4IW3A

Crystal structure of a pseudomonas putida prolyl-4-hydroxylase (p4h) in complex with elongation factor tu (ef-tu)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
201
structure length
201
Chain Sequence
HPMLAAVVDDLATHGWSQQAHFLPADLVRALAAECRRRDAEGELNPAGVGRGATQEVRETIRGDQIQWIDPGQAEACDQYLAAMDQLRLAINQGLFLGLEDFECHFALYPPGAFYRRHLDRFRDDDRRMVSAVLYLNEGWQPHDGGQLRMFLADGVEHDVEPVAGCLVVFLSGEVPHEVLPAGRERLSLTGWFRRRGNDPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Human oxygen sensing may have origins in prokaryotic elongation factor Tu prolyl-hydroxylation
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Metal binding protein/translation
total genus 58
structure length 201
sequence length 201
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4iw3A00
3KT1A 5C5TA 5C5UA 5ERLA 2RG4A 5DAQA 4XACA 2RDQA 5LBEA 5LBCA 3NNFA 4NHLA 4Q5OA 4BQWA 5LA9A 5DAXA 4IW3A 3NNJA 5M0TA 4UWDA 5LB6A 3BVCA 2JIJA 3OUIA 3HQUA 5L9RA 4NHMA 5A3UA 4XABA 2G19A 2JIGA 5EP9A 5DAWA 2FCVA 5EQUA 3KT7A 4XC9A 2Y33A 4XCBA 4JZRA 3OBZA 4ZONA 3EMRA 4Y5TA 2FCTA 2OPWA 4KBZA 4NMIA 5DAVA 3W20A 3ITQA 2HBTA 2Y34A 5LATA 2RDNA 3PL0A 4NHXA 2HBUA 3HQRA 5HV4A 3W21A 3NNMA 4NAOA 4NHKA 4XCAA 5L9VA 3MGUA 3NNLA 4NHYA 4XAAA 4MHRA 5HV0A 4Y5SA 3GJBA 5L9BA 4J25A 3OUJA 3OUHA 4BQYA 5LBFA 2V4AA 3DKQA 5IATA 5EPAA 2RDSA 2A1XA 5DAPA 3GJAA 5IAVA 2RDRA 5LASA 4MHUA 5LBBA 4BQXA 2G1MA 3GZEA 2FCUA 5IAXA 3KT4A 4ZPIA
chains in the Genus database with same CATH superfamily
1EAH1 2VR4A 4QX7A 1ZBA3 4WM8A 5DAQA 3JBG1 3IN9A 4ET7A 2QFEA 4WVMA 5J37A 1LAJA 1VB4A 1OH3A 5LBCA 1ASJ2 1MVQA 1PGSA 4DFSA 1MPXA 1H6XA 4N9HA 2ADDA 4FAHA 3CDZB 4LMFA 3N9OA 4Q5OA 4A42A 5FLHA 1OPOA 4BMEA 3ZPOA 5AFEA 4FO9A 2ZEWA 3CJIB 2WWJA 4D94A 5FZ1A 2VOXA 3GF6A 3OD4A 4RS5B 5FJKA 4LUKA 1AYN1 2R0FA 1XRUA 2JE9A 5HCFA 1DLCA 2XJRA 4Y1XA 3SHRA 3TWIA 1FYUA 1UPIA 4EYUA 1O7FA 1BEV2 5F3IA 5FIXA 4YSFA 4CUCA 3H0OA 3PIJA 4CRQA 3KS7A 1QGLA 5DAWA 3U78A 2VMEA 4CDWA 3VZLA 1N1SA 1YFYA 3ZFEC 2PTMA 3MYXA 4AVBA 4OQ8A 2JECA 2RS31 1XNDA 3H1YA 4MUVA 1V0AA 3ZYIB 4CCLA 2GMPA 1JYCA 2KD7A 3MLLA 4BISA 1ZZBA 3FBMA 1XC6A 5F6LB 4EJRA 2W94A 2Q30A 5CKMA 1XQNA 3FLTA 2HWD1 2UYAA 4PDWA 2WLQA 3OBZA 4OUSA 4AE2A 3ZIWA 4AZZA 4HVQA 4D7TA 3E6CC 4W4ZA 3N7KA 3PHMA 2ILMA 3ZFEB 4FT8A 2XXZA 3CMGA 4Q4X1 4QPIA 1ZRDA 4F7ZA 2KR2A 2WT0A 1PMJX 5FZKA 2XBO1 4KBZA 4UFLA 5A6ZA 3H1MA 5DPNA 1NOVA 1XE8A 4HN1A 3H3ZA 3AYEA 1C8NA 1U12A 2FHRA 1XE7A 1S0EA 1K45A 3BGAA 1XPWA 4LLFA 4GMP0 4UW4A 1QOOA 1W6NA 3FHQA 2WZR3 2IZWA 3MW3A 3VBHC 4YWAA 3NL1A 4XF4A 1IS3A 4GWJA 1UY3A 1W8OA 4QGMA 4UW5A 4CDUC 3I49A 2YGLA 5DZGA 3AK0A 5H9RA 4CDQC 3O1PA 4NHXA 5FP4A 4Q0PA 3H8OA 3NJVA 2XQRA 5FO7B 3O1MA 3M1HA 5FPLA 2WS92 5FZ7A 1GR3A 3H1WA 1RITA 1HKDA 4IEXA 2P4EA 4XDOA 5DG1A 4W50A 5L36A 3K77A 2WZEA 1LEDA 4YVSC 1PIV2 3VBHB 5LY1A 1AR62 1RUD1 2JG9A 1D2QA 4CDUB 1YFUA 3EHKA 2GNDA 4JGZA 1DFQA 2O0OA 3O0XA 4CDQB 3WP3A 1IZ3A 1SLAA 1PO12 2FZ2A 3RYRA 2CNAA 3ZYHA 2CGOA 1MR5A 3AP7A 4LEJA 4JHZA 4AVVA 2RDRA 5TSWA 2ZOEB 2PAKA 1W39A 5BNNC 4GWNA 1VRH2 4YVSB 3RI9A 4AFBA 3UJOA 4DXTA 1YI9A 3GBFA 1XYPA 3D4KA 4OMCA 4BLJA 1AXKA 2P3JA 3WHUA 4XIKA 1R1A3 3MLKA 4AEMA 2JEMA 1FI2A 2EIBA 4IV3A 4OZXA 1REFA 1PGL2 2D6LX 3S5AA 3PU3A 4LPLA 4HVOA 2R073 2VQ0A 3CEWA 2WR9A 3LDKA 2VAUA 4HSLA 4IW3A 3LFIA 5A3OA 1JS9A 1L7LA 5BNNB 2FDGA 3SC7X 4KG0A 1IGOA 3A21A 5FPAA 4QKFA 2FMYA 2X09A 2B5HA 3OUIA 2QQNA 5E8AA 3DECA 1R092 3RG0A 3R05A 1W3XA 1RUF1 4RA0A 4LORA 5CFCC 4BHPA 4Y22A 3BTZA 1DGRN 1NLRA 1O3SA 3JXSA 2BJSA 4AEKA 3IAPA 4HZFA 1H9WA 2D6MA 3IPVB 2QJVA 1TQ5A 3UNPA 4CDXA 1CIYA 3WNXA 3LF7A 3PTRB 3N35A 3AMPA 4MLOA 4P02B 1SZBA 2A75A 3LFMA 3BPZA 2NPIA 1UD1A 1UKGA 4QMAA 4QDSA 4AFCA 3ILNA 2Y38A 3VBSC 2WT1A 2DF7A 2E7QA 2D6PA 3NMBA 4YM0A 1QOTA 4LBJA 4UFHA 5CFCB 3B01A 5C8CC 2R041 1DP0A 3WF2A 1BXHA 4MGYE 1VMHA 5F8PA 4R9DA 1AYM2 1JZ3A 4YW2A 4FOYA 4XYXA 1UY0A 5EXOA 1GZWB 4KBBA 1W9SA 4YGDA 1UOBA 4TYSA 3AX4A 1WLWA 1H4HA 4LIVA 4MGSA 3LEMA 2L9LA 3N9PA 3VBSB 2FDFA 3UGGA 2AEZA 3HNMA 2HEWF 5JR7B 4OUEA 4LK7A 2RR12 3C7GA 4FOVA 1WW7A 5C8CB 2BNMA 5F5CA 5ANNA 3H3UA 1RVF3 2WNVC 5CZKA 2GH2A 2A3YA 1ONAA 5ACA3 1AR83 1AZDA 2Y6HA 1AJKA 4UFKA 4UYBA 2NYYA 3IT8A 4HKWA 1W06A 2JDZA 3L2YA 4XQ4A 5K7PA 2RS51 2YFUA 4YZ2A 2MEV2 3VHPA 1HXS1 4JQRA 4FXKB 4L92A 1IOAA 3BCWA 1EPZA 2VNGA 4MO3M 4K1ZA 2XVGA 5DMYA 3OGSA 2VZSA 5A1FA 5J09A 1T2XA 2V4AA 3M2MA 3POBA 4Z2AA 1QOSA 1J3RA 1UF2C 2BGOA 2YYOA 4LHLA 3SQOA 5GZGA 4M4RA 1RUG3 4A7ZA 4K8RB 2WNVB 3IM0A 3VKMA 3VHNA 1EV12 2JDPA 2UY9A 2GN3A 5JVVA 1Y9MA 5FMCA 1JTZX 4AXOA 3LWCA 1FMD3 2P5BA 1SCRA 3J4UH 2ZZJA 4FFFA 5IVJA 4Q4W2 4IEZA 2RS11 2D7FA 3LPGA 4AAXA 1ND2C 5FZ8A 1V9U1 1F35A 4LBQB 1V6JA 1LGBA 1LHOA 4LR4A 4NROA 1S0BA 3WW1A 1YJLA 1ZZ6A 4CEYC 3I2HA 5L7OC 4XFHA 2WWUA 4IDZA 2C4XA 4XF9A 3D0JA 5A33A 1HV1A 3KWVA 1VBC2 2WO2A 5E88A 3WY6A 2E51A 2EAKA 2JDUA 1B35C 1VBD3 1W6QA 4RYDA 3CLPA 2OA2A 2ZGPA 4RGAA 1G6NA 2O1QA 2EXKA 4GWMA 2ZGUA 2WWSA 3JZVA 4IESA 4JX0A 4N53A 5BNQA 2J1VA 4ZZ8A 4GKXA 3NNJA 3WX5A 1W8WA 2D3PA 1GBGA 1ND2B 1V6LA 5DDJ2 4COWA 4CEYB 5L7OB 1NCRA 1B09A 4BU2A 5FBZA 1XOYA 1ULPA 2B4KA 2ZGKA 3K3OA 3CQOA 5BUVA 3O1TA 1RHI3 1BKZA 4YM1A 1BYHA 1B35B 2IVJA 3POEA 2HWE1 3C7EA 3ROUA 1C28A 1SLTA 2D6KA 3C3VA 2IXHA 2ZS6B 1H6YA 2OT7A 2OQ7A 4CU7A 4AF9A 1XB9A 4QXKA 1J1TA 1BHGA 2GC3A 1I6XA 3AZWA 3I97A 2FD8A 5A3TA 4CXXA 1QJU1 4GULA 3AYDA 4RQPA 2J1UA 1MS4A 1ZZ7A 5HCBA 1LCLA 2LALA 3ZYBA 1X9PA 4OVEA 3GALA 1H0BA 1QDCA 4JDOA 4ZKTB 3J7MA 1FPN1 2WABA 2ZABA 3WCRA 3RMYA 1X36A 2BNOA 2YDEA 5D8AB 4TXWA 1JXNA 1FOD2 1W03A 2QNKA 1W0NA 3KV4A 3CJIA 3OD0A 2Q1ZB 4AGRA 4GMP1 4Q29A 4RS5A 3VL9A 1RYYA 2JD4A 1YHFA 3M3CA 5I0RA 4IGQA 4M4PA 3WZ1A 1RUG1 4N8MA 4ARXA 4ZU4A 4QXCA 5I0DA 1UYZA 2BFUL 2YZ4A 4EWAA 1RL3A 2C6SA 2CV6A 4E2QA 4F83A 3O7OA 1JZ6A 4C8DA 2RDNA 3GYDA 5EZWA 5KXDA 4GALA 3ZVXA 4QB6A 4UW3A 4XF0A 1W2UA 4COVA 3HQRA 4AQTA 1D0GA 3AL5A 3B69A 4YFZA 1OHFA 1KJRA 1W0OA 2VGDA 4XJ8A 3I3DA 3TYJA 4DEVA 1V6NA 2WYSA 4LA2A 4EN0A 4RR3C 4A41A 2ENRA 4G9SB 1OPMA 5DQ0A 5L9BA 5JPNB 5JSPA 3ACFA 5J7MA 3POSA 1CVNA 1LJ7A 2HWC3 1TG7A 2PXJA 3GZUC 1MS5A 3JD73 3KV6A 3OUJA 3OGVA 4Z8BA 4LITA 3ZFEA 1RUI3 2GC1A 2RHPA 1QH7A 1XU1A 3GGLA 1W90A 2ZX1A 3UT0A 4L99A 1POV0 4OHZA 1HN1A 2BBAA 3GJAA 2Z79A 1C8M1 1CD3G 4RSUA 4RR3B 1FNZA 2AACA 2QZ3A 2DDUA 1G9DA 4IUGA 5FXVA 2WSUA 2ZGSA 1O5UA 2CWMA 2WINB 4XDPA 1ULDA 1LECA 1VAMA 2DFBA 4ZPIA 1GV9A 2J42A 2RM22 2P2KA 1JH5A 1PMIA 5A7PA 4NIDA 1Q8SA 4XF3A 5I0UA 1E57A 5C3RA 3VZOA 2QQOA 4FVVA 4IE0A 4K21A 3UK9A 4A3ZA 3RZMA 4JDNA 4NRPA 5KC6A 2UU8A 5FZBA 5BY5A 2RMU2 1VBA2 2W2IA 3H3LA 2P37A 1UYPA 1SFPA 1OLQA 1H1MA 5FFOC 2R063 4TN7A 5JOWA 3C7HA 1COV3 3VBHA 1F8VA 3LE0A 4XAEA 4KMQA 1FXZA 4QD2A 4W6YA 4ARYA 4FTSA 1UN1A 4CDUA 2H0VA 1RUJ2 2JD9A 3HQUA 5AVAA 4CDQA 2QQPA 1LULA 3B94A 1GNZA 3A0NA 5A3UA 2A3WA 2H0BA 3U14A 1JYNA 4XIOA 2A73B 5AC92 3OEAA 3VBFC 1HB4A 1PMHX 2LUWA 2FCVA 2VVEA 4O9EA 4INDA 4AI3A 3KVAA 4XC9A 1JODA 5T5JA 5FZDA 4AEDB 2YBSA 4CU6A 1UY1A 4N43C 5FZ9A 4UBHA 3WT3A 4O7XA 3I2OA 1JN2P 2K0GA 2ZXQA 3DKWA 3PJQA 1O3RA 4YVSA 4Q4V3 2VC9A 4XJZA 2VUDA 4DIQA 2IFWA 3B00A 4SBVA 4BH9A 5F32A 1VMJA 2VTXA 3DN7A 1PO22 1C1LA 1HRI2 2WC2A 4ZONA 2VMGA 2I07B 4H7MA 3WQ0A 3VD4A 3VBFB 1UIJA 3C8XA 3MUZ1 3OBTA 2TBVA 5IFTA 2BW8A 5JOZA 3JD71 4N43B 1AXZA 1PNGA 4ISQA 5BNNA 4ASKA 2ARCA 3CU7A 2VVDA 2IVIB 1OF3A 1RUI1 4Q1RA 4UFIA 2RVAA 3F95A 3PUSA 2C1FA 5FCCA 4JKLA 3NJXA 3E6DA 2A6ZA 3WCSA 4Q4Y2 2QDRA 3D82A 2DVAA 1UKRA 2JE7A 1HJFA 1UOFA 4LKDA 1OUSA 1EAH2 5FY1A 3ZM8A 5LA0A 5JMCA 5I93A 1E5IA 4LLOA 1ZBE1 3JBG2 2D6NA 3IPVA 4XMAA 1LTEA 3VDCA 5FYZA 4NHKA 3RYKA 1Y7BA 2W39A 2Y0OA 3MGUA 3RZJA 5D21A 3SITA 3T4HB 5C3PA 4ORFA 3ORJA 3T0AA 4Y5SA 2ZGMA 2VUJA 3TB0A 1OXCA 3OGGA 3ACGA 3NV3A 5FZFA 4QKDA 3MUY1 4F8AA 4L9BA 2ZCWA 4AI1A 5LBFA 5CFCA 3KD4A 2UY8A 1AYN2 4JDMA 4CUBA 1GKBA 3T2QA 3NV1A 3RZKA 3QOPA 3WP4A 3LEKA 2VBDA 1GZWA 5FZLA 5JZGC 2WRAA 1BJQA 4JRAA 1V6OA 1W8ZA 2W91A 2WJSA 4MHUA 5B2GB 1RJ7A 4Y3OA 1LGCA 2RS32 4WM7B 2WZPP 5A6QA 1DQ4A 2GNMA 1QXPA 3AKQA 3VBSA 3RVHA 2HH9A 5IAXA 5I8SA 5KHGA 3I2GA 2ZKNA 4XUNA 4NO4A 3B5LB 4QDQA 2E53A 5C8CA 2HWD2 3DUIA 3OPTA 2WFPA 2HJIA 4Q4V1 3K3NA 2YG0A 3WVJA 5C33A 5CAZA 3RPQA 4FFGA 5CISA 3T09A 4MXVA 4P00B 1AUYA 4CU8A 2VZRA 1LKNA 1HN0A 1R1ZA 2UYBA 2XJUA 5JZGB 3V0BB 4BM8A 1MS0A 4BPZA 4Q4X2 5FYYA 1H8VA 3M3EA 1ULFA 2YB7A 4PQ9A 1W9YA 2FDJA 2XBO2 3HT1A 4QPGC 5G05L 4UWDA 4E4ZA 3EBRA 3MW4A 3N3HA 1JZ5A 1W0PA 1QJY3 2ATFA 5A3MA 2WL1A 1BZWA 4Q0SA 2VXJA 2RJLA 2DUQA 3LIGA 3EQEA 3FFZA 4XW3A 2WNVA 4PCRA 5FZAA 5LK5A 1HIXA 1O4TA 4Y33A 2DBIA 1VALA 1VIWB 1H2NA 2QCSB 2W52A 1UW8A 1WW4A 3EB7A 5E16A 1IS5A 2VCCA 3ZXGA 1WWYA 3QLQA 4A4AA 1DQ6A 2CAVA 2Y33A 4LBQA 4QPGB 3WP5A 2KXLA 1JZ8A 4CXYA 4CSWA 3ZR5A 4E4SA 4M0NA 1QWRA 2WKKA 1Q3EA 2GZWA 1VRBA 3WW4A 1F15A 