4IV3C

Crystal structure of recombinant foot-and-mouth-disease virus a22-h2093c empty capsid
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
GIVPVACSDGYGGLVTTDPKTADPVYGMVYNPPRTNYPGRFTNLLDVAEACPTFLCFDEGKPYVVTRTDEQRLLAKFDVSLAAKHMSNTYLSGIAQYYAQYSGTINLHFMFTGSTDSKARYMVAYVPPGVETPPDTPEKAAHCIHAEWDTGLNSKFTFSIPYVSAADYAYTASDVAETTNVQGWVCIYQITHGKAEQDTLVVSVSAGKDFELRLPIDPRSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational engineering of recombinant picornavirus capsids to produce safe, protective vaccine antigen.
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type a
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 37
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iv3C00
4RS5C 1EV13 4QPGA 1D4M3 1RUH2 4RHV2 2R072 3ZFEB 1AR91 4GB32 1HRI2 4GMP3 4Q4Y1 1PO13 4Y5Z0 1VBB1 1BBT1 4Q4W1 5AC93 1EV11 1HXS3 1TME3 1AYM1 5BNPC 5AC91 1QJY2 2RMU2 1H8TC 1VBA3 4JGZA 4WM7C 3VBOA 5ACA2 1E57A 4RR3B 4WM8B 1ZBA2 5BNNA 4GB33 3LOBA 4Z92B 4Q4X2 4Q4V1 1VBE3 1BEV1 2ZAHA 2BUKA 5CFDA 2HWF2 4CDXB 1RUF1 1BEV3 3J8F2 1MEC2 2HWB1 1ND3B 1OHFA 3VBFC 4GH4B 1RUF2 4CDXC 2GH8A 4Y4YA 2RR13 4AEDB 1RVF1 5C8CA 1HQNA 1RMU3 1MEC3 3J8F3 1VRH2 1AR61 1QJU3 1V9U3 2RR11 2HWD2 1AR93 4Q4Y3 4GMP1 4CEWA 4RR3A 4WM8A 1RMU1 3JBG2 4Q4W3 1MQTB 1NCRC 3ZFEA 4LLFA 5L7OA 1VBD2 2WFF2 1V9U1 1HRV3 1X33A 1AUYA 3VBHA 1ZBA3 4RQPA 2HWD1 3VBSA 1AL21 1VBD3 5JZGB 1ND3C 3NAPB 2WS91 5CFCB 4BCUA 1FOD1 4IV3A 1K5MC 2DF7A 4CEYA 4FTBA 3VBFB 5BNPB 3VDDC 2HWC3 1QJX3 3CJIC 3VBRC 2PLV2 2R071 3S6PA 4IV1A 1C8M1 1FMD2 4WM7B 1W39A 2HWF3 2RS52 1FPN1 4Q4X1 1C8M3 1ND2B 1PVC2 1ZBE1 1PGW1 1NOVA 1C8M2 1ND2C 4IV3C 4Q4X3 1PGL1 1EAH1 2RS53 5ABJA 2XPJA 1R1A3 1MEC1 4IV3B 3J8F1 3JD72 1BMV1 3VBFA 5C8CC 1AR71 3VDDB 3VBUB 5C8CB 1OOPC 4CDUA 3VBOB 4PDWC 4CEWC 1BMV2 1HRV1 1B35A 2RS11 4CEWB 2XBO2 1RUE1 1RUH1 4RHV1 2WFF1 5BNNC 1PGW2 3JD73 1FOD3 1NA1A 1R1A2 2RS13 1COV3 1RHI1 3NAPA 1HRV2 2RMU1 1RUG1 1VRH1 4EJRA 4QPIC 1PVC3 5A33B 1QJZA 1RUG3 3CJIA 1VRH3 4JGZB 1QQP2 1VBB2 2GSYA 1ZBE2 4YVSA 5GKAC 1FMD3 4JGZC 1PGL2 1GFF2 3VBRB 5A32B 4PDWB 2ZZQA 1QJX2 1ZBE3 4IV1C 1RUJ3 1VBB3 4Q4V2 1BEV2 4RS5A 1EAH3 2RS51 1R1A1 2Y26A 5JZGC 5ABJB 2HWE3 4CDWC 1TMF2 5ACA1 2XBO1 3JBG1 1COV2 1R081 1ND3A 1AR82 1FOD2 2HWE1 5FMOL 2BBVA 4NWWA 5K0UC 3JBG3 4CDUC 1RHI2 3VDDA 1AR72 1RUE3 1R082 1R093 1RUI1 2ZTNA 1MQTA 1SMVA 1RUC1 5DDJ1 1AL0G 5C9AC 4GMP0 3VBHB 5C9AB 1NA1B 1VBC2 1DDLA 4N43B 2R041 2R061 3VBSB 3TN91 2PLV1 1PO11 4CEYC 1OPOA 5CFCC 5K0UB 1NCQB 1PIV3 5BNOB 2FZ1A 2BPA2 2R063 3DPRB 1B35C 3VBUA 5BNOC 3HAGA 3VBRA 4YVSB 2WS92 3TN92 4YVWC 5D8AB 1H8TA 1NCRB 2BFUS 1AR81 4FTSA 3JB4C 1ZBA1 1BBT3 1Z7S2 1VBD1 1VAKA 1BBT2 1Z7S3 1R083 1CJDA 4JGYC 4N43C 5FMOS 4QPIB 1NA1C 1POV3 4CDQA 4RFT0 5CFDB 1Z7S1 5ABJC 1AYN3 1VB4A 1PO22 3ZFGB 1HRI3 1QJX1 1K5MA 5CFDC 1R091 4GH4A 2HWE2 3CJIB 4Q4W2 2HWB3 1RVF2 3DPRC 2HWF1 4CDUB 1EAH2 1ASJ3 2X5IA 4N53B 4YVSC 1OOPB 5J98B 5LK7B 1NY71 1RMU2 1AR63 1FPN2 2PLV3 1RUF3 4CDQC 1QQP3 4CDQB 1D4M1 1RB8G 1AR73 1RUE2 1PO21 4CDWA 2FZ2A 1QQP1 1VBE2 1HXS1 1RUD2 1TME1 3ZXAC 1NCQA 5BNOA 1AR83 4YVWA 1PO23 3IDEA 5A32A 1H8TB 1TMF3 4SBVA 1RUD3 4RS5B 1AL22 2HWC1 5C4WB 1AYM2 1A6CA 2HWD3 4QPGB 1TMF1 3FBMA 2RMU3 4JGYA 5D8AC 1AYN1 1PVC1 4GB31 5JZGA 3NAPC 2RR12 4N43A 1AR62 1K5MB 4CEYB 1NCQC 1PO12 2R073 1C8NA 3ZFGC 2MEV3 1HX6A 1EV12 1VBC1 2WWSA 4YVWB 4AEDC 1RUJ1 3VBUC 2MEV2 2QQPA 2X5IB 4N53A 1RUC2 1VBC3 4QPGC 5DDJ2 1QJU1 3ZFFA 2XBO3 3VBHC 1F2NA 1QJY3 1POV0 1VB2A 1CD3G 1R092 4GH4C 3ZFGA 1COV1 1RHI3 1AL23 3DPRA 4CDXA 1QJY1 1RUD1 1TME2 1HXS2 4AEDA 2WS93 5A33A 5K0UA 2RM23 2R062 1RUH3 4RHV3 5J96B 2WFF3 1PIV2 5D8AA 1F8VA 3M8LA 3JD71 2X5IC 2RM21 1NCRA 3ZFEC 1M06G 1AR92 4Q4Y2 3ZFFC 5C4WC 5L7OB 1QJU2 2R043 4QPIA 3ZFFB 1RUJ2 4RQPB 1NG0A 2WLPA 2WZR2 3VBSC 1FPN3 1RUI2 1PIV1 2MEV1 2WZR3 2HWC2 4CDWB 1FMD1 5CFCA 4FSJA 1ASJ2 2BFUL 2WZR1 1AYM3 1WCDJ 3JB8A 1OOPA 2RS33 4FTEA 4PDWA 5FOJB 4IV1B 4WM7A 3VBOC 5C4WA 1VBA1 4N53C 2RS12 2RM22 5L7OC 1AYN2 2RS31 4JGYB 1POV1 1MQTC 4RQPC 5ACA3 2RS32 1IHMA 1HRI1 5C9AA 1VBA2 1V9U2 1ND2A 4NWVA 4Q4V3 1VBE1 1NY72 1X36A 2IZWA 5BNPA 1RUI3 1ASJ1 5AC92 3TN93 2TBVA 1RUC3 5DDJ3 2R042 1B35B 1D4M2 1RUG2 4RR3C 4WM8C 1RVF3 2VQ0A 2HWB2 5BNNB
chains in the Genus database with same CATH superfamily
3DKWA 2WO3A 4LBNA 5A80A 4GWJA 2A3XA 2PHDA 4QPGA 4HSJA 4GA9A 4BU2A 1D4M3 1BLZA 2NPIA 2IUWA 1RUH2 2L9LA 3KVBA 4RHV2 1AXKA 2RG4A 4GB32 4GMP3 4Q4Y1 3I59A 2B39A 4XCAA 3RG0A 5HXMA 1OQ1A 2W46A 4Q4W1 4NIGA 2MPFA 1EV11 1YWKA 2GN7A 1QJFA 1V6IA 4IE5A 1H1AA 5FZGA 3TYJA 3H8RA 1IKPA 3BTYA 1UMZA 4QHOA 3WY6A 5KXCA 2ZX1A 1YJKA 2ZGSA 1W2TA 1S0GA 2YPDA 3IMNA 3MFCA 4LHSA 3KF3A 3WNLA 4B7KA 4ARYA 3NVCA 5FZOA 1JYIA 1D7PM 2BU9A 4ES9A 5FPAA 4AFCA 1CAXA 3WLUA 4BQ2A 2CL2A 2RDSA 2D44A 3EJKA 5FBZA 2VU9A 2YMZA 1IGOA 2JDZA 5FZMA 4QB6A 4E8DA 3PMSA 3HPNA 3FJSA 4IEUA 3TEXA 4COWA 1VBE3 1BEV1 4YG6A 2GC1A 2GNMA 4NROA 1O5LA 5FREA 2AGSA 2G9FA 2JG9B 4A45A 2O8QA 2RJKA 5SV5A 2W39A 3ROUA 4ITCA 4HMZA 3SMHA 1Y43B 1MEC2 1OHFA 2VC9A 3VBFC 2BNNA 5F3CA 3NV2A 4MOAA 4O9GA 4Y22B 2DFBA 2Y38A 3FN9A 5FO7B 3ILRA 5I8SA 3I97A 2XJVA 2QBXA 2RR13 3RMXA 