3 4Q5OA 1OFNA 1LU1A 4CVUA 4XC9A 1CWPA 2AACA 4NUBA 2W39A 1DLCA 2LS6A 5A1FA 1YIFA 2XLGA 2JX9A 4KG8A 5C71A 5A70A 4Q4V2 1W28A 4MLOA 2WNUC 4S2FA 3HIFA 3K3OA 2ARBA 1HRV1 3WW3A 5LEJA 1MQTC 2Q5TA 3NJVA 5B4NA 2KD7A 3AYDA 2MPFA 1GANA 3I2FA 4GIQA 1HB1A 5HI0A 3NJYA 1PIV3 1RJ8A 1MEC1 4V1PA 2RS12 4KQ7A 3TN93 5C9AC 5IVFA 5K0UC 1CAXB 2A3WA 3M70A 5A7WA 1SBFA 1Y43B 3ZN4A 1YIPA 3GBWA 3WINE 5IHRA 3WG4A 4BDVB 2Y6FA 4M00A 4MSVA 4KWJA 4Q0UA 4XPVA 3NNGA 4NHXA 1QJX3 2EALA 1POV3 3J9SA 3ZO0B 4AFBA 3MUZ1 1C4RA 4JKKA 4LK6A 1CZVA 4I02A 5EWSA 5FZ6A 3IT8A 2ZGUA 4UFIA 1WLTA 4QHOA 5KBFA 3J8F3 4Y33A 3O14A 4E4HA 2SLIA 5GZFA 3FBYA 2VBBA 2W95A 4JX0A 4Q4X3 5F1RA 1QH6A 2ZACA 1AYM1 1LTEA 3AMQA 3S6PA 5AC91 2VMCA 1H4GA 4OQ9A 4DY3A 2RDRA 1JZ3A 1BVP1 4FFFA 2JG8B 4I0WB 3UGHA 3A0KA 3L2YA 2VMDA 2D6PA 2RS33 2RMU3 2Y38A 5EIYB 5L9RA 3Q9OA 2WSVA 1OLME 3POSA 4QAWA 1AXYA 3ZM8A 4M3CF 5FPVA 1E57A 1BBT3 1VJ2A 4IGOA 1NUKA 1PHMA 4DUWA 4XAEA 4BZ4A 2JDMA 2WBKA 2WO2A 3QH6A 1ENSA 2WFPA 4LKFA 1U5XA 3SXWA 2AENA 3WF2A 3LF7A 4COUA 3RRDA 2QQMA 1VRH1 1XE8A 4FPLA 1LNSA 5T54A 3OYWA 4N53B 4AI8A 1CAVB 1LCLA 4XHBA 4DMIA 2HWB2 3LEIA 1HDKA 4L0PA 1V9U3 2VOWA 2VC9A 2BW8A 2WT2A 4RHV1 1ST8A 2HWE3 2ES3A 5IVBA 3M8LA 1EAH2 4WVZA 4UXAA 4DEQA 4KU7A 4CUBA 2RS51 3AP7A 4I3GA 5C3QA 3BUCA 4QQOA 3ZFFB 4ES9A 1UX6A 1YLLA 1UZYA 5B4XA 2G1MA 4LUMA 4I30A 3OPZA 1NX9A 4XQWA 1RIRA 4FPKA 4KBBA 2R063 1VBC2 1XU2A 3RSJA 1SBDA 1O5UA 3WUDA 1MS8A 2Y6HA 4CRQA 1WD4A 4HANA 2BWAA 4LA3A 5EPAA 5FK7A 1OUXA 4QWNA 2DV9A 4Q29A 1DU3D 3R4SA 4C91A 1HRI1 3J7MA 4EJRA 1ULDA 5BPXA 1R091 1QNWA 3LEGA 4AOCA 1OVPA 1Z7S1 4RSUA 3C3VA 2UWBA 4DFSA 4ZONA 1VMJA 2DVBA 2RR11 5J7MA 1S1AA 1IGOA 2I45A 1F9KA 1V6IA 3I54A 3DF0A 4GZ9A 4DOUA 1N1YA 1S0EA 1DZQA 1NQJA 1WWYA 2HYKA 5L73A 3OEAA 2DYCA 5DMYA 3KZ4C 1ODMA 5A7SA 1EUTA 2CTVA 3WF4A 3OGSA 4DINB 1S0IA 2WNUA 5BNQA 2ZAAA 2VTXA 3PUIA 1W9YA 1XOYA 2XKPA 1ZZ7A 3IDBB 4NHYA 3WDYA 3VBHC 4CEWB 5ACA3 4AEMA 2FZ1A 1ZBE3 5IUQA 1RUI2 3HOBA 4O7XA 3LD8A 2RS31 5F39A 4LJHA 4IV3A 5K0UA 2BOJA 4WVMB 5G05L 2D6NA 3HR9A 3OBAA 3VZKA 3D4KA 1PO11 3HQUA 5IAXA 1PGL2 5F3CA 4WV8A 4LITA 4NIIA 2A75A 3R05A 4ARXA 1YQ8A 1D4M3 2VO5A 4XIOA 1JOBA 5EV7A 2Y6LA 5DUWA 3T30A 4TZDA 2JECA 3I3BA 2J1AA 1UIKA 1F5JA 1Q3EA 1QQP1 1V9U1 1MZEA 2EXHA 3O0WA 1FV2A 3OUHA 4IE7A 2ETEA 4K3UA 1VMHA 2NMOA 1VBD2 3H1YA 2Y6KA 4XUOA 3VZLA 3J7LA 4QX7A 5A80A 5KXBA 3VZJA 1RMU1 1V6NA 4YWAA 3MFAA 2VULA 2YY1A 2AZ5A 3MO4A 1W2NA 3OEBA 5LW9A 1ENRA 2FQPA 1ZA4A 2VGDA 3I2HA 4SBVA 4WVVA 3UV9A 4RD7A 3IN9A 4QB1A 5LK5A 4NE9A 4CP2A 3SEEA 5FQ0A 5E8AA 4Z92B 1KDKA 3ZN6A 1UY2A 5A3MA 5FLJA 1C8M1 4IV1C 4ZPIA 5HCBA 5J3UA 2LALA 4Y26A 1AUYA 1RUE2 3JB8A 1IQAA 2D43A 3WQBA 3S30A 5JXJA 2E33A 3NAPB 2MNGA 2Q1MA 1W39A 4OULA 2ZGMA 1WCUA 5E89A 2Y6JA 3UGFA 5FYCA 2K0GA 4LHNA 3WQ7A 3WV6A 2ZGNA 1OFSA 1SFNA 1SLAA 3KHBA 4Q8KA 2ERFA 3LIHA 1ZBA3 1XNDA 2WLPA 2F4LA 2FCVA 2UWAA 2AREA 4AVSA 3DL3A 3DXUA 3HNYM 5A7PA 3O1RA 3IZOA 3WCRA 4ZKTB 3V0BB 2JG8C 4GMP3 3NV4A 4PQQA 3RZMA 5DAPA 3M1HA 5DUXA 4ATFA 2EVXA 1SHWB 4OLLA 4P9IA 4NIHA 1RUF3 2VZRA 4CCEA 4NHMA 3FFZA 2LW8A 3D82A 4D7TA 3LSEA 2A3YA 3SNMA 5HBAA 1K5JA 1TEIA 1H8TC 4YM2A 3KT1A 4QXHA 1LU2A 3MBWA 4SLIA 2NMNA 5CU1A 1PZ9A 4N53C 2X05A 3G6JB 2WYSA 3H8XA 4HK9A 2BFUL 1X33A 4BOWA 2X09A 4E8CA 3T0BA 1ZX5A 1R083 3EQEA 3V0AB 1VBB1 2XWBB 3QLQA 4UFMA 3I59B 5ANQA 3GGLA 1R1A1 4JKMA 4NN0A 4TTGA 1GQHA 4QPIB 5FMCA 4N8MA 4M3CA 1O91A 4AI0A 1QY4A 2FCTA 4AHXA 2WR9A 2CAVA 1G7YA 3M2MA 4P00B 3N4MA 4FSJA 3WY6A 3NQHA 5FXXA 4V2VA 2YPDA 3AP6A 2EAAA 3LWCA 1VPHA 4LO4B 2BGPA 3KCYA 4XDOA 3VBSB 1BEV1 1SLBA 1VMFA 3HQXA 4E4ZA 4AWDA 2ZGQA 3E6DA 3VBHA 1ULCA 1UD1A 1LHNA 4AVCA 2OVUA 2VH9A 2JDKA 1DQ6A 3HBZA 4QD2A 2WYFA 1TMF2 3ZMNA 3F2ZA 4N7IA 4A4AA 3KSCA 2VZVA 4Q4Y1 1ND3C 1GP4A 3INAA 3CHXA 1T6GC 1ZRRA 2VBDA 2ZEZA 5BY5A 1L7RA 1JHJA 5T5LA 4AI1A 1ZRFA 2WZR3 1ULFA 4NRMA 1C5HA 2V5DA 1LEDA 2D7FA 3KD4A 4QB6A 4PLNA 4FPYA 3FLTA 1TME1 1AYN1 2A3XA 5JSOA 3PHMA 3AFGA 2E9QA 1VB4A 2NM1A 5F8PA 4PLMA 4QM8A 5IJRA 4IGPA 1COV3 1DGLA 1RXGA 5JSPA 1LEMA 4N7UA 5A7OA 4A44A 4BISA 5GZGA 3IBMA 1O3RA 2WDBA 3CNAA 3ZXAC 2FDHA 1XNTA 4Q0VA 3T0DA 2DVGA 1WCDJ 4UFLA 2WNVB 2KM2A 4IE0A 1EV11 2VR4A 2PLV1 1CESA 1MZ6A 3H8UA 5EYYA 5J09A 2UY8A 2I74A 4HSJA 5FXVA 