4D6SA 4ZZ5A 4Y24A 4KWUA 3S6PA 3TBDA 2ZMKA 1RIRA 2VZPA 4G3YC 1WD4A 4XF1A 3WINE 4E4HA 3POYA 1RUD2 3Q8CA 4YARA 4Z2WA 1KJLA 2DVGA 1AL23 5FZGA 1RUH3 3MI8A 1ALYA 4HONA 4JC1A 1ND2A 4LOSA 4IETA 2YV8A 1GWLA 4CEYA 4LULA 5L7OA 1TMF1 3AP5A 4FCAA 4NAMA 2ZAAA 3AVSA 3OBRA 3WNLA 1QQP1 2VH9A 4IV1C 3LKJA 3WV6A 1MS1A 1JOBA 2HWF3 4QX8A 4XZPA 1B35A 4NIHA 4YGCA 4IEWA 3RZLA 2B45X 3LQCA 4AQ2A 2G9ZA 5FZHA 3ZO0B 1J83A 2E26A 3BI3A 3MZHA 1NKGA 1W8TA 1CX1A 3N36A 1MVEA 1YFXA 1U5ZA 5JI9A 4BIOA 2C9KA 4XAAA 2W0XA 1N3OA 1S0DA 2XMLA 4MHRA 5A3NA 1F31A 1WA4A 4QB2A 3THPA 4AYUA 1H2LA 4CCEA 2FDIA 2VBPA 4IV1B 1XYOA 4XEZA 2XJQA 5FPVA 1WMFA 1H9PA 4MXWB 2XGXA 1POV1 3WG2A 2WQ8A 1O5LA 3EYPA 2QQMA 1JUHA 3LA3A 1UOGA 1RUF2 1QJY1 2F17A 1NE4A 1N47A 3M3QA 2BTVC 1UX6A 5H9PA 3E5QA 1W99A 4DS0A 4YG6A 3WNOA 4EN6B 1IKQA 5C6CA 2BU9A 3M70A 2JX9A 5LBBA 3RFRA 2A6XA 3WF4A 4B1MA 2JB8A 5BYNA 5IVBA 1ZZ8A 2B9VA 3DXTA 3O0WA 3HJRA 4P14A 1QNYA 4PIZA 3AFGA 3SNMA 3TRSB 2GSYA 4PF1A 4I01A 4M00A 2TEPA 4DOUA 3VB9A 5C5TA 5CEHA 1OD5A 4TSVA 2ZAHA 3OB8A 2VNVA 4QHZA 3RGBA 3ALQA 4C1XA 4ES9A 2A6VA 1RJ8A 5I91A 2JB4A 3VZKA 4A7KA 1R081 2E6VA 4O61A 2VJXA 5T55A 2R042 3KV9A 4XUTA 5DAXA 5EWSA 3ME2A 4H7LA 3T2OA 4KU7A 1OT5A 1UXXX 4HVRA 2AREA 5EJ3A 2VXRA 3D6EA 5LB6A 3MO4A 5J48A 3ZXLA 1W28A 4EROA 4QAWA 5CFDC 1SMVA 3VBOC 2JIJA 4I0WB 5FP7A 2IUWA 5EYYA 3ZN6B 5FTTC 3U37A 1U5IA 1JHNA 4Z07A 4B8EA 2VQUA 4E9KA 3V0AB 2G19A 4OCTA 2E32A 3VBRC 3K48A 3CZUA 3E6BA 3KT7A 1YIFA 2AH2A 2QQIA 1WMXA 3AC0A 4L11A 4RR3A 2W1WA 4CCCA 1W3VA 4XBLA 2HWF1 4DUVA 5F3CA 5HPOA 2O14A 3MF9A 3R0RA 1HW5A 1OLRA 1PZ9A 4XCBA 4K20A 3N4MA 5T5PA 3WP6A 1CIWA 5CFDB 1IQAA 2NZ9A 4UAPA 3VBOB 1ULEA 2RS52 2QQJA 4DMIA 4DINB 4JQTA 1HXS2 2XR4A 2CDPA 5FYIA 5FZ4A 4FPGA 1IG3A 4JAAA 4QPYA 4COUA 1DCSA 3VBRB 2D98A 3ZSJA 1LRHA 1RXGA 5J36A 1WBFA 1ENRA 5KR7A 4BZ4A 3W20A 4XFFA 2X29A 5J3UA 4DB5A 4JTNA 4XUQA 3DYOA 4AHZA 4AWDA 4NWWA 4BQ5A 4PBOA 3HQXA 1AR93 3E97A 1A78A 1Z7S3 2AR6A 2OUHA 4BOWA 4L8QA 2RS12 1KRIA 1V9U2 2A70A 3LAGA 2Q4SA 3I3QA 4FFIA 4XXPA 1QJFA 4CEWC 3MBWA 1DYOA 3AZYA 1G9FA 3RJ2X 5DUWA 4ZU5A 1GSLA 4XQWA 3SXWA 4UF0B 1YXWA 3KQRA 5L9VA 3ES1A 1NQJA 3DCQA 4GKYA 1MACA 2KA3A 2QE3A 3N9LA 1EY2A 3NNLA 4P9JA 2NQYA 2XJTA 4G4FA 1G7YA 1KFXL 5JPMB 1SG3A 1I3HA 5F5QA 5I8TA 2WFF3 3RSJA 3VDBA 3AKTA 3O1VA 4YGEA 3LA2A 1VBB3 3O14A 3URFA 1J1LA 1S2BA 1YJKA 1IHMA 4Q0QA 1RGSA 5FP3A 1RMU3 4CEWB 3VBFA 4M0HA 4BQ3A 3HOBA 3RZZA 5IATA 1YWKA 1Z0HA 4XTPA 3AYAA 3EJKA 4N43A 2JJ6A 5EHDA 3ZXJA 4RHV3 2WYFA 2V5DA 5CADA 4XFGA 1RINA 2HWE2 2GC0A 4AK3A 3VKNA 1ZA7A 4AGGA 5IK4A 3SEEA 1ZBA1 2FCUA 1VB2A 1DYPA 1NA1C 1WD3A 2YC2A 3GZEA 3KT4A 5B4XA 4AI8A 2DV9A 1HB3A 1QJU2 4HL0A 4MX3A 1KDKA 3ACHA 3FUQA 1ZM1A 3BOPA 2PLV3 3KHBA 3AFKA 2VL4A 4H2AA 4ISRA 5LA1A 1WKYA 3ZKUA 3BOWA 1N3PA 4Q8LA 4NHLA 2WNEA 4LHKA 2E33A 1FPN2 1NG0A 2DCYA 4DNYA 3B9CA 1DDLA 5ABJC 4B4RA 1P8JA 3MIDA 4X6RB 4BA6A 2PQQA 4FPHA 4I2OA 1L7RA 3ATGA 2C0ZA 3CBNA 4C90A 1RB8G 2LM3A 4FPKA 1NA1B 5L19A 2LS6A 3K75B 5G04L 3AXDA 3I8TA 3S30A 5FWJA 1RUG2 2EIEA 2VCMA 1E5HA 3H8XA 5JUVA 4Q26A 1F2NA 3WHTA 2HYXA 1AR91 3AMQA 5GLVA 3WSOA 1TME3 1Z7S1 3AP4A 5ABJB 5C7GA 3B3QE 3K4AA 3HBZA 5FOJB 4EN7B 1UZWA 5C70A 1PVXA 5C9AC 1X8MA 4IQPA 1UL9A 4U2AA 5GM0A 2AYHA 3IDBB 4Z82A 1GYKA 1TNRA 1YO8A 2YFZA 3HR9A 3KF3A 4W6WA 3VD7A 3B9IA 1JBCA 3GHMA 4D7YA 4DPNA 2BQPA 3LOBA 3WDVA 4RL7A 4AI9A 4CYDA 2DUPA 4M3CB 3ZYPA 3NKGA 3VKOA 2WN2A 2GH8A 1OUXA 2CY6A 3POJA 3FBYA 1AX2A 3S5QA 1F9KA 3D3AA 1ASJ3 3CHXA 2VBBA 5JZGA 3U4XA 3V0BA 1VBB1 3UKNA 1LHVA 5F5IA 2OPWA 3O1RA 1K42A 2UWBA 1F4AA 1RMU1 5C9AB 1O6UA 2JENA 2BWCA 4OQ9A 1C8M2 2WZR1 5CVRA 4YZ5A 1QF3A 3W58A 2HBTA 3OY8B 4RHV1 4HOOA 2E7AA 1CZSA 2HEYF 3HN1A 1V6IA 5LATA 4HLTA 1JW6A 3KQ4B 3MF6A 5CU1A 1CJPA 1H1IA 4BE3A 5AVPA 2R49A 4MGIE 4NN0A 5FUIA 5FWEA 1NZIA 3VZJA 3NNMA 1C57A 2P6CA 5DG2A 1YQ6A 1UMIA 3JCIA 4GXLA 4QPGA 4XILA 1G9BA 3AKSA 3GXUA 1R64A 5E6HA 1EPWA 1XNTA 2A5ZA 2NM1A 2Q5TA 5IVCA 1UMZA 2PLV1 1HRV3 1UOJA 5IVEA 4CP0A 1SQ4A 2Z5WA 3KGZA 1K3IA 1NUKA 2EXHA 5A7OA 4HKLA 4CZSA 4C91A 4IL7A 1RUE3 2Q8OA 4B7KA 4BDVB 5A3PA 5GZFA 3VDAA 1GWKA 3JUUA 4YPJA 3VKFC 3AKRA 4ZXEA 4XFBA 2LROA 3MIGA 5C4WC 5GLTA 4Y1UA 1X50A 3QBQA 2A1XA 4X8PA 3DL3A 1G8WA 3LEIA 1ODNA 3WDYA 4QPWA 4MGKE 3E5XA 4PIYA 3TEWA 2FDHA 2VU9A 1VJ2A 2GN7A 2ZX0A 3Q8FA 5DUXA 2I74A 2ZEYA 4QWNA 3I7DA 3I2IA 1LOCA 1OH4A 2QQLA 2GMEA 3IDCB 2E31A 4R9CA 1R1A1 3V64A 4CP1A 1ZA4A 3MIFA 1GFF2 2F6BA 2RDQA 3VZMA 5C4WB 3M3OA 2XWBB 2Q8EA 5F37A 1LHNA 1O3TA 4XHXA 2I2SA 1FV3A 3J7NA 2R071 3R4DB 4PQQA 2XL9A 3TEZA 4BQWA 1W2TA 2WS93 3A4UA 4GZ9A 4XJWA 5JWPA 5LA9A 2DFCA 3FN9A 3JD72 1WCDJ 4IV1A 4N90A 1RUOA 3H8RA 5M0TA 3Q8AA 4LO7A 2EVXA 3WDUA 1PZ7A 4XDQA 2VMHA 2WN3A 1RUI2 1PIV3 2XONA 1GZCA 3BVCA 3J26N 4JHTA 2XHNA 4MXWA 1JZ7A 1IQDC 1GICA 2E9QA 1DF0A 4FOQA 2RV9A 1U5XA 4XQDA 3HD8B 4QX2A 4Y4RA 5FYSA 5A70A 1WMEA 1QNWA 2W92A 3AL6A 3KCXA 4PI0A 1PO13 2LRPA 4WVWA 1ENXA 3B02A 1S2KA 4K40A 4I09A 1UYXA 1MQTC 1HB1A 2ZTNA 1ZBE2 2VD7A 3THDA 4ATEA 5L73A 4LOTA 5FK7A 1Q43A 4OULA 2JKXA 1ZNPA 1JYXA 2YY1A 3GDBA 1SFYA 3KLSA 4PLNA 3V65A 1UY4A 3VD5A 5JLVA 1SLLA 2PAMA 3OCPA 4P5YA 2Q8CA 2DTWA 2YC4A 1QHDA 4YW7A 1I9RA 2VECA 3C7FA 4Q0VA 5JXIA 4KL1A 2X8KA 5FY7A 1XU2A 3EMRA 3M7AA 2NMNA 3IDEA 4LIUA 4MZUA 4MH0E 1HRV1 4P5HA 3PUHA 3MICA 4B4QA 1G9AA 2XPJA 1MQTB 1U0AA 4YG3A 4BXSV 1WMDA 1RUE1 3AXEA 1JI6A 1HJGA 3I2KA 3OPWA 1J58A 1W05A 3SH3A 4NIIA 4QXBA 5A6XA 3ITQA 5FZMA 4PLMA 5D8AC 4JRLA 5A1LA 1CAWB 2OX0A 3ZN6A 2AENA 4QGNA 1ZRRA 3J7HA 1ULGA 4XUOA 1R093 3PTYA 3V0AA 5JSRA 5HBAA 5FPBA 3AMMA 5J96B 1RVF1 4BLIA 2WO3A 4D6QA 2DYCA 1AR81 5ACA1 2JDMA 1AX1A 3I2FA 5A7NA 3SCGA 3VLBB 4IGPA 4XCAA 2IXKA 5BNOC 3KB5A 4DY5A 1A8MA 5A7SA 1GMMA 3ZSLA 3MV11 1UU4A 2BZDA 1H2KA 5CFDA 2BERA 1YCIA 3VBOA 5HV0A 2GU9A 4CP2A 2PHWA 2VZOA 2VZUA 1VBE2 4EN8B 3OUHA 2XKOA 4RGKA 4P9YA 3MLJA 4P9WA 3ZFFC 1ENSA 4J6GA 4D6RA 2WS91 3NW4A 3VBRA 3KMHA 3AMNA 3ON7A 4LXLA 2SLIA 4AOCA 1DQ2A 2BWAA 1MZ6A 4S2GA 5A7WB 2QQVA 3L2HA 5T5OA 1NY71 3IB3A 1K5JA 4V1PA 5BNOB 1KD7A 1FMD1 1YYNA 2MNGA 5C3OA 4COZA 1AYM3 5HCHA 1OVSA 4K7JA 4AEJA 1ZRFA 1CWPA 4HK9A 3PVNA 2VOTA 2YU2A 4I0BA 4LA3A 1OLMA 1V00A 5IWFA 5FJHA 4ATFA 4C0HA 2VZTA 3VV1A 1OQ1A 2ZX4A 2XLGA 4QU2A 3ZFFB 5AFBA 1CAXB 4AAPA 2XH6A 3SKVA 5CG9A 4UF0A 2D6OX 1VBD1 3NNGA 2RR13 3I54A 1AL0G 2C26A 2XJVA 3ZXEA 3RYPA 4TTGA 1ULOA 4IXLA 1KQRA 1TZOA 4N7UA 3ENRA 3AP9A 1JOPA 1YQ5A 2MEV3 3I2DA 1W2NA 3MIHA 4CEWA 1C4RA 1V6KA 4NVPA 5EFUA 3FUOA 4CXWA 3QH7A 1TMF2 1OFNA 1W6PB 5FQ0B 5IYYA 1RHI1 5C3SA 4META 1NX9A 2RE9A 1QQP2 1Y3TA 4I3PA 5BV6A 4WZFA 1SBEA 1PX3A 3MDPA 3ZDSA 1CJDA 4LNVA 2ARBA 2BUKA 4LO4B 1EV13 2B42B 1LOEA 5GLUA 4NRQA 4I30A 5K9YA 2G4IA 5ISLA 3RS6A 4XVHA 3T4VA 3UYJA 5KXBA 1H4GA 4Q4W3 3PDQA 1PM4A 4CPBD 4JZRA 4AEDC 4YGBA 3BU7A 1A3KA 1YIPA 1CZVA 2WBKA 2FZ1A 2ZX3A 1GQHA 2IWGB 2CAUA 3GBGA 1WLTA 2ZHLA 1VBC3 3R4UA 1O3QA 4LO8A 4A45A 2CHHA 3ST7A 5GZCA 4FPOB 1RXFA 4EQVA 5E89A 5T52A 3P3NA 4JTOA 1WBLA 1W8NA 2PHFA 2VZQA 4YW3A 3T0BA 4NIGA 1QJY2 5A80A 1NA1A 3ZN5A 3RWKX 3SLIA 1UX7A 3AZZA 1QH6A 3APBA 3GBWA 4H3WA 3HN3A 2I45A 2CWSA 2YU1A 3H9AA 3IMMA 2PHDA 4W65A 2A6YA 3WF3A 3LB9A 4HPKB 3T0DA 4TLGA 2GP3A 3TEXA 4FPEA 5FZ0A 5ABJA 1RTVA 3D8CA 3OGJA 2HBUA 5EYXA 3RWNA 5IK5A 1IPKA 1ZRCA 2XVKA 4NAOA 4ZY9A 2DCJA 2ZBJA 1CZTA 4NHYA 3OSDA 3ZIXA 1R082 1HV0A 2ZHKA 4HT1T 2HWC1 4NPRA 1REEA 1W04A 2E63A 1CPMA 1UYYA 3AVRA 4M3CA 3OG2A 4QX0A 5FZOB 4QHOA 3WQ1A 2RJKA 1UO9A 4IE4A 1IPJA 5FMDA 4MGQA 2WQZC 3O1UA 2VOWA 1WW6A 4XFIA 1KXGA 4UFJA 5EPAA 5C9AA 3WOGA 5BXXA 4AFAA 4E4DX 4Q8KA 3A22A 3PLQA 3U1XA 3P1IA 3ZYRA 1SPPB 1ZZCA 1OSGA 2YPJA 2O8OA 4NWVA 4QQPA 2XHKA 2OW4A 2HWF2 2Y6LA 4HMZA 4EN9B 5IVVA 3OY8A 5JOXA 5KHJA 4OI0A 3LCPA 5JR2A 1UPSA 4YLZA 2LTNA 1REDA 4DZGA 1QY4A 3NVCA 4YG0A 4ASLA 4RFRB 1OA4A 4CA9A 4WM7C 4OI1A 3AJYA 2IXJA 1Z78A 3UKTA 4Q4W1 3BODA 5FXZA 2JXAA 1N1YA 4XHBA 1VE0A 3RQ0A 1I5PA 2DVBA 4ZS3A 2D3RA 4CE8A 2OXBA 3OPZA 2R061 1COV1 3I3MA 1ZYBA 1JYWA 1URXA 4RN5A 1N1VA 3INAA 3WF0A 1PZ8A 5FZ3A 1O8PA 1VLNA 1SLBA 4I02A 2A71A 1KITA 2AZ5A 2WLPA 5JDBA 4X6QB 2BGPA 3BYWA 2OVUA 3MIBA 2P17A 4CCJA 1GP5A 2ORXA 2QKDA 4LBLA 2PA7A 1Q8PA 4QM8A 4C0BA 2Z69A 1VP6A 1LR5A 5LA2A 1QJX3 1CESA 3OOXA 1OOPC 2V72A 4C1WA 3T1LA 1XNBA 3OJBA 3BIEA 5A6YA 2JG8C 5CKQA 3ES4A 5FLIA 2CGNA 4NUBA 4DXZA 4R4ZA 4QU1A 1C3HA 2RM23 4S2FA 5F2SA 4BYYA 4NJ4A 3K4DA 3S7IA 4LO6B 5LRSA 4XXAA 5C4WA 4BQ2A 5F9TA 5FYMA 1JZ2A 2JDYA 4JV4A 4XJUA 1SLCA 3WG4A 4CCMA 4MGTA 1Y9GA 1O4YA 5LEJA 2XOMA 1L7QA 1OFSA 2CTVA 4TLFA 3ZYFA 2OQ6A 2RMU3 1VBA3 4N7IA 3ECQA 2XLFA 1OOPB 2IC1A 3NJZA 1FNYA 1QXJA 4JGYC 4W6XA 4YM2A 3E1F1 4XPVA 3KCYA 2JG8B 1JMUB 5GKAC 2EF6A 2P1BA 3GZAA 1SDWA 4W8JA 4B3NA 3AZXA 3POFA 4LHSA 5FZCA 3J8F3 4UBGA 3WUDA 4AGVA 1RUJ3 2ORZA 2X5IC 1ST8A 5FO9B 3NV4A 1ZBA2 4AR2A 3LD8A 4D0QA 1FT9A 1E5SA 