3SCHA 1RVF1 3GZUC 2YY1A 5LRSA 2A70A 3H3LA 1MEC3 3C3VA 3KMHA 5FYMA 1X82A 4GAZA 2GZWA 3FHAA 2HLEA 1TG7A 1VRH2 3SITA 3GM8A 2AYHA 2VTXA 3NV4A 4UW4A 1H6XA 4ARXA 4QPYA 3BGAA 1F9KA 1AR93 1O8PA 2D6MA 2Y6KA 2PHLA 4XUNA 4LQRA 3RI9A 1NQJA 1OUSA 4META 4HN1A 5T3NA 3S7EA 3GHNA 1IZ3A 1OUXA 4ZS2A 3ZFEA 3NWKA 3RZJA 5L7OA 1ZA7A 2DUPA 3A23A 2W1WA 1LOBA 1X33A 4JQTA 2VW1A 1JUIA 4GJZA 4XF4A 4TTGA 4D94A 1W3XA 3IM0A 1HB3A 1C1LA 2D40A 4Q26A 3WG2A 1LU2A 3RVHA 2FDFA 1I5PA 2K2SA 1UU5A 5JMCA 3B93A 4HKWA 1ND3C 2WS91 1OQEA 2WAAA 1YFYA 4OHWA 4BCUA 1FOD1 3GCXA 4XJUA 4RA0A 2D5HA 4WVVA 3DUIA 2WO7A 1RYYA 4AI9A 3WUCA 2A7AA 5IATA 2IXHA 2HWC3 2AZ5A 1KJLA 2NN8A 1QJX3 2VCAA 3VBRC 2PLV2 1H8VA 2K0GA 4E4ZA 2BVVA 3B02A 4FAHA 3S6PA 4JC1A 2BGCA 3OBRA 2DCYA 3WF4A 4IV1A 2GALA 4PBOA 4XBLA 4ZHNA 5IYYA 4DFSA 3O14A 3Q8EA 2NLRA 4BK4A 1W39A 2EVXA 4YLZA 3LDKA 2J7MA 2HEYF 2BZDA 4MYEA 5FZ6A 2CHHA 1FPN1 5LBFA 1YFUA 1PZ8A 1W6QA 1C8M3 4QMAA 5F6KA 3HN3A 2VBDA 5C3QA 3E5UA 1DGRN 3NJYA 1PGW1 2Y0OA 1ACCA 2VZTA 1N1SA 1JOPA 1W90A 3IDAA 3UGHA 2RS53 4CU6A 1XJAA 1DQ2A 2GAUA 3ZYFA 2EXKA 2PHRA 3AB0A 5FPBA 5KWRA 5LA9A 2ZMNA 5FMDA 1KRIA 1H4HA 1KJRA 2PELA 3MF6A 5B4XA 1AR71 1QGLA 3N9QA 4GZ9A 3FUOA 3WZ1A 3KM5A 2G9ZA 4K20A 1NAEA 4N8MA 4FFFA 4CEWC 1YLLA 1T6GC 3HN1A 4YGEA 1HRV1 5FP7A 1PNFA 2RS11 1GWKA 1LR5A 1RUE1 5DPNA 4BB3A 1RUH1 2BNOA 2Z5WA 4RHV1 5GLTA 4X8NA 3OBAA 5I0RA 1UY4A 3E5QA 1OMIA 3JD73 4LOSA 3I3BA 5IVVA 3VGIA 1GKBA 4GQ7A 2RMU1 1C3HA 1VRH1 1O91A 3M7AA 1Q8PA 2ZPXA 4IGOA 3WDXA 2W08A 4COYA 3K48A 4P5YA 3W20A 1RUG3 2VVDA 3C7EA 4R9CA 3VLBB 2GSYA 2ARXA 3J7HA 4CYDA 1XU1A 4JHZA 1FMD3 4AEMA 4JGZC 1PGL2 1QXPA 3AMNA 5L36A 1GANA 2UWAA 2CY6A 1YIFA 3CQOA 3N9OA 4QXBA 4A7KA 3GNEA 4PDWB 2ZZQA 5F3GA 3N4MA 1EPZA 4HG6B 4Q4V2 1BEV2 5IFTA 1GMMA 3QOPA 4QXCA 1J1TA 3DXTA 2ATFA 5FKBA 4DXZA 4E4SA 4PIYA 3ZDVA 5CISA 4DUVA 1RL3A 3BTAA 2X8KA 4UT5A 3U4SA 4Y33A 1TQ5A 4XF1A 5JZGC 2OZ6A 5BY5A 3PU3A 2D97A 1WA6X 1GZTA 2C9AA 1COV2 1U5XA 4QWNA 1FOD2 1JZ5A 4YW2A 3KHCA 2H6BA 4L92A 1OD3A 3ZPOA 1W8HA 2ZCWA 5FXVA 5T52A 3RWKX 2WT1A 3LGRA 1VR3A 5FDBA 2DFCA 3JBG3 4CDUC 2SBAA 4HZFA 1UZ0A 1AR72 1JOBA 2VZQA 2K46A 3AKPA 4IDZA 4AXOA 3NW4A 1EPWA 4TN7A 1US2A 5A3NA 4KWKA 3M3EA 1DF0A 2O8OA 3IZOA 5KXEA 2WZPP 2FDIA 1O3QA 4CP9B 4XAEA 5DDJ1 3FFZA 4AFBA 1AL0G 4EYUA 4GMP0 1S0DA 3H0OA 4IEQA 3VBHB 1KQRA 5BV6A 4YWAA 2ARBA 3AP4A 3T2QA 4NRMA 1NA1B 3D0SA 1JYTA 2D6KA 1DDLA 3JXSA 4N43B 2RDQA 4XTMA 5FYIA 1DG6A 1G86A 1PO11 1LJ7A 1GQGA 5C70A 1OI6A 4WZFA 2VQTA 3KQ4B 3ST7A 4AHXA 2E51A 4CEYC 1DGWA 2LS6A 1S0BA 1RITA 2R063 4NRPA 3L2HA 2QDRA 3DV8A 3USSA 2ZGTA 5DAWA 4L2NA 1IG0A 1MS0A 4YVSB 4I02A 4PT6A 3VKFC 5EIYB 1JMUB 3K46A 4IXLA 5KBFA 1FATA 5FQ0B 3CJXA 4JCKA 3LEGA 5IAVA 3KD4A 2Q0AA 1HN1A 1J58A 4K6BA 2YXSA 4DEVA 1BBT3 4GULA 4JKLA 1VMHA 1VAKA 1BBT2 4J25A 5HCFA 4FPYA 1V6OA 4ZKTB 1CJDA 5FMOS 4W65A 2CV6A 3ME2A 4ET7A 4XZPA 2WNOA 1R64A 2Q8DA 4BZ4A 1TEIA 2ZEYA 3TB0A 5A6QA 3LDRA 1ENSA 4RFT0 4BHPA 1Z7S1 4DINB 4IQPA 3ZN5A 1AYN3 1XNDA 1L7RA 4HPKA 1QXRA 1QJX1 4IERA 2AUYA 3HMYA 1IPSA 1VRBA 4FPEA 5BNQA 3HT1A 5FYVA 3PUIA 4Q4W2 5F6LB 1XNKA 1RVF2 1RXGA 1W2OA 1PZ7A 2Q8OA 3RNSA 1EAH2 4Y26A 4Z1VA 3FHQA 4DOUA 4D69A 5LK7B 1RMU2 3WQ1A 2IXIA 1DYOA 4EN8B 1L3JA 2VZ3A 5FJKA 4YW3A 2NP0A 2ET7A 2YU2A 1FXZA 5GLZA 5HPOA 5F1RA 1WLWA 5JPNB 4ZONA 3OGJA 4EN9B 1XYPA 3WHUA 1GP6A 3MPPG 3QH7A 1AR73 4K1YA 3ZR6A 4QQPA 3UJOA 4OZOA 2WNUC 2R0FA 4CXYA 3FMGA 1NCQA 2Y64A 1IS4A 1SACA 2W3JA 4NO4A 2VGDA 4ATFA 5BNOA 4HBNA 2KR2A 1MZEA 4Y5TA 2IVJA 2VPVA 2WNVA 2W1SA 5KC6A 4RGKA 5DAPA 1BQPA 3PUSA 3AZVA 1HKDA 4XETA 4F8AA 1W6NA 1WZXA 3KV9A 2VXJA 2GNDA 4JV4A 4W6YA 1VJ2A 1MACA 3MF9A 2HWD3 2P6CA 3FBMA 2RMU3 1SQ4A 2VY0A 3WSOA 3APBA 3D8CA 1UMIA 4LK7A 4PHZA 4NHYA 5G04L 4GB31 2XJQA 3DN7A 4Y1XA 1MZFA 5CZKA 5F3IA 1RXFA 4N43A 4IL7A 2NMNA 5J48A 2W1UA 3ZSJA 1W0PA 3KLSA 1CR7A 4AAXA 3ZOIA 2VBPA 5EFUA 2R49A 4BQ3A 5JDBA 4FOQA 1PO12 4FQ4A 1HB4A 2R073 3K75B 3ZFGC 1UPSA 3CIHA 1LENA 1YCIA 2WWSA 5FZKA 4CU7A 2BV4A 1W6PB 2GN3A 4QHZA 4G4FA 4I09A 2UYAA 5JOYA 2XOMA 2QQPA 2VH9A 3AL5A 4S2FA 3I2FA 3SNMA 1C5IA 5DDJ2 3VD3A 4W8JA 2IFWA 1ULFA 3ZXJA 2CAVA 4NAOA 3OUIA 4QGLA 2AREA 3ALQA 4KU8A 4LKEA 5F5AA 1XOYA 3O1PA 1UIJA 5CKQA 4N7IA 1QJY3 1POV0 3VZLA 4EZHA 4IE6A 1US3A 5C3OA 5HCHA 1R092 2DWRA 3VDBA 4YM1A 3AVRA 3WOGA 5A3WA 1COV1 1RHI3 3BUCA 1AL23 1ZZ8A 1LRHA 3DECA 3NKGA 4P08A 2VZRA 4J1XA 1KFXL 4AEDA 3VD9A 1H2KA 1UN1A 5K0UA 4K8FA 5D21A 2KD7A 3GYDA 4LULA 5FZBA 4XDOA 1UCXA 2Q8CA 3BPSA 5J96B 3C2UA 2JE7A 3H7YA 3R6SA 3LCPA 3H1MA 1UYZA 2YPJA 5FPZA 3WP5A 3WF0A 1QDOA 2RM21 2ZKLA 3MO4A 4LK6A 1A8MA 4MVTA 1NCRA 1OVSA 2E6VA 1UL9A 1REFA 4F3JA 3KT4A 2QCSB 3FFQA 2Q1MA 1WW7A 3LQCA 4QPIA 4XMIA 1KGYA 3ZFFB 2PMWB 3OSDA 1CAUB 1UW8A 3VBSC 5FOBB 1LEDA 4LBQA 4O9EA 1HV1A 1FYUA 2RJ2A 1EUUA 3RZMA 1QKQA 3IT8A 4FP3A 4HPKB 2HWC2 3NNLA 2V72A 5A7OA 1WD4A 2RDNA 2DCKA 3H8OA 3DGTA 2F17A 3MLLA 5FK7A 2EXIA 2Z2SB 1ASJ2 3N7LA 1DIWA 1NXMA 2EXHA 2ZKNA 5FRAA 5IK8A 5LCWL 2LALA 1MS1A 1AYM3 3NNJA 2Y6GA 4MLOA 3X29B 3JB8A 1L7LA 3NMBA 5LRRA 4FTEA 5LB6A 1J1LA 2JDKA 5FOJB 4P9GA 3LKJA 5FK8A 1F15A 2VNOA 4AVBA 3KCCA 3I3EA 4D7SA 5FAXA 1LNSA 2ZAAA 