4HG6B 1DFQA 1QJX2 1YFUA 3VDBA 1KD7A 3ZIXA 1D2SA 5C4WB 3DYMA 2IXJA 4LMFA 1OH4A 2G9FA 5DAXA 4IV1A 4YG6A 1REFA 5DUUA 5FYYA 3O7OA 1AX0A 1QWRA 3B02A 4Q4X2 1MR5A 3TAYA 5KR7A 2CYFA 4K9SA 4CYDA 3K77A 1R64A 2XBO1 4GH4B 1LRHA 4UWDA 5T5PA 1PVC1 1K42A 1UXXX 4Q0QA 1V6LA 2GC1A 3CZJA 4NAOA 4UFJA 2N7GA 4CU6A 1DYOA 1NCRC 1QXJA 4PI2A 5FP8A 3T0AA 5DN2A 5AFBA 2OS2A 1QU0A 1SG3A 2YDEA 1MS4A 3OPTA 2ZZJA 1WLCA 1LOCA 1CN1A 4LOTA 2R043 2JG8A 4NRPA 4M01A 1C1FA 1J84A 2P3IA 2GMMA 3MGUA 4WZFA 4CXXA 4PCRA 3P6BA 2Q8EA 1OURA 2XJSA 4MO3M 2P3YA 4GB32 5I0DA 2P4EA 2GH2A 2ZHKA 5FZEA 4AFMA 4H7MA 1LOGA 3NVCA 2J1VA 1SMVA 1I9RA 4JHTA 3E5XA 1H8TA 1RUC1 4QX2A 2VE1A 3O1MA 3MV01 2VMFA 3B9IA 1WCSA 1CAWA 4HETA 1KFXL 3NAPC 1V6KA 4ZU7A 3M7AA 5KC5A 2FDKA 3LGRA 1D0GA 3TBDA 4BA6A 1S55A 2R49A 3NNMA 4N53A 2BU9A 5FPXA 1CAVA 5A7WB 3WQ0A 1C57A 3KV6A 3WF3A 3H1MA 2FDFA 1GWLA 5FDBA 4HLTA 4IEOA 3AM2A 1FPN1 1ASJ2 5HV4A 2B42B 3ZDSA 4YFZA 1AR91 4YW6A 2AEZA 3WDXA 4DO0A 3WHUA 1PZ8A 4IE5A 4JGZC 1RUD1 3AVSA 1H4HA 1K12A 4BLJA 2ZX4A 5DAVA 4DS0A 3B01A 4H55A 4C0HA 5BNOC 4LO6B 5GJ6A 3WG2A 3E6CC 3NKGA 1ND2B 5T5OA 3WG3A 3RZGA 1F2NA 3HMYA 4K40A 2Z69A 1X82A 2WZEA 1LKNA 1PNFA 1SFPA 3GALA 5GLZA 1KFUL 1KJRA 5FP7A 5H9SA 3VBRC 2W47A 1YQ5A 3MIGA 3AKTA 2X10A 3NV1A 4OI1A 4XAAA 2WS93 4YZ1A 5M0TA 3N36A 2VNGA 3THPA 4L97A 2ZHLA 3BIWE 1C5IA 3HD8B 1FNZA 2DF7A 5CFCC 1ND3A 1OHFA 4CCOA 2ID4A 4GJZA 3IDAA 1AR82 5BXXA 1VBA1 1H1IA 5FZGA 4QQPA 1BK1A 2VZ3A 1CQ9A 5L7OC 5JOYA 4QPIC 1N3QA 1IOAA 2VVEA 2FDJA 2VUDA 3RG0A 5I91A 3IIAA 5TSWA 3MF6A 3U0ZA 3OYWB 1W90A 2VCAA 1H8VA 4YZ2A 2CU5A 3MF9A 2IFRA 1RUG1 5A3LA 3VBSC 1Q5OA 4EV0A 5DAQA 1ACCA 2XG3A 3JBG3 3PVEA 1OT5A 3SITA 2QQJA 2GSYA 1GNHA 2A6XA 2ZBJA 1SLCA 1VLNA 2F4PA 4XFBA 4EQVA 4HONA 2VNOA 3WVJA 3KT4A 4QPYA 5FPAA 1SPPA 1F4HA 1CIWA 3E6BA 5J37A 4AXOA 2AR6A 5A7NA 4XUTA 2ZMNA 1YO8A 4TLGA 1W6PB 5FK8A 1FATA 1I5ZA 3PU3A 5EJ3A 4Z82A 2QFEA 2X53S 1RUH2 2UYAA 4Q26A 4R9AA 3PU8A 4FPGA 1UY0A 4XUPA 3W5MA 2WT1A 4Q0PA 2VOXA 1TE1B 2FCUA 5C3SA 1UOJA 1NCRA 1RHI3 2GN7A 1DYKA 2JXAA 4QGMA 4QQLA 3QCWA 5HCFA 1LGCA 2MEV3 3AYAA 2EXKA 1W2OA 4IDZA 5JIAA 1PK6A 3RYPA 4NMIA 1NLQA 4MGQA 1BHGA 4ITCA 1ZZ9A 2PHFA 1J59A 2BJSA 2V5YA 4LO5B 5I8SA 2ZPXA 5L9BA 1AL22 1G9AA 4ASLA 1RUJ3 5EJ1B 4D69A 5FTTC 5C4WC 3N9OA 1KGYA 4JCKA 4Q4V1 4QGNA 2WNUB 5IK5A 2PQQA 1Q8VA 3RZJA 1PMJX 2ZABA 2JKBA 1ZBA2 1W3XA 4OMDA 3VKFC 1AF9A 1MS5A 2EAKA 1QF3A 5FIXA 4GH4C 2RS11 4FTEA 3AP9A 4IV3B 1OQ1A 3GBFA 4PHZA 1UY4A 1YCIA 4BH9A 5K0UB 1FT9A 4X8PA 3NMBA 4IXLA 3WG1A 4JDNA 4XACA 1OSGA 2R0HA 2ZX2A 1LOBA 1OLQA 4KMQA 3WP3A 4X6QB 4XW3A 5CKMA 3VUOA 4BQXA 2HEYF 3AMHA 1RVF2 4FFGA 4M4PA 5FZDA 5FBJA 1GZWA 2W5FA 3HNMA 4W6YA 5FUIA 3HEIA 5FV3A 4AAPA 1BKZA 5FKBA 4CCNA 3AZYA 5CADA 4JGZA 5F5QA 1JYXA 2WWJA 5BNOA 3T2OA 5SV5A 1YUDA 4BWOA 3AMPA 2R16A 3VHOA 1LHVA 1VIWB 3ELNA 2GNDA 4JRLA 5DABA 1WW4A 1F5FA 2W92A 4WBBA 3VBRA 1WCQA 1A78A 3N35A 1E5HA 1W8ZA 1YQCA 4RFRB 3U4SA 4ASKA 1WMFA 2XL9A 1O7FA 4J1XA 5CFCA 1H1AA 1BQPA 3MI8A 5FQ0B 5CB7A 3AKRA 4M0NA 1N1SA 3ZFGA 4QDQA 1IHMA 1SDDB 1W2UA 2LM3A 3GM8A 5L7OA 2XLAA 4QPIA 2X8KA 2Q8OA 1HXS3 3C7GA 2WFF1 1N3OA 3PTRB 3U37A 4F3JA 2J42A 4E9KA 3ZDVA 2HWB1 3J4UH 3VBSA 1ND2C 1W8TA 3RI8A 1S2BA 2QJVA 1JS9A 3H3UA 3NV3A 1E5SA 4NIAA 1URXA 1DQ1A 1EAH1 2WZR2 3T09A 4E2SA 2XJRA 4OVEA 3W9AA 2JEMA 4B1MA 3VBOC 1FOD2 4CU9A 3ZXDA 3IDEA 4LBNA 3ZYRA 1F35A 4RL7A 3BALA 1QOOA 1MEC3 1UCXA 3FE5A 4RS5C 4AFCA 3MPBA 1AR61 4EN9B 5FY7A 4FAGA 1VBC1 1COV2 4CE8A 1JXNA 1RJ7A 1FMD2 1Y3TA 2ZTNA 3IB3A 4QX1A 2XMLA 1YXWA 5DG1A 4HFSA 3B93A 5FZHA 3NNJA 3RNSA 5ISLA 5CEHA 4IEXA 2LTNA 1DQ2A 2DFBA 1H1MA 2HWF2 3OOXA 4GWJA 2VUCA 1GSLA 3GCXA 5EYXA 3KHCA 3JD72 3OY8A 1S0JA 3KB5A 3WW2A 3ZKYA 1TNFA 5FYVA 4TWTA 5ABJB 1X8EA 2JDYA 2WO7A 2DVAA 2QQLA 3LPFA 1OF4A 4P08A 2GNBA 2A6WA 2A7AA 2O14A 2PMWB 3AJZA 1SQ4A 5LZ6A 4CUAA 3T3YA 2WO1A 5FZ1A 1AYM3 2DU0A 4FPOB 5AC93 4IEPA 4CU8A 1G86A 1RTVA 5JDBA 1XSQA 4A3ZA 5FZOA 3MIEA 1GZ9A 4FTBA 3KVAA 3PLQA 5F3GA 4ATEA 2P2KA 2DU1A 1OC1A 2RG4A 3J7NA 5J36A 4LT5A 1UMZA 3SCHA 2DCJA 3VBHB 1YJLA 2OUHA 3I2IA 2ZJCA 3AMMA 3ILRA 4K1YA 2WKKA 2VQ0A 2PHLA 4FTSA 2VW0A 4G9SB 5FCCA 1LOAA 5HCAA 1SLIA 2DUPA 4N90A 5FP9A 5FY5A 4UF0A 1C1LA 3X29B 3UK9A 4YGEA 3A4UA 5JPMB 1QJEA 4QHBA 