1LU1A 2P3IA 2VE1A 2XUMA 1D7PM 3ETPA 1YFWA 3GM8A 3K51A 5FXWA 5AC93 4QXHA 1UAIA 1S0IA 4KWJA 1JU3A 1LENA 1ND3C 2VMIA 3T3YA 3ZXFA 4Y1YA 1HQWA 5FMOS 4ES8A 1LESA 4JGYB 3O1OA 5H9SA 4JKMA 2EIGA 3TN93 1GOFA 2OYZA 1X82A 4LO5B 4ASMB 1MZ5A 4Z1VA 1DU3D 1WLDA 4J25A 1ZREA 2VTXJ 4MADA 2HWB3 3TEYA 3RZGA 2X5IB 4UW6A 2BNNA 2QBXA 3OGRA 4FQZA 3AKPA 4XURA 1GZTA 4A3XA 3PNAA 1CAVB 1YEWA 5CBLA 3F2ZA 3K46A 1D4M3 1MQTA 5D1IA 1ND3B 2D40A 1TEIA 5FPUA 2C24A 1XBFA 3EO6A 3KVBA 4MVTA 2GNTA 1N1TA 3MIEA 4KGGA 1AR92 3PUQA 2R32A 5CIRA 5IAVA 3VHOA 1Z7S2 5J1XA 1CAWA 4CU9A 2ARXA 3PURA 2W46A 2DCKA 2MHFA 3ZYGA 1HDKA 4YVWC 1UZYA 2W08A 2W1SA 1MEC3 3HMYA 1QJX1 1X7NA 4Q4Y3 1BBT3 1D0HA 3SMHA 5GZDA 1EAH3 3NWKA 3GNEA 1UNBA 5KHHA 1SBFA 3NNFA 4JCKA 3I2JA 5F6KA 4WV8A 2QQKA 4B7EA 4XMIA 4FXGB 4PT6A 5D8AA 2GAUA 2BGCA 4Y1VA 3TNPB 1KS5A 2QQUA 3WD5A 4PF5A 4GH4C 1W2OA 4O9GA 1RMU2 2R0HA 3DPRC 4P9XA 5KXEA 4FTBA 4B1LA 4YVWB 4CUAA 2BRTA 2WZR2 3HVDA 1AYN3 3ZXDA 5FMBA 3POWA 5A7WA 2DWRA 2BOJA 3KSCA 2A6WA 4NHMA 4R9AA 4RHV2 1JHJA 3C7OA 1BCXA 3BIWE 4GB33 5BNOA 4E2SA 5FUNA 1L3JA 1GQGA 4NRMA 4IE7A 5FK8A 3VL8A 3J8F1 3T2PA 3ZLIA 1J3QA 2R16A 1RUJ1 1I1EA 2ZZQA 2QTWB 3ZKYA 2O8QA 2TNFA 1BK1A 4GH4B 4YFWA 3SH5A 5LY2A 5A32B 3RZHA 1PVC3 1Y9QA 2EAAA 3DPRB 4J1WA 2RS33 3POGA 4XZUG 3ZFFA 3ZXKA 1CAXA 4LKFA 2PLV2 3HAGA 4AI2A 4DY3A 2B39A 4QQOA 1LOFC 2WNOA 3THCA 2WO7A 3HIFA 3TN91 5DUUA 1AL21 2ZMNA 1RUH1 2X10A 2UWAA 4EWEA 1NCQC 3CZJA 2HWB1 4A6OA 1BK0A 1NAEA 2ERFA 5DAVA 3A0KA 3KV5A 4YRDA 5DUVA 1W8UA 2DVFA 3C2UA 3ILRA 1D4M1 5LW9A 5I0SA 1SEFA 4BMBA 4R52A 4DUWA 1W6PA 2ZX2A 2X53S 4HBNA 2F4PA 4B4PA 5FQ0A 4XFCA 5B4NA 3UL2A 2ADEA 4ZS2A 2Y34A 4E2GA 3FZ3A 3JB8A 2CL2A 3WNKA 3ZSEA 2D5HA 2VW1A 1NCQB 1DHKB 2VQTA 1QMJA 1R1A2 1SCSA 3LOIA 5FY8A 4FPYA 5K0UC 1JYIA 3HWJA 2OKXA 4PI2A 1LEMA 1Y43B 3S0MA 2NN8A 1MEC1 2BV4A 2XJPA 3FL7A 3HPNA 1O91A 2QZ2A 2WO1A 2Y26A 1BBT1 4COYA 2R072 5IK7A 1HB2A 3PJYA 4QT6A 3WDWA 4BXFA 3E5UA 1T6BX 1UZZA 2G9GA 1FATA 2AC1A 3U75A 3I59B 1AF9A 3N9MA 3BB6A 5JMOA 2WIIB 3RI8A 5K0UB 1RUD3 2VVFA 4LBOA 3FLRA 4PLOA 5DXDA 2VM9A 4MGZE 2IFRA 2OZJA 4R4XA 2IXIA 5LWBA 1NXMA 4OHYA 1WZXA 4AEDA 4GB31 3B93A 3ZFGC 1C5HA 1W6OB 5FYCA 4HPKA 4QB1A 2EXJA 3AJZA 3LGRA 1YQCA 2P34A 4LBKA 4RGGA 1Q8OA 2F4LA 3PUAA 4QX3A 3R6SA 1S0GA 2D97A 5ERLA 4YW4A 4XACA 3PIGA 1PVC1 1LOAA 4L97A 1ZZ9A 1DG6A 1MS8A 3BTYA 5ANQA 2BPA2 2QVSB 2ZGRA 4CP9B 1HRV2 2EA7A 3WF1A 3WEZA 3HNYM 3IIAA 1YC61 1DQ5A 2ZHNA 5SV8A 3JQWA 5F7UA 4MSVA 1RUE2 3WDXA 5FPZA 3ZFGB 5FZOA 4A6SA 4GA9A 1WW5A 1OKQA 4ITCA 1LHWA 1C5IA 1GNHA 3W59A 1X9TA 3VBUC 2UURA 1WGPA 3PVEA 4GAZA 2ZPXA 3JU9A 4GQ7A 1WCKA 4WVZA 1S0FA 4S2HA 1BMV1 1O8SA 3IMNA 3P5BA 2QQWA 1RUF3 4D3WA 3FJSA 5K8SA 1RVF2 4FPCA 3FC0A 1SPPA 2YPDA 4QKBA 1AR82 5ACA2 2VPVA 4OMDA 2WDBA 4LBMA 4FAGA 1X8EA 3I4IA 1WA6X 3Q9OA 1PK6C 2Q0AA 3ZPYA 1NYWA 4Q0UA 4OI2A 3W9AA 4D69A 3VBUB 2J7MA 4CCKA 2JDHA 2P6HA 2P3KA 3HEIA 4Y20B 1CR7A 3PMEA 4O65A 2OS2A 3FX3A 4AFDA 4K8FA 2CDOA 1ACCA 4I3GA 2ET7A 4AL9A 4Y5TA 4EZ4A 5KBFA 1OC1A 1VPHA 2K46A 3GCXA 4K3UA 3BALA 3JB4C 3N9QA 4WBBA 3PUIA 5FP8A 1NY72 1NE6A 4AHWA 2R043 4EE2A 2XUEA 2Y0IA 2LW8A 4AVSA 1AR73 1PK6B 1FMD2 3MHZA 3UETA 3K2OA 2JDAA 4UT5A 3MV01 2VTFA 3ACIA 4FOWA 2Y60A 1QJEA 1O4ZA 2ZGNA 5GLZA 4FPFA 4WM7A 3W5NA 4E8CA 2PELA 1OA3A 1TVGA 3USUB 3T08A 1AXYA 3VN4A 1QDOA 2QUOA 2XVLA 1IPSA 2VOVA 1RUC3 2OZ6A 2PHUA 2YC0A 4Q2FA 2BDRA 1VBD2 4BQ1A 3QACA 3BKZA 2JDKA 2WFF1 4L0PA 4BIFA 1ZRIA 1H30A 5FYTA 2ID4A 2C5DA 2ZMLA 3WXPA 3ZMNA 3QD6A 2RS53 1AJOA 4KGQA 3ETQA 4XETA 1HXS3 3GCWA 4QKNA 5FLJA 1KGYA 2J22A 1H1AA 1Q8VA 3AB0A 4PHZA 3WLUA 5CKNA 1TE1B 2V5YA 1CAUB 3UKVA 1RHI2 2XWJB 1K5MC 2OPKA 5IVFA 1MZFA 5IK8A 3IBMA 1OOPA 4Y1ZA 2A3XA 1BEV3 3FHAA 3RDIA 3LEGA 2TUNA 1NQDA 4XTMA 2JG8A 4UOJA 3FFQA 3ASIA 1S0CA 1EYBA 5FYHA 3IZOA 4EV0A 4BQXA 2NP0A 4OYUA 4LE4A 2D93A 3M3IA 5JXHA 1M06G 3I3BA 1QEXA 2RS13 2GNBA 1V9U3 5I0TA 2DUOA 5C5UA 2Q1MA 4QHBA 4AHXA 2JDNA 1QXRA 1K5MB 1GOGA 3FMGA 5LBEA 2PFWA 1OQDA 1GP6A 2VO5A 4JGYA 2P3YA 4S2DA 5JIUA 3H42B 4QX1A 1PGW1 2W95A 1SACA 1YUDA 2D5FA 4BQ4A 3WNPA 3DYPA 5JIAA 4CVUA 5HCAA 2ES3A 4I0AA 2X5IA 2PAEA 2CGPA 5FO8B 2V4VA 1CGPA 1NZCA 1QKQA 1CAVA 1IG0A 2VZVA 3UJQA 4IEOA 1CONA 4KG8A 4BB3A 2Z42A 1AR71 1SHWB 4OZOA 4QDRA 2VY0A 1ND3A 4KU8A 1TME1 2VW2A 4HXCA 4LKSA 2ZJCA 1V70A 4AW7A 2VZ3A 2HWE3 4YM3A 4OFGA 4XJ9A 2BOIA 5EIYB 1RUC1 2PHTA 4YW5A 5C8WA 1S1AA 2B8MA 1LOBA 3S7EA 2HWC2 1UZVA 1QJU3 5FOBB 5JSOA 4RFT0 5CNAA 1ASJ1 3VKLA 1VAKA 3UV9A 1IS6A 1DQ1A 1AR63 1UMHA 3TOJA 4BWOA 5HXMA 3K4ZA 1FPN3 2GDFA 3FE5A 3CF6E 5JXJA 3D5OA 4AVAA 4NMIA 4MV2A 4UFMA 1DGRA 2UWCA 4YVWA 1DGWX 2HKXA 5FY5A 4GMP3 2PHXA 1VR3A 3KGLA 3WQ7A 4LKEA 2W5FA 3B7MA 3P6BA 5T3NA 5FR3A 2GC2A 1BEV1 1GLHA 3ELNA 3IAQA 2XB6C 1YQ2A 2EALA 1NXD1 2EICA 2YUEA 5FRAA 4ZXKA 3ZN4A 2Q1FA 1VRH3 1X33A 1W9WA 3CIHA 4KWLA 2Z4FA 5DZFA 5FDBA 3O5SA 1J3PA 5A3WA 3BTAA 3JQXA 1JUIA 4LE3A 1E5RA 3W21A 4GH4A 1OURA 5CYYA 2J1RA 4WVVA 5A32A 2GALA 3DPRA 1PNFA 2R30A 4OHXA 4ONUA 4URAA 1DGLA 4CTEA 1QU0A 1XSQA 3IDAA 1AX0A 5FP9A 2R062 4E27A 1COV2 4MYEA 5FY9A 2VQAA 5F5AA 5KXCA 1GQPA 2IXCA 5IW0A 1TNFA 5APAA 4V2VA 3RNSA 5DZEA 5HXVA 3IKWA 5FUPA 3AMHA 4LTAA 1J84A 1NT0A 4CCOA 4P9IA 2B7YA 1DBNA 1I5ZA 3LPFA 4K1YA 1DIWA 2KM2A 5EV7A 4YW1A 1US2A 4TWTA 3NRUA 3WNMA 1KDMA 1C8M3 1XNKA 2E7TA 2J1TA 2XJSA 2CU5A 4U36A 1LOFA 2D3SA 2Y6FA 4Q4V2 4DRRA 3BU0A 4P08A 3AP6A 3RRDA 2W9XA 3KT1A 3ZR6A 2DBNA 1NCQA 2XL7A 2RG4A 5BNPC 3OYWB 3ZXAC 1T6GC 4J1XA 2WA3A 3FHIB 5F39A 4UXAA 3H7YA 4XJAA 1UQXA 2WNUC 1MZEA 1OLME 5FY4A 1UIKA 3LDRA 1S55A 1OBNA 2CYFA 2PQSA 1PIV1 1AR61 3L9JT 4QQ2A 1CQ9A 2H6BA 3NO8A 3NQHA 3VDDC 3I59A 3M8LA 3HT2A 5K0UA 4LT5A 1BVP1 1SBDA 1PO11 2BP6A 2NLRA 4GJZA 4HSJA 1DGWA 3AM2A 5BNPB 1Q5OA 5LCWL 2D44A 4FFHA 2WT2A 2JIGA 5K4LA 3ZYJB 3NAPC 2BFUS 3BN6A 3CO2A 5EP9A 2WNUB 2FDKA 2ETEA 4Q27A 4M01A 1H8TC 2AUYA 1GUIA 4DUXA 1VRH1 1W6OA 4OLLA 1MS9A 3SCHA 3VDDB 2FMDA 1NLQA 2W1UA 2ZGLA 2WAAA 3WQBA 5EJZB 4AQ6A 4URTA 2DVDA 5LRRA 1W6MB 3VD9A 3U0ZA 1O59A 3WW3A 3ZSKA 1PGL1 4CP9A 3NAPB 2G9FA 2WQ4A 2W68A 3EXUA 1JOJA 4WM8C 1NLSA 4HANA 3CJXA 1H8TB 1DZRA 4AVCA 2W87A 4NE9A 5JAXA 4CCNA 2YROA 3ZFGA 2CSGA 4AFMA 4FSJA 1A34A 3VZNA 3T2TA 2EIDA 3A23A 3NKTA 3WG1A 2R1DA 1WCQA 1R091 5KWRA 2PMWB 1UWWA 4DRVA 3DV8A 2PN5A 2WUHA 1YNAA 2YBPA 4P9GA 5FKBA 3TNQA 4AHYA 4B29A 5KC5A 1JYVA 4D7SA 4Z92B 4AQSA 3V56A 2J1EA 5CA6A 1QJX2 2D43A 2JE8A 3PVBB 4MOAA 4WM8B 4A2UA 1D4VB 2HLEA 4EZHA 1YLLA 1XYNA 4WVMB 4YW6A 4LUMA 3THTA 3IWZA 5C71A 3NSTA 3PU8A 1US3A 5J98B 4Q1PA 5GALA 1ZBE3 5FKCA 4NIAA 3WUCA 1MS3A 1S2EA 4P9LA 4CDWC 2BEOA 1YRZA 3VBUA 1SLIA 2NMOA 4A44A 2AEYA 3GJBA 4Y20A 1LODA 1PX4A 3WW2A 2HYKA 1SFNA 4FPJA 2RJ2A 1AVBA 3QCWA 4LHNA 1DLLA 5FYBA 3GZTB 3UESA 4IERA 2VCAA 5DDJ3 1QIQA 4PDWC 4IEQA 4PJYA 5FYUA 1G86A 1AYM1 4OI4A 5FPXA 3KCCA 4F3JA 5DAPA 2K2SA 1PK6A 5GLWA 1POQA 4CDWB 4OUMA 3H50A 2OIIA 1GWMA 1LU2A 1DZTA 3J8F2 4M3CE 3MFCA 4QPIC 1N3QA 3RJRA 5FAXA 1UZ0A 1OA2A 2ZGTA 2Q8DA 2G1MA 1OQEA 1M4WA 3USUA 2C9AA 3N7MA 1CPNA 4QX5A 5KHKA 3SISA 5JOYA 3FLPA 1D2SA 5IVYA 2N7GA 2RR11 3PMSA 3DGTA 1W8FA 3LSDA 1W9TA 4PDWB 1OKOA 3OBAA 4DXSA 4XBNA 1OI6A 5BPXA 3MPBA 4K9SA 3TN92 2Z2SB 5LK7B 4FTEA 1AL22 3U11A 1RUH2 1K12A 1A6CA 1XSRA 4XUPA 2JKBA 2MEV1 3R4SA 2K9ZA 4R8HA 3CNAA 4QPIB 2HWB2 3U10A 1ODMA 2Y8KA 1JZ4A 4LBNA 3LZZA 1FOD3 3GHNA 5F3EA 5CB7A 4DEQA 1ZX5A 1VBE3 3OTFA 5FREA 3ZSMA 1D4M2 4H55A 3VUOA 2PYTA 2A7AA 1FAYA 3MPPG 1CAUA 3AZVA 4UI9L 1W6NB 5L9RA 1GANA 1EV11 4DO0A 4IE6A 1F4HA 2VG9A 2JG9C 4YYOA 3I3EA 4LBQD 3OEBA 5EQUA 4JGZC 4IEUA 4QM9A 3G7DA 5FY0A 3ILFA 4Y4YA 2ET1A 2Y64A 4JVAA 2Y6JA 4LK6A 2ZA9A 5T5LA 3O12A 1MEC2 2DCTA 5FYVA 3U07A 4SLIA 1H2MA 1HX6A 1PM7A 1BBT2 2WAOA 1C1FA 5A1AA 3LIHA 4AVTA 3KHCA 1VBC1 5CG8A 3T30A 1AHSA 5FZEA 1K5MA 1HQNA 1IS4A 2W3JA 5DABA 3VGIA 2JG9B 1UU6A 1HLCA 3DXUA 2FCTA 2VZ1A 4K6BA 3X29B 4CPBA 4JGZB 4AI0A 2BVVA 5IFPA 5JCTA 4IEPA 4IEVA 1STMA 2WZ8A 5I8YA 3SH4A 4IV3C 5DDJ1 3T1MA 4FBFA 1LB2A 4N9IA 1W8HA 4HETA 5GJ6A 2QDNA 1OF4A 3H7JA 1ZVFA 5DN2A 2X05A 4TZDA 2HEVF 2VULA 4GB32 1TMF3 3A7QA 5IUQA 4KI5M 4YNIA 5H9QA 1BVVA 3AYCA 1QQP3 1UXZA 4QGLA 5FXXA 4QQHA 2DU1A 2DURA 2ZGOA 4PIXA 5T54A 5F3GA 3LDBA 4CCDA 4NPLA 1PVC2 5GZEA 2J1SA 1WLCA 4HFSA 4IV3B 3CL1A 2ZGQA 4Y5Z0 4Y26A 4IE5A 3Q8BA 3ZDVA 4FQ4A 1APNA 3ABZA 3BUCA 1DYKA 2XLAA 2YHJA 4FP2A 4CDXC 3MW2A 3TAYA 1W9FA 4RD7A 3J7LA 4AG4A 1FOD1 3KZ4C 1W2AX 4GIQA 3LSEA 3G6JB 1ULCA 1VBE1 2WA4A 4XOGA 1LOGA 1POV3 3WG3A 1G9CA 2RDSA 2VMCA 4X8NA 1VAVA 3U4SA 4A7YA 4Y22B 5JI7A 1BMV2 4HG6B 4R9BA 1FV2A 3KM5A 4KH9A 2ZKLA 4XE9A 1XXNA 1WCUA 4HK8A 5FBJA 5IJRA 2VCBA 1QJZA 2ZHMA 4V2WA 3H8UA 3UGHA 4CDXB 5F1RA 4YZ3A 3BTXA 1GNYA 1KFUL 2YBKA 2XDVA 2R6QA 2IXLA 2SBAA 5FMOL 1CN1A 1XE0A 3FWEA 5D2AA 2H6CA 4BJ0A 1OVPA 1PO23 1SDDB 2R1BA 5IHRA 1HRI3 1RUNA 1HQLA 3DYMA 