2RS12 2RM22 4WVMB 1ZRRA 3WX5A 2TUNA 4YZ4A 4HL0A 5GM0A 3D0JA 4CCJA 5FYUA 1MQTC 2QQKA 5FTTC 3AZXA 1GOHA 1J83A 1ZRCA 1CAWB 4XFCA 1SLLA 2B42B 2XJRA 4NWVA 4OHVA 2VW2A 1UXZA 2EF6A 4CP1A 1DU3D 2CGNA 4CPBA 2IZWA 3QD6A 4XJ9A 2P3KA 5C6CA 1O4TA 1OA3A 3RRDA 5BNPA 4BQYA 4NPMA 1YQ5A 5JCTA 3TN93 2JDMA 3CZJA 4NPLA 4MGSA 2P6HA 2TBVA 1V70A 4C1WA 4QX0A 1AVBA 1YJLA 1MZ5A 1LHOA 2VR4A 5FZDA 5T50A 2XG3A 5LASA 4L11A 1SDDB 4MV2A 4NR1A 2Q4SA 4AI1A 2OPWA 2VQ0A 4AFMA 4YNIA 2ZACA 5BNNB 5I0DA 4AI3A 1S1AA 3LA7A 4RS5C 4AVAA 1EV13 3VDAA 1QIQA 2R32A 1J59A 3WW3A 4BIFA 5A6YA 3CHXA 5FY9A 1HRI2 1V00A 2ZMLA 3A22A 1Z78A 1VBB1 1WW5A 5F2WA 3HWJA 3AL6A 1BYHA 4OYUA 2QKDA 5F5IA 4RGAA 1Y9GA 3BOWA 3HJRA 3LSEA 3T08A 3RMYA 4M01A 1HN0A 2G4IA 3ACGA 3PURA 1GSLA 4BXSV 2JIGA 1F31A 3B3QE 4FFHA 5AC91 1GV9A 1QJY2 2ZABA 3DKQA 2RHPA 2CDOA 1AHSA 3KT7A 2CSGA 1S2BA 5FZIA 5CB7A 1UOFA 1S0IA 3VBOA 4I3PA 2D3SA 3DYPA 4P9XA 4QX3A 3ZPYA 1OSGA 5APAA 1OKQA 2MHFA 1Y7BA 4RR3B 4PI2A 1AF9A 1ZBA2 4GB33 2DVDA 4LMFA 2FCVA 3V0AB 3BTXA 2XXZA 1YFXA 3LB9A 1MVQA 2W0XA 1UY3A 4Q4V1 1M4WA 1DQ5A 4XMAA 1HIXA 4ASLA 4XCBA 2WL1A 4LBJA 4BH9A 3HQRA 2ZZJA 1QXJA 4Q0QA 1UZYA 4GWIA 1QY4A 3ZKYA 3VD5A 4E9KA 1KS5A 2BWCA 4QXHA 3VKLA 2JENA 3VZOA 1GZCA 3ZXGA 3ILNA 2HWB1 1ND3B 5JSRA 3URFA 4CUAA 1ZNPA 3MW4A 4CDXC 5C33A 3UGFA 3WDYA 4AF9A 1OD5A 1S2EA 2GH8A 1SBFA 2ADEA 4XW3A 4AEDB 5G05L 5FPVA 1JZ7A 1G9AA 3VUOA 4JDOA 1WLCA 2X53S 4TLFA 2J22A 3J8F3 1DQ0A 3B9CA 4KG8A 3ZXEA 5FZ1A 3ZN6A 1AR61 3VHRA 4YARA 2HWD2 3HNMA 2ETEA 4LKDA 4WM8A 1RMU1 3KZ4C 2VOVA 1UX6A 3C7GA 3WCRA 3BKZA 5IFPA 2YBKA 5IVJA 1WGPA 1VBD2 4CCMA 1V9U1 2WO2A 5I0TA 3T0AA 1AUYA 2WJSA 1CAWA 3ZXKA 4RQPA 3CLPA 3GZEA 5HCBA 1DYPA 1AL21 1W9YA 5I0UA 4LBQB 2B9UA 4QHBA 4TXWA 1N1TA 4XUPA 3W5NA 5CFCB 1SHWB 2FBEA 3WW1A 3MV01 1GLHA 2DF7A 2H6CA 2XQRA 4FTBA 1XC6A 5E16A 1GQPA 3RPQA 5BNPB 3VDDC 3WF3A 1G7YA 5DUUA 1JYCA 3FBYA 3I2JA 1CZVA 4XOGA 3CJIC 4EQVA 3SH4A 4BQ4A 4OHZA 1YRZA 4YZ1A 4XJWA 2PQSA 2YYOA 1C8M1 4D7TA 3R4DB 3NJZA 4A41A 3O1VA 2ZA9A 3SEPA 1C1FA 4BQXA 4DIQA 2HWF3 5FZ4A 1FNZA 1WCSA 1BCXA 2GC0A 3N9NA 1CJPA 5BXXA 2YDEA 1GOGA 4JX0A 3NV3A 1W2UA 4L0PA 4NE9A 1ND2B 2X29A 2YV8A 4CPBD 5K8SA 3WCSA 1ZBE1 2CGOA 4X8PA 4O65A 1NOVA 3GJAA 2X10A 1XE0A 1Q56A 2RDRA 4LHLA 4IV3C 1J3PA 4M4RA 4Q4X3 1PGL1 4N9IA 5ABJA 2FCTA 4HANA 2NM1A 4Z2AA 1NLQA 1R1A3 2OZJA 4WVZA 4HLTA 5C3SA 1BMV1 4XXPA 4XTPA 4Y5SA 5C8CC 1UOBA 1CIWA 4E2GA 4IW3A 2WWUA 3ZMNA 1DZRA 3VBUB 1QOSA 4BIOA 4QU2A 4DRVA 1JZ6A 2UURA 2DVFA 2VUDA 4FPGA 1OLMA 4NPRA 1QH6A 5FZ9A 5FZFA 1K3IA 2GDFA 3OYWA 4QQLA 1FAYA 2WWJA 3J4UH 4XJ8A 5C5UA 1OA2A 4LHKA 2YFUA 3UV9A 3RWNA 2WFF1 3SCGA 1WKYA 5BNNC 4XHBA 4YM2A 2BW8A 2FDGA 3I7DA 2B7YA 3P3PA 3N7JA 4P9JA 1R1A2 1X8MA 3FE5A 5A6ZA 5FZAA 1HLCA 4AHWA 3NAPA 1HRV2 1AX2A 3AVSA 3PJYA 1RUG1 4AE2A 4BJ0A 4EJRA 3T0DA 3OUHA 1QWRA 2YG0A 5F37A 5ISLA 3TNQA 1A78A 1XNAA 5FCCA 4YSFA 5EWSA 3H8UA 1LTEA 2Z4FA 1REDA 2DCJA 3A0KA 4P9LA 4FCAA 4COZA 1VBB2 5LBBA 4YVSA 1PM7A 2O14A 1JW6A 5H9RA 3U0ZA 3WNNA 1GFF2 2Y6LA 2R30A 3M3CA 4Z2WA 2J1TA 3N36A 1JHNA 3MHZA 2P4EA 1BXHA 2DV9A 1VBB3 4IV1C 4UFKA 4AQ6A 5KR7A 4Y1UA 3AJZA 2QQOA 1NKGA 2PXJA 1EAH3 3VKMA 4Q1PA 1V0AA 4PQQA 1DFQA 2XJUA 3NKTA 4TLGA 1W04A 3WD5A 1ST8A 2R7EB 2C0ZA 4HT1T 4JDMA 2DTWA 3RJRA 1LGNA 3E6DA 1OPMA 4EN0A 1VMFA 4AFAA 5ACA1 1CGPA 4JHTA 2EIBA 4Y22A 3JBG1 2YB7A 4QGNA 1R081 1CZSA 2LM3A 1ND3A 3ABZA 4XFGA 5JPMB 4BYYA 1Q8SA 2GH2A 5IVYA 4MXVA 2HWE1 2XWJB 2OPKA 3BOPA 5FYYA 1OF4A 3KWVA 4IEXA 1VP6A 2WQZC 4M3CE 5A7QA 4C90A 2ENRA 3VDDA 2I07B 1RTVA 1ULOA 4KWJA 3HQXA 4G3YC 1JI6A 1UZVA 1MQTA 2W92A 4BISA 4BK5A 5DAVA 4XF3A 2PHUA 3USUB 1RUC1 4YW5A 5C9AC 1G9FA 3U10A 3POYA 3ZYPA 4AI0A 2P34A 1PHMA 3I8TA 1K5JA 4QDQA 3VB9A 3T2PA 1H9PA 3B69A 1YC61 4LKFA 4FP2A 5A7WB 5JOZA 5LA0A 1UMHA 3OD4A 2C24A 2ARCA 2RV9A 3MIGA 2A6YA 1SLIA 2B4KA 3D82A 5D2AA 5E89A 3IN9A 1REEA 2ZX3A 3SHRA 3WG4A 2R061 3IBMA 1JXNA 1IPKA 3ZYHA 3BU7A 3MICA 5CFCC 1SG3A 1XBFA 5IK4A 5K0UB 1NCQB 5BNOB 1UU6A 2FZ1A 5IUQA 3MDPA 1W8WA 4COUA 3VBUA 4L99A 1K12A 2WSUA 4DPNA 2ZHMA 5LEJA 4I0BA 4YVWC 5D8AB 4A4AA 4HVQA 1H8TA 4D8MA 1NCRB 1SFNA 4BDVB 4FTSA 3ZXLA 4OUMA 1PMIA 1LHNA 4J6GA 2DUQA 3VHOA 2JB4A 3OGVA 4YGBA 5A3TA 1QOOA 3HNBM 2BQPA 2W91A 1H9WA 1Z7S3 3RZZA 2R6QA 4MSVA 3I3DA 4DZGA 3I4IA 1NE4A 4QX1A 1PK6A 3POBA 4BXFA 1F4HA 4P5HA 1NA1C 1POV3 4XFIA 2JG9C 4FPOB 5CFDB 5ABJC 4AI2A 2ZGRA 2GC2A 3NV1A 1VB4A 5GALA 2HEWF 1PO22 3ZFGB 4AVVA 1HRI3 4GALA 3I2GA 1R091 4FOVA 4I0AA 2QQWA 4YW7A 5L73A 5CNAA 4L9BA 2ZX2A 3LIHA 1N1YA 5GJ6A 1STMA 3PVOA 3DPRC 3WDTA 2KM2A 2HWF1 1WCUA 4LBMA 2IC1A 4QKFA 4XF0A 4YVSC 4HKOA 4KI5M 4XILA 5CKNA 3M1HA 5FY1A 3GHMA 2XKPA 1NY71 3LSDA 3WV6A 1ZZ6A 1JYNA 5C4WB 1ULPA 2JWPA 3J7NA 5K9YA 4ISQA 4CCKA 1YI7A 2A3WA 2AC1A 1IS5A 1W06A 3K51A 2PLV3 1IS3A 2DCZA 2OA2A 4CDQC 1MS9A 2VMCA 1DQ4A 4DRRA 2W52A 2BGOA 4BQWA 1S4CA 2N7GA 3UKTA 1RB8G 3PIGA 1H0BA 1OC1A 3N7KA 2WQ4A 1XNTA 4QQOA 2FZ2A 1SCSA 5FZ8A 5LZ6A 4CXXA 1HXS1 1TME1 1V6JA 4QPWA 5GZEA 3ZXAC 3BTZA 4MGYE 1PVXA 3CDZB 2JG8A 2QTWB 1AR83 3I2IA 1O59A 1ULDA 1J3QA 1AJKA 1OH4A 2JECA 1ZX5A 2WRAA 1LODA 4XDPA 4B1MA 3ACLA 5A70A 4RS5B 2W1QA 5FV3A 3CF6E 1AYM2 3MI8A 