4IW4C

Crystal structure of the serine protease domain of masp-3 in complex with ecotin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
138
structure length
137
Chain Sequence
b'QPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ecotin
publication title The Serine Protease Domain of MASP-3: Enzymatic Properties and Crystal Structure in Complex with Ecotin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 17
structure length 137
sequence length 138
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4iw4C00
4IW4C 1EZSA 1N8OE 1XXFC 2Y6TE 1FI8C 1ECYA 1SLXA 1XX9C 1ECZA 1SLVA 1AZZC 1ID5I 1P0SE 1SLUA 4NIYE 1XXDC 1IFGA 1SLWA 1EZUA
chains in the Genus database with same CATH superfamily
4RWYH 5F7KC 3ZTJG 1W0WB 2CLZA 4ZXBB 3HI5H 1G6RB 5CJQH 4RCAA 5CF3A 4AYBA 1ORSA 4WTQA 1IL1A 3FFCA 1LWJA 3PQYA 3D6GA 5I6LA 4WI8A 2BVPB 3UTPD 4I18A 1FUNA 3C6LD 2HFEB 3JWOL 3T1FA 5F1KC 2AQPA 2XX1A 3BUPA 1QLRA 3TWYA 1ML0A 3QS2A 4NWUL 5IG7A 2EXWD 4PP1C 3JWOH 3L3OB 2XPYA 5FUCE 3OG6B 1ES0A 2EP6A 2VR6A 3AXIA 2CGRL 2IBZX 2HX8A 1FP5A 2QPFA 1G7PB 4WUUA 3IXAA 1RQ5A 4NWUH 3RFRA 4MS6A 4JFHD 3HI6L 4LO9A 1IGYB 3FPXA 1BFTA 3WEXA 3NZ8A 1KPRB 2CGRH 1JN6B 1MCEA 4PHZA 1DN2A 3HB3D 3RNQB 3SO3C 4GXFA 4PGBA 3PGDB 4HKJB 4X6EB 3ETSA 3FQWB 3CBRA 3HI6H 5IVXE 2Y5TA 4XPGL 3RIFF 5HDOA 2XY2A 2E74C 5IHBA 1AMXA 1CLOL 3MV8E 3VCLB 2AEPL 4GO9A 1I1AB 2BO0A 4JGJA 4L5FE 5IKCA 3EBHA 4XPGH 4UMGA 3B2PA 1W0VA 1PNDA 3B9DA 1J9SA 1CLOH 1L9OA 1MJ7L 4KI5D 1TKWA 1KT2A 2AEPH 4NERA 3GTNA 4GQRA 4JQIA 2IVFC 5HHNA 3GRBA 3QJHB 2L3BA 1NUFA 5JW5B 2AQSA 3ZMNA 3NIDE 1MJ7H 2JFCA 3NQIA 4MD5B 3AUVA 3KPSD 3CN1A 4OCWL 1HHIB 4PGCB 2FE0A 1A6TA 4GP4B 5IJCC 1MCSA 5FO8B 1K9TA 4E36A 3EJCA 4EI5B 3TL5A 1NDGB 1P4LB 3V7AE 1CIDA 4DIXA 3EYVB 1B4LA 1Z1WA 1SYVA 3DXAE 4JLRB 3IPEA 3EO1B 3NCEB 3V0AC 2C4FU 4FGMA 2Y1YA 1AQDA 1S9XA 3HC0A 3FK3A 5C07D 3B7SA 4ZMWA 5KSVB 1J48A 4U0RC 1Z0NA 2G5UA 4L4VD 4HKBA 2JCWA 2WLMA 4JPWL 2VLJE 4N8PA 3UTSA 2EIBA 4IS6B 1JAEA 4JO5A 4E9YA 4AV5A 4TYUA 3HJ0A 3NIFF 4JPWH 4P2RE 2XN9A 3IDMB 4P2QB 3P4MA 1BWWA 1MJ8L 3EJQA 4MAZA 4R7XA 3ZGHA 4KROC 4PRHA 1UC6A 2LQRA 4XBPB 5DZ9A 2HVKB 3CX5K 3U2JA 4ALAL 4YL4A 1MJ8H 5EZPA 3AU1B 4LHJB 1WD8A 2R2EA 4DP4X 5JW4R 3P3YA 1VFAB 1A22B 2OJEA 4ALAH 4JANA 2WVVB 1HQ4A 3AQXA 5CMAB 5JMRA 3OAZH 2JF1A 1TQTA 1N6UA 4ODSL 3FTVA 3L17A 2E6JA 1IAKB 1SXAA 1RUPL 2X70A 4FYSA 4F8LA 3VGAB 1XBDA 1G1YA 5TDNB 2BWDA 3LQAC 4MNQE 3S37X 3M1BA 4ODSH 3PL6D 1AD9A 2VJ8A 4H2AA 1NBZB 2Y24A 1XXFC 3VXUB 1RUPH 3STZB 3W2DL 4B9GA 5FW6A 4PRIA 4WI0B 2F8VA 3FMGL 3KPNA 1YMMA 1WBYB 5DHEA 4Z7OF 4QXVA 1KBGL 2DEWX 3I6KA 3W2DH 1CDHA 4WZ9A 3FMGH 4BWWA 2RJMA 5J1SC 2WZ0A 4TUOA 1GVIA 2BVYA 1NGWA 4Y9GA 1XGTA 2PCYA 5JIHA 1KBGH 3P3SA 4PQXA 1KNOA 2B3RA 2FBOJ 3QNYA 1Y18B 1II4E 3HLAB 4LHUA 4B27A 4QAMB 3UX9B 2BJML 4CW1B 1J0KA 1ZGLB 4LCIL 4OLZL 1A3QA 4XN1A 4LLAA 3WDJA 3RWHA 4PSPA 3OD3A 2BJMH 3ROLB 