4KQ7A 4KWKA 1WUVA 1XNCA 3DF0A 4BK4A 1LNSA 3OF1A 3LA7A 1F5JA 2Y6KA 3MEPA 4M3CF 2XKPA 3WNNA 1R083 1YI7A 2ZACA 2VMFA 4NPMA 2VUCA 2FBEA 1WCSA 4NOTA 3ACLA 2BBVA 2B46X 5JXGA 1CX4A 2J1AA 5EJ1B 3VHRA 3W5MA 3WR0A 4BK5A 3IIIA 3QH6A 1J59A 3ZMOA 3VD3A 1JU4A 4LQRA 4XABA 1EP0A 1EUUA 3Q8EA 1UCXA 3DEMA 1GZ9A 2YGMA 2XQXA 4IGOA 3ZOIA 4XBQA 3SKJE 4GD4A 1XNAA 2XG3A 3J9SA 5LEKA 5A3LA 4CUGA 2OUJA 3JBG3 2MPFA 3BPSA 2BYVE 1BQPA 2ZEXA 4IEYA 4OHVA 4OHWA 2DTYA 2RM21 2WFF2 4YZ4A 3O1SA 1IKPA 1VBB2 5T50A 1S4CA 2JWPA 2YXSA 1OD3A 1F5FA 5KHIA 2GP5A 3OYWA 3HBKA 1RC6A 1FX5A 4HKOA 2RMU1 1VBA1 1KS4A 4ZU7A 2VMDA 3ZX7A 3D0SA 2VNRA 1U5YA 2PHLA 4HN0A 3KF5A 1Q56A 2FQPA 4GJYA 3N7LA 2R7EB 4ZHNA 1LHUA 4FP3A 4N53C 5F2WA 1OMIA 4QQLA 5BNPA 1ENQA 2VNOA 5E1RA 4KNCA 3PVOA 5AC91 5IT6A 3S57A 2DCZA 4FI9A 4MG2A 1DQ0A 5SV5A 2EXIA 1UU5A 1NCRC 2VOKA 2VUAA 1VMFA 1KEXA 1V6MA 2WNUA 1YQ8A 3N9NA 3PL0A 3HNBM 5A33B 2JICA 5HV4A 4JKKA 2GMMA 3NJYA 3POIA 2HWD3 3UGFA 1XJAA 1GOHA 3CKHA 1W6QB 3O0VA 2B9UA 3VDDA 4GWIA 3MFAA 1LGNA 1PGW2 4N53B 2WSVA 4FPLA 3RMXA 1Y4WA 3WDTA 1PO21 3NV2A 4BCUA 4DQAA 1HRI1 2V73A 3SCFA 5LZ6A 1JYTA 1GU3A 2Y6GA 4Q4X3 4BQYA 1W6MA 2W47A 4PBPA 3M4FA 2DU0A 2XBO3 4RQPC 3NAPA 2W1QA 1Q8QA 4YZ1A 2ZEZA 1NCRB 3DKQA 5FV3A 1GP4A 4DXRA 1H8TA 3P3PA 3SEPA 1AR72 1PHMA 1S0JA 3USSA 2BVBA 2VW0A 1TME2 1DZQA 5FZ6A 2V09A 2YMZA 3N7JA 4E8DA 5C3QA 2AGSA 5LASA 4WZCA 1UY2A 4L2NA 4XFAA 2ARAA 3CJIC 4D8MA 4EWDA 1BLZA 5A7QA 1A8DA 4RS5C 1EUTA 5HI0A 4Q4Y1 5FZIA 4LJHA 2PHRA 4NR1A 1RUC2 4RQPB 4H14A
chains in the Genus database with same CATH topology
3KT1A 5C5TA 5C5UA 5ERLA 2RG4A 5DAQA 4XACA 2RDQA 5LBEA 5LBCA 3NNFA 4NHLA 4Q5OA 4BQWA 5LA9A 5DAXA 4IW3A 3NNJA 5M0TA 4UWDA 5LB6A 3BVCA 2JIJA 3OUIA 3HQUA 5L9RA 4NHMA 5A3UA 4XABA 2G19A 2JIGA 5EP9A 5DAWA 2FCVA 5EQUA 3KT7A 4XC9A 2Y33A 4XCBA 4JZRA 3OBZA 4ZONA 3EMRA 4Y5TA 2FCTA 2OPWA 4KBZA 4NMIA 5DAVA 3W20A 3ITQA 2HBTA 2Y34A 5LATA 2RDNA 3PL0A 4NHXA 2HBUA 3HQRA 5HV4A 3W21A 3NNMA 4NAOA 4NHKA 4XCAA 5L9VA 3MGUA 3NNLA 4NHYA 4XAAA 4MHRA 5HV0A 4Y5SA 3GJBA 5L9BA 4J25A 3OUJA 3OUHA 4BQYA 5LBFA 2V4AA 3DKQA 5IATA 5EPAA 2RDSA 2A1XA 5DAPA 3GJAA 5IAVA 2RDRA 5LASA 4MHUA 5LBBA 4BQXA 2G1MA 3GZEA 2FCUA 5IAXA 3KT4A 4ZPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KT1 A;  5C5T A;  5C5U A;  5ERL A;  2RG4 A;  5DAQ A;  4XAC A;  2RDQ A;  5LBE A;  5LBC A;  3NNF A;  4NHL A;  4Q5O A;  4BQW A;  5LA9 A;  5DAX A;  4IW3 A;  3NNJ A;  5M0T A;  4UWD A;  5LB6 A;  3BVC A;  2JIJ A;  3OUI A;  3HQU A;  5L9R A;  4NHM A;  5A3U A;  4XAB A;  2G19 A;  2JIG A;  5EP9 A;  5DAW A;  2FCV A;  5EQU A;  3KT7 A;  4XC9 A;  2Y33 A;  4XCB A;  4JZR A;  3OBZ A;  4ZON A;  3EMR A;  4Y5T A;  2FCT A;  2OPW A;  4KBZ A;  4NMI A;  5DAV A;  3W20 A;  3ITQ A;  2HBT A;  2Y34 A;  5LAT A;  2RDN A;  3PL0 A;  4NHX A;  2HBU A;  3HQR A;  5HV4 A;  3W21 A;  3NNM A;  4NAO A;  4NHK A;  4XCA A;  5L9V A;  3MGU A;  3NNL A;  4NHY A;  4XAA A;  4MHR A;  5HV0 A;  4Y5S A;  3GJB A;  5L9B A;  4J25 A;  3OUJ A;  3OUH A;  4BQY A;  5LBF A;  2V4A A;  3DKQ A;  5IAT A;  5EPA A;  2RDS A;  2A1X A;  5DAP A;  3GJA A;  5IAV A;  2RDR A;  5LAS A;  4MHU A;  5LBB A;  4BQX A;  2G1M A;  3GZE A;  2FCU A;  5IAX A;  3KT4 A;  4ZPI A; 
#chains in the Genus database with same CATH topology
 1EAH 1;  2VR4 A;  4QX7 A;  1ZBA 3;  4WM8 A;  5DAQ A;  3JBG 1;  3IN9 A;  4ET7 A;  2QFE A;  4WVM A;  5J37 A;  1LAJ A;  1VB4 A;  1OH3 A;  5LBC A;  1ASJ 2;  1MVQ A;  1PGS A;  4DFS A;  1MPX A;  1H6X A;  4N9H A;  2ADD A;  4FAH A;  3CDZ B;  4LMF A;  3N9O A;  4Q5O A;  4A42 A;  5FLH A;  1OPO A;  4BME A;  3ZPO A;  5AFE A;  4FO9 A;  2ZEW A;  3CJI B;  2WWJ A;  4D94 A;  5FZ1 A;  2VOX A;  3GF6 A;  3OD4 A;  4RS5 B;  5FJK A;  4LUK A;  1AYN 1;  2R0F A;  1XRU A;  2JE9 A;  5HCF A;  1DLC A;  2XJR A;  4Y1X A;  3SHR A;  3TWI A;  1FYU A;  1UPI A;  4EYU A;  1O7F A;  1BEV 2;  5F3I A;  5FIX A;  4YSF A;  4CUC A;  3H0O A;  3PIJ A;  4CRQ A;  3KS7 A;  1QGL A;  5DAW A;  3U78 A;  2VME A;  4CDW A;  3VZL A;  1N1S A;  1YFY A;  3ZFE C;  2PTM A;  3MYX A;  4AVB A;  4OQ8 A;  2JEC A;  2RS3 1;  1XND A;  3H1Y A;  4MUV A;  1V0A A;  3ZYI B;  4CCL A;  2GMP A;  1JYC A;  2KD7 A;  3MLL A;  4BIS A;  1ZZB A;  3FBM A;  1XC6 A;  5F6L B;  4EJR A;  2W94 A;  2Q30 A;  5CKM A;  1XQN A;  3FLT A;  2HWD 1;  2UYA A;  4PDW A;  2WLQ A;  3OBZ A;  4OUS A;  4AE2 A;  3ZIW A;  4AZZ A;  4HVQ A;  4D7T A;  3E6C C;  4W4Z A;  3N7K A;  3PHM A;  2ILM A;  3ZFE B;  4FT8 A;  2XXZ A;  3CMG A;  4Q4X 1;  4QPI A;  1ZRD A;  4F7Z A;  2KR2 A;  2WT0 A;  1PMJ X;  5FZK A;  2XBO 1;  4KBZ A;  4UFL A;  5A6Z A;  3H1M A;  5DPN A;  1NOV A;  1XE8 A;  4HN1 A;  3H3Z A;  3AYE A;  1C8N A;  1U12 A;  2FHR A;  1XE7 A;  1S0E A;  1K45 A;  3BGA A;  1XPW A;  4LLF A;  4GMP 0;  4UW4 A;  1QOO A;  1W6N A;  3FHQ A;  2WZR 3;  2IZW A;  3MW3 A;  3VBH C;  4YWA A;  3NL1 A;  4XF4 A;  1IS3 A;  4GWJ A;  1UY3 A;  1W8O A;  4QGM A;  4UW5 A;  4CDU C;  3I49 A;  2YGL A;  5DZG A;  3AK0 A;  5H9R A;  4CDQ C;  3O1P A;  4NHX A;  5FP4 A;  4Q0P A;  3H8O A;  3NJV A;  2XQR A;  5FO7 B;  3O1M A;  3M1H A;  5FPL A;  2WS9 2;  5FZ7 A;  1GR3 A;  3H1W A;  1RIT A;  1HKD A;  4IEX A;  2P4E A;  4XDO A;  5DG1 A;  4W50 A;  5L36 A;  3K77 A;  2WZE A;  1LED A;  4YVS C;  1PIV 2;  3VBH B;  5LY1 A;  1AR6 2;  1RUD 1;  2JG9 A;  1D2Q A;  4CDU B;  1YFU A;  3EHK A;  2GND A;  4JGZ A;  1DFQ A;  2O0O A;  3O0X A;  4CDQ B;  3WP3 A;  1IZ3 A;  1SLA A;  1PO1 2;  2FZ2 A;  3RYR A;  2CNA A;  3ZYH A;  2CGO A;  1MR5 A;  3AP7 A;  4LEJ A;  4JHZ A;  4AVV A;  2RDR A;  5TSW A;  2ZOE B;  2PAK A;  1W39 A;  5BNN C;  4GWN A;  1VRH 2;  4YVS B;  3RI9 A;  4AFB A;  3UJO A;  4DXT A;  1YI9 A;  3GBF A;  1XYP A;  3D4K A;  4OMC A;  4BLJ A;  1AXK A;  2P3J A;  3WHU A;  4XIK A;  1R1A 3;  3MLK A;  4AEM A;  2JEM A;  1FI2 A;  2EIB A;  4IV3 A;  4OZX A;  1REF A;  1PGL 2;  2D6L X;  3S5A A;  3PU3 A;  4LPL A;  4HVO A;  2R07 3;  2VQ0 A;  3CEW A;  2WR9 A;  3LDK A;  2VAU A;  4HSL A;  4IW3 A;  3LFI A;  5A3O A;  1JS9 A;  1L7L A;  5BNN B;  2FDG A;  3SC7 X;  4KG0 A;  1IGO A;  3A21 A;  5FPA A;  4QKF A;  2FMY A;  2X09 A;  2B5H A;  3OUI A;  2QQN A;  5E8A A;  3DEC A;  1R09 2;  3RG0 A;  3R05 A;  1W3X A;  1RUF 1;  4RA0 A;  4LOR A;  5CFC C;  4BHP A;  4Y22 A;  3BTZ A;  1DGR N;  1NLR A;  1O3S A;  3JXS A;  2BJS A;  4AEK A;  3IAP A;  4HZF A;  1H9W A;  2D6M A;  3IPV B;  2QJV A;  1TQ5 A;  3UNP A;  4CDX A;  1CIY A;  3WNX A;  3LF7 A;  3PTR B;  3N35 A;  3AMP A;  4MLO A;  4P02 B;  1SZB A;  2A75 A;  3LFM A;  3BPZ A;  2NPI A;  1UD1 A;  1UKG A;  4QMA A;  4QDS A;  4AFC A;  3ILN A;  2Y38 A;  3VBS C;  2WT1 A;  2DF7 A;  2E7Q A;  2D6P A;  3NMB A;  4YM0 A;  1QOT A;  4LBJ A;  4UFH A;  5CFC B;  3B01 A;  5C8C C;  2R04 1;  1DP0 A;  3WF2 A;  1BXH A;  4MGY E;  1VMH A;  5F8P A;  4R9D A;  1AYM 2;  1JZ3 A;  4YW2 A;  4FOY A;  4XYX A;  1UY0 A;  5EXO A;  1GZW B;  4KBB A;  1W9S A;  4YGD A;  1UOB A;  4TYS A;  3AX4 A;  1WLW A;  1H4H A;  4LIV A;  4MGS A;  3LEM A;  2L9L A;  3N9P A;  3VBS B;  2FDF A;  3UGG A;  2AEZ A;  3HNM A;  2HEW F;  5JR7 B;  4OUE A;  4LK7 A;  2RR1 2;  3C7G A;  4FOV A;  1WW7 A;  5C8C B;  2BNM A;  5F5C A;  5ANN A;  3H3U A;  1RVF 3;  2WNV C;  5CZK A;  2GH2 A;  2A3Y A;  1ONA A;  5ACA 3;  1AR8 3;  1AZD A;  2Y6H A;  1AJK A;  4UFK A;  4UYB A;  2NYY A;  3IT8 A;  4HKW A;  1W06 A;  2JDZ A;  3L2Y A;  4XQ4 A;  5K7P A;  2RS5 1;  2YFU A;  4YZ2 A;  2MEV 2;  3VHP A;  1HXS 1;  4JQR A;  4FXK B;  4L92 A;  1IOA A;  3BCW A;  1EPZ A;  2VNG A;  4MO3 M;  4K1Z A;  2XVG A;  5DMY A;  3OGS A;  2VZS A;  5A1F A;  5J09 A;  1T2X A;  2V4A A;  3M2M A;  3POB A;  4Z2A A;  1QOS A;  1J3R A;  1UF2 C;  2BGO A;  2YYO A;  4LHL A;  3SQO A;  5GZG A;  4M4R A;  1RUG 3;  4A7Z A;  4K8R B;  2WNV B;  3IM0 A;  3VKM A;  3VHN A;  1EV1 2;  2JDP A;  2UY9 A;  2GN3 A;  5JVV A;  1Y9M A;  5FMC A;  1JTZ X;  4AXO A;  3LWC A;  1FMD 3;  2P5B A;  1SCR A;  3J4U H;  2ZZJ A;  4FFF A;  5IVJ A;  4Q4W 2;  4IEZ A;  2RS1 1;  2D7F A;  3LPG A;  4AAX A;  1ND2 C;  5FZ8 A;  1V9U 1;  1F35 A;  4LBQ B;  1V6J A;  1LGB A;  1LHO A;  4LR4 A;  4NRO A;  1S0B A;  3WW1 A;  1YJL A;  1ZZ6 A;  4CEY C;  3I2H A;  5L7O C;  4XFH A;  2WWU A;  4IDZ A;  2C4X A;  4XF9 A;  3D0J A;  5A33 A;  1HV1 A;  3KWV A;  1VBC 2;  2WO2 A;  5E88 A;  3WY6 A;  2E51 A;  2EAK A;  2JDU A;  1B35 C;  1VBD 3;  1W6Q A;  4RYD A;  3CLP A;  2OA2 A;  2ZGP A;  4RGA A;  1G6N A;  2O1Q A;  2EXK A;  4GWM A;  2ZGU A;  2WWS A;  3JZV A;  4IES A;  4JX0 A;  4N53 A;  5BNQ A;  2J1V A;  4ZZ8 A;  4GKX A;  3NNJ A;  3WX5 A;  1W8W A;  2D3P A;  1GBG A;  1ND2 B;  1V6L A;  5DDJ 2;  4COW A;  4CEY B;  5L7O B;  1NCR A;  1B09 A;  4BU2 A;  5FBZ A;  1XOY A;  1ULP A;  2B4K A;  2ZGK A;  3K3O A;  3CQO A;  5BUV A;  3O1T A;  1RHI 3;  1BKZ A;  4YM1 A;  