4LE3A 5LBEA 2X09A 2A71A 3VHPA 4NIDA 3I2DA 4QPGB 1TMF1 1I5ZA 2B46X 5A6XA 5FYCA 1V6LA 3ZYJB 1QNWA 3RDIA 1WBFA 3AYAA 1FT9A 1H6YA 3NAPC 1MVEA 2RR12 2OQ7A 3RI8A 1DQ1A 1YQCA 3ZVXA 1KS4A 1CPNA 4OMCA 4CEYB 5JOXA 5J09A 3Q8FA 5F39A 5JR7B 1IQAA 1GU3A 4RFRB 1CX1A 4R4ZA 1O8SA 1EV12 1GZ9A 1ENRA 4HN0A 4OHYA 4YVWB 1Z0HA 2JDYA 4ZY9A 3ZLIA 4EWDA 3AP7A 1SPPA 1CPMA 2VD7A 2A73B 1VBC3 2NZ9A 4QPGC 3VV1A 4BPZA 5IK7A 2DVGA 4YGCA 3O1OA 4NHMA 2VOWA 3AZYA 3ES1A 1QJU1 2EAKA 1CQ9A 4ONUA 1TVGA 2QNKA 5DG1A 3ZFFA 1Q8OA 1OH3A 2C6SA 3CO2A 2LW8A 4XBQA 1Y9QA 1LGBA 4P14A 2Y8KA 4AHYA 2Q1FA 4M3CB 2V73A 4Y1YA 4IETA 4ZXKA 2QVSB 1X50A 5L9BA 5F8PA 4A7ZA 4ZU4A 2QQLA 1BVP1 4K3UA 2VVEA 2ZEZA 4GXLA 1RUD1 4MH0E 4ATEA 5A3UA 4Y4RA 5JWPA 4XF9A 2JE8A 3OEAA 3OTFA 2UYBA 3O7OA 2RM23 5SV8A 1W6PA 4BA6A 3WNKA 4HK8A 1RUH3 3OPZA 4M3CF 4RHV3 2JD9A 2K9ZA 4S2GA 1LGCA 4XJAA 3ZM8A 2J1SA 1GQHA 2A3YA 2B45X 3JCIA 4ZS3A 5A1AA 3W58A 3S5AA 3HR9A 2PHWA 3JD71 3SISA 2VQAA 1F8VA 3PTRB 3PL0A 5DUWA 1AR92 3P5BA 4UI9L 5L7OB 4OI4A 2GC3A 2QQUA 1U0AA 5JR2A 1XU2A 1WLTA 4COVA 1RUJ2 4K8RB 1NG0A 4XIKA 2ZJCA 4HFSA 3KCXA 4UFLA 5JXIA 4BQ1A 1RUI2 2MEV1 3T1LA 2D6PA 4GWMA 1SCRA 4Q8KA 2D43A 3P1IA 1FMD1 1DQ6A 5E88A 5CFCA 4JQRA 1PMHX 3HNYM 1QMJA 2BFUL 5FLHA 1JN2P 4OUEA 4XACA 3POIA 3WNOA 3D3AA 2WC2A 1WCDJ 2IVIB 4QGMA 4AK3A 4QXKA 2BERA 1AJOA 1OOPA 2J1VA 3E97A 3OBZA 5FIXA 5EJ1B 4PDWA 1OFNA 1CAVA 1UY1A 3M70A 2D93A 2OT7A 2WT0A 4JKMA 4EWAA 4YW1A 3VBOC 4LLOA 4B4RA 5C4WA 4JAAA 4N53C 4B3NA 5L7OC 3BIEA 2VMFA 4YM0A 2RS31 4ZZ5A 3SCFA 3MGUA 4JGYB 1POV1 1JU3A 3H42B 4Q0UA 4DMIA 1ZA4A 1UD1A 4GWNA 3KSCA 1ZZBA 3WHTA 2XJPA 4EROA 1W8FA 1HRI1 4RGGA 2V5YA 1N3PA 1XE8A 4GIQA 3PDQA 3V64A 1ND2A 2VMDA 3L2YA 5H9QA 4MUVA 3AKQA 2XL7A 3LA2A 3PLQA 2JDNA 4L8QA 1XRUA 2JG9A 4ZZ8A 4NMIA 1VBE1 1NY72 1X36A 1T6BX 2XHNA 4LUMA 4Q1RA 4PIXA 4RSUA 1V6KA 1SLCA 4S2DA 4WZCA 4YFWA 5EZWA 3SXWA 3PJQA 3AKSA 3BB6A 4FO9A 1SLTA 2VTXJ 3MUZ1 2WAOA 1DCSA 1YFWA 4AGVA 4LBOA 4MO3M 4AL9A 3ASIA 3FX3A 3DL3A 2WKKA 4NRQA 5DDJ3 2R042 2QUOA 3OYWB 3RZGA 1D4M2 2ZEWA 5EPAA 3ZSLA 3EMRA 2UY9A 1RVF3 1D4VB 1OURA 1PZ9A 1TZOA 4LHNA 1ENQA 3TOJA 3WR0A 3POGA 5FMCA 5GLWA 5I93A 3U14A 1DHKB 5FXWA 3KV6A 3MW3A 4B8EA 4DY3A 1N47A 4XC9A 5CIRA 2R072 3ZFEB 1AR91 5CG8A 1ZZ9A 1PO13 2FQPA 3POWA 3PUAA 4MHRA 2WNEA 4M0NA 2EIEA 2DURA 4UFJA 1B09A 4AQTA 5AC93 1HXS3 1PMJX 1TME3 1XNCA 5A1LA 2WR9A 4XPVA 4ZU5A 5KXDA 5BPXA 4A6SA 4IE0A 4FQZA 4M00A 2WNUA 3MLKA 2BP6A 5JSPA 1W2AX 2RMU2 4PIZA 5I91A 4D6RA 1H8TC 1VBA3 2VNVA 3NJVA 1S55A 2IXKA 2MNGA 3EXUA 4JGZA 5FP4A 1NZCA 2AEZA 4OUSA 5B4NA 5EJ3A 2VECA 1FNYA 3PVEA 1SBEA 1UOGA 1MS5A 2HH9A 1BK0A 4Y3OA 4IEWA 4YGDA 4WM8B 1LAJA 5IT6A 5BNNA 2SLIA 3I2HA 4P9YA 3MZHA 1W05A 1YO8A 3PVBB 4Z92B 1ZRDA 1QF3A 3G6JB 1HDKA 4Q4X2 4XUOA 4A3ZA 5JVVA 5FPXA 2PAKA 2G1MA 3I3MA 1FV3A 2JEMA 5KC5A 4H7LA 5H9SA 2ZGOA 4QKDA 4AG4A 5KHIA 1N1VA 1JU4A 3AYDA 2HWF2 2WABA 1RUF1 1QHDA 1WCKA 1KITA 3SKJE 1RUOA 1D0HA 2V09A 3ZIWA 3EBRA 3AZZA 1NX9A 1BHGA 4QT6A 4Y4YA 2G9GA 4NIAA 4BQ5A 3B01A 1RINA 1OKOA 3HOBA 1VALA 3DYOA 2QQMA 3ZDSA 1HQNA 1RMU3 4A42A 3ACFA 4QAWA 4PBPA 2DTYA 3AP6A 1QJU3 2GNBA 1V9U3 2XONA 3ZSEA 1W8TA 4Q4Y3 4GMP1 4NAMA 1QDCA 4Q0VA 1NQDA 4RR3A 3JUUA 5FZ7A 2GMEA 3JBG2 2VZVA 1MQTB 4Q4W3 3I2KA 2ADDA 3B00A 1LOEA 4LLFA 4BE3A 4P9WA 3OGGA 1HRV3 2Y6HA 4YZ5A 1PM4A 2LUWA 1HJGA 4Z07A 4JVAA 3MIFA 3VBSA 2FDJA 1VBD3 2WFPA 3VN4A 2VULA 3T4HB 3FL7A 1GWMA 4IV3A 1W8ZA 4U36A 4CEYA 4HONA 4Y20A 2NYYA 3VBFB 4S2HA 2BBAA 3LFIA 4LIVA 5DAXA 3FHIB 2E7TA 3WQBA 5BUVA 1G9BA 3V65A 3TRSB 4OI0A 1V6MA 1WCQA 4IE7A 1CAVB 2AACA 2BJSA 3C7OA 2JKBA 4CUGA 1FMD2 3AP5A 4WM7B 5KXBA 5DXDA 2J1AA 4XBNA 1UY2A 2D5FA 4E8CA 5FZ3A 4PCRA 2VNGA 4Q4X1 3ZSMA 4KU7A 4QB2A 2XLAA 2ZX0A 4CCDA 5EYXA 4DUXA 3VHNA 4C0BA 2C4XA 2VNRA 3A4UA 5FYHA 4CRQA 5BYNA 2QQVA 3IPVA 3PUQA 5CADA 5F7UA 1MEC1 2WYFA 4EN7B 3JD72 1RC6A 2XKOA 5A7PA 2VO5A 4V2VA 1YNAA 5KHGA 4MGTA 4F7ZA 2R1BA 5DZGA 3J9SA 3JQWA 3UETA 2QDNA 3VDDB 1A8DA 5C8CB 4DXSA 2CWMA 1WA4A 1OOPC 2HBUA 3CNAA 4QB1A 4QKBA 2CDPA 4ZPIA 2VZ1A 3B5LB 3J26N 2OQ6A 1BMV2 4HK9A 4XVHA 3USUA 3M3OA 3KVAA 2XBO2 4CEWB 5C8WA 1QH7A 2IWGB 3IIAA 3AMMA 4HETA 1SDWA 3S5QA 1VE0A 1FOD3 3JQXA 4QQHA 4QM8A 2J1UA 2EIGA 1LOAA 4QX5A 1COV3 1RHI1 4D3WA 1GYKA 4J1WA 1HV0A 2BRTA 3B7MA 4C91A 4XABA 2QZ2A 1O4ZA 2VVFA 4AFDA 3TWIA 1J3RA 3DF0A 2TEPA 3QBQA 4KGGA 3RYPA 1O3SA 1F4AA 1NUKA 1QJZA 2XVGA 3KB5A 5DZEA 5FXZA 3CJIA 2FD8A 2IXJA 3MIDA 1QQP2 4Q0PA 5H9PA 3T30A 3PUHA 5FZOB 5ERLA 5LBCA 2EALA 2EA7A 5FY8A 2JX9A 3T1MA 2AH2A 3K3NA 1U5ZA 2E31A 4GKXA 4URTA 1WWYA 2IXCA 1GNYA 4MZUA 4PI0A 1MZ6A 1AXZA 1QJX2 2Q5TA 4Q8LA 3KGZA 3WP3A 3WXPA 1RUJ3 1FX5A 2FMYA 4RS5A 2RS51 3ORJA 3O1MA 1DLCA 4H14A 4R4XA 3T4VA 4UOJA 3O1UA 1PK6B 2ZGUA 3HBZA 4CUBA 4OFGA 1A3KA 5HXVA 2WN3A 4U2AA 2PQQA 3F95A 2ARAA 2HWE3 3PIJA 4CDWC 1TMF2 2UY8A 2P2KA 1UF2C 2FCUA 2XBO1 5F3EA 5FLIA 3ZXDA 1VMJA 5FO8B 2E63A 3RYRA 4MGIE 3WW2A 2V4VA 1D2SA 3MEPA 3OPTA 3K77A 1SBDA 1WLDA 2P17A 2BBVA 3AZWA 3MUY1 4NWWA 4PQ9A 4URAA 5K0UC 3NRUA 3N9MA 3MPBA 1RUE3 3WNXA 1LKNA 1R082 3DXUA 3IIIA 1RUI1 3GXUA 2JD4A 2WINB 3H50A 3POJA 2OIIA 1U12A 1SMVA 1W8OA 1K45A 5E8AA 4C1XA 4NIIA 