3CVHA 3TO2A 1X4YA 4PPTA 2ICWB 2JB6A 4JHBA 4LCIH 4OLZH 2QZ5A 5E5MB 1A7BA 1M7IA 5IJKC 4WJ5A 2H1XA 2NXZB 4N3TA 1WTGT 4RBPH 3GYRA 1IAIL 1Z9PA 4L8DA 4TLUA 5DJYB 5E6IC 1QA9B 3PGFL 2OTUB 2BNQB 3O2VL 1SQMA 5IIEA 4E9VA 3EH1A 5KYUB 1IAIH 5I18L 2X3BA 1KTLA 3PGFH 4KXZI 2Q86A 3O2VH 3Q8EA 3JWNC 5DHVA 2ZX9A 4D0BB 4Y2DD 2NUTB 2JKNA 3SQOL 1ID2A 4OVVA 4GKOA 2ZX8A 5AVTB 5I18H 3RP1A 4Q8BA 2AITA 2YQ3A 3SQOH 3GO1L 2J2ZB 3BQUB 4Z95L 2OR8A 1CXEA 5C0BD 5GQBA 2EKSB 2EH7L 1KLFA 1TJMA 3O9WC 5KS9A 4XVUD 4GAYA 3GO1H 2ZXBA 3BPCB 4ZUVA 4QO1B 4ZQTA 4Z95H 3GI8L 2WXJA 4J4PD 2EE2A 4N1EA 5IMLA 1O9ZA 2EH7H 3UAJD 3K81A 4PIRF 3MRGB 3NIFB 3GI8H 2WCPA 5DD0L 4HMEA 1U95A 1XIWA 4NPYB 3EBGA 4PJ8A 1T7YA 4GBXD 5BQ7B 3ZYIA 1TQSA 3VDCA 4HHAA 4LGRB 5DD0H 1NIFA 4DERA 4GB9A 3U82B 3PXJA 2RAMA 2Z35A 2Y7OA 4H1LG 2YZ8A 3LKSA 1DJZA 1U3HD 3ULAB 2GJZA 1LEIB 1ZS8A 3LPOA 5CNHA 2YPLA 1Z5YD 1ZAGA 1NZRA 3MBED 4KTDL 2V5SA 3F8UB 4BUHA 5IOPA 2AQ1A 4LARL 2APWA 2BWIA 3IRCA 3O6KL 4Z77A 1BZ7A 1ZSHA 5EB9A 4ZX3A 4XZUA 5AVRB 1KPVA 4KTDH 2NRDA 2YAMA 1QTPA 4EIUA 3ZO9A 2NY1C 4BXSV 1R5IB 3SQBB 3VFOA 2D3LA 3O6KH 3FO1B 5C2UB 4BQBA 2F08A 3CFJA 3LRMA 4JFDE 5ELIA 3UO8B 8FABA 4I0PD 3C5ZB 1XTLA 3MLSL 4D0CB 2JI2A 3CHXA 4Z7OB 3ABMB 3BSZL 4IKNA 6TAAA 1H3GA 4NXSA 3GBLA 2H3NB 5FYLE 5I1JL 3LRKA 3MLSH 1OLLA 2DMCA 3CQQA 2R29L 3BPNB 1E4KA 2IFGA 3BSZH 3QUGA 4XI5D 4HZAA 4G7SB 1GCFA 4L9LC 4QKXB 1NAMA 5DEFA 2OXGB 5I1JH 3BVVA 2FEDD 3STBA 3NUKA 2JKTM 1XT5A 2R29H 5E5LA 3QQ9D 1GJUA 3N1MC 2X4RA 3VI4F 1JVLA 1OB1A 1DVUA 1EZUA 3CSYB 1V3JA 2IH3A 2ODIA 2B20A 2XNAB 4LVNC 1J8HE 4YHIB 5DMIL 1RL1A 5I16A 3MI6A 2EC9T 5G4MA 2K6ZA 1CE6A 3L81A 3EYOB 1RJLB 1U8QB 3S2CA 4XPHL 1T5WB 1J9CT 5DMIH 3IGAB 4HJUA 5AQ0A 1MCOL 3B2DC 3LXCA 4MJJA 4YBQC 1J10A 3WXWL 1YPZF 3LS4L 4XPHH 5TD4A 4JAMA 3FNKA 4QNPE 2HVKA 3MRNA 2FQGA 1MCOH 2ZX5A 3MJGX 5K69A 2R0KL 4FA7B 4X6CA 3WXWH 3LS4H 1N7ML 1EFQA 3BUYB 1WFMA 4HK0B 1U91B 4G9DB 4JFEE 2DKMA 4GI8A 2OK0L 2R0KH 5CGMA 3KPSA 1HN1A 2VDLL 3GFUA 1LYQA 1N7MH 5CEYA 4ZW8A 5C0DB 1OAKL 4M9OA 1HHHA 1KENL 4A6YL 4IHBA 3NJJA 3IWUA 5F7MC 2OK0H 2GIXA 1T20A 1YDPB 2VDLH 2CBMA 4GUCA 4MVBD 4NQCD 4Z7VF 4XMUA 1OAKH 3EOAB 4A6YH 5F9JB 1CD1A 1KENH 3PWLB 5TDNA 3AJ7A 1FVEA 3K3QA 3ZZ1A 3F85A 4NCC2 5TF1L 1Z9MA 2OCCB 3IE9A 4MQ7B 5C07A 1FFTB 4HX1A 3QJOA 5DJ2B 3U4EA 1MNNA 3K0YA 4MZIA 4JY5L 1PKQB 1UZ8A 4Q2ZA 2CRZA 5T3ZE 1A1OA 4PGEA 2HJLB 2IGTA 2UX7A 5TF1H 4BQ8A 5EFIB 4UQBA 3MV01 1ZHLA 2IXQA 2VWEE 3GS4A 4JY5H 3TBYA 4O2FB 3PG2A 3UBFA 4I0KA 1CG9B 3MRJA 1IC1A 4YFDB 2QLVB 4PRPD 1NWOA 8CGTA 3UZEA 1WFTA 3DVNB 4NJ9L 4I1RA 4H7VA 5DCCA 2VMEA 2ZYRA 3D3VA 4Z7UF 3T0EC 5AW1B 1Z9SB 4DP6X 3C2AL 4NJ9H 3CDGA 5GGRY 4BZ1A 4XCFL 3FB8B 3HE7B 2XKNA 4CSZA 5CEXA 3RDTC 1DJXA 3CFEA 2Z1KA 5LNGA 2MQCA 1RZ7L 3C2AH 2VDOL 2EQDA 2DQMA 4LZKA 5IMKB 4XCFH 1PZ2A 5IW6B 4EDXA 4C59B 1V55B 3U7YL 2YC1B 3LVEA 1DCEA 3D39B 5D2NC 2CIKB 3U83A 3VFWA 3VGBA 1RZ7H 4TQ8A 4BQCA 2VDOH 