3ZYJB 3O1OA 2PHUA 2PQSA 2Q1ZB 1QEXA 3NKTA 5I8TA 3RDIA 3TNQA 3FHAA 5FY8A 4RHV3 1QH7A 2BNMA 3ZXEA 1YNAA 4UI9L 3WDTA 2ZZQA 2JDNA 1LAJA 5I0UA 1HKDA 2IXHA 2RS53 3BPZA 3BOPA 3ZYIB 5LASA 3FUOA 3BPSA 1LENA 3VL8A 4LBLA 5FWEA 4IESA 3AP4A 3LKJA 5DDJ1 1J1TA 1YQ2A 2OT7A 1AXKA 1LHOA 2ZX0A 3S5AA 1VBD1 1YJKA 5C3RA 3TEXA 4MXWA 4Q4W2 2VZTA 1JZ8A 2Z79A 1UYZA 5FRAA 3G7DA 2WINB 3C8XA 5CNAA 3UNPA 1LB2A 1NCQC 4IV3C 2CWMA 2QDNA 4MVTA 1HRI3 3KWVA 4M3CE 5F32A 1B09A 1R093 1GQGA 5KHIA 3BTYA 1Z7S3 1HB2A 1QHDA 1BLZA 1RXFA 3FUQA 2OW4A 2WNEA 3GXUA 2RDSA 4IV1B 5F6KA 2Q8DA 1QDOA 2W3JA 3IPVA 3DYOA 1RUE1 4YLZA 3GDBA 4LBQD 3WDVA 4ASMB 3JQXA 2RR13 5DPNA 1DGWA 2G9GA 3PNAA 2GP5A 2R0FA 4Z8BA 3LDRA 2WS92 4JGYB 4FP2A 4LBOA 4LIUA 2J22A 2VVFA 4YFWA 2YU1A 5DXDA 2RJLA 2RM21 1ND2A 3EXUA 5EQUA 4OHZA 2HJIA 2YGMA 1G9BA 4Z07A 2AC1A 1UZVA 2OXBA 2VXRA 4HKWA 4BE3A 2BPA2 1MS3A 2DBNA 1JOPA 2YMZA 1ENQA 4YM1A 4WZCA 4ZS3A 2VU9A 5F9TA 2ZGRA 5FXWA 4QKDA 3VBOA 3PTYA 1PX4A 2BVVA 3WDWA 4L92A 4RS5A 4FCAA 3GHNA 5BUVA 3N7MA 1Z78A 4ZZ8A 1W6QB 5JZGA 4DQAA 2KA3A 1HIXA 4HN0A 4OUMA 3DKQA 3CZUA 3SCGA 1PO13 2YGLA 3WF0A 2ZEXA 3KGLA 1H8TB 5LA9A 3WNNA 2Z5WA 5F5AA 4TN7A 1CAWB 1XC6A 4LBQA 1KITA 1CPNA 3JQWA 3NW4A 2BP6A 4XE9A 5FZIA 5J98B 3TYJA 4ZZ5A 2Q4SA 2GNTA 2R6QA 4GA9A 1BMV2 2DUQA 1AVBA 3TEYA 2HWD1 2ADEA 3FN9A 1QQP3 4D0QA 2O8QA 4OFGA 1VBE1 3HT2A 3ZKUA 2ET1A 3WCSA 4ZXEA 4QKBA 4R9CA 2XVLA 4EROA 4FFIA 4MGZE 2B45X 3I3DA 3JZVA 3DV8A 2CGPA 2D5FA 4XABA 1RMU3 1YEWA 1GICA 1LESA 1UL9A 4U2AA 5C5TA 3CIHA 4KWLA 4QX8A 2WLQA 5E88A 2CV6A 4HPKA 4D6SA 5IAVA 3BI3A 3ZYBA 4ISQA 1W6PA 2ZKLA 4P9YA 1C8M3 3JB4C 4QQ2A 1FV3A 3N9PA 4PIYA 3A23A 1W8FA 3ILFA 4C90A 3RJRA 5FZCA 1DIWA 2H0VA 5FBZA 1V6OA 4LHLA 3RZLA 1ND3B 1UAIA 2CDOA 2RVAA 4L99A 3MUY1 4WM8C 3VHRA 1J58A 4HVQA 4YGCA 5KXCA 2C24A 3HPNA 5H9RA 1MZFA 3U07A 3GZAA 3BIEA 5FREA 5IT6A 4XFCA 4YZ4A 4NIGA 4AL9A 5KWRA 4L8QA 4YG3A 3UJOA 4EWDA 5FYUA 1EY2A 3FLPA 2P37A 4NPLA 1JUIA 1QJU2 4FPEA 1JYVA 3BU0A 5GALA 1ZRIA 2OA2A 3OGJA 1Y9GA 2AGSA 4EWAA 3ME2A 4Y5SA 2PAEA 2D40A 1UU5A 1OOPC 3ZXLA 1GP5A 2HBTA 5A3TA 3LOBA 1GZCA 2ZGPA 3SKVA 1NCQA 1PO21 2WWUA 4NWVA 2XH6A 4RN5A 1QOSA 1SPPB 3M3EA 5FMOL 4TSVA 4MG2A 3AZZA 4BQWA 4AEDB 3I3EA 3KGZA 4J1WA 1ULGA 1UIJA 4OYUA 2P1BA 1J83A 2H0BA 1ODNA 1VBB3 2J1SA 2XHNA 3JXSA 1QXRA 4FQ4A 1OI6A 4AE2A 1LJ7A 3F95A 1R1A3 2NPIA 5JLVA 3THDA 4W50A 4D3WA 2XJVA 3PMSA 3VV1A 3JU9A 4B29A 4JV4A 2JDUA 3D6EA 2CL2A 4HT1T 1YC61 1NCRB 1MS0A 3ENRA 1EPWA 5EFUA 5LA2A 4I2OA 3KQ4B 3KLSA 3VZNA 5C8CB 5A6ZA 2EA7A 2PXJA 1BEV3 4PF1A 4U36A 4GULA 5BNNC 1PK6B 5FWJA 4XF9A 2PHTA 5FUPA 4FVVA 4QU2A 3POFA 4LLOA 1OA2A 4FXKB 2WT0A 1IS5A 1M4WA 3PMEA 1KS4A 3BTZA 4OZOA 3AJYA 4GB31 2YC4A 3NNLA 2G4IA 1Y4WA 4NO4A 2CNAA 2Y8KA 1FXZA 3C7HA 4Q4Y3 4UBGA 3ETPA 2W94A 1H9PA 3HVDA 4AQSA 2YBKA 1K5MC 4FI9A 3BCWA 5A32B 2D97A 3WQ1A 4C0BA 5FOJB 2GALA 1HRV2 2ORZA 2VY0A 4X6RB 1TME3 1AYN3 1HQWA 2IXCA 1IG0A 3A21A 4BHPA 4CCKA 4CCJA 4JGYC 1REEA 5F3EA 1V6MA 1YFWA 1HB3A 3A7QA 3ZLIA 4NAMA 5FUNA 3WNOA 2XB6C 5JR2A 4E4SA 1HQNA 2G19A 2R1DA 4S2DA 1ASJ1 5IVJA 3N9NA 4XMIA 1IPJA 4BK4A 5CAZA 1ULEA 1GZWB 5GM0A 1D2QA 2XUMA 2WZPP 4LEJA 2D3RA 2RDNA 1NZIA 2XVKA 3IWZA 2JE8A 2J7MA 1EV13 1XE0A 2PLV3 4JGZB 4DZGA 3VKNA 3T1MA 3ACIA 3PVOA 1WCKA 2PELA 2R1BA 5BNOB 4KGGA 2WAOA 2VG9A 1NXMA 2JDPA 3B9CA 4MGSA 4OHXA 3PL0A 3PJQA 4NHKA 3ZYGA 1CAUA 1W8HA 3VBRB 2RDQA 2D3PA 3APBA 2ET7A 4IW3A 3ST7A 1W3VA 2K46A 3Q8AA 3WNKA 1OPOA 4A3XA 4D94A 2QNKA 3LB9A 1OA3A 2XBO3 2VCBA 3HN1A 3LSDA 4XJ8A 1OPMA 5ABJA 4LBKA 5CFCB 1PVC3 2BBAA 4WM8A 2HKXA 3MW2A 1HN0A 1CPMA 2P17A 4XFFA 1LHUA 4WM7C 5LBBA 4A42A 5HPOA 5K9YA 1AR81 4BB3A 1LR5A 3ZFGB 1XNAA 3SH4A 2H6CA 5L7OB 2IXIA 5G04L 1RINA 2UY9A 3VDDC 3IIIA 1QJY2 4FOQA 1AJOA 1GFF2 4BIOA 1OF3A 2HEWF 2QQIA 3FFQA 1QJFA 2OZ6A 5DQ0A 4BQ4A 3EYPA 1GV9A 4BJ0A 1C3HA 1XE7A 5A6XA 5ERLA 1JHNA 2BGOA 1VRH2 3FC0A 4OI2A 1AR72 4PF5A 4BXFA 2VZPA 5CA6A 2GH8A 2VAUA 2R072 1H6YA 1NLRA 1OOPA 2VMEA 4NPRA 4HVRA 4I01A 3R6SA 1RUC3 3WNPA 3MYXA 4GWMA 2A5ZA 2VL4A 3C7EA 3NNFA 4LR4A 3O12A 1HV0A 4Y4RA 3SC7X 5F2WA 3CF6E 1KDMA 1JH5A 3QH7A 4XOGA 4IEYA 4BQYA 2HWC1 4QPWA 1K45A 4ZY9A 1LECA 2MHFA 2DVDA 3LA7A 4H3WA 1FPN3 3WOGA 3NL1A 2F6BA 1FX5A 1UOFA 2JENA 2VNRA 4ZHNA 4XILA 2V72A 