4JRAA 5FYSA 3BN6A 2R0HA 1UYXA 1IQDC 4QDRA 2W5FA 4AEKA 3QCWA 1JYWA 4KGQA 1JH5A 5C9AB 4IUGA 4E2QA 1OVPA 3OUJA 4JTNA 5T5PA 1VBC2 3HIFA 5IWFA 5A3OA 4LO4B 5FZCA 3ZO0B 1W9WA 2CAUA 2YBSA 1D0GA 3VD4A 4WVWA 3TN91 5DN2A 1IPJA 3EB7A 2Y34A 4NJ4A 1N3QA 3UESA 1JZ3A 3RZLA 1DYKA 2JDAA 1HB2A 4AEJA 2XQXA 1EY2A 2DVAA 2GP5A 1OFSA 3ES4A 2FDKA 4HOOA 2E26A 2XJTA 3A7QA 4HKLA 2JICA 1B35C 1MPXA 3S7IA 1F5JA 3WP6A 3HAGA 4AVSA 1MS3A 2QE3A 2VBBA 1O5UA 5EYYA 3TN92 3UYJA 4N7UA 4NN0A 2P37A 4LXLA 1W2NA 2FHRA 2OVUA 1W6OB 3JB4C 1PNGA 2XLGA 4K9SA 1PX4A 2VOTA 4D7YA 3S57A 3QLQA 2LRPA 4AHZA 1VBD1 3T3YA 3C7FA 1UKRA 3AXEA 2VZUA 4AAPA 1LULA 5FJHA 3I2OA 1W8UA 3WNPA 1FV2A 1LESA 4GKYA 2O1QA 5I8TA 4AI8A 3A21A 3AM2A 4CDQA 3M3IA 5F2SA 3ZX7A 2VZOA 3THTA 5IHRA 2ORXA 3IDCB 1K5MA 4AOCA 5CFDC 3OJBA 5FYBA 2VL4A 2EIDA 3CJIB 5FUIA 3VL8A 2PA7A 5CKMA 2NMOA 2DCTA 2E33A 2W2IA 3PTYA 3WG3A 1GZWB 1AZDA 1G6NA 4AYUA 3R4UA 3U11A 1ASJ3 4N53B 1SFPA 4UWDA 4FPFA 1OOPB 3IWZA 2VAUA 5FLJA 3MFAA 3V0BB 4BMEA 2IXLA 2Q1ZB 2D3RA 1WUVA 4GD4A 4KBBA 2F4PA 1PK6C 2D6NA 4JTOA 1ZYBA 3IB3A 5GLUA 2WYSA 1RGSA 3GBWA 3P3NA 5DAQA 3VZKA 3NNFA 2DVBA 3K2OA 3U4XA 1LB2A 5AFBA 2JDUA 3T09A 2BYVE 3O0VA 3ZMOA 1UKGA 1W8NA 1XSQA 1RUE2 1PX3A 4CDWA 4IGQA 1D2QA 2GP3A 5FKCA 2FDHA 1QQP1 1VBE2 2WLQA 3NNGA 4FOWA 4OQ8A 4LA2A 1W9FA 4CCNA 5ANQA 1CX4A 3WDWA 1KD7A 4QX8A 3I54A 1QNYA 3K4DA 4YVWA 1PO23 2PAMA 5A32A 2VMEA 1TMF3 4NUBA 3CBNA 4SBVA 4M4PA 3C7HA 4A3XA 3DEMA 1AL22 2HWC1 4LORA 1QOTA 4XYXA 3MW2A 4MX3A 1GNZA 2E7QA 4W4ZA 4B1LA 2YFZA 3M4FA 3T0BA 3KV5A 4CCEA 1AYN1 2FMDA 1NE6A 4DNYA 3VDCA 1NZIA 3H1WA 5JZGA 1CIYA 2AR6A 4V2WA 5EXOA 2D7FA 3LIGA 3MYXA 4M3CA 2E7AA 1K5MB 1GP4A 3P6BA 5JAXA 3WQ0A 1E5HA 5B2GB 1OT5A 1NCQC 3ZYGA 4MGKE 4LT5A 4LO8A 4K7JA 3O0WA 3HVDA 1X9PA 5FZ0A 3GJBA 3LPGA 4ORFA 3R0RA 4LBQD 1HX6A 1VBC1 5LEKA 5CVRA 4AEDC 4QDSA 5GZFA 1RUJ1 3OOXA 4DB5A 4AGRA 2HYKA 4CVUA 5C3RA 3VBUC 1YEWA 1NLSA 1WW4A 2X5IB 1RIRA 4Y1ZA 2W87A 2LROA 2UWBA 1KEXA 3D6EA 4FXKB 1UX7A 3U75A 1ALYA 3M3QA 4TZDA 4WV8A 3OBTA 2XBO3 5EHDA 4CSWA 4RD7A 3OB8A 1UQXA 5AFEA 3UKNA 5JIUA 4UW3A 5F5QA 2XL9A 1NT0A 1S2KA 1I9RA 2XJSA 4GH4C 3U07A 3UT0A 5A3LA 4LBKA 5FWEA 4H7MA 4AVCA 3DPRA 4Z8BA 3ITQA 3O0XA 1QEXA 5FXXA 4EWEA 3L9JT 3DYMA 2PHTA 1ZM1A 2R062 4H55A 4AWDA 2WFF3 2BVBA 3RGBA 5CU1A 4CCLA 4K21A 1WBLA 1EYBA 3LDBA 2Y33A 2I45A 5LW9A 1M06G 3MBWA 2DU0A 3NNMA 4D0QA 5L9RA 2PYTA 2XGXA 5L9VA 2A5ZA 5CG9A 1UAIA 5FWJA 4RQPB 3W5MA 2WZR2 2W68A 1LU1A 2ZX4A 4CP2A 1TNRA 4AQ2A 5FY4A 2BNMA 2JG8C 3ATGA 5FZHA 3NO8A 4PF1A 2WSVA 3KT1A 4CDWB 4E27A 1XQNA 2XVKA 4FSJA 3E5XA 3GF6A 2HJIA 2YBPA 2WZR1 5C3PA 3NL1A 4CU8A 4FPJA 3OD0A 2RE9A 1LHUA 2RS33 2NQYA 3CMGA 3ZSKA 4KL1A 1WMXA 1SPPB 2H0BA 4KH9A 4XUQA 5J7MA 4OI2A 2VMIA 2VW0A 5LATA 1S0CA 5JOWA 2ORZA 1AYN2 2OS2A 1AXYA 1OLME 2OUHA 1W6QB 2BTVC 4JZRA 4L97A 4BLJA 1K42A 2I74A 5K7PA 4D6QA 4RQPC 3Q8CA 2RS32 1IHMA 5ACA3 2Z79A 2ZS6B 1Y3TA 1XB9A 2ERFA 1O4YA 4RL7A 1LHWA 4NOTA 4RYDA 5C9AA 1ZRFA 2QFEA 1V9U2 3WINE 4LITA 4OMDA 3CEWA 3BU0A 1OQDA 2C26A 3LOIA 4Q4V3 2DUOA 1UPIA 2CU5A 2HYXA 3GZTB 1UWWA 1N3OA 4IGPA 5J36A 1Q43A 3OPWA 4XHXA 1ASJ1 2WQ8A 3Q9OA 1SEFA 2GMMA 4G9SB 2VXRA 4IEOA 5FY5A 2B9VA 1MS8A 4CUCA 1JBCA 3E6CC 1RUC3 2HBTA 4XFFA 3WF2A 3H1YA 1Q5OA 1RUG2 1UOJA 4RR3C 1O3RA 3MIHA 5FP8A 3EQEA 4PF5A 3WVJA 2HWB2 3H7JA 2BWAA 2VCBA 5D8AC 3SH5A 3ZN6B 3AFGA 1GNHA 1YQ6A 3SKVA 1YIPA 4KBZA 5DUVA 3D5OA 2VUJA 2R16A 1XYOA 3Q8BA 4Y5Z0 1BBT1 1HB1A 5T5JA 3WQ7A 2I2SA 2VOKA 2OUJA 5E1RA 3BCWA 4LOTA 3AX4A 3KS7A 3O1SA 1AYM1 2PAEA 1QU0A 5BNPC 5JUVA 1BVVA 2WZEA 5DMYA 2VUCA 4XZUG 2VQUA 2WUHA 1CONA 5T55A 1F35A 5C71A 4DXTA 4NHKA 4M0HA 5FUPA 3ZXFA 1SLAA 1KXGA 1R1ZA 2P3IA 2JIJA 5M0TA 4WM7C 5ACA2 1XSRA 1UZZA 4INDA 1IOAA 1E57A 1GZWA 1U5IA 2QQNA 2VTFA 2EAAA 2YROA 3PNAA 4OVEA 3SLIA 4KMQA 2CGPA 3LOBA 4P02B 4TSVA 5LWBA 3LEIA 3N3HA 5IAXA 2W95A 3TAYA 3O12A 2YC4A 4DXRA 2GMPA 2XWBB 1BZWA 3AKTA 3FLTA 3IAPA 1WW6A 3E6BA 3THCA 2ZAHA 5GZCA 1UXXX 3LWCA 2BUKA 4EN6B 3ETPA 3HT2A 5CFDA 4PLOA 2KXLA 1H2LA 4CZSA 5J3UA 4CDXB 1BEV3 4MXWB 1H2NA 3J8F2 1JYVA 1DLLA 1YYNA 4GH4B 4A6OA 3O1TA 2VCMA 1RUF2 1DBNA 3HBKA 3FLPA 1MR5A 3LAGA 4CCCA 2XUEA 2P1BA 3HD8B 4XQWA 2YUEA 4QD2A 4XURA 5T54A 3UJQA 5C8CA 2BDRA 3I49A 4F83A 1QJEA 3VL9A 2WT2A 3T2TA 1IKQA 1C57A 3BI3A 3PU8A 2RR11 1UZWA 2CTVA 2VM9A 3KHBA 4R8HA 4CEWA 3WDVA 4WVMA 1X7NA 5FY0A 2WZ8A 3LEMA 2CWSA 1NCRC 4TYSA 4AVTA 3C8XA 2XLFA 4XFAA 4I0WB 2WFF2 3OEBA 2ZOEB 5A1FA 3VBHA 1V6NA 1ZBA3 2VG9A 2ZMKA 1CAUA 2ZGNA 2HWD1 1LOFC 2C1FA 1DP0A 4ZU7A 5EJZB 5JZGB 3OG2A 3NAPB 4UAPA 1ODNA 2UU8A 4XFBA 1JS9A 1DGLA 2PHXA 5I8YA 1K5MC 4QX7A 5FPUA 2ZEXA 3AJYA 3LFMA 1NXD1 2Q30A 5CAZA 3KV4A 1O7FA 5LY2A 2R071 1Q8QA 4Z82A 3U78A 4AGGA 4K1ZA 5IJRA 4WBBA 1C4RA 1CAXB 3QACA 4YG3A 3AC0A 1EUTA 1JODA 2QJVA 1OA4A 2RJLA 3SH3A 3TEZA 3V56A 4FBFA 4X6RB 2RS52 2Z42A 4KG0A 3RYKA 5A7SA 1IS6A 2Y0IA 5FYZA 2XHKA 2PHFA 1O6UA 1C5HA 2Y6FA 4OZXA 3ZKUA 2XMLA 5ANNA 5A7WA 1PVC2 3K4AA 1W99A 3THDA 1S0JA 1WD3A 5CBLA 1C8M2 4MXWA 1ND2C 2EICA 4LTAA 4LKSA 4CE8A 3LA3A 1EAH1 1Y4WA 4OI1A 2XPJA 2ZXQA 4IV3B 3J8F1 3RS6A 3WDUA 4Y20B 4V1PA 3VBFA 4BOWA 2HKXA 2V5DA 4CCOA 4R9DA 3UGGA 2VMGA 4AZZA 