3US9A 3CFMA 1RP8A 3IBOA 2J6EA 3N1PC 3PL6A 4GQPH 3U7YH 2VTFA 2GJ6D 5FFLA 3CZLA 1FRGL 2WWMD 2D31B 1EGJL 2PW1A 4MXQC 2QSQA 2HG5B 1JZFA 4NGHL 2WWKO 1BQHA 1NFIA 1E7VA 3TH2T 1IAOB 3BRDA 1FRGH 4YAQB 1EGJH 1QHQA 1M57B 2PTTB 5GGSA 3VD3A 4WV1C 4NGHH 1PFOA 4L29A 4NO0B 1F0LA 2PWDA 3VI4B 3D08A 4BSVB 4X83A 3V9CA 1UWXH 3MNVB 3GMLA 3NSXA 1S7WA 2B4CC 4G5AA 4FXGA 4BSJA 2DPKA 3FSVA 5L6YL 1AQHA 3C6SA 1QAWA 1XCQB 3KL3A 4B9KC 3QP3A 4XNDA 4N0FB 1E50A 3KDMB 3D33A 2OMVA 3WL9A 3PHAA 2C3HA 1KCRL 4HSQA 3OMIB 4QPEA 2EE9A 5L6YH 1FL5B 2UZXB 3CFIC 1YEWA 2WW8A 5DJ6B 5DJXA 2NXYD 2VLRB 3KYMA 2WLYA 1KCRH 3GQFA 1DJGA 1YPZB 4J8QA 4R83A 1M7DB 4MJ5A 4BKSC 3ARBB 1YEDA 3U4BL 4GG8B 4G7QB 5EUOE 4HKZB 4YHYB 1QBBA 4XRCA 3GJFK 4LDOB 4D0DA 3WY2A 4ODVL 4KJWD 4X4ME 2X4SB 2Q8BL 2V5YA 4Y2DA 2BIPA 3LRSB 3PJNA 1HI6A 4Q6KA 5GRVK 4E42A 3D85D 5DZAA 1B90A 4ODVH 3U6XS 4KV5E 4FJZA 4HDIA 4XMZA 5KBMA 4Z7VB 4YR6B 4ZW7A 2Q8BH 3P3UA 4Y16A 2D7PA 2D73A 5DO8A 1R5IA 2I7SA 3TBCA 2X1XR 2D2CC 5H37A 5C0BA 4ETYA 1A4JA 5KZCB 1PZUB 2A9CA 2MHAA 3CZNA 1I75A 3FO2A 1MUJA 4D0CA 1EHKB 2AXFA 5DR5L 4EVNA 5JDJA 3RX8A 4J4PA 3CWGA 2EE3A 1MLCB 2ZZUT 4PRDA 1OP5H 3UAJA 3VXSB 1QFHA 4FQQA 5DR5H 2NNAB 5EBLA 1BJ8A 2Z8RA 2XG5A 3HR5A 1DZ0A 5DQJA 2V6HA 4NO3A 3UL4A 5M7QA 3JYBA 1FHNA 4XNZC 4IGBB 1D5ZB 4RMUA 3GMRB 3IJYA 3U7AA 1AE6L 3UPRA 4O51B 2H2PC 1GCYA 1BVLA 3GIZL 4Z7UB 4MA3A 5TTRA 3BUBA 5HYJE 2VIRB 1AE6H 4V1DA 3P9LB 1IFGA 3AU0A 5BZWA 2QV2A 3ARGD 1KTBA 3DX9B 3V5KB 2ID5A 3C5SB 3GIZH 3V0HA 3MNMA 4QLRA 5F9WB 4TNVK 1ZPUA 2B1AL 3MBEA 4JRXA 2E4TA 3U0TB 1HNFA 3KNBB 1GGIL 1ETZA 3QQXA 1CXIA 4NSKA 3TBWA 1AGCA 3G5YA 1EHAA 3WD5L 5ABDE 4AH2A 1HK6A 3U46B 2ARJA 2B1AH 3IDNB 3S36L 2E47A 4N9GB 5L2KD 4LCCA 1Z2KA 3EAKA 2CALA 5C08D 1GGIH 4GUPA 5F71A 5IGXL 2K1MA 3SDCD 2HKHL 2Z4QA 3WD5H 3E0GA 4B9JA 1E0OB 4A7UA 1RPUA 4U1GC 3S36H 3DVIA 1QUNB 3WIHL 4PJ9C 3W81A 5E9DD 2AJVL 4I0PA 1X5GA 4JO2L 4IU3A 5IGXH 1Q0YL 1WAAA 2HKHH 3QQNA 4O02L 4H8UA 2NW2B 3K91A 1JPGA 2XYCA 3WIHH 2D9QB 2AJVH 3LJ3A 1Y0LA 4JO2H 1TSHA 4LKXB 1Q0YH 1PEWA 3MV7A 5E8OA 5EBMB 4Z3HA 4O02H 4PV1C 3O3BB 2VKWA 4F3FB 1QI3A 2OI9C 2IPUK 4PP2A 5M94B 1SJEA 2IADB 5IV2A 3EGXB 3GB7A 2F58L 4GKSB 1MFEL 2A2QT 3WKYA 1JZ2A 1P1ZB 4NC2B 1ZLUK 2FJUB 2F58H 1NCBL 1GKEA 1MFEH 1ZT4B 3RVXC 2NNRA 4LRNL 3LKPB 4DGUA 4QRPA 1V8HA 1HX0A 1DEDA 1NCBH 1Q9OB 2OX5B 2FDBP 3CU7A 2CCVA 2JLLA 4GT7A 2ITCA 2EEAA 5I1GL 2Y3NA 4LRNH 5DVNA 5GRUL 4IHOB 4FOMA 4FULA 2ARJQ 1TQBC 2ZOWA 3NN8A 3U25A 4AC2A 4NDMA 4F37F 5I1GH 5GRUH 3F12A 1SJMA 3PJSB 2J12B 2UXGA 4IDJL 5EA0L 4K07A 4HA1A 2E8YA 2VJ0A 4RFOL 4BDVA 4AIOA 5IFHL 3RFZC 4OB5L 3UTQB 4HFWB 1OHQA 3MX0B 2WKGA 4IDJH 1KTDB 5EA0H 2NY5L 1AOHA 6PCYA 4H20L 2GTZB 5J13B 4RFOH 5IFHH 4TOYH 3FOLA 4OB5H 3AC0A 3PNWA 2Z9TA 4YHML 3ARFC 2NY5H 4NN7C 3M17A 4LL4A 2ZQKA 4H20H 1I7RB 5FXCH 4ZFZB 3H7BB 43C9A 1PLBA 1NCWH 5GRXG 2UXTA 3KLDA 4NQCA 5A3ID 4YHMH 1HXYB 3EO0B 2H9GB 4GKZB 5KN5B 