1BYH A;  1B35 B;  2IVJ A;  3POE A;  2HWE 1;  3C7E A;  3ROU A;  1C28 A;  1SLT A;  2D6K A;  3C3V A;  2IXH A;  2ZS6 B;  1H6Y A;  2OT7 A;  2OQ7 A;  4CU7 A;  4AF9 A;  1XB9 A;  4QXK A;  1J1T A;  1BHG A;  2GC3 A;  1I6X A;  3AZW A;  3I97 A;  2FD8 A;  5A3T A;  4CXX A;  1QJU 1;  4GUL A;  3AYD A;  4RQP A;  2J1U A;  1MS4 A;  1ZZ7 A;  5HCB A;  1LCL A;  2LAL A;  3ZYB A;  1X9P A;  4OVE A;  3GAL A;  1H0B A;  1QDC A;  4JDO A;  4ZKT B;  3J7M A;  1FPN 1;  2WAB A;  2ZAB A;  3WCR A;  3RMY A;  1X36 A;  2BNO A;  2YDE A;  5D8A B;  4TXW A;  1JXN A;  1FOD 2;  1W03 A;  2QNK A;  1W0N A;  3KV4 A;  3CJI A;  3OD0 A;  2Q1Z B;  4AGR A;  4GMP 1;  4Q29 A;  4RS5 A;  3VL9 A;  1RYY A;  2JD4 A;  1YHF A;  3M3C A;  5I0R A;  4IGQ A;  4M4P A;  3WZ1 A;  1RUG 1;  4N8M A;  4ARX A;  4ZU4 A;  4QXC A;  5I0D A;  1UYZ A;  2BFU L;  2YZ4 A;  4EWA A;  1RL3 A;  2C6S A;  2CV6 A;  4E2Q A;  4F83 A;  3O7O A;  1JZ6 A;  4C8D A;  2RDN A;  3GYD A;  5EZW A;  5KXD A;  4GAL A;  3ZVX A;  4QB6 A;  4UW3 A;  4XF0 A;  1W2U A;  4COV A;  3HQR A;  4AQT A;  1D0G A;  3AL5 A;  3B69 A;  4YFZ A;  1OHF A;  1KJR A;  1W0O A;  2VGD A;  4XJ8 A;  3I3D A;  3TYJ A;  4DEV A;  1V6N A;  2WYS A;  4LA2 A;  4EN0 A;  4RR3 C;  4A41 A;  2ENR A;  4G9S B;  1OPM A;  5DQ0 A;  5L9B A;  5JPN B;  5JSP A;  3ACF A;  5J7M A;  3POS A;  1CVN A;  1LJ7 A;  2HWC 3;  1TG7 A;  2PXJ A;  3GZU C;  1MS5 A;  3JD7 3;  3KV6 A;  3OUJ A;  3OGV A;  4Z8B A;  4LIT A;  3ZFE A;  1RUI 3;  2GC1 A;  2RHP A;  1QH7 A;  1XU1 A;  3GGL A;  1W90 A;  2ZX1 A;  3UT0 A;  4L99 A;  1POV 0;  4OHZ A;  1HN1 A;  2BBA A;  3GJA A;  2Z79 A;  1C8M 1;  1CD3 G;  4RSU A;  4RR3 B;  1FNZ A;  2AAC A;  2QZ3 A;  2DDU A;  1G9D A;  4IUG A;  5FXV A;  2WSU A;  2ZGS A;  1O5U A;  2CWM A;  2WIN B;  4XDP A;  1ULD A;  1LEC A;  1VAM A;  2DFB A;  4ZPI A;  1GV9 A;  2J42 A;  2RM2 2;  2P2K A;  1JH5 A;  1PMI A;  5A7P A;  4NID A;  1Q8S A;  4XF3 A;  5I0U A;  1E57 A;  5C3R A;  3VZO A;  2QQO A;  4FVV A;  4IE0 A;  4K21 A;  3UK9 A;  4A3Z A;  3RZM A;  4JDN A;  4NRP A;  5KC6 A;  2UU8 A;  5FZB A;  5BY5 A;  2RMU 2;  1VBA 2;  2W2I A;  3H3L A;  2P37 A;  1UYP A;  1SFP A;  1OLQ A;  1H1M A;  5FFO C;  2R06 3;  4TN7 A;  5JOW A;  3C7H A;  1COV 3;  3VBH A;  1F8V A;  3LE0 A;  4XAE A;  4KMQ A;  1FXZ A;  4QD2 A;  4W6Y A;  4ARY A;  4FTS A;  1UN1 A;  4CDU A;  2H0V A;  1RUJ 2;  2JD9 A;  3HQU A;  5AVA A;  4CDQ A;  2QQP A;  1LUL A;  3B94 A;  1GNZ A;  3A0N A;  5A3U A;  2A3W A;  2H0B A;  3U14 A;  1JYN A;  4XIO A;  2A73 B;  5AC9 2;  3OEA A;  3VBF C;  1HB4 A;  1PMH X;  2LUW A;  2FCV A;  2VVE A;  4O9E A;  4IND A;  4AI3 A;  3KVA A;  4XC9 A;  1JOD A;  5T5J A;  5FZD A;  4AED B;  2YBS A;  4CU6 A;  1UY1 A;  4N43 C;  5FZ9 A;  4UBH A;  3WT3 A;  4O7X A;  3I2O A;  1JN2 P;  2K0G A;  2ZXQ A;  3DKW A;  3PJQ A;  1O3R A;  4YVS A;  4Q4V 3;  2VC9 A;  4XJZ A;  2VUD A;  4DIQ A;  2IFW A;  3B00 A;  4SBV A;  4BH9 A;  5F32 A;  1VMJ A;  2VTX A;  3DN7 A;  1PO2 2;  1C1L A;  1HRI 2;  2WC2 A;  4ZON A;  2VMG A;  2I07 B;  4H7M A;  3WQ0 A;  3VD4 A;  3VBF B;  1UIJ A;  3C8X A;  3MUZ 1;  3OBT A;  2TBV A;  5IFT A;  2BW8 A;  5JOZ A;  3JD7 1;  4N43 B;  1AXZ A;  1PNG A;  4ISQ A;  5BNN A;  4ASK A;  2ARC A;  3CU7 A;  2VVD A;  2IVI B;  1OF3 A;  1RUI 1;  4Q1R A;  4UFI A;  2RVA A;  3F95 A;  3PUS A;  2C1F A;  5FCC A;  4JKL A;  3NJX A;  3E6D A;  2A6Z A;  3WCS A;  4Q4Y 2;  2QDR A;  3D82 A;  2DVA A;  1UKR A;  2JE7 A;  1HJF A;  1UOF A;  4LKD A;  1OUS A;  1EAH 2;  5FY1 A;  3ZM8 A;  5LA0 A;  5JMC A;  5I93 A;  1E5I A;  4LLO A;  1ZBE 1;  3JBG 2;  2D6N A;  3IPV A;  4XMA A;  1LTE A;  3VDC A;  5FYZ A;  4NHK A;  3RYK A;  1Y7B A;  2W39 A;  2Y0O A;  3MGU A;  3RZJ A;  5D21 A;  3SIT A;  3T4H B;  5C3P A;  4ORF A;  3ORJ A;  3T0A A;  4Y5S A;  2ZGM A;  2VUJ A;  3TB0 A;  1OXC A;  3OGG A;  3ACG A;  3NV3 A;  5FZF A;  4QKD A;  3MUY 1;  4F8A A;  4L9B A;  2ZCW A;  4AI1 A;  5LBF A;  5CFC A;  3KD4 A;  2UY8 A;  1AYN 2;  4JDM A;  4CUB A;  1GKB A;  3T2Q A;  3NV1 A;  3RZK A;  3QOP A;  3WP4 A;  3LEK A;  2VBD A;  1GZW A;  5FZL A;  5JZG C;  2WRA A;  1BJQ A;  4JRA A;  1V6O A;  1W8Z A;  2W91 A;  2WJS A;  4MHU A;  5B2G B;  1RJ7 A;  4Y3O A;  1LGC A;  2RS3 2;  4WM7 B;  2WZP P;  5A6Q A;  1DQ4 A;  2GNM A;  1QXP A;  3AKQ A;  3VBS A;  3RVH A;  2HH9 A;  5IAX A;  5I8S A;  5KHG A;  3I2G A;  2ZKN A;  4XUN A;  4NO4 A;  3B5L B;  4QDQ A;  2E53 A;  5C8C A;  2HWD 2;  3DUI A;  3OPT A;  2WFP A;  2HJI A;  4Q4V 1;  3K3N A;  2YG0 A;  3WVJ A;  5C33 A;  5CAZ A;  3RPQ A;  4FFG A;  5CIS A;  3T09 A;  4MXV A;  4P00 B;  1AUY A;  4CU8 A;  2VZR A;  1LKN A;  1HN0 A;  1R1Z A;  2UYB A;  2XJU A;  5JZG B;  3V0B B;  4BM8 A;  1MS0 A;  4BPZ A;  4Q4X 2;  5FYY A;  1H8V A;  3M3E A;  1ULF A;  2YB7 A;  4PQ9 A;  1W9Y A;  2FDJ A;  2XBO 2;  3HT1 A;  4QPG C;  5G05 L;  4UWD A;  4E4Z A;  3EBR A;  3MW4 A;  3N3H A;  1JZ5 A;  1W0P A;  1QJY 3;  2ATF A;  5A3M A;  2WL1 A;  1BZW A;  4Q0S A;  2VXJ A;  2RJL A;  2DUQ A;  3LIG A;  3EQE A;  3FFZ A;  4XW3 A;  2WNV A;  4PCR A;  5FZA A;  5LK5 A;  1HIX A;  1O4T A;  4Y33 A;  2DBI A;  1VAL A;  1VIW B;  1H2N A;  2QCS B;  2W52 A;  1UW8 A;  1WW4 A;  3EB7 A;  5E16 A;  1IS5 A;  2VCC A;  3ZXG A;  1WWY A;  3QLQ A;  4A4A A;  1DQ6 A;  2CAV A;  2Y33 A;  4LBQ A;  4QPG B;  3WP5 A;  2KXL A;  1JZ8 A;  4CXY A;  4CSW A;  3ZR5 A;  4E4S A;  4M0N A;  1QWR A;  2WKK A;  1Q3E A;  2GZW A;  1VRB A;  3WW4 A;  1F15 A;  4D6S A;  4ZZ5 A;  4Y24 A;  4KWU A;  3S6P A;  3TBD A;  2ZMK A;  1RIR A;  2VZP A;  4G3Y C;  1WD4 A;  4XF1 A;  3WIN E;  4E4H A;  3POY A;  1RUD 2;  3Q8C A;  4YAR A;  4Z2W A;  1KJL A;  2DVG A;  1AL2 3;  5FZG A;  1RUH 3;  3MI8 A;  1ALY A;  4HON A;  4JC1 A;  1ND2 A;  4LOS A;  4IET A;  2YV8 A;  1GWL A;  4CEY A;  4LUL A;  5L7O A;  1TMF 1;  3AP5 A;  4FCA A;  4NAM A;  2ZAA A;  3AVS A;  3OBR A;  3WNL A;  1QQP 1;  2VH9 A;  4IV1 C;  3LKJ A;  3WV6 A;  1MS1 A;  1JOB A;  2HWF 3;  4QX8 A;  4XZP A;  1B35 A;  4NIH A;  4YGC A;  4IEW A;  3RZL A;  2B45 X;  3LQC A;  4AQ2 A;  2G9Z A;  5FZH A;  3ZO0 B;  1J83 A;  2E26 A;  3BI3 A;  3MZH A;  1NKG A;  1W8T A;  1CX1 A;  3N36 A;  1MVE A;  1YFX A;  1U5Z A;  5JI9 A;  4BIO A;  2C9K A;  4XAA A;  2W0X A;  1N3O A;  1S0D A;  2XML A;  4MHR A;  5A3N A;  1F31 A;  1WA4 A;  4QB2 A;  3THP A;  4AYU A;  1H2L A;  4CCE A;  2FDI A;  2VBP A;  4IV1 B;  1XYO A;  4XEZ A;  2XJQ A;  5FPV A;  1WMF A;  1H9P A;  4MXW B;  2XGX A;  1POV 1;  3WG2 A;  2WQ8 A;  1O5L A;  3EYP A;  2QQM A;  1JUH A;  3LA3 A;  1UOG A;  1RUF 2;  1QJY 1;  2F17 A;  1NE4 A;  1N47 A;  3M3Q A;  2BTV C;  1UX6 A;  5H9P A;  3E5Q A;  1W99 A;  4DS0 A;  4YG6 A;  3WNO A;  4EN6 B;  1IKQ A;  5C6C A;  2BU9 A;  3M70 A;  2JX9 A;  5LBB A;  3RFR A;  2A6X A;  3WF4 A;  4B1M A;  2JB8 A;  5BYN A;  5IVB A;  1ZZ8 A;  2B9V A;  3DXT A;  3O0W A;  3HJR A;  4P14 A;  1QNY A;  4PIZ A;  3AFG A;  3SNM A;  3TRS B;  2GSY A;  4PF1 A;  4I01 A;  4M00 A;  2TEP A;  4DOU A;  3VB9 A;  5C5T A;  5CEH A;  1OD5 A;  4TSV A;  2ZAH A;  3OB8 A;  2VNV A;  4QHZ A;  3RGB A;  3ALQ A;  4C1X A;  4ES9 A;  2A6V A;  1RJ8 A;  5I91 A;  2JB4 A;  3VZK A;  4A7K A;  1R08 1;  2E6V A;  4O61 A;  2VJX A;  5T55 A;  2R04 2;  3KV9 A;  4XUT A;  5DAX A;  5EWS A;  3ME2 A;  4H7L A;  3T2O A;  4KU7 A;  1OT5 A;  1UXX X;  4HVR A;  2ARE A;  5EJ3 A;  2VXR A;  3D6E A;  5LB6 A;  3MO4 A;  5J48 A;  3ZXL A;  1W28 A;  4ERO A;  4QAW A;  5CFD C;  1SMV A;  3VBO C;  2JIJ A;  4I0W B;  5FP7 A;  2IUW A;  5EYY A;  3ZN6 B;  5FTT C;  3U37 A;  1U5I A;  1JHN A;  4Z07 A;  4B8E A;  2VQU A;  4E9K A;  3V0A B;  2G19 A;  4OCT A;  2E32 A;  3VBR C;  3K48 A;  3CZU A;  3E6B A;  3KT7 A;  1YIF A;  2AH2 A;  2QQI A;  1WMX A;  3AC0 A;  4L11 A;  4RR3 A;  2W1W A;  4CCC A;  1W3V A;  4XBL A;  2HWF 1;  4DUV A;  5F3C A;  5HPO A;  2O14 A;  3MF9 A;  3R0R A;  1HW5 A;  1OLR A;  1PZ9 A;  4XCB A;  4K20 A;  3N4M A;  5T5P A;  3WP6 A;  1CIW A;  5CFD B;  1IQA A;  2NZ9 A;  4UAP A;  3VBO B;  1ULE A;  2RS5 2;  2QQJ A;  4DMI A;  4DIN B;  4JQT A;  1HXS 2;  2XR4 A;  2CDP A;  5FYI A;  5FZ4 A;  4FPG A;  1IG3 A;  4JAA A;  4QPY A;  4COU A;  1DCS A;  3VBR B;  2D98 A;  3ZSJ A;  1LRH A;  1RXG A;  5J36 A;  1WBF A;  1ENR A;  5KR7 A;  4BZ4 A;  3W20 A;  4XFF A;  2X29 A;  5J3U A;  4DB5 A;  4JTN A;  4XUQ A;  3DYO A;  4AHZ A;  4AWD A;  4NWW A;  4BQ5 A;  4PBO A;  3HQX A;  1AR9 3;  3E97 A;  1A78 A;  1Z7S 3;  2AR6 A;  2OUH A;  4BOW A;  4L8Q A;  2RS1 2;  1KRI A;  1V9U 2;  2A70 A;  3LAG A;  2Q4S A;  3I3Q A;  4FFI A;  4XXP A;  1QJF A;  4CEW C;  3MBW A;  1DYO A;  3AZY A;  1G9F A;  3RJ2 X;  5DUW A;  4ZU5 A;  1GSL A;  4XQW A;  3SXW A;  4UF0 B;  1YXW A;  3KQR A;  5L9V A;  3ES1 A;  1NQJ A;  3DCQ A;  4GKY A;  1MAC A;  2KA3 A;  2QE3 A;  3N9L A;  1EY2 A;  3NNL A;  4P9J A;  2NQY A;  2XJT A;  4G4F A;  1G7Y A;  