1AR93 1H0BA 3OY8B 3TB0A 1PIV2 2TNFA 4KL1A 3ROUA 3RWKX 3TN92 4RQPC 1RUD3 1SDWA 1POV0 3FBMA 3P3PA 3EJKA 5KC6A 3UESA 5JAXA 1UX7A 4COZA 5LK7B 3AMNA 1A8MA 1R092 2EIDA 2E7TA 2B5HA 2P3KA 4YVSA 4AQ6A 5C70A 3VD4A 3O1VA 5BNNA 1NZCA 2E53A 2JDZA 2ZXQA 5IFPA 1JYIA 5JI7A 1LGNA 2Y0IA 5LBCA 4XETA 4LPLA 4A7ZA 1AL21 4N9HA 3O5SA 1SBEA 5FZOB 3MIDA 3WF1A 1OKQA 1V00A 1W8NA 4Y3OA 2ZS6B 4AI9A 1OLMA 4AEDC 3J8F2 4FQZA 1XJAA 4LORA 5FYSA 1NYWA 3PUAA 1K5MA 2OUJA 1VR3A 4LE4A 1VBA3 1I5PA 1QMJA 4HXCA 1R1ZA 5FP4A 2VZUA 2EXJA 1CD3G 1L7LA 1XYPA 1U5ZA 3DCQA 5CZKA 4JGYA 5I8YA 2J1EA 1PGW2 2Z4FA 3I2JA 3CJIB 5AFEA 2RS32 2WNOA 2RMU2 1HJGA 2IVJA 2XWJB 2Z42A 4G4FA 3VD9A 4XXAA 2B46X 3H8OA 1RUG3 1DCSA 1S0BA 2ZAHA 3U1XA 5E1RA 2ZGSA 5C8CC 1RVF1 1BBT2 2CWSA 3FHIB 1W6OB 1PK6C 3RMYA 2JD9A 2KR2A 4NOTA 1XRUA 2DURA 5CYYA 5A1AA 2J1TA 5FPBA 3KV4A 1DLLA 4S2HA 5KHJA 3RYKA 1WMXA 2W2IA 3NJZA 4QU1A 5FAXA 1W6NA 1W6QA 3MLJA 3OTFA 4UW3A 1JZ5A 4QX5A 3S57A 4TXWA 1RGSA 2RJKA 3VBUA 3IAPA 4E8DA 4RFT0 2QQVA 4Q1RA 3I3MA 1NOVA 3BODA 4MXWB 1V9U2 1DQ5A 2PTMA 5I0RA 5FJHA 2HWE2 2VMIA 1W9FA 2W87A 4URAA 4JZRA 3OSDA 5A6YA 4B1LA 1UYYA 4YPJA 3U14A 2BERA 4COWA 4NVPA 1I1EA 3SLIA 1CONA 5FKCA 3SH5A 2JE9A 5JWPA 1RMU2 4CXYA 3THCA 4WM7A 1X36A 3KF3A 1IZ3A 2E51A 1RC6A 3ZPOA 1SACA 5J1XA 5A3PA 2R062 3I2OA 1W99A 3IPVB 3OD4A 4HVOA 4IEVA 3SMHA 1S0GA 4DUVA 1TG7A 1GWKA 2VECA 4XF0A 5FZBA 3VDDA 1WD3A 3WNXA 3DXTA 1P8JA 3WHTA 1O4YA 3AKQA 2K9ZA 3BGAA 4XFHA 4YNIA 3RS6A 2VM9A 3NO8A 4LKSA 3K75B 1LHWA 2VOVA 1HJFA 2BUKA 4CEYA 2QE3A 1JZ2A 1YWKA 3I7DA 5F7UA 1UOGA 5BNPA 4RR3C 1S0FA 2DCTA 2DCZA 4P9LA 2LRPA 4ISRA 4Q4V3 4URTA 2JG9C 4LBMA 4UW5A 3W20A 4XQDA 3POWA 5FYHA 1PNGA 1G9FA 3UT0A 4W65A 3D0JA 2VCMA 2PAMA 3VBOB 1FOD1 4MGYE 4AVBA 4YG0A 5LATA 3H42B 4RS5B 2RS13 2TUNA 1J3QA 5J48A 2WQ8A 3S5QA 1VP6A 2GZWA 5JZGB 4ARYA 3CEWA 4LKDA 3B3QE 3S7EA 4PLOA 4A2UA 5C3OA 3ORJA 5F5CA 3I49A 1YFYA 1UO9A 3ZFGC 5FMBA 2NLRA 3DKWA 5ACA2 4XF3A 2HWF1 1WUVA 3AZVA 2VOKA 5FFOC 3JD71 1ZBE2 4LBQB 4XJAA 3O1TA 1US2A 3U4XA 3ZX7A 2XJUA 4FPHA 4CXWA 1PGSA 4RQPA 3SKJE 1QXPA 4IE6A 3T08A 3ALQA 4QX0A 2P6HA 2IUWA 3AC0A 4P02B 3DN7A 5CVRA 3VKLA 2JDHA 3H3ZA 4RGAA 2BTVC 3N7KA 4HZFA 1JU4A 4BMEA 2VTXJ 3LAGA 1D4M2 1X9TA 3DUIA 4HBNA 4JAAA 1MVQA 1UNBA 2A6ZA 2GDFA 3BVCA 4XHXA 4NRQA 1UKRA 3D3AA 4MXVA 2W9XA 3BN6A 1T6BX 1XPWA 5FPLA 3MDPA 4AEDA 4HPKB 2QQPA 4AI2A 3M3CA 2YHJA 1XNBA 1QGLA 1UZZA 3AXEA 3LE0A 1BEV2 1OQEA 3ZSEA 4GJYA 1ULOA 3ZSJA 4OHYA 2VXJA 2WL1A 1Y7BA 5FMOS 4DIQA 4MGTA 1LULA 2WFF3 5A3WA 5CG9A 3WP5A 4OI4A 2JIGA 1W6MA 4P9WA 2V73A 5CKNA 1UKGA 1UF2C 2HWB3 4I0BA 4BK5A 5C8CA 4XJZA 4KH9A 1DGRA 2QTWB 5EZWA 1UYXA 1LGBA 2XR4A 4IETA 3NV2A 2V4AA 3N9MA 1EAH3 1V0AA 1NE4A 2B39A 2JWPA 3FL7A 2DCKA 2ZKNA 4L2NA 4MUVA 4RYDA 2GU9A 2EIEA 3P5BA 4LUKA 3R4UA 4CCLA 1UY1A 2UWCA 4LXLA 3CL1A 1ZA7A 2NP0A 3HQRA 1AR63 1DG6A 4JHZA 1GOGA 4Q4W1 4IGQA 1VBC3 2EIBA 2BQPA 2E7QA 4LO7A 4W8JA 1LOFC 1IKQA 5A32A 1GQPA 5EXOA 2CGOA 5FYMA 3VB9A 3N9QA 4J6GA 1NCQB 4AYUA 4AEKA 5IYYA 3RPQA 3CJIC 4HN1A 3GNEA 1CVNA 2GNMA 2OX0A 3KM5A 2V09A 1RUF2 4QXBA 1GNZA 4IEQA 2GMPA 4GQ7A 1PX3A 1BCXA 2QZ2A 5L19A 2XJTA 4R4XA 3RWNA 1EUUA 4OI0A 1DQ0A 1SCSA 4MV2A 1WW5A 4RGKA 5T52A 3POJA 1DDLA 3EMRA 2NN8A 4LA2A 4JQRA 2WWSA 5D21A 2E32A 4QT6A 3N3HA 5GZDA 3MLLA 1W8WA 2XBO2 1STMA 3KV5A 4XBNA 2ORXA 4RR3A 1REDA 2ZA9A 4QDRA 4B3NA 2WABA 5IW0A 4BM8A 2JG9A 2GAUA 1R082 1GYKA 3N7JA 3CDZB 4YGBA 3VZMA 3RFRA 5A33A 1W04A 1NAEA 3BB6A 1BVVA 1MS9A 3E97A 3OBTA 3THTA 3U11A 4CUCA 4YM0A 4RGGA 2ARCA 1VAVA 2W68A 4C8DA 3VD7A 1ONAA 1SEFA 4DXZA 2ZMKA 1ZZCA 4ES8A 4YZ5A 4OHVA 3LA3A 3MIBA 3MV11 4DUXA 1FNYA 3OGVA 4CDXB 5FO8B 2ZEYA 2FBEA 2A70A 5FY4A 1VAMA 4N43C 4Y4YA 5FO7B 4A7YA 3QD6A 2C9AA 3M3OA 4LULA 3IKWA 2BFUS 3R0RA 4IEUA 4I09A 2Z2SB 3MIFA 1BMV1 4BCUA 4YW7A 4CDUA 1UZWA 1JODA 3BYWA 3J26N 4AK3A 4AQ2A 1HW5A 2OIIA 3RZKA 1WW7A 3ACFA 3AL5A 2PHDA 5DDJ3 3VBFB 2YU2A 1VBD3 1PMIA 2RHPA 4LK7A 2PA7A 4K8FA 1POQA 4XCAA 4XEZA 3K46A 4MHRA 4LIVA 4OUEA 5H9PA 3WP4A 3WW1A 1GWMA 1RL3A 1AR92 3OJBA 2XGXA 2XDVA 4OZXA 2UYBA 2A73B 3CQOA 4KG0A 3ACLA 3DEMA 3ZPYA 4AVAA 2BWCA 3VKMA 5JZGC 1IPSA 4TLFA 3ZSKA 3RYRA 4XF1A 2G9ZA 3H8RA 1CAUB 2AYHA 2QCSB 2XKOA 4XXPA 2OKXA 1CGPA 2OYZA 2CSGA 4BQ2A 1ZRCA 2TBVA 1RUE3 