1UATA 4K5NA 2LR4A 3GS0A 5EO0B 4WUUE 4LPWA 5TFSL 4AVIA 3LKRB 5I8CB 3P0VL 2EDRA 3APMA 3KWUA 4ZX6A 4NHCL 3LV3B 2HG5A 2WY3B 5TFSH 2IANE 3P0VH 5HPOA 4KNQA 4HSCX 3QULA 4NHCH 5DC9B 3ZDXE 2MFNA 3D25B 4XMXA 5AB9A 4PCTA 3UTZB 3ZUCA 1I7UB 3BWSA 5DTFB 4NO0A 1XB8A 4GIAA 3WIFB 3RVVC 3O2WL 4G9FA 3FF7A 2WXLA 4OF0A 4A2MA 1BPVA 5DJ8B 4H88H 4Z3FA 1B6UA 4RAUB 1IEHA 3MV9D 2NY2C 2O4EA 4J6IA 3O2WH 4R2GD 3MRLB 1AXSB 1UYWL 2BVTA 4L1SA 3NP3A 2Y22A 2B3IA 4FQXA 4TLTA 3N5AA 1N64L 2J88L 2KI6A 3B2VL 5DJ6A 5B39B 5JHDD 1UYWH 3QIUC 3HE6D 4QTHA 5GS0C 4LP4A 4JHZA 4PJBA 2WIIA 4AJ0A 2H6UA 5FA3A 2WZPD 2OYKA 3AG3B 3OGOE 3CVDA 1N64H 2J88H 3B2VH 4F5CA 4HIQA 3TVMC 3HEIB 3EG9B 3N85L 1MZYA 2E75C 5J11B 1AD0B 4M56A 1O5DT 1KWGA 1BCIA 4UTAL 5GGTL 3CFCL 4XHJC 3HAEH 3N85H 3IFOA 4AIEA 3M6DA 1Y6MR 2BP3A 4DETA 4HZ1A 2GJ6A 1E8WA 5E1GA 4UTAH 5GGTH 1WFUA 2DKSA 3CFCH 2BMKB 3DV4A 2XSKA 3MJ8A 3GXMA 2Z31D 4WJG3 1UM6L 3II2A 4NO2B 1HSBB 1HCYA 1KDJA 1S78C 5CJOL 5C0GA 4YPGA 3DJTA 4PWFA 4LOVA 1LHZA 4KRPC 1UM6H 3WLWC 3CSBA 1N5AA 1ERNA 3H7LA 3FUJA 5FV2A 4HKXB 4I77L 2IOOA 3CU1A 3FTGB 4R0LB 5CJOH 2Q5BA 3DX8B 1S8DA 4ODUB 1EAPB 3BVNA 1LM8V 3WFHA 1NCOA 2YPVL 5LXVA 4I77H 4M61A 4K5MA 4TV3A 5CJ5A 1LP9F 3H9SD 2AHIA 5HDQL 2LHAA 3BEWA 4OI7A 4B97A 4L23A 3OZKA 2J8UE 1BXAA 4FQJL 4HEPA 4IKLA 1R5WA 4U49A 5HDQH 3E2HB 5JORA 1B4TA 2FJFB 3MUJA 3SDXA 3REVB 4WNSA 4P3DA 4LNVA 3PAZA 4OZHF 4FQJH 4X7FC 3HW7A 5ADOL 2R1XB 3DX9A 3DTXA 2QQNL 4NOFA 3H6AA 3UH8A 1HU8A 2FT7A 3L08A 1B0GB 3SCMB 5J56B 5ADOH 4GW1A 5DJDB 5DUML 2QQNH 4OCRL 5B8CA 5E00A 4ATWA 4YDMA 4HCRA 5MP6L 1JHKL 1ZKAA 3NPSC 2VERA 5GZOD 3S97C 5DUMH 4OCRH 3ZKXC 3LZFL 4BKLB 1UZGA 2M8XA 5MP6H 1JHKH 2J43A 4ZSOB 5IQ7L 5LJYH 4S1DC 2IH1B 4X7TA 2Q76B 4AW4A 1ZE3H 3LZFH 3MO1A 1ZT1B 3P4OB 3FTSA 3GHPA 1BA9A 3H0TB 5FGBC 3GRWL 5FM8A 3GMOA 1FFNB 2EYRB 2R1YB 3II1A 3NZSA 2AXHA 3IMUA 4NHUA 4HZLA 2HRGA 2FL5A 4S2SB 2ED6A 1MI5B 4XP9L 4U1IA 2Q10A 1LK2B 2XG4B 4QRRB 1EO8L 3GDCA 3GRWH 4MX7B 4ZMQA 1WJ3A 1QSEB 1TVDA 3V5DA 3QDAA 1AZUA 1G5AA 2AV1B 4JB9L 4XP9H 3DO3A 3CNKA 3V8OA 4HFUL 4XVJL 2CKBL 1EO8H 4JFPB 1AR2A 5D93C 4W9HC 2J56A 4JY6B 3FN9A 3V0VB 2F8XC 4YIQB 4JB9H 3C5JA 1HH6B 4HFUH 4XVJH 1MXGA 4PY8I 2CKBH 4Y2OA 2ENJA 4H26B 3BQVA 4QY8B 3I02A 1ZK5A 3B2UC 3TO4C 2YEZA 1VIWA 1D6EA 2NY3D 4J3SA 5ESQA 1E8YA 1SJHB 2I9TA 1X5ZA 2XWJA 1HCZA 3CSPA 3GK8L 4MZ2A 4A7TA 1XQ4A 3PWVB 1JF5A 3WN5B 2IPKA 4H5SB 3M7FB 1TTFA 3BSHA 5F6HI 3GK8H 5L2KA 5C08A 2KL6A 5DQ9B 3EF4A 2YD0A 3V2AR 5L8LB 4JO8A 3WFDL 4KPHL 3SIKA 5LBVA 1KELL 3L9BA 1MHEB 5D5MF 2CJTA 4Y5VC 4DCQA 5I6NA 4M7LT 1KJVA 4C56D 4E0RA 3WFDH 2VDKL 2H2SD 4KPHH 4P8QA 1KELH 2HPTA 5D6DA 5F44A 4JZNB 3EBAA 1DO6A 4NQTA 4JFOB 3QUML 2VDKH 3OKNB 4KZEH 1MCLA 1I53A 2IEPA 4M3HA 4C47A 4OH2A 5I1AA 1T21B 2CRIA 3VWKD 1A6UL 3JTSB 2A0LC 4YDVA 2WAHA 1DUYB 2ZE0A 3ULVE 3QUMH 3X11B 4WO4C 2X4UA 3D5OF 4ZG1A 1GS7A 2VUOA 4KXBA 1A6UH 5FIEA 4HWNA 3FOMA 1SDYA 2YAHA 