3IMMA 3AFKA 3BVCA 3LE0A 3E1F1 4LJHA 5T5OA 2PFWA 5F32A 2V4AA 4MGZE 4JKKA 1G8WA 2XVLA 5DQ0A 3VBOB 4PDWC 3N9LA 4CDUA 1UY0A 2BGPA 1F5FA 1B35A 1GBGA 4QX2A 4CP9A 3LZZA 2EXJA 3IKWA 4UFIA 1CVNA 2DYCA 2B5HA 2JDPA 4N90A 5IVCA 3O1RA 3H3UA 2J1RA 4OULA 1J84A 1PGW2 3AK0A 1NA1A 4XQDA 1GICA 2O0OA 2RS13 4UW5A 4YM3A 1YXWA 2VZSA 2JE9A 1S0FA 2ZHLA 4YW4A 3AYEA 3GZAA 2J1EA 1JYXA 5EQUA 5A3PA 2YC0A 2VZPA 4QPIC 3WG1A 1PVC3 5JI7A 3JZVA 4YFZA 4I3GA 1JZ2A 2D3PA 4DEQA 3KQRA 1CESA 2A6VA 5LA2A 5A33B 5IVBA 1HW5A 2JXAA 3U1XA 2X05A 5CA6A 3ECQA 1VRH3 3R4SA 3S0MA 2D6OX 4JGZB 3WF1A 3WEZA 1W9TA 2W9XA 5AVAA 4A44A 4E4DX 1ZBE2 5GKAC 4XAAA 4C0HA 2E32A 3VBRB 1GR3A 5A32B 2VMHA 5FZLA 4Q5OA 1ZBE3 3BALA 3POEA 4YG0A 1W6NB 3M2MA 1A34A 1HQLA 3V0AA 2E53A 4CXWA 4EE2A 4I30A 1NLRA 1VAVA 1R1A1 2Y26A 2A6WA 4LPLA 5C7GA 1C28A 1GUIA 2HEVF 5ABJB 2PN5A 2WIIB 3J7LA 1KDKA 4DUWA 3Q8AA 4GJYA 3AMQA 1AR82 3OGSA 2YZ4A 3H3ZA 2GNTA 3ZR5A 1Y9MA 2VUAA 5FMOL 3NSTA 1VAMA 4JDNA 4YRDA 4MGQA 1RHI2 1LECA 3J7MA 1AX1A 2DBIA 4Q0SA 4IEZA 1SFYA 4I01A 5I0SA 2D98A 1R093 4FFIA 3S30A 2ZTNA 4D6SA 1W0OA 2BEOA 4BWOA 2F4LA 1GP5A 2VCCA 4DO0A 1Q8VA 4UF0B 5FZEA 1O3TA 1LOGA 2XR4A 3D4KA 2D6LX 2ZGKA 3MIEA 4UBGA 2OKXA 1RJ8A 3CL1A 3AP9A 3H9AA 3AYCA 4O7XA 4B7EA 1XE7A 5EV7A 4FI9A 1UU4A 3WP4A 3GBFA 3ILFA 3KF5A 2R041 5FFOC 3VBSB 3BIWE 4AQSA 4FAGA 4UBHA 2PLV1 1ZRIA 4CDUB 4CU9A 5JXGA 1DZTA 3RSJA 1NYWA 1KDMA 1OPOA 1PIV3 3BODA 3POFA 4YPJA 5FYTA 2BPA2 5EP9A 3RJ2X 1W0NA 3DPRB 5L19A 3WUDA 1DGWX 1OLQA 2OXBA 5BNOC 4MG2A 1JZ4A 3VBRA 3W21A 5FR3A 1RUNA 2WS92 3UKVA 4OHXA 2WNVC 5FP3A 3SEEA 1ZZ7A 4CA9A 1G9DA 3H8XA 4KQ7A 1BJQA 4ZXEA 2BFUS 1AR81 5JXJA 1ZBA1 4A7YA 2QQIA 4DQAA 1W6MB 1Z7S2 4LA3A 4UFMA 2ET1A 2CNAA 5FMBA 2YGMA 4R52A 4QQ2A 1WMDA 3RQ0A 4PJYA 5IK5A 1R083 4JGYC 4N43C 5DUXA 5HV4A 4YZ2A 4QPIB 4NHLA 3EO6A 2WN2A 4XIOA 2DU1A 2A6XA 5JSOA 2WNUB 4BMBA 4IEYA 1TE1B 1WMFA 4KNCA 2WA3A 3OY8B 1MS4A 3ENRA 3UL2A 3WW4A 4GH4A 2HWE2 4AW7A 4JRLA 3W59A 3AMPA 3GGLA 4IE4A 4LUKA 1H1IA 2HWB3 1VPHA 4ASMB 5C5TA 1AX0A 3AMHA 3PMEA 2CYFA 4XFHA 4XE9A 4YW6A 2OW4A 4CP0A 4DY5A 4N9HA 1RJ7A 1H1MA 2J42A 3LPFA 2X5IA 4ISRA 2C5DA 4QKNA 1OXCA 4Y24A 2OYZA 4UYBA 1YHFA 2YC2A 3OF1A 3POSA 5FUNA 5J98B 4BM8A 1DZQA 2AENA 4I2OA 2C9KA 3T2OA 3NQHA 3F2ZA 4QM9A 4W6WA 1W3VA 1AR63 4B29A 3O5SA 1SLBA 4FPCA 4LR4A 4FOYA 2Q8EA 1FPN2 4EV0A 1RUF3 4XJZA 3TEYA 1LOCA 2WO1A 1H4GA 4R9BA 2XH6A 1QQP3 2ZBJA 3VZJA 4LO5B 3G7DA 3N7MA 4SLIA 4IEVA 4X6QB 2R1DA 1D4M1 2XB6C 4CDQB 4UFHA 1OLRA 1Q3EA 3ETQA 5IVFA 4ES8A 1APNA 1PO21 1JTZX 4OCTA 1HJFA 2BOJA 3EHKA 2JDHA 1RUD2 1P8JA 1XNBA 1W28A 1SZBA 4EZ4A 3INAA 1ULEA 2YU1A 5J1XA 1ONAA 3IDEA 2XUMA 3W9AA 4H2AA 4HXCA 1H8TB 3OCPA 4KWUA 2A75A 1ENXA 3GBGA 1FI2A 1E5RA 1RUD3 1BKZA 2QZ3A 1W6MA 3MIBA 1KFUL 2KA3A 1ZVFA 2ZGQA 1GWLA 2WBKA 5D1IA 3K4ZA 1PGSA 1HQWA 3ACIA 1DGRA 1A6CA 2E9QA 1S0EA 1I6XA 2VOXA 4FT8A 4JGYA 4UF0A 3OGRA 4C8DA 3RZKA 3UNPA 3HQUA 4LE4A 4OLLA 4P00B 4ASKA 1PVC1 5JXHA 4A2UA 5HV0A 5LA1A 4HVRA 4XUTA 2A6ZA 3FLRA 5CEHA 5FY7A 2IFRA 1AR62 1I1EA 2UWCA 1ULGA 3FUQA 1G9CA 3QH6A 5AVPA 5DABA 4HSLA 4E2SA 1YQ8A 1ZZCA 4PLNA 3B94A 4KWLA 5DG2A 4W50A 5FP9A 1UYPA 3MV11 2DDUA 4Q2FA 1C8NA 2MEV3 2H0VA 4RN5A 3THPA 4HVOA 2WNVB 1H30A 3FC0A 4UW6A 2Y6JA 1URXA 4MADA 1JZ8A 3SC7X 2JB8A 2TNFA 4OQ9A 1YI9A 2MEV2 2ZGMA 2JKXA 3CKHA 4N53A 4Q27A 4BLIA 3DCQA 4UXAA 4FFGA 1RUC2 5T5LA 1BK1A 2WA4A 3N35A 5IVEA 3V0BA 3BYWA 3K3OA 3IDBB 5J37A 1TNFA 3TEWA 2WDBA 4XQ4A 1IG3A 4H3WA 2GU9A 3VBHC 2ZGPA 1F2NA 3I59B 3LF7A 5LY1A 3I3QA 2ZGLA 1U5YA 5GZDA 2YHJA 3IPVB 3UK9A 3ON7A 4YZ3A 3SQOA 1VB2A 2P5BA 1CD3G 3ZYBA 5FPLA 3NJXA 1POQA 3CZUA 2YGLA 4LBLA 3ZFGA 2ID4A 1VLNA 2JG8B 2ZHNA 2QQJA 4CDXA 1QJY1 3OY8A 1TME2 1HXS2 5IW0A 2WS93 5A33A 1GOFA 5FO9B 2G19A 4Q29A 5FQ0A 5FBJA 1W6OA 4IEPA 1JOJA 3VZNA 4AR2A 1PIV2 3BPZA 3GDBA 1CN1A 1LHVA 1UYYA 1XPWA 4IESA 5D8AA 4B4PA 3RZHA 3M8LA 3ZYRA 1X9TA 2X5IC 4LEJA 5KHKA 3HEIA 3GALA 1E5SA 3VZMA 3ZFEC 3LD8A 4Q4Y2 3ZFFC 5C4WC 1QJU2 2AEYA 4QU1A 1CZTA 2R043 4XXAA 1OBNA 3PHMA 4LNVA 4FPHA 5DZFA 5JI9A 5CYYA 3B9IA 3VKNA 1LOFA 2WLPA 4O61A 4NIHA 1FPN3 2JJ6A 4CTEA 1OF3A 1PIV1 4E4HA 3PVNA 1W03A 1YQ2A 2WZR3 1WMEA 2LTNA 5TSWA 4B4QA 5JMOA 1ULCA 2RVAA 3IAQA 2W47A 3ZYIB 4P9IA 1UIKA 2B8MA 5A7NA 4NHXA 3LEKA 2OX0A 3AKRA 3AXDA 5JLVA 5KHJA 5HI0A 3ELNA 4W6XA 1UO9A 3VKOA 4DS0A 3CU7A 3ZIXA 3RFRA 2XDVA 1LCLA 4IV1B 1JUHA 1XYNA 2F6BA 4WM7A 1VBA1 1JHJA 2ILMA 1L7QA 4LO7A 1LEMA 3MLJA 4PLMA 1UNBA 3WT3A 2P3YA 1VIWB 2Y60A 5F5CA 3ZN4A 1VBA2 2BOIA 4FPLA 2A1XA 1ZREA 3JU9A 3KGLA 4TWTA 3U37A 4FXGB 2ES3A 3R05A 3A0NA 4LO6B 1I3HA 1X8EA 3FZ3A 4YYOA 1YUDA 3EYPA 4FPKA 4Y1VA 5JIAA 4LIUA 4FVVA 2PTMA 1E5IA 1CWPA 5GLVA 3TBDA 3WNMA 5F9TA 3GCWA 1RUI3 3N9PA 4NVPA 4R9AA 1EP0A 4XDQA 5HCAA 5AC92 1T2XA 4MHUA 3FWEA 3KCYA 4XEZA 5K4LA 2VE1A 1ODMA 2DBNA 3ACHA 5E6HA 1W9SA 5LK5A 2Z69A 1B35B 2P3JA 1XXNA 2ZHKA 5KHHA 3VD7A 4WM8C 2W94A 2VJXA 5A3MA 5HBAA 3TNPB 4K40A 5GZGA 1H2MA
chains in the Genus database with same CATH topology