1C28A 5FPUA 2XVGA 4XFIA 1ZNPA 1W06A 4YVSB 5FXZA 1RUNA 5FZ8A 4DY5A 4ZS2A 4CP0A 2WC2A 4AEJA 4WM8B 1ENXA 4W4ZA 1AZDA 2YB7A 4FP3A 2O1QA 1GZTA 2I2SA 5DAWA 3WNLA 4A45A 4CPBD 5D1IA 2RM23 2JIJA 4MADA 4AGVA 3ZFEC 3R4DB 4ZU5A 1WW6A 1MS1A 4CCDA 1IS4A 2WRAA 3P3NA 4UBHA 4D8MA 2J1RA 4PQ9A 3I8TA 1JZ7A 3AX4A 4XF4A 4YSFA 3S7IA 1DQ4A 2VTFA 3VD5A 3PURA 3PUQA 5AVAA 3RZHA 4IL7A 5DZFA 3H9AA 1LOFA 4KBZA 1OXCA 1RUG2 2XQRA 2ARAA 3OGRA 3FJSA 1OOPB 5IK7A 1RUI1 3ZYPA 2B7YA 3ASIA 1EP0A 1VAKA 4Z2WA 2R042 4MH0E 3E5UA 4IQPA 4Y20A 2YG0A 3CJIA 1W9WA 1XSRA 2VZ1A 2VMHA 4R8HA 4QPGC 1PGL1 1AX2A 1GP6A 1Z0HA 2HWD3 3ZR6A 4P9XA 4UFKA 1W6OA 1VBE3 4CPBA 3HWJA 3T1LA 2BNOA 3VL9A 5JPNB 4EE2A 3QBQA 3S0MA 5CIRA 3POGA 2NQYA 1UYPA 3MHZA 2QQKA 4CCMA 2L9LA 4H14A 4IUGA 2IXLA 2Y64A 5FPZA 1E5IA 1Y9MA 1SCRA 1N1TA 2P34A 3HJRA 5D8AC 2B9VA 2E63A 3H7YA 2ARXA 3LDBA 1OD5A 3OD0A 3POIA 4HK8A 4XBLA 3VKOA 4CCCA 5BNNB 1JYNA 3M3QA 3UKTA 4N9IA 2XONA 2O8OA 4P14A 5LB6A 3OUJA 4CP1A 2JE7A 3KT7A 3ZXFA 2WSUA 3Q8EA 1XU1A 2JDAA 2LROA 2C0ZA 2ADDA 1YHFA 1S0CA 3VDCA 2P6CA 3ETQA 1TNRA 4EYUA 5CFDA 2YV8A 1K5MB 1XQNA 4D7YA 2YUEA 4N43A 4BQ5A 2ZHMA 3L9JT 5LEKA 3M3IA 1UOBA 1Y9QA 2AEYA 4KGQA 1HN1A 3AYCA 1BK0A 3DECA 3ABZA 4CTEA 2NYYA 2C1FA 4BYYA 3POYA 1CJDA 1YQ6A 2ATFA 1GKBA 5FZ3A 5FZAA 5FP3A 4YW2A 3LQCA 4CU7A 1WGPA 2X29A 2DTYA 4OHWA 5BYNA 5C6CA 4QGLA 2ZCWA 1A3KA 3OUIA 3T4HB 2QDRA 2EF6A 4DRRA 4PDWC 1NA1A 2C9KA 2QVSB 4TYSA 3GCWA 1KS5A 2J1UA 5LWBA 2BVBA 1PO23 2Q30A 3TEWA 4XUQA 3WLUA 1W6NB 2CY6A 3H7JA 5JCTA 4JTOA 3MPPG 1FAYA 3VBUB 1F8VA 5FY1A 4UFHA 1UPIA 5LRSA 1JI6A 1XXNA 4FPCA 3U78A 4AVTA 1OMIA 3JBG2 2DDUA 1GUIA 3AFKA 4CDXC 2A6VA 2QQUA 4DXTA 4DXRA 4YVWC 3LCPA 3CJXA 4QQHA 3PUHA 4Y5TA 3NRUA 2GMEA 3MW4A 3USUB 4OQ8A 2VW2A 4WM7B 1QOTA 2CAUA 1NY72 5T55A 1OLRA 3AYEA 2ZOEB 2RE9A 5EP9A 4AAXA 2IFWA 3VBFC 5I0SA 3ZFEA 1AJKA 1UN1A 3OB8A 2JICA 1SLLA 4COYA 2IXKA 3VZOA 1QNYA 3HT1A 5K4LA 3VDDB 4MGIE 3RVHA 1QJY1 2VOTA 4GAZA 4W6XA 1DZRA 2ZX1A 5K8SA 1OH3A 4PT6A 2YFZA 2YROA 2D98A 2OQ6A 3I97A 4CEYB 3A22A 1TQ5A 3MW3A 3DPRA 4MHUA 5FYTA 2WFF2 4CEWC 5BNPB 3AZXA 1RHI2 4GB33 4IEZA 1AR71 1YFXA 1H2MA 1X50A 3ES1A 1K3IA 5FZKA 4COVA 1OD3A 1W0OA 4I0AA 2R071 4LLFA 1WLWA 4DEVA 3KF5A 2MEV2 1UY3A 3EO6A 1BXHA 3VHPA 2XLFA 1TMF1 1W0NA 3CKHA 5F5IA 1HV1A 1D4VB 2QKDA 4QPGA 1RUJ2 3TOJA 3TEZA 1GNYA 4AF9A 1CX1A 5FY9A 4YGDA 3PVBB 3ACHA 5FZMA 5DUVA 1AR62 3HN3A 1NXD1 3K4ZA 4Z2AA 1ASJ3 4JVAA 2ZGLA 5C7GA 5DZGA 1PIV1 3QOPA 1UW8A 3TN91 2FHRA 1XBFA 4RQPB 1WMEA 4ZU4A 1OKOA 2QQWA 3URFA 3VLBB 2VQTA 3UGGA 3B5LB 2V4VA 2PHWA 3PDQA 5D8AA 3WNMA 4Q0SA 1Q8PA 3UKVA 5HCHA 5EJZB 1IG3A 2W91A 2JKXA 1KEXA 4AFDA 4JDMA 5JOWA 5FLHA 4C1WA 1QJX1 4S2GA 1JYCA 1POV1 4KI5M 3CO2A 1D0HA 3V64A 4BIFA 2FDGA 1W9SA 4EN8B 1JW6A 3J8F1 1JN2P 3SQOA 4Q4X1 3VN4A 1U5YA 3AXDA 4Y1UA 1AR83 4EZ4A 5IVCA 4PIZA 3WR0A 1PM7A 1O3TA 1ZRDA 1BYHA 1RYYA 1H30A 1TZOA 3U75A 1MQTA 1NLSA 2D6OX 1JBCA 2C4XA 2Y33A 4MZUA 5FYBA 1PGW1 1HQLA 4M0HA 5L9VA 2DFCA 3TWIA 1RITA 2RMU1 5C9AA 1B35B 1W6MB 2QBXA 2QUOA 4CDQB 1WA6X 4XDPA 5IK8A 4FFHA 1ZYBA 1NQDA 3LZZA 2OZJA 4YVSC 3WD5A 1BBT1 4AHYA 2GC2A 1ZZ6A 1G9CA 2X5IC 2VUAA 1MZ5A 4G3YC 4MYEA 4PDWA 1Q43A 2C6SA 5KHHA 5FZFA 2IZWA 1Q56A 4E2QA 4ONUA 3WXPA 1HXS2 3MZHA 3JUUA 4F7ZA 2JB4A 3ITQA 4C1XA 2BZDA 1H2LA 1E5RA 4HL0A 4YW4A 3FWEA 3ZSLA 3O1SA 4F8AA 3SCFA 3WZ1A 1PZ7A 3HAGA 2WA3A 4MOAA 4NPMA 2VVDA 4NHLA 2EICA 4CDXA 2HH9A 2HWE1 5DDJ2 2I07B 3V65A 5A3NA 1ALYA 4BQ3A 2HWC3 4W6WA 1M06G 4XMAA 3J7HA 3OPWA 4YVWA 1RUH3 1OVSA 5T5JA 3AK0A 3KMHA 4LO8A 4ZXKA 5GLVA 3RGBA 5IK4A 2QZ3A 1MEC2 1Q8OA 3H3LA 3K3NA 1GMMA 4AG4A 2R061 5DG2A 5LRRA 3VBFA 2NZ9A 2R30A 2XQXA 2BBVA 1UMIA 3IDCB 1DYPA 3WSOA 3OGGA 5C5UA 1W8OA 3CLPA 2R32A 4EN0A 1S2KA 1AL23 2YBPA 4EN7B 5KHGA 1US3A 4AW7A 5CG8A 5JI9A 4HOOA 4INDA 4RR3B 3VBUC 2JG9B 1W8UA 2QQNA 1WKYA 4PJYA 4D7SA 1HB4A 4JDOA 2W1WA 2RM22 3TNPB 4AVVA 5A33B 5C3PA 5LA1A 4XYXA 5FYIA 3CBNA 1AYM2 1O59A 3GJAA 5AC92 4O9GA 3FHQA 1DHKB 1V6JA 4NROA 5I93A 3I2DA 4XDQA 4MX3A 5F3IA 4AQTA 1YI9A 3WP6A 4E2GA 2W52A 4FOWA 1SFYA 4IERA 4JC1A 5JXGA 2B9UA 1I3HA 4R9DA 3ACGA 1LODA 3KQRA 5A3UA 2VQAA 2GN3A 2PYTA 2WQZC 1RVF3 4OUSA 5ACA1 2ZGOA 4E27A 2VBPA 3I3QA 1ZBE1 2YZ4A 1SZBA 4LNVA 2WO3A 4F83A 1N3PA 4CEYC 4CDUB 5LY2A 