1LP9B 3PWPB 1IZKA 1KZQA 3D52A 4AY0A 5EEYA 5FHAL 5FM5O 4JEGB 4GMSL 4LBEB 1NIBA 2G0KA 1WT5A 1C5BL 2W60B 4LSVL 1Q9WA 5DMJB 9PCYA 2XN0A 5F7NC 3EJJX 1CFNA 1T0NA 5FHAH 1FN4B 3HI1B 1A9BA 1JERA 4F8TA 4QJ4B 4GMSH 1C5BH 4LSVH 4DVBA 5C0EA 1RJZB 4OZHB 4WJKB 5IMMB 3TPKA 3PWUA 1DSYA 3BSGA 4RNRA 4CC4A 1TEGA 3O11B 3PWNB 1LEGB 3EW3B 1UASA 3PJLA 4LCUA 1RHHB 4GAFB 4QTIL 3SPVB 4K7PY 5F89B 5F3BA 1AKJB 4JFXA 3P02A 3PP4L 4M7ZC 5GS2D 5T1KD 3ZLQC 1XF2A 3AB0C 3TCTA 1OF0A 4AENB 4QTIH 1A6AB 3QS3A 5AW7B 2W0KA 3FT0A 3R4DA 1JZ4A 1T0MB 4NQXB 1Q9KA 2WXPA 5C09D 3PP4H 3K6FA 1FDLL 3DX6B 2JLPA 4LVOC 2IFFL 4RAHA 3EG9A 2I7OA 1T2QL 4LGPB 1SHMA 3BH8B 4XN9A 1U58B 3MR9A 3KWTA 1H15B 1FGNL 1FDLH 1GGTA 5CCHE 4HSAC 2C1PA 2IFFH 5C0FA 1T2QH 3RWIA 2HUHA 2J4WL 4JO3L 4LGSB 3OV6A 1FGNH 5HHPA 3KW7A 2AS5M 5DVMA 1M71B 2N1KA 1CU4L 4I2XA 4A37A 3QNZA 2J4WH 4JO3H 3UYOD 4AW7A 4CN1A 2Y2YA 3FUIA 1I8MA 2RA1A 4TMPA 5AW6B 4ODTL 4I18C 3TN0B 3V0JA 4HV8A 1G84A 1CU4H 1YN7B 3N40P 5EBWB 2MMXA 1UUSA 1JWUB 4ODTH 3O3DA 3BP4B 4XNXL 5E5RB 2WXHA 1DQVA 5F97E 3RTLA 4ODUA 2IQAA 4AYMC 2F7QA 4J3UA 2FZ3B 5D7KD 4XNXH 1JK9A 4P5KA 3V4VL 3RGVD 3IDXL 3H85A 5JHDA 4AXWB 4NIKB 3QH3B 3I9IA 4NENB 4PWKA 4YDIL 5FDWA 4G6JL 3UOAB 4RGNB 3OTTA 3VG0L 3CFKA 3V4VH 4Q74A 2WZPA 3F7PC 3IDXH 4PCYA 5FB8A 1EXUA 4W9IC 4P4KA 5L88L 3X12B 5D5MB 4ZFQA 4YDIH 4G6JH 2GFBB 2H3KA 1IC7L 5DVLA 3VG0H 4LDLB 4I1PA 1I7TB 2CHNA 2EDBA 1MIEL 3SD2A 3T08A 5FECB 3VXUE 2LTQB 2BW4A 4WHTA 3QIBB 2W94A 1KC5L 4P04A 3TH4T 4DQAA 1WVZA 2FWLB 1IC7H 4CNIA 1MIEH 4X4ZA 5FA4A 3T6VA 5ICYA 3KAAA 2ENYA 2XPZA 5ALCL 4AEEA 4Z0XB 5CKAA 1KC5H 2VDML 2Y1AA 2ZCZA 2Z31A 4MD4A 3W0WD 2Q6WB 3HHRB 3KEHA 4MXWL 1JPSL 1MH5B 3BZDA 5ALCH 2X6BA 1G7QB 2HRPL 1VB9A 4DOHB 2VDMH 2Y36L 4M03A 5AW4B 3REWB 5KVFE 4L1HA 4UZGA 4E9XA 2Q76A 3V7MA 4DP7X 4MXWH 2PWHA 1JPSH 3ULUF 2AK4D 5K5YA 2HRPH 3B5GA 3DIDA 3D3VE 2Y36H 3V6OA 4EUPB 3F58L 4PG2C 4PIBA 4PV8B 3O2DL 1VFMA 2F7PA 4LEBA 2JXMA 4OFIA 3F58H 2QPEB 1WUNT 2GK0B 1U0QA 3O2DH 5AW9B 1OK8A 5FYJD 2BHFA 2FO8A 2UWEA 1CLCA 3LB6D 1CBJA 1Q94B 2GI7A 2PF6A 3VG9C 1IUZA 5C0ND 2BNQE 4JY6A 4OTXL 2X2UA 1OT1A 1GZHA 2PPCA 5GZND 5IK3A 3EFOB 4I13B 1N59B 4DH2A 4OTXH 1TYRA 4YEEA 3X1FA 2W38A 1Z5HA 2Z3FA 3QR0A 3D4ZA 4UDTB 4L37A 5JA8B 3L2NA 2PCXA 3MFFB 3DGCR 4U05A 3MZTA 5EF2A 3WLBB 1K3IA 1JDCA 1UOVA 1YNTA 3GBEA 3WJMB 3X14B 3K1DA 1P7KA 5BCAA 2A77L 3QDGD 5GZOA 3IMSA 3NRQA 2LAAA 3V4PB 4O00A 3JTTB 4BK8A 4CKVX 3OKEB 2VLME 1K5WA 5FW8A 2A77H 1JK8A 2BNRD 2KS0A 4OF5A 1E3FA 2P8PA 4TVPD 3FFDB 1FG2B 4KQ4L 1OGTB 4XNYL 2EIZB 3DUUB 2I32A 3NIFE 5HYQB 2R4SL 2ZF8A 1U3ZA 2G2RA 4WWNA 2Y5EA 2I5YL 3QE5A 2X6MA 4KQ4H 2YQBA 4XNYH 1U8OA 2BP0A 3RBSA 5IB4A 2R4SH 2NT1A 3ESUF 2UUDH 4R3SB 1AS7A 1W72A 4KKCD 2I5YH 4UQDA 2LV4A 1I3UA 4R4ND 4LLMB 3EJTA 2WB1A 4F1SA 2PCFB 4PJAA 2Q3AA 1U92B 5CAYB 3G5XB 1UXSA 4XN7A 1U41A 4YBLC 4GYBA 1XDTT 1XTMA 2OMTB 1CR9L 1WLHA 4Z7IA 2DYRB 3KPRB 3QRLA 5D70L 4F24A 