1KFX L;  5JPM B;  1SG3 A;  1I3H A;  5F5Q A;  5I8T A;  2WFF 3;  3RSJ A;  3VDB A;  3AKT A;  3O1V A;  4YGE A;  3LA2 A;  1VBB 3;  3O14 A;  3URF A;  1J1L A;  1S2B A;  1YJK A;  1IHM A;  4Q0Q A;  1RGS A;  5FP3 A;  1RMU 3;  4CEW B;  3VBF A;  4M0H A;  4BQ3 A;  3HOB A;  3RZZ A;  5IAT A;  1YWK A;  1Z0H A;  4XTP A;  3AYA A;  3EJK A;  4N43 A;  2JJ6 A;  5EHD A;  3ZXJ A;  4RHV 3;  2WYF A;  2V5D A;  5CAD A;  4XFG A;  1RIN A;  2HWE 2;  2GC0 A;  4AK3 A;  3VKN A;  1ZA7 A;  4AGG A;  5IK4 A;  3SEE A;  1ZBA 1;  2FCU A;  1VB2 A;  1DYP A;  1NA1 C;  1WD3 A;  2YC2 A;  3GZE A;  3KT4 A;  5B4X A;  4AI8 A;  2DV9 A;  1HB3 A;  1QJU 2;  4HL0 A;  4MX3 A;  1KDK A;  3ACH A;  3FUQ A;  1ZM1 A;  3BOP A;  2PLV 3;  3KHB A;  3AFK A;  2VL4 A;  4H2A A;  4ISR A;  5LA1 A;  1WKY A;  3ZKU A;  3BOW A;  1N3P A;  4Q8L A;  4NHL A;  2WNE A;  4LHK A;  2E33 A;  1FPN 2;  1NG0 A;  2DCY A;  4DNY A;  3B9C A;  1DDL A;  5ABJ C;  4B4R A;  1P8J A;  3MID A;  4X6R B;  4BA6 A;  2PQQ A;  4FPH A;  4I2O A;  1L7R A;  3ATG A;  2C0Z A;  3CBN A;  4C90 A;  1RB8 G;  2LM3 A;  4FPK A;  1NA1 B;  5L19 A;  2LS6 A;  3K75 B;  5G04 L;  3AXD A;  3I8T A;  3S30 A;  5FWJ A;  1RUG 2;  2EIE A;  2VCM A;  1E5H A;  3H8X A;  5JUV A;  4Q26 A;  1F2N A;  3WHT A;  2HYX A;  1AR9 1;  3AMQ A;  5GLV A;  3WSO A;  1TME 3;  1Z7S 1;  3AP4 A;  5ABJ B;  5C7G A;  3B3Q E;  3K4A A;  3HBZ A;  5FOJ B;  4EN7 B;  1UZW A;  5C70 A;  1PVX A;  5C9A C;  1X8M A;  4IQP A;  1UL9 A;  4U2A A;  5GM0 A;  2AYH A;  3IDB B;  4Z82 A;  1GYK A;  1TNR A;  1YO8 A;  2YFZ A;  3HR9 A;  3KF3 A;  4W6W A;  3VD7 A;  3B9I A;  1JBC A;  3GHM A;  4D7Y A;  4DPN A;  2BQP A;  3LOB A;  3WDV A;  4RL7 A;  4AI9 A;  4CYD A;  2DUP A;  4M3C B;  3ZYP A;  3NKG A;  3VKO A;  2WN2 A;  2GH8 A;  1OUX A;  2CY6 A;  3POJ A;  3FBY A;  1AX2 A;  3S5Q A;  1F9K A;  3D3A A;  1ASJ 3;  3CHX A;  2VBB A;  5JZG A;  3U4X A;  3V0B A;  1VBB 1;  3UKN A;  1LHV A;  5F5I A;  2OPW A;  3O1R A;  1K42 A;  2UWB A;  1F4A A;  1RMU 1;  5C9A B;  1O6U A;  2JEN A;  2BWC A;  4OQ9 A;  1C8M 2;  2WZR 1;  5CVR A;  4YZ5 A;  1QF3 A;  3W58 A;  2HBT A;  3OY8 B;  4RHV 1;  4HOO A;  2E7A A;  1CZS A;  2HEY F;  3HN1 A;  1V6I A;  5LAT A;  4HLT A;  1JW6 A;  3KQ4 B;  3MF6 A;  5CU1 A;  1CJP A;  1H1I A;  4BE3 A;  5AVP A;  2R49 A;  4MGI E;  4NN0 A;  5FUI A;  5FWE A;  1NZI A;  3VZJ A;  3NNM A;  1C57 A;  2P6C A;  5DG2 A;  1YQ6 A;  1UMI A;  3JCI A;  4GXL A;  4QPG A;  4XIL A;  1G9B A;  3AKS A;  3GXU A;  1R64 A;  5E6H A;  1EPW A;  1XNT A;  2A5Z A;  2NM1 A;  2Q5T A;  5IVC A;  1UMZ A;  2PLV 1;  1HRV 3;  1UOJ A;  5IVE A;  4CP0 A;  1SQ4 A;  2Z5W A;  3KGZ A;  1K3I A;  1NUK A;  2EXH A;  5A7O A;  4HKL A;  4CZS A;  4C91 A;  4IL7 A;  1RUE 3;  2Q8O A;  4B7K A;  4BDV B;  5A3P A;  5GZF A;  3VDA A;  1GWK A;  3JUU A;  4YPJ A;  3VKF C;  3AKR A;  4ZXE A;  4XFB A;  2LRO A;  3MIG A;  5C4W C;  5GLT A;  4Y1U A;  1X50 A;  3QBQ A;  2A1X A;  4X8P A;  3DL3 A;  1G8W A;  3LEI A;  1ODN A;  3WDY A;  4QPW A;  4MGK E;  3E5X A;  4PIY A;  3TEW A;  2FDH A;  2VU9 A;  1VJ2 A;  2GN7 A;  2ZX0 A;  3Q8F A;  5DUX A;  2I74 A;  2ZEY A;  4QWN A;  3I7D A;  3I2I A;  1LOC A;  1OH4 A;  2QQL A;  2GME A;  3IDC B;  2E31 A;  4R9C A;  1R1A 1;  3V64 A;  4CP1 A;  1ZA4 A;  3MIF A;  1GFF 2;  2F6B A;  2RDQ A;  3VZM A;  5C4W B;  3M3O A;  2XWB B;  2Q8E A;  5F37 A;  1LHN A;  1O3T A;  4XHX A;  2I2S A;  1FV3 A;  3J7N A;  2R07 1;  3R4D B;  4PQQ A;  2XL9 A;  3TEZ A;  4BQW A;  1W2T A;  2WS9 3;  3A4U A;  4GZ9 A;  4XJW A;  5JWP A;  5LA9 A;  2DFC A;  3FN9 A;  3JD7 2;  1WCD J;  4IV1 A;  4N90 A;  1RUO A;  3H8R A;  5M0T A;  3Q8A A;  4LO7 A;  2EVX A;  3WDU A;  1PZ7 A;  4XDQ A;  2VMH A;  2WN3 A;  1RUI 2;  1PIV 3;  2XON A;  1GZC A;  3BVC A;  3J26 N;  4JHT A;  2XHN A;  4MXW A;  1JZ7 A;  1IQD C;  1GIC A;  2E9Q A;  1DF0 A;  4FOQ A;  2RV9 A;  1U5X A;  4XQD A;  3HD8 B;  4QX2 A;  4Y4R A;  5FYS A;  5A70 A;  1WME A;  1QNW A;  2W92 A;  3AL6 A;  3KCX A;  4PI0 A;  1PO1 3;  2LRP A;  4WVW A;  1ENX A;  3B02 A;  1S2K A;  4K40 A;  4I09 A;  1UYX A;  1MQT C;  1HB1 A;  2ZTN A;  1ZBE 2;  2VD7 A;  3THD A;  4ATE A;  5L73 A;  4LOT A;  5FK7 A;  1Q43 A;  4OUL A;  2JKX A;  1ZNP A;  1JYX A;  2YY1 A;  3GDB A;  1SFY A;  3KLS A;  4PLN A;  3V65 A;  1UY4 A;  3VD5 A;  5JLV A;  1SLL A;  2PAM A;  3OCP A;  4P5Y A;  2Q8C A;  2DTW A;  2YC4 A;  1QHD A;  4YW7 A;  1I9R A;  2VEC A;  3C7F A;  4Q0V A;  5JXI A;  4KL1 A;  2X8K A;  5FY7 A;  1XU2 A;  3EMR A;  3M7A A;  2NMN A;  3IDE A;  4LIU A;  4MZU A;  4MH0 E;  1HRV 1;  4P5H A;  3PUH A;  3MIC A;  4B4Q A;  1G9A A;  2XPJ A;  1MQT B;  1U0A A;  4YG3 A;  4BXS V;  1WMD A;  1RUE 1;  3AXE A;  1JI6 A;  1HJG A;  3I2K A;  3OPW A;  1J58 A;  1W05 A;  3SH3 A;  4NII A;  4QXB A;  5A6X A;  3ITQ A;  5FZM A;  4PLM A;  5D8A C;  4JRL A;  5A1L A;  1CAW B;  2OX0 A;  3ZN6 A;  2AEN A;  4QGN A;  1ZRR A;  3J7H A;  1ULG A;  4XUO A;  1R09 3;  3PTY A;  3V0A A;  5JSR A;  5HBA A;  5FPB A;  3AMM A;  5J96 B;  1RVF 1;  4BLI A;  2WO3 A;  4D6Q A;  2DYC A;  1AR8 1;  5ACA 1;  2JDM A;  1AX1 A;  3I2F A;  5A7N A;  3SCG A;  3VLB B;  4IGP A;  4XCA A;  2IXK A;  5BNO C;  3KB5 A;  4DY5 A;  1A8M A;  5A7S A;  1GMM A;  3ZSL A;  3MV1 1;  1UU4 A;  2BZD A;  1H2K A;  5CFD A;  2BER A;  1YCI A;  3VBO A;  5HV0 A;  2GU9 A;  4CP2 A;  2PHW A;  2VZO A;  2VZU A;  1VBE 2;  4EN8 B;  3OUH A;  2XKO A;  4RGK A;  4P9Y A;  3MLJ A;  4P9W A;  3ZFF C;  1ENS A;  4J6G A;  4D6R A;  2WS9 1;  3NW4 A;  3VBR A;  3KMH A;  3AMN A;  3ON7 A;  4LXL A;  2SLI A;  4AOC A;  1DQ2 A;  2BWA A;  1MZ6 A;  4S2G A;  5A7W B;  2QQV A;  3L2H A;  5T5O A;  1NY7 1;  3IB3 A;  1K5J A;  4V1P A;  5BNO B;  1KD7 A;  1FMD 1;  1YYN A;  2MNG A;  5C3O A;  4COZ A;  1AYM 3;  5HCH A;  1OVS A;  4K7J A;  4AEJ A;  1ZRF A;  1CWP A;  4HK9 A;  3PVN A;  2VOT A;  2YU2 A;  4I0B A;  4LA3 A;  1OLM A;  1V00 A;  5IWF A;  5FJH A;  4ATF A;  4C0H A;  2VZT A;  3VV1 A;  1OQ1 A;  2ZX4 A;  2XLG A;  4QU2 A;  3ZFF B;  5AFB A;  1CAX B;  4AAP A;  2XH6 A;  3SKV A;  5CG9 A;  4UF0 A;  2D6O X;  1VBD 1;  3NNG A;  2RR1 3;  3I54 A;  1AL0 G;  2C26 A;  2XJV A;  3ZXE A;  3RYP A;  4TTG A;  1ULO A;  4IXL A;  1KQR A;  1TZO A;  4N7U A;  3ENR A;  3AP9 A;  1JOP A;  1YQ5 A;  2MEV 3;  3I2D A;  1W2N A;  3MIH A;  4CEW A;  1C4R A;  1V6K A;  4NVP A;  5EFU A;  3FUO A;  4CXW A;  3QH7 A;  1TMF 2;  1OFN A;  1W6P B;  5FQ0 B;  5IYY A;  1RHI 1;  5C3S A;  4MET A;  1NX9 A;  2RE9 A;  1QQP 2;  1Y3T A;  4I3P A;  5BV6 A;  4WZF A;  1SBE A;  1PX3 A;  3MDP A;  3ZDS A;  1CJD A;  4LNV A;  2ARB A;  2BUK A;  4LO4 B;  1EV1 3;  2B42 B;  1LOE A;  5GLU A;  4NRQ A;  4I30 A;  5K9Y A;  2G4I A;  5ISL A;  3RS6 A;  4XVH A;  3T4V A;  3UYJ A;  5KXB A;  1H4G A;  4Q4W 3;  3PDQ A;  1PM4 A;  4CPB D;  4JZR A;  4AED C;  4YGB A;  3BU7 A;  1A3K A;  1YIP A;  1CZV A;  2WBK A;  2FZ1 A;  2ZX3 A;  1GQH A;  2IWG B;  2CAU A;  3GBG A;  1WLT A;  2ZHL A;  1VBC 3;  3R4U A;  1O3Q A;  4LO8 A;  4A45 A;  2CHH A;  3ST7 A;  5GZC A;  4FPO B;  1RXF A;  4EQV A;  5E89 A;  5T52 A;  3P3N A;  4JTO A;  1WBL A;  1W8N A;  2PHF A;  2VZQ A;  4YW3 A;  3T0B A;  4NIG A;  1QJY 2;  5A80 A;  1NA1 A;  3ZN5 A;  3RWK X;  3SLI A;  1UX7 A;  3AZZ A;  1QH6 A;  3APB A;  3GBW A;  4H3W A;  3HN3 A;  2I45 A;  2CWS A;  2YU1 A;  3H9A A;  3IMM A;  2PHD A;  4W65 A;  2A6Y A;  3WF3 A;  3LB9 A;  4HPK B;  3T0D A;  4TLG A;  2GP3 A;  3TEX A;  4FPE A;  5FZ0 A;  5ABJ A;  1RTV A;  3D8C A;  3OGJ A;  2HBU A;  5EYX A;  3RWN A;  5IK5 A;  1IPK A;  1ZRC A;  2XVK A;  4NAO A;  4ZY9 A;  2DCJ A;  2ZBJ A;  1CZT A;  4NHY A;  3OSD A;  3ZIX A;  1R08 2;  1HV0 A;  2ZHK A;  4HT1 T;  2HWC 1;  4NPR A;  1REE A;  1W04 A;  2E63 A;  1CPM A;  1UYY A;  3AVR A;  4M3C A;  3OG2 A;  4QX0 A;  5FZO B;  4QHO A;  3WQ1 A;  2RJK A;  1UO9 A;  4IE4 A;  1IPJ A;  5FMD A;  4MGQ A;  2WQZ C;  3O1U A;  2VOW A;  1WW6 A;  4XFI A;  1KXG A;  4UFJ A;  5EPA A;  5C9A A;  3WOG A;  5BXX A;  4AFA A;  4E4D X;  4Q8K A;  3A22 A;  3PLQ A;  3U1X A;  3P1I A;  3ZYR A;  1SPP B;  1ZZC A;  1OSG A;  2YPJ A;  2O8O A;  4NWV A;  4QQP A;  2XHK A;  2OW4 A;  2HWF 2;  2Y6L A;  4HMZ A;  4EN9 B;  5IVV A;  3OY8 A;  5JOX A;  5KHJ A;  4OI0 A;  3LCP A;  5JR2 A;  1UPS A;  4YLZ A;  2LTN A;  1RED A;  4DZG A;  1QY4 A;  3NVC A;  4YG0 A;  4ASL A;  4RFR B;  1OA4 A;  4CA9 A;  4WM7 C;  4OI1 A;  3AJY A;  2IXJ A;  1Z78 A;  3UKT A;  4Q4W 1;  3BOD A;  5FXZ A;  2JXA A;  1N1Y A;  4XHB A;  1VE0 A;  3RQ0 A;  1I5P A;  2DVB A;  4ZS3 A;  2D3R A;  4CE8 A;  2OXB A;  3OPZ A;  2R06 1;  1COV 1;  3I3M A;  1ZYB A;  1JYW A;  1URX A;  4RN5 A;  1N1V A;  3INA A;  3WF0 A;  1PZ8 A;  5FZ3 A;  1O8P A;  1VLN A;  1SLB A;  4I02 A;  2A71 A;  1KIT A;  2AZ5 A;  2WLP A;  5JDB A;  4X6Q B;  2BGP A;  3BYW A;  2OVU A;  3MIB A;  2P17 A;  4CCJ A;  1GP5 A;  2ORX A;  2QKD