2FMDA 5CBLA 1CZTA 2IVIB 2A6YA 2W08A 5T3NA 3T4VA 5BNPC 2XPJA 1W2TA 4LBJA 2OPWA 3KCCA 5JR7B 2HWD2 3DGTA 4YW5A 4CDWB 2OPKA 2KXLA 1D4M1 2YFUA 4NWWA 4B4RA 1C8NA 1SLTA 1VBE2 1ZVFA 3FLRA 3HBKA 4RHV2 3WW4A 2BOIA 3ZXJA 1F15A 2WZ8A 2E26A 2RS52 3VHNA 1A34A 4XFAA 4GALA 4K20A 3ZFFC 5GLUA 5FY0A 4IEWA 4UW4A 4L9BA 5LY1A 4P9JA 4Q27A 5IFTA 4K7JA 4EWEA 4A6OA 1JYTA 2Y0OA 4B7EA 3BOWA 1MPXA 1RUH1 1LOEA 2VUJA 3AKSA 5IWFA 4YRDA 4EZHA 1ZREA 3VD3A 2DVFA 1HRI2 1Q8SA 2VD7A 1QDCA 4YZ3A 1W2AX 4CP9A 4XUNA 4JTNA 3CMGA 2D6MA 1Z7S2 3IM0A 4XJWA 2XHKA 2GP3A 2X5IA 4K6BA 1IS3A 5I0TA 4QDSA 1CZSA 4B4QA 3E1F1 3D8CA 5A1LA 2RR12 2VJXA 4QX3A 3LFMA 4NR1A 2A1XA 2ZHNA 1PM4A 1FOD3 4JKLA 3I4IA 4CUGA 1UWWA 2E31A 4HMZA 3W59A 5FZ0A 1ZBA1 2YC0A 1FMD3 3AZWA 4KNCA 3FMGA 4UW6A 4B8EA 1IS6A 1U0AA 4HKOA 2P3JA 4HSLA 5J96B 1XYNA 1GBGA 1NT0A 2B4KA 3LA2A 1O8PA 2HWF3 2XL7A 4I3PA 4FO9A 2A71A 2D5HA 4GMP1 4Y20B 3JD73 5DZEA 3VDAA 3BKZA 4Y22B 5F37A 3SEPA 2E7AA 5F6LB 3UETA 1B35C 1PO22 2D6LX 3AB0A 4XJUA 4A7KA 1CAXA 1RUF1 4CDQC 3MEPA 4Y1ZA 4UOJA 4KU8A 1IPKA 2HEVF 2WN3A 5FZ9A 4AGGA 4YARA 2W1SA 4BLIA 4NJ4A 1EPZA 1PO12 2B8MA 3SH3A 3ZIWA 5JOXA 1J3PA 4EN6B 3W58A 4QHZA 2WIIB 3ON7A 4XTMA 3RMXA 5GLTA 1L3JA 3ZR5A 4PIXA 3N9LA 1VE0A 2O0OA 2BEOA 4YW3A 3RI9A 1R081 1KXGA 1QQP2 4FOVA 3LDKA 1S0DA 3I2GA 2VZQA 4AR2A 3C7OA 4GKYA 1N1VA 3MFCA 4CZSA 1G9DA 2DUOA 4PBPA 3B94A 4Y1VA 4K8RB 4Q2FA 1J3RA 3N7LA 3USUA 4P5HA 3B69A 3KS7A 5FYZA 4XFGA 4B4PA 4D6QA 3B7MA 5GLWA 3M4FA 1X8MA 3D5OA 1DBNA 1OA4A 4O65A 3UKNA 5CFDB 5LBEA 4AFAA 2F17A 5GZCA 5IVVA 4N43B 4K21A 1C8M2 1F4AA 2VPVA 3V56A 4XZUG 4AHWA 1OQDA 4O9EA 4Q1PA 2W1UA 3OBRA 3PIJA 3ECQA 5JOZA 1JU3A 1O5LA 1RUOA 3Q8CA 2IWGB 2VZSA 3ILNA 2ENRA 2XJQA 5KXEA 1WBLA 1L7QA 2SBAA 1APNA 5IVEA 1U12A 2JD4A 2WZR1 4LHKA 1BZWA 3E5QA 4Q4W3 4AHZA 1G6NA 1NG0A 3D0SA 3LPGA 4XIKA 5APAA 2D6KA 2Q8CA 2TEPA 1NA1B 1F31A 4DB5A 4FXGB 5HXVA 1PMHX 3ZFFA 1COV1 3BTAA 3ES4A 1FMD1 1WA4A 1YYNA 2R7EB 1MVEA 1W03A 2HBUA 4RA0A 1JZ4A 2WQ4A 1WMDA 3GZEA 4YM3A 5SV8A 2EIGA 2D93A 2CDPA 2YYOA 5L36A 3KVBA 1BJQA 2WJSA 1KQRA 5JVVA 4J25A 3B00A 4Z1VA 2BV4A 2PN5A 3K51A 3PVNA 1HX6A 1UZ0A 4CDUC 3FX3A 3O0XA 1GR3A 1JZ6A 5HV0A 1X7NA 1G8WA 5JXHA 5K7PA 3ZFEB
chains in the Genus database with same CATH topology
4XQ4A 5T50A 4CDWC 1VBB2 3UL2A 1JOJA 5AVPA 3ZN5A 3C2UA 3VGIA 1R1A2 4X8NA 2K2SA 1V70A 2GC3A 3DPRB 4FPJA 1YRZA 3NSTA 3O0VA 2JJ6A 3ATGA 4FPFA 1O3QA 2YXSA 1O3SA 4FT8A 1JTZX 1MACA 2PFWA 3OF1A 4CEWA 2R041 2W0XA 2Q0AA 1UPSA 1FYUA 4QPGB 1B35A 3FZ3A 2VMGA 4R9BA 3WDUA 2GC0A 4CDQA 1WLDA 4WVMA 1PVXA 3K48A 3USSA 4Q4Y2 1CJPA 3OCPA 4R4ZA 5JMCA 4GWNA 2D3SA 2HWC2 2Y26A 1TME2 1AYN2 1I6XA 4BMBA 4GMP0 3LOIA 1QJZA 5D8AB 2DTWA 3KCXA 3H0OA 3RJ2X 2ZMLA 1KJLA 2WNVC 3JCIA 3RQ0A 1EV12 3A0NA 2PLV2 3PJYA 4P9GA 1A6CA 1XYOA 4DNYA 3IMNA 3H1WA 4FAHA 2DWRA 1FI2A 2ZGKA 4AGRA 4MGKE 4ORFA 1W0PA 1YI7A 4XTPA 5BV6A 4META 5GKAC 5E16A 4BQ1A 1MQTB 2WS91 3NAPA 4QMAA 5C9AB 1PVC2 1QJU3 5C8WA 1IKPA 3T2TA 4GKXA 5JIUA 4QM9A 1CR7A 1JUHA 4XZPA 2DCYA 4PDWB 2E6VA 4Y5Z0 2AUYA 4WVWA 1RUI3 3V0BA 3UJQA 3U10A 1DGRN 2PHXA 1DF0A 5CFDC 3JBG1 3MLKA 1QKQA 3RZZA 5FO9B 5JSRA 2BGCA 2FMYA 3GZTB 4YVWB 3ZXKA 4HKLA 4FOYA 3GYDA 1RUC2 3GZUC 4DPNA 1DZTA 4PBOA 1ZZBA 3SISA 3GF6A 1VB2A 1HLCA 1NY71 5H9QA 3AP5A 5KXDA 4DRVA 2WA4A 1EYBA 2ZGTA 3V0AA 4CDWA 2ZX3A 3ZN6B 3H50A 2PAKA 1ZZ8A 3I59A 1FPN2 2LUWA 1NA1C 2CGNA 1Q8QA 4XJ9A 3L2HA 4QXKA 1J1LA 5C33A 4FBFA 4YYOA 3AKPA 1RHI1 1RUD2 2ILMA 3GBGA 3WX5A 2PHRA 2MEV1 5FLIA 1N47A 2IC1A 2BYVE 1O4ZA 4L11A 1AL0G 4KWKA 4LTAA 1HRV3 1AX1A 1H2NA 2XJPA 3EHKA 3SHRA 3NWKA 2EXIA 1RUJ1 3ZVXA 4Y1YA 4LE3A 2BNNA 3GHMA 1WBFA 3ZSMA 1H9WA 5FOBB 1A8DA 1VBA2 4Y1XA 4GXLA 1UU6A 1QJU1 4Y24A 3DPRC 4JRAA 4R52A 1NE6A 1U5IA 2UURA 4E4DX 1H2KA 1DGWX 3MIHA 2VW1A 5B2GB 1XNCA 2WNVA 3WUCA 4BPZA 3MICA 3WT3A 4H7LA 4Y22A 4M3CB 1GLHA 1XNKA 3ZXGA 1UU4A 3CU7A 3EBRA 5C4WA 4B7KA 5GZEA 1O4TA 3TRSB 2UU8A 1AXZA 2AH2A 4AI3A 1RB8G 2YPJA 2D44A 1QJY3 1VALA 1AHSA 4YW1A 2H6BA 4GH4A 4K1ZA 2C5DA 2FZ2A 1ZM1A 4Q8LA 1VRH3 5KHKA 4XBQA 1AR73 1KRIA 2X5IB 3ZMOA 2R073 3QACA 1CX4A 1HXS1 3BU7A 1TMF3 1OFNA 1LU1A 2W39A 1YIFA 2XLGA 2JX9A 4KG8A 4Q4V2 4MLOA 2WNUC 4S2FA 3HIFA 2ARBA 1HRV1 3WW3A 5LEJA 1MQTC 2Q5TA 3AYDA 2MPFA 1GANA 4GIQA 5HI0A 