4MQXD 2C9UA 2FRGP 3BW9A 1CR9H 2F61A 2YA0A 4K3GA 5D1ZB 5D70H 3PREA 3H55A 3TC9A 3SDDB 5IFAL 2QKIA 1I3VA 1T04A 1EUUA 4HU8A 3UJIL 2AXWA 4L5FL 1ACYL 4AYDC 4Q97A 1A5FL 1A9VA 5IFAH 2IV8A 3LNEA 4HJGB 4E68A 1S7RA 2CM5A 4ONFL 3UJIH 2K6YA 4AKPA 3LQZA 1GZQA 1ACYH 4L5FH 4DKEL 2A83A 1A5FH 4NNYB 2PW2B 4N6RB 5TJWK 3HR6A 1AKJA 1R33A 2DYPB 4C56A 2K6WA 1NGPL 4UT9L 2VO5A 3CZFA 4ODWB 5FLUA 2XVGA 4ONFH 2APFA 2Y7SA 3GJFB 5I75C 3BO8A 4DKEH 3QUHA 4OGZA 1NGPH 5F96L 1FNGB 1TPXB 3N0AA 1IIIA 1PNCA 4UZSA 4HXBL 1OSZB 3VWKA 1BLNB 4XAKD 2VW4A 1AP2A 5EU6B 5KVDE 5SWZB 4EO5A 3Q8BA 2BP8A 4GKLA 4Q9BA 5F96H 3TONA 3FAWA 1R3JA 4HXBH 2WYIA 5EOTB 2A6DB 1CXFA 2VE6B 5HYEA 1FHGA 3TEWA 5GJTL 3FT2A 1U8MB 3QUYB 4A68A 3OR7B 1N0XL 5E8DL 4Z7WF 1ZRUA 4JRXE 1PCXA 2YO3A 3EJUA 5GSVA 4ZTEA 4G8IA 5J1AB 5E2JA 5GJTH 3GSWB 2UZYB 5DJ0A 1N0XH 4FXKB 5E8DH 5BMFL 1MFUA 1XIWC 4Q9QL 3C60D 2XPGB 2YBRB 4PJ8C 2L7JA 1ZLWK 4JY4A 2AXGA 4J3VA 5BMFH 3U1QA 4Q9QH 1D5BA 2OCJA 5KJRL 2V5RA 1WAAE 4U6XB 3S36X 5HJDA 2EACA 4HWUA 5HI4D 5T1KA 5KJRH 1E4HA 5JQHC 3ZTJH 4KI5F 3FCTA 3BH9A 4OLYL 1S9WB 4YDLC 1JZEA 5HHQA 3ILPA 3PS6A 1J7VR 1UM5L 2K0RA 5C09A 3VFUB 4HIIA 1VGEL 3GMQB 4P23B 4YSCA 4JM0A 1UVQA 5E7BA 1MQ8A 1RUML 3DJRA 4OLYH 3ZKSD 3T04D 3AGVA 1UM5H 1CLYL 4OUUB 3SGKA 4IBQA 3LZNA 1VGEH 3V0DA 2B0SL 1R5VB 1XGUA 1RUMH 3I6SA 3Q8AA 2H45A 2OMUB 3N2JA 1P4BL 4ZUUA 3M45A 3L3IB 4PJDA 1CLYH 1PKQE 2CDFB 3H4FA 5E08L 4NN6B 4PFEA 2WXKA 2B0SH 4ZW6A 1EMTL 3FHEA 3BP7A 4GRWF 1RURL 1P4BH 3CZSA 2IDCA 4N2AA 3OXRB 2GPZA 5T1JA 5DFWH 5E08H 1E4KC 4AJWA 1VGKB 4L2LA 2N56A 1EMTH 2V9UA 4MNHA 1RURH 1IM3D 5HGBA 1BWMA 1AYOA 1MHCB 5ETUA 4Y5XA 3T5WA 1FG9C 3B1TA 5A2KH 1CXLA 1F3JA 2RR3A 2Z8VC 1KGUA 4RMTA 2CHWA 1GJIA 2D3VA 5BOZG 1CUOA 3UZVA 3KBEA 1FYHB 2RFXB 2PPAA 3RGVA 1K4DB 2ZWZA 4KQ3L 4L3FA 1X7QB 4CILA 3HUJA 3GZQA 4DUWA 1KGCE 3VU1A 1IKFL 4U1LA 1U8LB 4KVNL 5IB5A 3D39E 4KQ3H 1NICA 3HLKA 1RVFL 2GHWB 4C58B 1VACB 1IKFH 1GYVA 3QUXD 4BA0A 4KVNH 2NYYD 5J06A 3APDA 1AXTL 1TO5A 1RVFH 5ERWA 1HEZA 1JGIA 5D9SB 4IOSD 5EN2A 2WO2B 4L8BB 1KIPA 4BUQA 1AXTH 3MRRA 4N8UA 5FX3A 5A2IH 3JWDC 3VI4E 1A7PL 3TBBA 3W0WA 3B3IB 4GT0A 4YHNB 3C6LB 2KLRA 2DLFL 5LAXB 1ZHKA 2OMXB 4KRLB 1E6OL 4OCMC 3QC5X 1A7PH 5JMOC 3BD3A 4AZ8B 3N91A 1QW8A 5BS0B 5DEGB 1P6AB 1SEBB 1XH3B 2DLFH 2VH5L 4PJIF 4Z7WB 1K72A 1WISA 3VD2A 4BA8A 3NJNA 1E6OH 3ARDD 1EDQA 2VH5H 2VLRE 3AS0A 4Q9CA 5SWQA 2EXYD 1UD6A 5I30L 1YPZE 4PJBE 3TCXA 4ZW3A 2YGOA 3QQ4B 3GM8A 3UDWA 2I07A 1C5DA 4QYAA 3DBXB 1IBGL 2IAMB 4F5CE 5LKNA 4A38A 3JV4B 1GC1L 5I30H 5DDHB 2R56L 5HHOD 3O41A 3KH4A 1IBGH 3WHXA 2WMPB 4RFEB 4FNUA 3ZBMA 3FHQA 1A4KB 1GC1H 3UZEC 2R56H 4GRMB 5CEZL 4I5BA 1Q0XH 2Y25A 4HWBA 1FNHA 2WSKA 4YPJA 4GRLB 2JJUA 5DJZB 4NT6B 2DJSA 3V95A 1EO5A 1SNRA 3EYFA 3HS0B 1YMHB 1MWAA 3P73B 4QJ3B 4E9WA 1F97A 2NCMA 4Z7VE 5CEZH 4RRPG 3A5VA 2OTWA 4N9OB 5KYWB 4PJFF 4APQD 3ILEA 1QNIA 4UF7C 4D9QE 1E5CA 4RFNC 1CDIA 5GSRA 1S7SA 