A;  4LBL A;  2PA7 A;  1Q8P A;  4QM8 A;  4C0B A;  2Z69 A;  1VP6 A;  1LR5 A;  5LA2 A;  1QJX 3;  1CES A;  3OOX A;  1OOP C;  2V72 A;  4C1W A;  3T1L A;  1XNB A;  3OJB A;  3BIE A;  5A6Y A;  2JG8 C;  5CKQ A;  3ES4 A;  5FLI A;  2CGN A;  4NUB A;  4DXZ A;  4R4Z A;  4QU1 A;  1C3H A;  2RM2 3;  4S2F A;  5F2S A;  4BYY A;  4NJ4 A;  3K4D A;  3S7I A;  4LO6 B;  5LRS A;  4XXA A;  5C4W A;  4BQ2 A;  5F9T A;  5FYM A;  1JZ2 A;  2JDY A;  4JV4 A;  4XJU A;  1SLC A;  3WG4 A;  4CCM A;  4MGT A;  1Y9G A;  1O4Y A;  5LEJ A;  2XOM A;  1L7Q A;  1OFS A;  2CTV A;  4TLF A;  3ZYF A;  2OQ6 A;  2RMU 3;  1VBA 3;  4N7I A;  3ECQ A;  2XLF A;  1OOP B;  2IC1 A;  3NJZ A;  1FNY A;  1QXJ A;  4JGY C;  4W6X A;  4YM2 A;  3E1F 1;  4XPV A;  3KCY A;  2JG8 B;  1JMU B;  5GKA C;  2EF6 A;  2P1B A;  3GZA A;  1SDW A;  4W8J A;  4B3N A;  3AZX A;  3POF A;  4LHS A;  5FZC A;  3J8F 3;  4UBG A;  3WUD A;  4AGV A;  1RUJ 3;  2ORZ A;  2X5I C;  1ST8 A;  5FO9 B;  3NV4 A;  1ZBA 2;  4AR2 A;  3LD8 A;  4D0Q A;  1FT9 A;  1E5S A;  1LU1 A;  2P3I A;  2VE1 A;  2XUM A;  1D7P M;  3ETP A;  1YFW A;  3GM8 A;  3K51 A;  5FXW A;  5AC9 3;  4QXH A;  1UAI A;  1S0I A;  4KWJ A;  1JU3 A;  1LEN A;  1ND3 C;  2VMI A;  3T3Y A;  3ZXF A;  4Y1Y A;  1HQW A;  5FMO S;  4ES8 A;  1LES A;  4JGY B;  3O1O A;  5H9S A;  4JKM A;  2EIG A;  3TN9 3;  1GOF A;  2OYZ A;  1X82 A;  4LO5 B;  4ASM B;  1MZ5 A;  4Z1V A;  1DU3 D;  1WLD A;  4J25 A;  1ZRE A;  2VTX J;  4MAD A;  2HWB 3;  3TEY A;  3RZG A;  2X5I B;  4UW6 A;  2BNN A;  2QBX A;  3OGR A;  4FQZ A;  3AKP A;  4XUR A;  1GZT A;  4A3X A;  3PNA A;  1CAV B;  1YEW A;  5CBL A;  3F2Z A;  3K46 A;  1D4M 3;  1MQT A;  5D1I A;  1ND3 B;  2D40 A;  1TEI A;  5FPU A;  2C24 A;  1XBF A;  3EO6 A;  3KVB A;  4MVT A;  2GNT A;  1N1T A;  3MIE A;  4KGG A;  1AR9 2;  3PUQ A;  2R32 A;  5CIR A;  5IAV A;  3VHO A;  1Z7S 2;  5J1X A;  1CAW A;  4CU9 A;  2ARX A;  3PUR A;  2W46 A;  2DCK A;  2MHF A;  3ZYG A;  1HDK A;  4YVW C;  1UZY A;  2W08 A;  2W1S A;  1MEC 3;  3HMY A;  1QJX 1;  1X7N A;  4Q4Y 3;  1BBT 3;  1D0H A;  3SMH A;  5GZD A;  1EAH 3;  3NWK A;  3GNE A;  1UNB A;  5KHH A;  1SBF A;  3NNF A;  4JCK A;  3I2J A;  5F6K A;  4WV8 A;  2QQK A;  4B7E A;  4XMI A;  4FXG B;  4PT6 A;  5D8A A;  2GAU A;  2BGC A;  4Y1V A;  3TNP B;  1KS5 A;  2QQU A;  3WD5 A;  4PF5 A;  4GH4 C;  1W2O A;  4O9G A;  1RMU 2;  2R0H A;  3DPR C;  4P9X A;  5KXE A;  4FTB A;  4B1L A;  4YVW B;  4CUA A;  2BRT A;  2WZR 2;  3HVD A;  1AYN 3;  3ZXD A;  5FMB A;  3POW A;  5A7W A;  2DWR A;  2BOJ A;  3KSC A;  2A6W A;  4NHM A;  4R9A A;  4RHV 2;  1JHJ A;  3C7O A;  1BCX A;  3BIW E;  4GB3 3;  5BNO A;  4E2S A;  5FUN A;  1L3J A;  1GQG A;  4NRM A;  4IE7 A;  5FK8 A;  3VL8 A;  3J8F 1;  3T2P A;  3ZLI A;  1J3Q A;  2R16 A;  1RUJ 1;  1I1E A;  2ZZQ A;  2QTW B;  3ZKY A;  2O8Q A;  2TNF A;  1BK1 A;  4GH4 B;  4YFW A;  3SH5 A;  5LY2 A;  5A32 B;  3RZH A;  1PVC 3;  1Y9Q A;  2EAA A;  3DPR B;  4J1W A;  2RS3 3;  3POG A;  4XZU G;  3ZFF A;  3ZXK A;  1CAX A;  4LKF A;  2PLV 2;  3HAG A;  4AI2 A;  4DY3 A;  2B39 A;  4QQO A;  1LOF C;  2WNO A;  3THC A;  2WO7 A;  3HIF A;  3TN9 1;  5DUU A;  1AL2 1;  2ZMN A;  1RUH 1;  2X10 A;  2UWA A;  4EWE A;  1NCQ C;  3CZJ A;  2HWB 1;  4A6O A;  1BK0 A;  1NAE A;  2ERF A;  5DAV A;  3A0K A;  3KV5 A;  4YRD A;  5DUV A;  1W8U A;  2DVF A;  3C2U A;  3ILR A;  1D4M 1;  5LW9 A;  5I0S A;  1SEF A;  4BMB A;  4R52 A;  4DUW A;  1W6P A;  2ZX2 A;  2X53 S;  4HBN A;  2F4P A;  4B4P A;  5FQ0 A;  4XFC A;  5B4N A;  3UL2 A;  2ADE A;  4ZS2 A;  2Y34 A;  4E2G A;  3FZ3 A;  3JB8 A;  2CL2 A;  3WNK A;  3ZSE A;  2D5H A;  2VW1 A;  1NCQ B;  1DHK B;  2VQT A;  1QMJ A;  1R1A 2;  1SCS A;  3LOI A;  5FY8 A;  4FPY A;  5K0U C;  1JYI A;  3HWJ A;  2OKX A;  4PI2 A;  1LEM A;  1Y43 B;  3S0M A;  2NN8 A;  1MEC 1;  2BV4 A;  2XJP A;  3FL7 A;  3HPN A;  1O91 A;  2QZ2 A;  2WO1 A;  2Y26 A;  1BBT 1;  4COY A;  2R07 2;  5IK7 A;  1HB2 A;  3PJY A;  4QT6 A;  3WDW A;  4BXF A;  3E5U A;  1T6B X;  1UZZ A;  2G9G A;  1FAT A;  2AC1 A;  3U75 A;  3I59 B;  1AF9 A;  3N9M A;  3BB6 A;  5JMO A;  2WII B;  3RI8 A;  5K0U B;  1RUD 3;  2VVF A;  4LBO A;  3FLR A;  4PLO A;  5DXD A;  2VM9 A;  4MGZ E;  2IFR A;  2OZJ A;  4R4X A;  2IXI A;  5LWB A;  1NXM A;  4OHY A;  1WZX A;  4AED A;  4GB3 1;  3B93 A;  3ZFG C;  1C5H A;  1W6O B;  5FYC A;  4HPK A;  4QB1 A;  2EXJ A;  3AJZ A;  3LGR A;  1YQC A;  2P34 A;  4LBK A;  4RGG A;  1Q8O A;  2F4L A;  3PUA A;  4QX3 A;  3R6S A;  1S0G A;  2D97 A;  5ERL A;  4YW4 A;  4XAC A;  3PIG A;  1PVC 1;  1LOA A;  4L97 A;  1ZZ9 A;  1DG6 A;  1MS8 A;  3BTY A;  5ANQ A;  2BPA 2;  2QVS B;  2ZGR A;  4CP9 B;  1HRV 2;  2EA7 A;  3WF1 A;  3WEZ A;  3HNY M;  3IIA A;  1YC6 1;  1DQ5 A;  2ZHN A;  5SV8 A;  3JQW A;  5F7U A;  4MSV A;  1RUE 2;  3WDX A;  5FPZ A;  3ZFG B;  5FZO A;  4A6S A;  4GA9 A;  1WW5 A;  1OKQ A;  4ITC A;  1LHW A;  1C5I A;  1GNH A;  3W59 A;  1X9T A;  3VBU C;  2UUR A;  1WGP A;  3PVE A;  4GAZ A;  2ZPX A;  3JU9 A;  4GQ7 A;  1WCK A;  4WVZ A;  1S0F A;  4S2H A;  1BMV 1;  1O8S A;  3IMN A;  3P5B A;  2QQW A;  1RUF 3;  4D3W A;  3FJS A;  5K8S A;  1RVF 2;  4FPC A;  3FC0 A;  1SPP A;  2YPD A;  4QKB A;  1AR8 2;  5ACA 2;  2VPV A;  4OMD A;  2WDB A;  4LBM A;  4FAG A;  1X8E A;  3I4I A;  1WA6 X;  3Q9O A;  1PK6 C;  2Q0A A;  3ZPY A;  1NYW A;  4Q0U A;  4OI2 A;  3W9A A;  4D69 A;  3VBU B;  2J7M A;  4CCK A;  2JDH A;  2P6H A;  2P3K A;  3HEI A;  4Y20 B;  1CR7 A;  3PME A;  4O65 A;  2OS2 A;  3FX3 A;  4AFD A;  4K8F A;  2CDO A;  1ACC A;  4I3G A;  2ET7 A;  4AL9 A;  4Y5T A;  4EZ4 A;  5KBF A;  1OC1 A;  1VPH A;  2K46 A;  3GCX A;  4K3U A;  3BAL A;  3JB4 C;  3N9Q A;  4WBB A;  3PUI A;  5FP8 A;  1NY7 2;  1NE6 A;  4AHW A;  2R04 3;  4EE2 A;  2XUE A;  2Y0I A;  2LW8 A;  4AVS A;  1AR7 3;  1PK6 B;  1FMD 2;  3MHZ A;  3UET A;  3K2O A;  2JDA A;  4UT5 A;  3MV0 1;  2VTF A;  3ACI A;  4FOW A;  2Y60 A;  1QJE A;  1O4Z A;  2ZGN A;  5GLZ A;  4FPF A;  4WM7 A;  3W5N A;  4E8C A;  2PEL A;  1OA3 A;  1TVG A;  3USU B;  3T08 A;  1AXY A;  3VN4 A;  1QDO A;  2QUO A;  2XVL A;  1IPS A;  2VOV A;  1RUC 3;  2OZ6 A;  2PHU A;  2YC0 A;  4Q2F A;  2BDR A;  1VBD 2;  4BQ1 A;  3QAC A;  3BKZ A;  2JDK A;  2WFF 1;  4L0P A;  4BIF A;  1ZRI A;  1H30 A;  5FYT A;  2ID4 A;  2C5D A;  2ZML A;  3WXP A;  3ZMN A;  3QD6 A;  2RS5 3;  1AJO A;  4KGQ A;  3ETQ A;  4XET A;  1HXS 3;  3GCW A;  4QKN A;  5FLJ A;  1KGY A;  2J22 A;  1H1A A;  1Q8V A;  3AB0 A;  4PHZ A;  3WLU A;  5CKN A;  1TE1 B;  2V5Y A;  1CAU B;  3UKV A;  1RHI 2;  2XWJ B;  1K5M C;  2OPK A;  5IVF A;  1MZF A;  5IK8 A;  3IBM A;  1OOP A;  4Y1Z A;  2A3X A;  1BEV 3;  3FHA A;  3RDI A;  3LEG A;  2TUN A;  1NQD A;  4XTM A;  2JG8 A;  4UOJ A;  3FFQ A;  3ASI A;  1S0C A;  1EYB A;  5FYH A;  3IZO A;  4EV0 A;  4BQX A;  2NP0 A;  4OYU A;  4LE4 A;  2D93 A;  3M3I A;  5JXH A;  1M06 G;  3I3B A;  1QEX A;  2RS1 3;  2GNB A;  1V9U 3;  5I0T A;  2DUO A;  5C5U A;  2Q1M A;  4QHB A;  4AHX A;  2JDN A;  1QXR A;  1K5M B;  1GOG A;  3FMG A;  5LBE A;  2PFW A;  1OQD A;  1GP6 A;  2VO5 A;  4JGY A;  2P3Y A;  4S2D A;  5JIU A;  3H42 B;  4QX1 A;  1PGW 1;  2W95 A;  1SAC A;  1YUD A;  2D5F A;  4BQ4 A;  3WNP A;  3DYP A;  5JIA A;  4CVU A;  5HCA A;  2ES3 A;  4I0A A;  2X5I A;  2PAE A;  2CGP A;  5FO8 B;  2V4V A;  1CGP A;  1NZC A;  1QKQ A;  1CAV A;  1IG0 A;  2VZV A;  3UJQ A;  4IEO A;  1CON A;  4KG8 A;  4BB3 A;  2Z42 A;  1AR7 1;  1SHW B;  4OZO A;  4QDR A;  2VY0 A;  1ND3 A;  4KU8 A;  1TME 1;  2VW2 A;  4HXC A;  4LKS A;  2ZJC A;  1V70 A;  4AW7 A;  2VZ3 A;  2HWE 3;  4YM3 A;  4OFG A;  4XJ9 A;  2BOI A;  5EIY B;  1RUC 1;  2PHT A;  4YW5 A;  5C8W A;  1S1A A;  2B8M A;  1LOB A;  3S7E A;  2HWC 2;  1UZV A;  1QJU 3;  5FOB B;  5JSO A;  4RFT 0;  5CNA A;  1ASJ 1;  3VKL A;  1VAK A;  3UV9 A;  1IS6 A;  1DQ1 A;  1AR6 3;  1UMH A;  3TOJ A;  4BWO A;  5HXM A;  3K4Z A;  1FPN 3;  2GDF A;  3FE5 A;  3CF6 E;  5JXJ A;  3D5O A;  4AVA A;  4NMI A;  4MV2 A;  4UFM A;  1DGR A;  2UWC A;  4YVW A;  1DGW X;  2HKX A;  5FY5 A;  4GMP 3;  2PHX A;  1VR3 A;  3KGL A;  3WQ7 A;  4LKE A;  2W5F A;  3B7M A;  3P6B A;  5T3N A;  5FR3 A;  2GC2 A;  1BEV 1;  1GLH A;  3ELN A;  3IAQ A;  2XB6 C;  1YQ2 A;  2EAL A;  1NXD 1;  2EIC A;  2YUE A;  5FRA A;  4ZXK A;  3ZN4 A;  2Q1F A;  1VRH 3;  1X33 A;  1W9W A;  3CIH A;  4KWL A;  2Z4F A;  5DZF A;  5FDB A;  3O5S A;  1J3P A;  5A3W A;  3BTA A;  3JQX A;  1JUI A;  4LE3 A;  1E5R A;  3W21 A;  4GH4 A;  1OUR A;  5CYY A;  2J1R A;  4WVV A;  5A32 A;  2GAL A;  3DPR A;  1PNF A;  2R30 A;  4OHX A;  4ONU A;  4URA A;  1DGL A;  4CTE A;  1QU0 A;  1XSQ A;  3IDA A;  1AX0 A;  5FP9 A;  2R06 2;  4E27 A;  1COV 2;  4MYE A;  5FY9 A;  2VQA A;  5F5A A;  5KXC A;  1GQP A;  2IXC A;  5IW0 A;  1TNF A;  5APA A;  4V2V A;  3RNS A;  5DZE A;  5HXV A;  3IKW A;  5FUP A;  3AMH A;  4LTA A;  1J84 