3DKWA 4LBNA 4QPGA 2A3XA 2PHDA 4HSJA 4GA9A 1D4M3 2NPIA 3ZXKA 1RUH2 4RHV2 4DMIA 1AXKA 4GB32 4GMP3 4Q4Y1 3RG0A 3I59A 2B39A 1OQ1A 4Q4W1 2MPFA 1EV11 1YWKA 2GN7A 1V6IA 3TYJA 1H1AA 1IKPA 1UMZA 3WY6A 5KXCA 2ZX1A 1YJKA 2ZGSA 1S0GA 3MFCA 3IMNA 4B7KA 3NVCA 1JYIA 4ES9A 4AFCA 1CAXA 3WLUA 2CL2A 2D44A 3EJKA 5FBZA 2VU9A 2YMZA 1IGOA 2JDZA 3PMSA 3FJSA 4IEUA 4COWA 1VBE3 1BEV1 4YG6A 2GC1A 2GNMA 5FREA 1O5LA 2AGSA 2G9FA 2JG9B 2O8QA 2RJKA 5SV5A 2W39A 3ROUA 4ITCA 4HMZA 3SMHA 1Y43B 1MEC2 1OHFA 3VBFC 2BNNA 3NV2A 4O9GA 4Y22B 2DFBA 2Y38A 5FO7B 5I8SA 3ILRA 2XJVA 2RR13 3RMXA 3SCHA 1RVF1 3GZUC 2YY1A 5LRSA 2A70A 1MEC3 3C3VA 3KMHA 1X82A 2GZWA 1VRH2 3SITA 3NV4A 2AYHA 4UW4A 4QPYA 3RI9A 1F9KA 1AR93 2D6MA 2PHLA 1NQJA 4META 4HN1A 5T3NA 3S7EA 3GHNA 1IZ3A 3ZFEA 3NWKA 5L7OA 2DUPA 1LOBA 1X33A 2VW1A 1JUIA 4XF4A 4D94A 3IM0A 1C1LA 2D40A 4Q26A 3WG2A 1LU2A 2K2SA 1UU5A 5JMCA 3B93A 4HKWA 1ND3C 2WS91 1OQEA 1YFYA 4OHWA 4BCUA 1FOD1 4XJUA 4RA0A 2D5HA 4WVVA 3DUIA 3WUCA 2A7AA 2IXHA 2HWC3 2AZ5A 1KJLA 2NN8A 1QJX3 3VBRC 2PLV2 1H8VA 2K0GA 4E4ZA 2BVVA 3B02A 4FAHA 3S6PA 4JC1A 2BGCA 3OBRA 2DCYA 4IV1A 2GALA 4PBOA 4XBLA 4DFSA 3O14A 2NLRA 1W39A 2EVXA 4YLZA 2HEYF 4MYEA 1FPN1 1YFUA 1PZ8A 1W6QA 1C8M3 4QMAA 5F6KA 3E5UA 1DGRN 1PGW1 2Y0OA 1N1SA 2RS53 1DQ2A 2GAUA 2EXKA 2PHRA 3AB0A 5KWRA 2ZMNA 1KRIA 1H4HA 1KJRA 2PELA 3MF6A 1AR71 1QGLA 3WZ1A 3FUOA 3KM5A 4K20A 4CEWC 1YLLA 1T6GC 3HN1A 4YGEA 1HRV1 1PNFA 2RS11 1LR5A 1RUE1 1RUH1 2BNOA 2Z5WA 4RHV1 5GLTA 4X8NA 5I0RA 3E5QA 1OMIA 3JD73 3VGIA 1GKBA 4GQ7A 2RMU1 1C3HA 1VRH1 1O91A 3M7AA 1Q8PA 2ZPXA 3WDXA 2W08A 4COYA 3K48A 1RUG3 2VVDA 4R9CA 3VLBB 2GSYA 2ARXA 4CYDA 1XU1A 1FMD3 4AEMA 4JGZC 1PGL2 1QXPA 3AMNA 5L36A 1GANA 2UWAA 2CY6A 1YIFA 4A7KA 3GNEA 4PDWB 2ZZQA 3N4MA 1EPZA 4Q4V2 1BEV2 3QOPA 1J1TA 4DXZA 2ATFA 4E4SA 4PIYA 1RL3A 3BTAA 2X8KA 5JZGC 1TQ5A 4XF1A 2OZ6A 5BY5A 2D97A 2C9AA 1COV2 1U5XA 1FOD2 4YW2A 2H6BA 4L92A 2ZCWA 5T52A 2WT1A 3LGRA 1VR3A 5FDBA 2DFCA 3JBG3 4CDUC 2SBAA 4HZFA 1AR72 3AKPA 4AXOA 3NW4A 1EPWA 4KWKA 3M3EA 1DF0A 2O8OA 5KXEA 2WZPP 1O3QA 5DDJ1 3FFZA 4AFBA 1AL0G 4GMP0 1S0DA 3H0OA 4IEQA 3VBHB 1KQRA 5BV6A 2ARBA 3AP4A 1NA1B 3D0SA 2D6KA 1DDLA 4N43B 4XTMA 1DG6A 1G86A 1PO11 1LJ7A 1GQGA 1OI6A 4WZFA 3ST7A 4AHXA 4CEYC 2E51A 1DGWA 1S0BA 1RITA 2R063 3L2HA 2QDRA 3DV8A 3USSA 2ZGTA 4L2NA 1MS0A 4YVSB 4I02A 3VKFC 4IXLA 5KBFA 1FATA 5FQ0B 3CJXA 4JCKA 3KD4A 2Q0AA 1J58A 4K6BA 2YXSA 1BBT3 4GULA 1VAKA 1BBT2 5HCFA 4FPYA 1V6OA 4ZKTB 1CJDA 5FMOS 4W65A 2CV6A 3ME2A 4XZPA 4BZ4A 1TEIA 3TB0A 4RFT0 1ENSA 4BHPA 1Z7S1 4DINB 4IQPA 3ZN5A 1AYN3 1XNDA 4HPKA 1QXRA 1QJX1 4IERA 2AUYA 3HMYA 4FPEA 5BNQA 3HT1A 4Q4W2 5F6LB 1XNKA 1RVF2 1PZ7A 2Q8OA 3RNSA 1EAH2 4Y26A 4Z1VA 4DOUA 4D69A 5LK7B 1RMU2 3WQ1A 2IXIA 4EN8B 1L3JA 4YW3A 2NP0A 2ET7A 1FXZA 5GLZA 5F1RA 1WLWA 5JPNB 4EN9B 3OGJA 1XYPA 3WHUA 3MPPG 3QH7A 1AR73 4K1YA 4QQPA 3UJOA 2WNUC 2R0FA 3FMGA 1NCQA 1IS4A 1SACA 4NO4A 4ATFA 2VGDA 5BNOA 4HBNA 1MZEA 2VPVA 2WNVA 5KC6A 1BQPA 4F8AA 3AZVA 1HKDA 4XETA 1W6NA 2GNDA 4JV4A 4W6YA 1VJ2A 1MACA 3MF9A 2HWD3 3FBMA 2RMU3 1SQ4A 2VY0A 3APBA 3D8CA 1ZRCA 4GB31 2XJQA 3DN7A 4Y1XA 1MZFA 4N43A 4IL7A 2NMNA 5J48A 3ZSJA 1W0PA 3KLSA 1CR7A 5JDBA 5EFUA 2R49A 4FOQA 1PO12 4FQ4A 2R073 3ZFGC 1UPSA 1LENA 1YCIA 2WWSA 1W6PB 2GN3A 4G4FA 4I09A 2UYAA 5JOYA 2QQPA 2VH9A 4S2FA 3SNMA 1C5IA 5DDJ2 2IFWA 1ULFA 3ZXJA 2CAVA 4QGLA 2AREA 3ALQA 4KU8A 1UIJA 4N7IA 1QJY3 1POV0 3VZLA 1R092 2DWRA 4YM1A 3WOGA 1COV1 1RHI3 1AL23 1ZZ8A 1LRHA 3NKGA 4J1XA 1KFXL 4AEDA 1H2KA 1UN1A 5K0UA 4K8FA 4LULA 3GYDA 5J96B 1UCXA 3C2UA 2JE7A 3H7YA 3R6SA 3LCPA 3H1MA 2YPJA 5FPZA 3WP5A 1QDOA 2RM21 2ZKLA 4MVTA 1A8MA 1NCRA 2E6VA 1UL9A 1REFA 4F3JA 3KT4A 2QCSB 3FFQA 2Q1MA 1WW7A 4QPIA 4XMIA 3ZFFB 1CAUB 1UW8A 3VBSC 5FOBB 1LEDA 4LBQA 4O9EA 1HV1A 1FYUA 1QKQA 3IT8A 4FP3A 4HPKB 2HWC2 1WD4A 2DCKA 3DGTA 3MLLA 2EXIA 2Z2SB 1ASJ2 3N7LA 1DIWA 1NXMA 2EXHA 2ZKNA 5FRAA 5IK8A 2LALA 1MS1A 1AYM3 4MLOA 3X29B 3JB8A 5LRRA 4FTEA 1J1LA 5FOJB 4P9GA 3LKJA 4AVBA 2VNOA 4D7SA 3KCCA 5FAXA 2ZAAA 2RS12 2RM22 4WVMB 1ZRRA 3WX5A 2TUNA 4YZ4A 4HL0A 5GM0A 3D0JA 1MQTC 5FTTC 3AZXA 1CAWB 4XFCA 1SLLA 2B42B 2XJRA 4NWVA 4OHVA 2VW2A 2EF6A 4CP1A 1DU3D 2CGNA 2IZWA 3QD6A 4XJ9A 2P3KA 5C6CA 1O4TA 1OA3A 3RRDA 5BNPA 5JCTA 3TN93 2TBVA 1V70A 4C1WA 1AVBA 1YJLA 1MZ5A 1LHOA 5T50A 2XG3A 4L11A 4MV2A 4AI1A 4NR1A 2Q4SA 2VQ0A 4AFMA 4YNIA 2ZACA 5BNNB 4AI3A 1S1AA 3LA7A 4RS5C 4AVAA 1EV13 1J59A 2R32A 3WW3A 4BIFA 1HRI2 1V00A 2ZMLA 1Z78A 1VBB1 1WW5A 3HWJA 1BYHA 2QKDA 4RGAA 3BOWA 3LSEA 3RMYA 4M01A 2G4IA 1GSLA 1F31A 3B3QE 5AC91 1GV9A 1QJY2 2ZABA 2RHPA 3KT7A 1AHSA 1S2BA 5CB7A 1S0IA 3VBOA 4I3PA 2D3SA 3ZPYA 4P9XA 1OSGA 1OKQA 2MHFA 1Y7BA 4RR3B 1AF9A 1ZBA2 4GB33 2DVDA 3V0AB 5L73A 1YFXA 3LB9A 1MVQA 2W0XA 4Q4V1 4XMAA 1M4WA 1DQ5A 1HIXA 4ASLA 2WL1A 4LBJA 4BH9A 2ZZJA 1QXJA 4Q0QA 1UZYA 1QY4A 4E9KA 1KS5A 2BWCA 3VKLA 2JENA 3VZOA 1GZCA 3ZXGA 3ILNA 2HWB1 1ND3B 5JSRA 3URFA 1ZNPA 3MW4A 4CDXC 5C33A 3WDYA 4AF9A 1OD5A 2GH8A 1SBFA 4XW3A 4AEDB 1G9AA 3VUOA 4JDOA 1WLCA 2X53S 4TLFA 3J8F3 1DQ0A 3B9CA 4KG8A 3ZXEA 3ZN6A 1AR61 3VHRA 4YARA 2HWD2 2ETEA 4WM8A 1RMU1 3KZ4C 2VOVA 1UX6A 3WCRA 1WGPA 1VBD2 1V9U1 5I0TA 1AUYA 2WJSA 1CAWA 4RQPA 3CLPA 5HCBA 1DYPA 1AL21 5I0UA 4LBQB 2B9UA 4QHBA 1N1TA 5CFCB 2FBEA 3WW1A 1GLHA 2DF7A 2H6CA 4FTBA 5E16A 5BNPB 3RPQA 3VDDC 1G7YA 5DUUA 1JYCA 3FBYA 