3HHSB 4ZD3L 5A16B 3X1NA 4NQSA 2FHBA 3PHQB 3QDGA 4JREB 4K9EL 3OKMB 1NCIA 4I4WA 1RZJC 1FJ1B 4UAOC 2ADGB 1CIUA 3CK0L 4ZD3H 1H9VA 5TH2A 1CVRA 2BNRA 2C3VA 3ZE0E 4K9EH 2RGSA 5DUJA 4L8CA 1LMIA 4MAYD 4GRWB 1N9PA 2CXKA 3PL6C 4O2CA 1I8KA 1OGSA 2H5UA 3CK0H 4LLVA 5IB1A 5FYLL 1T1XB 2I85A 3A67L 5HYSB 5GJSL 3HBZA 4FYQA 1CICD 4L4VB 4OAWB 5C6WH 1JD7A 2H1PL 5FYLH 3HZMB 3RUGF 1BLNA 3A67H 5GJSH 3FQ1A 4ZFFA 5C1MB 4ZAKD 3CC5B 2E9BA 2YRPA 3ES6B 4FE9A 4NQQA 4UV4L 4OGYL 4Z7UE 1JXFA 3KLHD 2QR0B 2CJ3A 2H1PH 1AZCA 4KJQD 4NFCA 1SJXA 2MJWA 2VJXA 2A6DA 4FXGC 2RB8A 4LAJH 4W9DC 2G5BB 4UV4H 2VR8A 3VSVA 3WFEL 3X3GL 4IBVA 1SDDB 5JDSB 1NJ9B 3TFKC 4PW4A 2HKFL 4U1MB 3SKUD 4JQXA 5HVGB 3G5VA 1UFUA 3H42L 3WFEH 3X3GH 3GWJA 4PG9B 2O6CA 2BY0A 1A66A 4LCWB 4Y9FA 5F1NA 4W9FC 2DQTL 1A1MB 4D9RD 2HKFH 3VSTA 3GBDA 4ELKB 1F58L 3H42H 2DM4A 4G8EB 4NRZA 1L0XA 1TIUA 1CWVA 1R3HA 1WTLA 2XQYA 3QAZC 4EN3A 3QUZA 2DQTH 2BLFA 4GG6A 4DZBA 1V27A 1F58H 4APXA 5B39G 5DMKA 1IVTA 1KULA 4OD2B 5CR1A 4RIRB 4JFFD 1U8CB 1EVTC 1QFOA 4OGXL 1IM9D 3V5HB 4BFBD 1TU2A 3NCJL 2ZPKL 4Y2DC 3B1UA 1FVCB 4JUTA 4KK6D 2IBZY 4OGXH 3FQ4A 1I85A 3ZIMA 32C2A 4EPSA 4DSYA 2ZPKH 5DRNB 1OALA 4XGZB 4Y16C 2BOBA 2R69L 4PJIB 5C0CB 2LABA 3TYFB 4G80B 4WHYG 1SXCA 4I88A 5IR1A 1F11B 2YMOA 4LVHC 4OCLC 2R69H 1KJ2B 4XTRC 2CUHA 4P49A 4G6ML 5CWSB 4J4PC 1LWHA 3I6GB 3K8LA 2DQCH 5T3ZL 3UAJC 4J1UB 1X7TA 4H1LH 4ZUSB 4S0TD 1KN2L 1P5UA 3AADB 5LG6A 3UMNA 2EDXA 3MUGB 4G6MH 4O4YL 3NJXA 5T3ZH 2VDRH 3US0A 2FT8A 3C60A 4PI0A 5B3NA 1KN2H 1XAKA 3ASWA 1G9MC 1X5IA 4O4YH 4AUJA 4RDBA 1I7ZA 5DRXB 5DZPA 1FFQA 2YD6A 5IMOA 4ILDA 2WYTA 3G08A 5ISZD 1YA5A 3QI9D 1OAJA 2JJTA 5CLZA 1NGZB 2TSBA 1NPNA 4PJFB 1OO2A 3LZPA 4BHUI 5L8KB 1ZTXE 1BD2B 3MBEC 3OXSB 1EJ6A 1XH2A 2BY3A 5B38B 1VKXB 3CZJA 2VDNL 2ITDA 5J12B 4UZUA 4XB3A 3T2LA 3RWDA 1OLZA 5MEPA 1VENA 2VW6A 3F83A 5LG1A 5BZDA 4LCCC 2NY0C 1M05B 1KIRA 4Y88A 1GZPB 4P5TD 2VDNH 5C0JB 1CI5A 3ARVA 3NESA 4DKFL 1J1OL 1ZJBA 2XV2A 1SEQL 1K2DB 1IIKA 4C4KT 4I0PC 3ARED 1HVXA 4LP8A 4PGJA 4XE5B 1O7DE 3KYOB 4DKFH 4JHAL 1J1OH 4IRJD 2ZUQB 1SEQH 3RUGB 2EABA 3ARSA 3B9EA 1O7VA 3A47A 1KXTA 1P84J 3QHFL 4JHAH 4YHNA 5CHNB 2C9AA 5L4MA 4XI5C 2W95A 3IJEB 4JZOB 3S96B 1PZAA 1C16A 3C08L 3NA9L 1CL7H 1IM3A 3IE4A 3K7UA 4GBXB 2FEDC 4JM2A 4MFHA 3QHFH 1CB4A 1UEMA 2WOYA 3GSUA 4Y1AB 3NA9H 3C08H 4S0SD 5C6PB 3PF2A 3BIAX 1QNZL 4J3WA 1WA1X 5AKRA 1U3HB 2R7EA 5EZIL 4B95C 2EVGA 3BXNA 5JA9A 1HQRA 4HUUB 5DRZA 1E8ZA 1QNZH 4RGMC 4IU2A 4XAWL 4XP5L 4HBCL 5EZIH 3AAZB 1UH2A 4UQAA 4QHUA 3JT2A 1ZT7B 3X1GA 3HZYB 4U2YA 4XAWH 4XP5H 1SBSL 4HBCH 3WBDA 4ZO8A 2FUQA 4PGDB 5EH1A 3D2UD 2YLHA 2AK1L 2FWSA 3WTSA 1SBSH 2M26A 3IN2A 4MJ4A 1DQQA 1TMCB 1T5XA 5LO7A 1FL6B 5J6HB 4OQTL 4IOSA 3K4ZA 4JS7A 4I2XE 2BS9A 2AK1H 3L8QA 4YX2L 4AKQA 4N26A 3OB0H 5D96B 3FB7B 1TUPA 1UM4L 3OC8A 3EDJA 3VXRB 2EUXA 3VA2C 4C83B 3AXLB 5D7IF 3HHSA 5LVEA 4OQTH 2BNUB 2DEYX 4FG2A 2CDGA 1OAUL 4YX2H 