A;  1NT0 A;  4CCO A;  4P9I A;  2B7Y A;  1DBN A;  1I5Z A;  3LPF A;  4K1Y A;  1DIW A;  2KM2 A;  5EV7 A;  4YW1 A;  1US2 A;  4TWT A;  3NRU A;  3WNM A;  1KDM A;  1C8M 3;  1XNK A;  2E7T A;  2J1T A;  2XJS A;  2CU5 A;  4U36 A;  1LOF A;  2D3S A;  2Y6F A;  4Q4V 2;  4DRR A;  3BU0 A;  4P08 A;  3AP6 A;  3RRD A;  2W9X A;  3KT1 A;  3ZR6 A;  2DBN A;  1NCQ A;  2XL7 A;  2RG4 A;  5BNP C;  3OYW B;  3ZXA C;  1T6G C;  4J1X A;  2WA3 A;  3FHI B;  5F39 A;  4UXA A;  3H7Y A;  4XJA A;  1UQX A;  2WNU C;  1MZE A;  1OLM E;  5FY4 A;  1UIK A;  3LDR A;  1S55 A;  1OBN A;  2CYF A;  2PQS A;  1PIV 1;  1AR6 1;  3L9J T;  4QQ2 A;  1CQ9 A;  2H6B A;  3NO8 A;  3NQH A;  3VDD C;  3I59 A;  3M8L A;  3HT2 A;  5K0U A;  4LT5 A;  1BVP 1;  1SBD A;  1PO1 1;  2BP6 A;  2NLR A;  4GJZ A;  4HSJ A;  1DGW A;  3AM2 A;  5BNP B;  1Q5O A;  5LCW L;  2D44 A;  4FFH A;  2WT2 A;  2JIG A;  5K4L A;  3ZYJ B;  3NAP C;  2BFU S;  3BN6 A;  3CO2 A;  5EP9 A;  2WNU B;  2FDK A;  2ETE A;  4Q27 A;  4M01 A;  1H8T C;  2AUY A;  1GUI A;  4DUX A;  1VRH 1;  1W6O A;  4OLL A;  1MS9 A;  3SCH A;  3VDD B;  2FMD A;  1NLQ A;  2W1U A;  2ZGL A;  2WAA A;  3WQB A;  5EJZ B;  4AQ6 A;  4URT A;  2DVD A;  5LRR A;  1W6M B;  3VD9 A;  3U0Z A;  1O59 A;  3WW3 A;  3ZSK A;  1PGL 1;  4CP9 A;  3NAP B;  2G9F A;  2WQ4 A;  2W68 A;  3EXU A;  1JOJ A;  4WM8 C;  1NLS A;  4HAN A;  3CJX A;  1H8T B;  1DZR A;  4AVC A;  2W87 A;  4NE9 A;  5JAX A;  4CCN A;  2YRO A;  3ZFG A;  2CSG A;  4AFM A;  4FSJ A;  1A34 A;  3VZN A;  3T2T A;  2EID A;  3A23 A;  3NKT A;  3WG1 A;  2R1D A;  1WCQ A;  1R09 1;  5KWR A;  2PMW B;  1UWW A;  4DRV A;  3DV8 A;  2PN5 A;  2WUH A;  1YNA A;  2YBP A;  4P9G A;  5FKB A;  3TNQ A;  4AHY A;  4B29 A;  5KC5 A;  1JYV A;  4D7S A;  4Z92 B;  4AQS A;  3V56 A;  2J1E A;  5CA6 A;  1QJX 2;  2D43 A;  2JE8 A;  3PVB B;  4MOA A;  4WM8 B;  4A2U A;  1D4V B;  2HLE A;  4EZH A;  1YLL A;  1XYN A;  4WVM B;  4YW6 A;  4LUM A;  3THT A;  3IWZ A;  5C71 A;  3NST A;  3PU8 A;  1US3 A;  5J98 B;  4Q1P A;  5GAL A;  1ZBE 3;  5FKC A;  4NIA A;  3WUC A;  1MS3 A;  1S2E A;  4P9L A;  4CDW C;  2BEO A;  1YRZ A;  3VBU A;  1SLI A;  2NMO A;  4A44 A;  2AEY A;  3GJB A;  4Y20 A;  1LOD A;  1PX4 A;  3WW2 A;  2HYK A;  1SFN A;  4FPJ A;  2RJ2 A;  1AVB A;  3QCW A;  4LHN A;  1DLL A;  5FYB A;  3GZT B;  3UES A;  4IER A;  2VCA A;  5DDJ 3;  1QIQ A;  4PDW C;  4IEQ A;  4PJY A;  5FYU A;  1G86 A;  1AYM 1;  4OI4 A;  5FPX A;  3KCC A;  4F3J A;  5DAP A;  2K2S A;  1PK6 A;  5GLW A;  1POQ A;  4CDW B;  4OUM A;  3H50 A;  2OII A;  1GWM A;  1LU2 A;  1DZT A;  3J8F 2;  4M3C E;  3MFC A;  4QPI C;  1N3Q A;  3RJR A;  5FAX A;  1UZ0 A;  1OA2 A;  2ZGT A;  2Q8D A;  2G1M A;  1OQE A;  1M4W A;  3USU A;  2C9A A;  3N7M A;  1CPN A;  4QX5 A;  5KHK A;  3SIS A;  5JOY A;  3FLP A;  1D2S A;  5IVY A;  2N7G A;  2RR1 1;  3PMS A;  3DGT A;  1W8F A;  3LSD A;  1W9T A;  4PDW B;  1OKO A;  3OBA A;  4DXS A;  4XBN A;  1OI6 A;  5BPX A;  3MPB A;  4K9S A;  3TN9 2;  2Z2S B;  5LK7 B;  4FTE A;  1AL2 2;  3U11 A;  1RUH 2;  1K12 A;  1A6C A;  1XSR A;  4XUP A;  2JKB A;  2MEV 1;  3R4S A;  2K9Z A;  4R8H A;  3CNA A;  4QPI B;  2HWB 2;  3U10 A;  1ODM A;  2Y8K A;  1JZ4 A;  4LBN A;  3LZZ A;  1FOD 3;  3GHN A;  5F3E A;  5CB7 A;  4DEQ A;  1ZX5 A;  1VBE 3;  3OTF A;  5FRE A;  3ZSM A;  1D4M 2;  4H55 A;  3VUO A;  2PYT A;  2A7A A;  1FAY A;  3MPP G;  1CAU A;  3AZV A;  4UI9 L;  1W6N B;  5L9R A;  1GAN A;  1EV1 1;  4DO0 A;  4IE6 A;  1F4H A;  2VG9 A;  2JG9 C;  4YYO A;  3I3E A;  4LBQ D;  3OEB A;  5EQU A;  4JGZ C;  4IEU A;  4QM9 A;  3G7D A;  5FY0 A;  3ILF A;  4Y4Y A;  2ET1 A;  2Y64 A;  4JVA A;  2Y6J A;  4LK6 A;  2ZA9 A;  5T5L A;  3O12 A;  1MEC 2;  2DCT A;  5FYV A;  3U07 A;  4SLI A;  1H2M A;  1HX6 A;  1PM7 A;  1BBT 2;  2WAO A;  1C1F A;  5A1A A;  3LIH A;  4AVT A;  3KHC A;  1VBC 1;  5CG8 A;  3T30 A;  1AHS A;  5FZE A;  1K5M A;  1HQN A;  1IS4 A;  2W3J A;  5DAB A;  3VGI A;  2JG9 B;  1UU6 A;  1HLC A;  3DXU A;  2FCT A;  2VZ1 A;  4K6B A;  3X29 B;  4CPB A;  4JGZ B;  4AI0 A;  2BVV A;  5IFP A;  5JCT A;  4IEP A;  4IEV A;  1STM A;  2WZ8 A;  5I8Y A;  3SH4 A;  4IV3 C;  5DDJ 1;  3T1M A;  4FBF A;  1LB2 A;  4N9I A;  1W8H A;  4HET A;  5GJ6 A;  2QDN A;  1OF4 A;  3H7J A;  1ZVF A;  5DN2 A;  2X05 A;  4TZD A;  2HEV F;  2VUL A;  4GB3 2;  1TMF 3;  3A7Q A;  5IUQ A;  4KI5 M;  4YNI A;  5H9Q A;  1BVV A;  3AYC A;  1QQP 3;  1UXZ A;  4QGL A;  5FXX A;  4QQH A;  2DU1 A;  2DUR A;  2ZGO A;  4PIX A;  5T54 A;  5F3G A;  3LDB A;  4CCD A;  4NPL A;  1PVC 2;  5GZE A;  2J1S A;  1WLC A;  4HFS A;  4IV3 B;  3CL1 A;  2ZGQ A;  4Y5Z 0;  4Y26 A;  4IE5 A;  3Q8B A;  3ZDV A;  4FQ4 A;  1APN A;  3ABZ A;  3BUC A;  1DYK A;  2XLA A;  2YHJ A;  4FP2 A;  4CDX C;  3MW2 A;  3TAY A;  1W9F A;  4RD7 A;  3J7L A;  4AG4 A;  1FOD 1;  3KZ4 C;  1W2A X;  4GIQ A;  3LSE A;  3G6J B;  1ULC A;  1VBE 1;  2WA4 A;  4XOG A;  1LOG A;  1POV 3;  3WG3 A;  1G9C A;  2RDS A;  2VMC A;  4X8N A;  1VAV A;  3U4S A;  4A7Y A;  4Y22 B;  5JI7 A;  1BMV 2;  4HG6 B;  4R9B A;  1FV2 A;  3KM5 A;  4KH9 A;  2ZKL A;  4XE9 A;  1XXN A;  1WCU A;  4HK8 A;  5FBJ A;  5IJR A;  2VCB A;  1QJZ A;  2ZHM A;  4V2W A;  3H8U A;  3UGH A;  4CDX B;  5F1R A;  4YZ3 A;  3BTX A;  1GNY A;  1KFU L;  2YBK A;  2XDV A;  2R6Q A;  2IXL A;  2SBA A;  5FMO L;  1CN1 A;  1XE0 A;  3FWE A;  5D2A A;  2H6C A;  4BJ0 A;  1OVP A;  1PO2 3;  1SDD B;  2R1B A;  5IHR A;  1HRI 3;  1RUN A;  1HQL A;  3DYM A;  4KQ7 A;  4KWK A;  1WUV A;  1XNC A;  3DF0 A;  4BK4 A;  1LNS A;  3OF1 A;  3LA7 A;  1F5J A;  2Y6K A;  3MEP A;  4M3C F;  2XKP A;  3WNN A;  1R08 3;  1YI7 A;  2ZAC A;  2VMF A;  4NPM A;  2VUC A;  2FBE A;  1WCS A;  4NOT A;  3ACL A;  2BBV A;  2B46 X;  5JXG A;  1CX4 A;  2J1A A;  5EJ1 B;  3VHR A;  3W5M A;  3WR0 A;  4BK5 A;  3III A;  3QH6 A;  1J59 A;  3ZMO A;  3VD3 A;  1JU4 A;  4LQR A;  4XAB A;  1EP0 A;  1EUU A;  3Q8E A;  1UCX A;  3DEM A;  1GZ9 A;  2YGM A;  2XQX A;  4IGO A;  3ZOI A;  4XBQ A;  3SKJ E;  4GD4 A;  1XNA A;  2XG3 A;  3J9S A;  5LEK A;  5A3L A;  4CUG A;  2OUJ A;  3JBG 3;  2MPF A;  3BPS A;  2BYV E;  1BQP A;  2ZEX A;  4IEY A;  4OHV A;  4OHW A;  2DTY A;  2RM2 1;  2WFF 2;  4YZ4 A;  3O1S A;  1IKP A;  1VBB 2;  5T50 A;  1S4C A;  2JWP A;  2YXS A;  1OD3 A;  1F5F A;  5KHI A;  2GP5 A;  3OYW A;  3HBK A;  1RC6 A;  1FX5 A;  4HKO A;  2RMU 1;  1VBA 1;  1KS4 A;  4ZU7 A;  2VMD A;  3ZX7 A;  3D0S A;  2VNR A;  1U5Y A;  2PHL A;  4HN0 A;  3KF5 A;  1Q56 A;  2FQP A;  4GJY A;  3N7L A;  2R7E B;  4ZHN A;  1LHU A;  4FP3 A;  4N53 C;  5F2W A;  1OMI A;  4QQL A;  5BNP A;  1ENQ A;  2VNO A;  5E1R A;  4KNC A;  3PVO A;  5AC9 1;  5IT6 A;  3S57 A;  2DCZ A;  4FI9 A;  4MG2 A;  1DQ0 A;  5SV5 A;  2EXI A;  1UU5 A;  1NCR C;  2VOK A;  2VUA A;  1VMF A;  1KEX A;  1V6M A;  2WNU A;  1YQ8 A;  3N9N A;  3PL0 A;  3HNB M;  5A33 B;  2JIC A;  5HV4 A;  4JKK A;  2GMM A;  3NJY A;  3POI A;  2HWD 3;  3UGF A;  1XJA A;  1GOH A;  3CKH A;  1W6Q B;  3O0V A;  2B9U A;  3VDD A;  4GWI A;  3MFA A;  1LGN A;  1PGW 2;  4N53 B;  2WSV A;  4FPL A;  3RMX A;  1Y4W A;  3WDT A;  1PO2 1;  3NV2 A;  4BCU A;  4DQA A;  1HRI 1;  2V73 A;  3SCF A;  5LZ6 A;  1JYT A;  1GU3 A;  2Y6G A;  4Q4X 3;  4BQY A;  1W6M A;  2W47 A;  4PBP A;  3M4F A;  2DU0 A;  2XBO 3;  4RQP C;  3NAP A;  2W1Q A;  1Q8Q A;  4YZ1 A;  2ZEZ A;  1NCR B;  3DKQ A;  5FV3 A;  1GP4 A;  4DXR A;  1H8T A;  3P3P A;  3SEP A;  1AR7 2;  1PHM A;  1S0J A;  3USS A;  2BVB A;  2VW0 A;  1TME 2;  1DZQ A;  5FZ6 A;  2V09 A;  2YMZ A;  3N7J A;  4E8D A;  5C3Q A;  2AGS A;  5LAS A;  4WZC A;  1UY2 A;  4L2N A;  4XFA A;  2ARA A;  3CJI C;  4D8M A;  4EWD A;  1BLZ A;  5A7Q A;  1A8D A;  4RS5 C;  1EUT A;  5HI0 A;  4Q4Y 1;  5FZI A;  4LJH A;  2PHR A;  4NR1 A;  1RUC 2;  4RQP B;  4H14 A; 
#chains in the Genus database with same CATH homology
 3KT1 A;  5C5T A;  5C5U A;  5ERL A;  2RG4 A;  5DAQ A;  4XAC A;  2RDQ A;  5LBE A;  5LBC A;  3NNF A;  4NHL A;  4Q5O A;  4BQW A;  5LA9 A;  5DAX A;  4IW3 A;  3NNJ A;  5M0T A;  4UWD A;  5LB6 A;  3BVC A;  2JIJ A;  3OUI A;  3HQU A;  5L9R A;  4NHM A;  5A3U A;  4XAB A;  2G19 A;  2JIG A;  5EP9 A;  5DAW A;  2FCV A;  5EQU A;  3KT7 A;  4XC9 A;  2Y33 A;  4XCB A;  4JZR A;  3OBZ A;  4ZON A;  3EMR A;  4Y5T A;  2FCT A;  2OPW A;  4KBZ A;  4NMI A;  5DAV A;  3W20 A;  3ITQ A;  2HBT A;  2Y34 A;  5LAT A;  2RDN A;  3PL0 A;  4NHX A;  2HBU A;  3HQR A;  5HV4 A;  3W21 A;  3NNM A;  4NAO A;  4NHK A;  4XCA A;  5L9V A;  3MGU A;  3NNL A;  4NHY A;  4XAA A;  4MHR A;  5HV0 A;  4Y5S A;  3GJB A;  5L9B A;  4J25 A;  3OUJ A;  3OUH A;  4BQY A;  5LBF A;  2V4A A;  3DKQ A;  5IAT A;  5EPA A;  2RDS A;  2A1X A;  5DAP A;  3GJA A;  5IAV A;  2RDR A;  5LAS A;  4MHU A;  5LBB A;  4BQX A;  2G1M A;  3GZE A;  2FCU A;  5IAX A;  3KT4 A;  4ZPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...