4V1PA 1PIV3 1RJ8A 1MEC1 3TN93 2RS12 4KQ7A 5C9AC 5K0UC 1CAXB 2A3WA 3M70A 1SBFA 1Y43B 3ZN4A 1YIPA 3GBWA 3WINE 3WG4A 4Q0UA 4M00A 4MSVA 4KWJA 4XPVA 1QJX3 2EALA 1POV3 3J9SA 3ZO0B 4AFBA 1C4RA 4I02A 5EWSA 3IT8A 2ZGUA 1WLTA 5KBFA 3J8F3 3O14A 2SLIA 5GZFA 3FBYA 5F1RA 4Q4X3 1QH6A 2ZACA 1AYM1 1LTEA 3AMQA 3S6PA 5AC91 1H4GA 4DY3A 1BVP1 2JG8B 4I0WB 3A0KA 3L2YA 2D6PA 2RS33 2RMU3 2Y38A 3Q9OA 2WSVA 3POSA 1AXYA 4M3CF 1E57A 1BBT3 1VJ2A 1PHMA 4BZ4A 3QH6A 1ENSA 2WFPA 3SXWA 1U5XA 2AENA 4COUA 3RRDA 1VRH1 1XE8A 4FPLA 5T54A 3OYWA 4N53B 4AI8A 1CAVB 1LCLA 4XHBA 4DMIA 2HWB2 1HDKA 1V9U3 2VOWA 2BW8A 2WT2A 4RHV1 2HWE3 2ES3A 3M8LA 1EAH2 4WVZA 4UXAA 4KU7A 2RS51 3AP7A 4I3GA 4QQOA 3ZFFB 4ES9A 1UX6A 1YLLA 1UZYA 4LUMA 4I30A 3OPZA 4XQWA 1RIRA 4FPKA 4KBBA 2R063 1VBC2 1XU2A 3RSJA 1SBDA 1O5UA 3WUDA 1MS8A 4CRQA 1WD4A 4HANA 2BWAA 4LA3A 2DV9A 4Q29A 1DU3D 3R4SA 4C91A 1HRI1 4EJRA 1ULDA 5BPXA 1R091 1QNWA 1Z7S1 4RSUA 3C3VA 2UWBA 4DFSA 2DVBA 2RR11 5J7MA 1S1AA 1IGOA 2I45A 1F9KA 1V6IA 3I54A 3DF0A 4DOUA 1N1YA 1S0EA 1DZQA 1NQJA 2HYKA 5L73A 2DYCA 3KZ4C 2CTVA 4DINB 1S0IA 2WNUA 5BNQA 2ZAAA 2XKPA 3IDBB 1ZZ7A 4CEWB 5ACA3 3WDYA 3VBHC 4AEMA 2FZ1A 1ZBE3 5IUQA 1RUI2 2RS31 5K0UA 4IV3A 4WVMB 2D6NA 3HR9A 3VZKA 3D4KA 1PO11 1PGL2 4WV8A 2A75A 3R05A 4XIOA 1D4M3 5EV7A 5DUWA 4TZDA 2JECA 1UIKA 1F5JA 1Q3EA 1QQP1 1V9U1 1MZEA 2EXHA 3O0WA 1FV2A 4K3UA 2ETEA 2NMOA 1VBD2 3H1YA 3VZLA 5KXBA 3VZJA 1RMU1 1V6NA 3MFAA 2VULA 2YY1A 2AZ5A 1ENRA 2FQPA 1ZA4A 2VGDA 4SBVA 4WVVA 3UV9A 4RD7A 3IN9A 5LK5A 4CP2A 4Z92B 5FQ0A 5E8AA 1KDKA 3ZN6A 5A3MA 5FLJA 1C8M1 4IV1C 5HCBA 5J3UA 2LALA 4Y26A 1AUYA 1RUE2 3JB8A 1IQAA 2D43A 3S30A 3NAPB 2MNGA 2Q1MA 1W39A 4OULA 2ZGMA 5E89A 3WV6A 2K0GA 4LHNA 3WQ7A 2ZGNA 1OFSA 1SFNA 1SLAA 4Q8KA 2ERFA 1ZBA3 1XNDA 2WLPA 2UWAA 2AREA 4AVSA 3DL3A 3WCRA 4ZKTB 3V0BB 2JG8C 4GMP3 3NV4A 3M1HA 5DUXA 4ATFA 2EVXA 4OLLA 4P9IA 1RUF3 4NHMA 3FFZA 4D7TA 3D82A 3LSEA 2A3YA 3SNMA 5HBAA 1TEIA 1H8TC 4YM2A 3KT1A 1LU2A 4SLIA 2NMNA 5CU1A 1PZ9A 4N53C 3G6JB 4HK9A 2BFUL 1X33A 4BOWA 1ZX5A 1R083 3EQEA 3V0AB 1VBB1 2XWBB 3QLQA 3I59B 1R1A1 4NN0A 1GQHA 4QPIB 4M3CA 1O91A 4AI0A 1QY4A 4AHXA 2CAVA 1G7YA 3M2MA 3N4MA 4FSJA 3WY6A 3LWCA 3AP6A 2EAAA 4LO4B 3VBSB 4AE2A 3KCYA 1BEV1 1SLBA 3HQXA 4E4ZA 4AWDA 2ZGQA 3E6DA 3VBHA 1ULCA 1UD1A 1LHNA 4AVCA 2OVUA 2VH9A 1DQ6A 3HBZA 4QD2A 1TMF2 3ZMNA 4N7IA 3KSCA 4Q4Y1 1ND3C 3INAA 1T6GC 1ZRRA 5BY5A 5T5LA 4AI1A 1ZRFA 2WZR3 1ULFA 1C5HA 1LEDA 2D7FA 3KD4A 4PLNA 4FPYA 3FLTA 1TME1 1AYN1 2A3XA 5JSOA 3PHMA 3AFGA 2E9QA 1VB4A 2NM1A 4PLMA 4QM8A 1COV3 1DGLA 5JSPA 1LEMA 4N7UA 5GZGA 3IBMA 1O3RA 3CNAA 3ZXAC 4Q0VA 2DVGA 1WCDJ 2WNVB 2KM2A 1EV11 2PLV1 1CESA 1MZ6A 3H8UA 5EYYA 5J09A 2UY8A 2I74A 4HSJA 1DFQA 1QJX2 1YFUA 1KD7A 3ZIXA 1D2SA 5C4WB 2IXJA 2G9FA 4IV1A 4YG6A 1REFA 5DUUA 3O7OA 1AX0A 1QWRA 3B02A 4Q4X2 1MR5A 3TAYA 2CYFA 4K9SA 4CYDA 2XBO1 4GH4B 1LRHA 5T5PA 1PVC1 4Q0QA 1V6LA 2GC1A 2N7GA 1NCRC 1QXJA 5AFBA 1QU0A 2YDEA 1MS4A 2ZZJA 1WLCA 1LOCA 1CN1A 2R043 2JG8A 4M01A 1C1FA 2P3IA 3MGUA 2GMMA 4WZFA 4PCRA 2XJSA 4GB32 2GH2A 2ZHKA 4AFMA 4H7MA 1LOGA 3NVCA 1SMVA 1I9RA 3E5XA 1H8TA 1RUC1 3B9IA 1WCSA 1CAWA 4HETA 1KFXL 3NAPC 1V6KA 4ZU7A 3M7AA 5KC5A 3LGRA 1D0GA 3TBDA 4BA6A 1S55A 2R49A 4N53A 5FPXA 1CAVA 3WQ0A 1C57A 3H1MA 5FDBA 4HLTA 4IEOA 3AM2A 1FPN1 1ASJ2 2B42B 3ZDSA 4YFZA 1AR91 3WDXA 3WHUA 1PZ8A 4JGZC 1RUD1 1H4HA 4BLJA 2ZX4A 4DS0A 3B01A 4H55A 4C0HA 5BNOC 4LO6B 5GJ6A 3WG2A 3E6CC 3NKGA 1ND2B 5T5OA 3WG3A 1F2NA 3HMYA 4K40A 2Z69A 1X82A 1LKNA 1PNFA 5H9SA 3GALA 5GLZA 1KFUL 1KJRA 3VBRC 3MIGA 3AKTA 3NV1A 4OI1A 2WS93 4YZ1A 3N36A 2VNGA 3THPA 4L97A 2ZHLA 3BIWE 1C5IA 3HD8B 1FNZA 2DF7A 5CFCC 1ND3A 1OHFA 1AR82 5BXXA 1VBA1 1H1IA 4QQPA 1BK1A 1CQ9A 5L7OC 5JOYA 4QPIC 1N3QA 1IOAA 2VVEA 3RG0A 5I91A 3IIAA 5TSWA 3MF6A 3U0ZA 3OYWB 1H8VA 4YZ2A 3MF9A 2IFRA 1RUG1 5A3LA 3VBSC 1Q5OA 4EV0A 3PVEA 2XG3A 3JBG3 3SITA 2GSYA 1GNHA 2A6XA 2ZBJA 1SLCA 1VLNA 2F4PA 4XFBA 2VNOA 3WVJA 3KT4A 4QPYA 1CIWA 3E6BA 5J37A 4AXOA 2AR6A 2ZMNA 1YO8A 1W6PB 1FATA 1I5ZA 5EJ3A 4Z82A 2QFEA 2X53S 1RUH2 2UYAA 4Q26A 4R9AA 4FPGA 2WT1A 4Q0PA 2VOXA 1TE1B 2GN7A 1NCRA 1RHI3 1DYKA 2JXAA 4QGMA 4QQLA 3QCWA 5HCFA 1LGCA 2MEV3 3AYAA 2EXKA 5JIAA 1PK6A 3RYPA 4ITCA 1ZZ9A 2PHFA 1J59A 2V5YA 4LO5B 5I8SA 2ZPXA 1G9AA 