4XOGA 3CJIC 3SH4A 4OHZA 1YRZA 4YZ1A 4XJWA 2YYOA 4D7TA 1C8M1 3R4DB 3NJZA 2ZA9A 1C1FA 2HWF3 1FNZA 1WCSA 1BCXA 2GC0A 5BXXA 1CJPA 2YDEA 3NV3A 1W2UA 5K8SA 1ND2B 2X29A 2YV8A 3WCSA 1ZBE1 2CGOA 4X8PA 1NOVA 1Q56A 4LHLA 4IV3C 1J3PA 4Q4X3 1PGL1 4N9IA 5ABJA 4HANA 2NM1A 1R1A3 2OZJA 4WVZA 4HLTA 1BMV1 4XXPA 4XTPA 5C8CC 4E2GA 1CIWA 3ZMNA 1DZRA 3VBUB 1QOSA 4BIOA 4QU2A 4DRVA 2UURA 2DVFA 4FPGA 4NPRA 1QH6A 2GDFA 3OYWA 4QQLA 1FAYA 3J4UH 4XJ8A 1OA2A 4LHKA 3UV9A 3RWNA 2WFF1 3SCGA 5BNNC 4XHBA 4YM2A 2BW8A 3I7DA 2B7YA 3P3PA 3N7JA 4P9JA 1R1A2 1X8MA 3FE5A 1HLCA 4AHWA 3NAPA 1HRV2 1AX2A 3PJYA 1RUG1 4AE2A 4EJRA 1QWRA 3TNQA 1A78A 5FCCA 4YSFA 5EWSA 3H8UA 1LTEA 1REDA 2DCJA 3A0KA 4P9LA 4FCAA 4COZA 1VBB2 4YVSA 1PM7A 1JW6A 5H9RA 3U0ZA 1GFF2 3M3CA 2R30A 4Z2WA 3N36A 1JHNA 4IV1C 1BXHA 2DV9A 1VBB3 4AQ6A 4Y1UA 3AJZA 1EAH3 3VKMA 4Q1PA 1DFQA 2XJUA 3NKTA 3WD5A 2C0ZA 4HT1T 4JDMA 2DTWA 3RJRA 1LGNA 3E6DA 1OPMA 4EN0A 4AFAA 5ACA1 1CGPA 4Y22A 3JBG1 4QGNA 1R081 2LM3A 1ND3A 4XFGA 5JPMB 4BYYA 1Q8SA 2GH2A 4MXVA 2HWE1 2XWJB 2OPKA 3BOPA 4IEXA 1VP6A 2WQZC 4M3CE 4C90A 2ENRA 3VDDA 2I07B 1RTVA 4KWJA 3HQXA 4G3YC 1MQTA 4XF3A 2PHUA 3USUB 1RUC1 4YW5A 5C9AC 1G9FA 3U10A 3POYA 3ZYPA 4AI0A 2P34A 1PHMA 3I8TA 1H9PA 3B69A 5JOZA 4FP2A 3OD4A 5E89A 3MIGA 2A6YA 1SLIA 3D82A 3IN9A 1REEA 2ZX3A 3SHRA 3WG4A 2R061 3IBMA 1JXNA 1IPKA 3BU7A 3MICA 5CFCC 5K0UB 5IK4A 1NCQB 5BNOB 1UU6A 2FZ1A 5IUQA 3MDPA 4COUA 3VBUA 4L99A 2WSUA 4DPNA 2ZHMA 5LEJA 4I0BA 4YVWC 5D8AB 4HVQA 1H8TA 1NCRB 1SFNA 4FTSA 3ZXLA 4OUMA 1PMIA 1LHNA 4J6GA 2DUQA 3VHOA 4YGBA 1QOOA 2BQPA 1H9WA 1Z7S3 3RZZA 2R6QA 4MSVA 4DZGA 3I4IA 1NE4A 1PK6A 4P5HA 1NA1C 1POV3 4XFIA 2JG9C 4FPOB 5CFDB 5ABJC 4AI2A 2ZGRA 2GC2A 3NV1A 1VB4A 5GALA 2HEWF 1PO22 3ZFGB 4AVVA 1HRI3 4GALA 1R091 4FOVA 4I0AA 5CNAA 4L9BA 2ZX2A 1N1YA 5GJ6A 3PVOA 3DPRC 3WDTA 2KM2A 2HWF1 4LBMA 2IC1A 4XF0A 4YVSC 4HKOA 4XILA 3M1HA 3GHMA 2XKPA 1NY71 3LSDA 3WV6A 1ZZ6A 5K9YA 4ISQA 1YI7A 2A3WA 1IS5A 3K51A 2PLV3 1IS3A 2DCZA 2OA2A 4CDQC 1MS9A 1DQ4A 4DRRA 2W52A 2N7GA 3UKTA 1RB8G 1H0BA 3N7KA 2WQ4A 4QQOA 2FZ2A 1SCSA 1HXS1 1TME1 1V6JA 5GZEA 3ZXAC 4MGYE 1PVXA 2JG8A 1AR83 1ULDA 1J3QA 1AJKA 2JECA 1ZX5A 1LODA 3ACLA 4RS5B 5C4WB 3CF6E 1AYM2 3MI8A 4LE3A 3VHPA 2A71A 3I2DA 4QPGB 1TMF1 1I5ZA 2B46X 3ZYJB 1V6LA 1QNWA 3RDIA 1WBFA 3AYAA 1FT9A 3NAPC 1MVEA 2RR12 3RI8A 1DQ1A 3ZVXA 1KS4A 1CPNA 5JOXA 4CEYB 5J09A 5JR7B 1IQAA 4R4ZA 1EV12 1GZ9A 1ENRA 4HN0A 4OHYA 4YVWB 1Z0HA 4EWDA 3AP7A 1CPMA 2A73B 1VBC3 2NZ9A 4QPGC 3VV1A 4BPZA 5IK7A 2DVGA 4YGCA 4NHMA 2VOWA 3AZYA 3ES1A 1QJU1 2EAKA 1CQ9A 4ONUA 5DG1A 2QNKA 3ZFFA 1Q8OA 3CO2A 4XBQA 1Y9QA 1LGBA 4P14A 4AHYA 4M3CB 2V73A 4Y1YA 4IETA 4ZXKA 2QVSB 1X50A 4A7ZA 4ZU4A 1BVP1 4K3UA 2VVEA 4GXLA 1RUD1 4MH0E 4ATEA 5JWPA 4XF9A 3OTFA 2UYBA 3O7OA 2RM23 5SV8A 1W6PA 4BA6A 4HK8A 1RUH3 3OPZA 4M3CF 4RHV3 2K9ZA 4S2GA 4XJAA 1LGCA 1GQHA 2A3YA 2B45X 3JCIA 3W58A 3HR9A 2PHWA 3JD71 3SISA 2VQAA 1F8VA 5DUWA 1AR92 5L7OB 4OI4A 2GC3A 1U0AA 1XU2A 1WLTA 4COVA 1RUJ2 1NG0A 4XIKA 2ZJCA 4HFSA 3KCXA 4BQ1A 1RUI2 2MEV1 3T1LA 2D6PA 4GWMA 1SCRA 4Q8KA 2D43A 1FMD1 1DQ6A 5E88A 5CFCA 4JQRA 1QMJA 2BFUL 5FLHA 1JN2P 2WC2A 1WCDJ 4QGMA 4AK3A 4QXKA 1AJOA 1OOPA 3E97A 4PDWA 1OFNA 1CAVA 3M70A 2D93A 2WT0A 4EWAA 4YW1A 3VBOC 4LLOA 4B4RA 5C4WA 4JAAA 4N53C 4B3NA 5L7OC 4YM0A 2RS31 3SCFA 3MGUA 4JGYB 1POV1 4Q0UA 1ZA4A 1UD1A 4GWNA 3KSCA 1ZZBA 3WHTA 2XJPA 4EROA 1HRI1 4RGGA 2V5YA 1N3PA 1XE8A 4GIQA 3V64A 1ND2A 3L2YA 5H9QA 4MUVA 3AKQA 2XL7A 3LA2A 3PLQA 4L8QA 1XRUA 2JG9A 1VBE1 1NY72 1X36A 4LUMA 4Q1RA 4RSUA 4PIXA 5EZWA 1V6KA 1SLCA 4S2DA 4WZCA 4YFWA 3SXWA 3PJQA 3AKSA 3BB6A 4FO9A 1SLTA 1YFWA 4AGVA 4LBOA 3ASIA 3FX3A 3DL3A 2WKKA 5DDJ3 2R042 2QUOA 3OYWB 1D4M2 3ZSLA 2UY9A 1RVF3 1D4VB 1PZ9A 4LHNA 1ENQA 3TOJA 3WR0A 5I93A 5GLWA 1DHKB 4B8EA 3MW3A 4DY3A 1N47A 5CIRA 2R072 3ZFEB 1AR91 5CG8A 1ZZ9A 1PO13 2FQPA 3POWA 2WNEA 4M0NA 4AQTA 2DURA 1B09A 5AC93 1HXS3 1TME3 1XNCA 4XPVA 4ZU5A 5KXDA 5BPXA 4FQZA 4M00A 2WNUA 3MLKA 5JSPA 5I91A 2RMU2 4PIZA 1H8TC 1VBA3 1S55A 2IXKA 2MNGA 3EXUA 4JGZA 1NZCA 4OUSA 5EJ3A 2VECA 1FNYA 3PVEA 1SBEA 1MS5A 4YGDA 4IEWA 4WM8B 5IT6A 5BNNA 2SLIA 4P9YA 3MZHA 3PVBB 1YO8A 1ZRDA 4Z92B 1QF3A 3G6JB 1HDKA 4Q4X2 5FPXA 5JVVA 2PAKA 1FV3A 2JEMA 5KC5A 4H7LA 5H9SA 2ZGOA 5KHIA 1N1VA 3AYDA 2HWF2 1RUF1 1QHDA 1WCKA 1KITA 1RUOA 1D0HA 2V09A 3ZIWA 3EBRA 3AZZA 4Y4YA 4QT6A 2G9GA 3B01A 1RINA 1VALA 3ZDSA 1HQNA 1RMU3 4PBPA 2DTYA 3AP6A 1QJU3 2GNBA 1V9U3 3ZSEA 4Q4Y3 4GMP1 1QDCA 4Q0VA 1NQDA 4RR3A 3JUUA 2GMEA 3JBG2 4Q4W3 1MQTB 3B00A 1LOEA 4LLFA 4BE3A 4P9WA 3OGGA 1HRV3 4YZ5A 2LUWA 4Z07A 4JVAA 3MIFA 3VBSA 1VBD3 2WFPA 3VN4A 2VULA 4IV3A 4U36A 4CEYA 4Y20A 2NYYA 3VBFB 4S2HA 3FHIB 2E7TA 5BUVA 1G9BA 3V65A 3TRSB 4OI0A 1V6MA 1CAVB 2JKBA 1FMD2 3AP5A 4WM7B 5KXBA 5DXDA 4XBNA 2D5FA 4PCRA 2VNGA 4Q4X1 3ZSMA 4KU7A 2XLAA 2ZX0A 5EYXA 3VHNA 4C0BA 2VNRA 3A4UA 4CRQA 5BYNA 3IPVA 5CADA 1MEC1 4EN7B 3JD72 1RC6A 2XKOA 1YNAA 5KHGA 4F7ZA 2R1BA 5DZGA 3J9SA 3JQWA 2QDNA 3VDDB 1A8DA 5C8CB 2CWMA 1WA4A 1OOPC 3CNAA 3B5LB 3J26N 1BMV2 4HK9A 3USUA 3M3OA 4CEWB 2XBO2 5C8WA 1QH7A 2IWGB 3IIAA 3AMMA 4HETA 1SDWA 1FOD3 3JQXA 4QQHA 4QM8A 4QX5A 2EIGA 1LOAA 1COV3 1RHI1