1AL22 4ASLA 1RUJ3 4D69A 5FTTC 5C4WC 4QGNA 4JCKA 4Q4V1 2WNUB 5IK5A 2PQQA 1Q8VA 2ZABA 2JKBA 1ZBA2 3VKFC 1AF9A 1MS5A 2EAKA 1QF3A 4GH4C 2RS11 4FTEA 3AP9A 4IV3B 1OQ1A 3GBFA 5K0UB 1YCIA 4BH9A 1FT9A 4X8PA 4IXLA 3WG1A 4JDNA 1OSGA 2R0HA 2ZX2A 1LOBA 1OLQA 3WP3A 4X6QB 4XW3A 3VUOA 2HEYF 3AMHA 1RVF2 4A2UA 1GZWA 4W6YA 1BKZA 3AZYA 5CADA 4JGZA 5F5QA 5BNOA 5SV5A 1YUDA 4BWOA 3AMPA 2R16A 3VHOA 1LHVA 1VIWB 3ELNA 2GNDA 4JRLA 3VBRA 1WW4A 1F5FA 4WBBA 3N35A 1A78A 1WMFA 2XL9A 1O7FA 4J1XA 5CFCA 1H1AA 1BQPA 3MI8A 5FQ0B 5CB7A 3AKRA 4M0NA 1N1SA 3ZFGA 1IHMA 1W2UA 2LM3A 5L7OA 2XLAA 4QPIA 2X8KA 2Q8OA 1HXS3 2WFF1 1N3OA 4F3JA 4E9KA 2HWB1 3J4UH 3VBSA 1ND2C 3RI8A 1S2BA 2QJVA 3H3UA 3NV3A 1URXA 1DQ1A 1EAH1 2WZR2 4E2SA 2XJRA 4OVEA 3W9AA 2JEMA 3VBOC 1FOD2 3ZXDA 3IDEA 4LBNA 3ZYRA 4AFCA 4RL7A 3BALA 1QOOA 1MEC3 1UCXA 3FE5A 4RS5C 3MPBA 1AR61 4EN9B 4FAGA 1VBC1 1COV2 1JXNA 1RJ7A 1FMD2 1Y3TA 2ZTNA 5DG1A 1YXWA 4HFSA 3B93A 3RNSA 4IEXA 2LTNA 1DQ2A 2DFBA 1H1MA 2HWF2 5EYXA 1GSLA 3JD72 3OY8A 1S0JA 3KB5A 3WW2A 1TNFA 4TWTA 5ABJB 1X8EA 2DVAA 2GNBA 2A6WA 2A7AA 3AJZA 1SQ4A 1AYM3 2DU0A 4FPOB 5AC93 4IEPA 1G86A 1RTVA 5JDBA 3MIEA 1GZ9A 4FTBA 3PLQA 4ATEA 2P2KA 2DU1A 4LT5A 5J36A 1UMZA 3SCHA 2DCJA 3VBHB 1YJLA 2OUHA 2ZJCA 3AMMA 3ILRA 4K1YA 2WKKA 2VQ0A 2PHLA 2VW0A 4G9SB 5FCCA 1LOAA 5HCAA 1SLIA 2DUPA 4N90A 1C1LA 3X29B 3UK9A 4YGEA 3A4UA 5JPMB 4QHBA 3ZYJB 2PHUA 2Q1ZB 3NKTA 5I8TA 3RDIA 3TNQA 4RHV3 1QH7A 2BNMA 3ZXEA 1YNAA 3WDTA 2ZZQA 5I0UA 1HKDA 2IXHA 2RS53 3BPZA 3BOPA 3ZYIB 3FUOA 1LENA 3VL8A 4LBLA 4IESA 3AP4A 3LKJA 5DDJ1 1J1TA 2ZX0A 1AXKA 1LHOA 1VBD1 1YJKA 4MXWA 4Q4W2 2Z79A 5FRAA 3G7DA 2WINB 5CNAA 1LB2A 1NCQC 4IV3C 2CWMA 2QDNA 4MVTA 1HRI3 4M3CE 1B09A 1R093 1GQGA 5KHIA 1Z7S3 1QHDA 3FUQA 4IV1B 5F6KA 2OW4A 2WNEA 1QDOA 3IPVA 1RUE1 4YLZA 4LBQD 3WDVA 4ASMB 3JQXA 2RR13 1DGWA 2G9GA 3PNAA 2R0FA 4Z8BA 2WS92 4JGYB 4FP2A 4LBOA 4YFWA 2VVFA 5DXDA 2RJLA 2RM21 1ND2A 3EXUA 4OHZA 2HJIA 2YGMA 1G9BA 4Z07A 2VXRA 4HKWA 4BE3A 2BPA2 1MS3A 2YMZA 1ENQA 4YM1A 4WZCA 2VU9A 5F9TA 2ZGRA 3VBOA 3PTYA 2BVVA 3WDWA 4L92A 4RS5A 4FCAA 3GHNA 5BUVA 3N7MA 1Z78A 1W6QB 5JZGA 4DQAA 2KA3A 1HIXA 4HN0A 4OUMA 3SCGA 1PO13 2YGLA 3KGLA 1H8TB 2Z5WA 1CAWB 4LBQA 1KITA 1CPNA 3JQWA 3NW4A 4XE9A 5J98B 3TYJA 2Q4SA 2GNTA 2R6QA 4GA9A 1BMV2 2DUQA 1AVBA 2HWD1 1QQP3 2O8QA 4OFGA 1VBE1 3HT2A 2ET1A 3WCSA 4R9CA 2XVLA 4EROA 4MGZE 2B45X 3JZVA 3DV8A 2CGPA 2D5FA 1RMU3 1GICA 1LESA 1UL9A 4U2AA 4KWLA 2WLQA 5E88A 2CV6A 4HPKA 4ISQA 1W6PA 2ZKLA 4P9YA 1C8M3 3JB4C 4QQ2A 1FV3A 4PIYA 3ILFA 4C90A 3RJRA 1DIWA 2H0VA 5FBZA 1V6OA 4LHLA 1ND3B 1UAIA 4L99A 4WM8C 3VHRA 5ABJC 4HVQA 5KXCA 1J58A 4YGCA 5H9RA 1MZFA 3U07A 3GZAA 5FREA 5IT6A 4XFCA 4YZ4A 5KWRA 4L8QA 4YG3A 3UJOA 4EWDA 1EY2A 3FLPA 2P37A 1JUIA 1QJU2 4FPEA 5GALA 2OA2A 3OGJA 4EWAA 2AGSA 3ME2A 2PAEA 2D40A 1UU5A 1OOPC 3ZXLA 3LOBA 1GZCA 2ZGPA 1NCQA 1PO21 4NWVA 2XH6A 1QOSA 3M3EA 5FMOL 4TSVA 3AZZA 4AEDB 3KGZA 4J1WA 1ULGA 1UIJA 2H0BA 1VBB3 4FQ4A 1QXRA 1OI6A 1LJ7A 1R1A3 2NPIA 5JLVA 4D3WA 2XJVA 3PMSA 3VV1A 3JU9A 4B29A 4JV4A 3D6EA 2CL2A 4HT1T 1NCRB 1MS0A 3ENRA 1EPWA 5EFUA 4I2OA 3VZNA 3KLSA 5C8CB 2EA7A 1BEV3 4U36A 4GULA 5BNNC 1PK6B 4XF9A 2PHTA 4FVVA 4QU2A 4LLOA 1OA2A 4FXKB 2WT0A 1IS5A 1M4WA 3PMEA 1KS4A 3AJYA 4GB31 2G4IA 4NO4A 2CNAA 4UBGA 1FXZA 4Q4Y3 1H9PA 4AQSA 1K5MC 5A32B 3BCWA 3WQ1A 2D97A 5FOJB 4C0BA 2GALA 1HRV2 2VY0A 4X6RB 1TME3 1AYN3 1HQWA 2IXCA 4BHPA 4JGYC 1REEA 1V6MA 1YFWA 2XB6C 4E4SA 1HQNA 2R1DA 4S2DA 1ASJ1 4XMIA 1IPJA 5CAZA 1ULEA 1GZWB 5GM0A 1D2QA 2XUMA 2WZPP 4LEJA 2D3RA 2XVKA 3IWZA 1EV13 2PLV3 4JGZB 4DZGA 3VKNA 3T1MA 3PVOA 1WCKA 2PELA 2R1BA 5BNOB 4KGGA 2VG9A 1NXMA 3B9CA 4OHXA 3PJQA 4NHKA 3ZYGA 1CAUA 3VBRB 2D3PA 3APBA 2ET7A 3ST7A 1OPOA 4A3XA 4D94A 2QNKA 3LB9A 1OA3A 2XBO3 3HN1A 3LSDA 4XJ8A 1OPMA 5ABJA 4LBKA 5CFCB 1PVC3 4WM8A 2HKXA 3MW2A 2P17A 1CPMA 4XFFA 1LHUA 4WM7C 5K9YA 1AR81 1LR5A 3ZFGB 3SH4A 2H6CA 5L7OB 2IXIA 1RINA 2UY9A 3VDDC 1QJY2 4FOQA 1AJOA 1GFF2 4BIOA 2HEWF 3FFQA 2OZ6A 1GV9A 1C3HA 1XE7A 1JHNA 1VRH2 3FC0A 4OI2A 1AR72 4PF5A 5CA6A 2GH8A 2R072 1NLRA 1OOPA 4NPRA 4HVRA 4I01A 3R6SA 1RUC3 3MYXA 4GWMA 2A5ZA 4LR4A 3O12A 1HV0A 3CF6E 1KDMA 1JH5A 3QH7A 4XOGA 4IEYA 2HWC1 1LECA 2MHFA 2DVDA 3LA7A 4H3WA 1FPN3 3WOGA 3NL1A 2F6BA 1FX5A 2JENA