2X87A 2DQ6A 5INDA 4JMXA 1IGTA 3POCA 1UM4H 3KCPB 3KYAA 3LOWA 5BJTA 1FJ1A 5TGBB 4IRZL 1EJFA 1AQ8A 1OAUH 2Z92A 2F5BL 2FX8L 4RAVB 1H6FA 3SBRA 1OKEA 1NFDF 3EDEA 4TL4A 43CAB 5C9JB 4IRZH 3ARDA 5K9QI 4GS7B 4JG9A 3E80A 2F5BH 2FX8H 5EU7E 2AANA 1AZBA 5BVJB 2B5IB 3MGTB 2BOCB 4RVBA 2VR7A 1TTRA 4IJ3B 5FGCB 2CLRA 3WS6A 5FKAA 2EVJA 2V7NA 5HHOA 4DGYL 2DLEA 3NJHA 3RB5A 4GY4A 1ZY9A 4H8VA 3JSSA 1NEZA 1VFOA 4DGYH 4F7EB 3VA6A 2IC2A 2UXFA 3RQ3A 1CZ8L 5AVSB 4X8XA 4LPXA 4R97C 4GLRH 1N2RA 4NQUA 2VAAA 4LCWA 4FQXC 3GC3A 1VFUA 2NY4D 1CZ8H 3AG1B 3ME0A 4APQA 2IALA 2V4LA 4AJVA 4MSWB 3D69A 3HG0A 4RGOH 1F2QA 4K3JL 4ZSOE 1OP3H 3O4LA 2GY7B 2ALWA 3VWJB 4HGWB 1QP1A 2HLAA 3JZYA 4K8RD 3TURA 2ZAGA 1KOAA 4K3JH 4KUCD 3ZL1A 3UZQA 1C12B 2XWBA 3FO0H 4K4KA 1KPUB 3L4VA 4MAYA 1DVXA 2V7HA 4B6ZA 1O9VA 1OCRB 1MI5E 1R1CA 4JG1L 4M00A 3VDBA 3UBGA 3WV0A 4QRRE 5FM5M 1GMEA 3NRPA 1F18A 3T6WA 3V52L 1QSEE 2VDQB 5KSUB 4N2LA 1A3LL 3ZRCC 4JG1H 1ETB1 4J28A 3V52H 3WY3A 1IE5A 3UBXB 2K9FB 1IT9L 1WZ1L 1HDMA 1TOXA 1A3LH 3TLRA 3IXTB 5FGRA 5E24E 4ONOA 3DO7A 1OSEA 4QXUL 3VE0B 2EKJA 1E9QB 2GAZB 1IT9H 5K39A 1WZ1H 3EOBB 4PRPB 2P24B 3ZHNA 3GXFA 3UTTA 4QXUH 4F15B 1WCQA 1K5NA 2BXZA 2CO6A 3MFGB 5I8KL 1G4MA 1QWHA 2BZCA 5DUPL 3F3HA 4QRUA 4YE4L 1QO3A 2GG1A 2PP9A 3BSZA 5I8KH 1NCDL 2HFFA 4TUJB 5DUPH 3S5YA 2ESVD 4NNXA 4YE4H 1PZ3A 3GSXA 4FTVB 5E99L 3B7YA 3I75B 1NCDH 4U1JB 1F5WA 1KLGB 4AWJC 5BV7C 3ZTDC 1IM9A 3INOA 2AJ3A 2H32B 4KJWC 5D7IB 4G2AA 5HYIA 1DQTA 3AY2A 5HDBF 4ZNEA 2AQ3A 5JHLL 5B8CC 1DVTA 3HBQA 2AVGA 3BZFB 3HCVA 3VJ6B 4PB0L 1RMFL 4P2OB 3FU9A 5FR3A 3IFNL 2XQ0A 4QWWD 5JHLH 3KH3A 3ALPA 2F9BT 1FV1A 1NINA 1NFDB 1LP9E 2CNYA 2LT9A 2XWRA 2IOIA 3PWPE 1DBKL 1RMFH 4PB0H 5AL0A 1TZIA 4WFHD 3IFNH 4NFBA 5JLZB 1IKOP 2M83A 1YJDL 2VABA 3QFDA 4PWEA 5CBEB 4EBQL 3BFWA 5KBDA 1DBKH 1GOHA 2JKLA 3SGEH 4W6XB 1PCSA 1DN0A 4AV4A 1YJDH 3S0PA 3VYOA 3OKOB 3FH5A 3IFPB 4EBQH 4OZHE 2NXYB 1SVBA 2XQYK 3IDYB 1EQWA 1EEZA 2Z7WA 5H4YA 1P5VB 2ZUUA 2VYRE 4Z5RB 4EUPG 3WE6A 4WFED 3IGKA 5DYOA 2ALAA 4H8HA 3QZNA 2GSIA 3LRLA 2BIOA 3QHZL 1NH6A 4X5WB 1DSWA 1QPPA 4LEEA 1T4WA 4A6YA 5I6XC 2WJ7A 1IGFL 5ISZA 3QI9A 4HWEL 3QHZH 4OLWL 3T8MA 4G8GD 4HUUA 2IG2L 4JDTL 3CX2A 3IJSB 1ZIAA 2WZ6A 2AKRB 4LNRA 1J86A 1WWCA 4FNSA 3MRPA 2H26A 3D85B 5KSAD 4OLWH 4HWEH 2WP3T 1YC8A 2IG2H 4JDTH 3U2SA 3DROA 2HG0A 3G04A 4E5XB 4GW4B 2J21A 2QLYA 4GKNA 5DEJA 1N8ZB 3TX4A 1X6LA 2DYSB 3QZMA 3K72A 1UXWA 2B2XL 3WS3B 4P5TA 4G70B 2LLLA 5D1QB 4N2KA 4KMLB 5EEUA 2F7IA 4HUWB 5FV1L 1YG9A 4YWGL 3P4NB 1XCXA 5T3XL 4ERSL 5CD5C 4DUXA 2DTSA 4IRJA 3TOPA 4M8QB 5FPIA 3II3A 5D6DC 1R3KB 1ZDQA 4YWGH 1OTUC 3FYEB 5F0PB 2O61B 5T3XH 2IMMA 4ERSH 4LL9A 1ESOA 3JUYA 2MTAA 4YFEA 4ZMTA 3FL7A 2BWQA 2XACC 4NI6A 1G9NL 3ET9F 4GSRA 3KWVA 2FT6A 2A4CA 3TBVB 1SXSA 4JRYA 1G9NH 1T3FA 4FRWA 4NQDD 3H4HA 2YQ2A 1K4CB 3B9KD 4RGNE 1WT5C 3GSQB 3FU7A 2KPNA 4M8VA 2OMYB 5D5ME 4U3SB 5I1LB 1EGJA 4L3EA 1FZKA 2TSAA 2OR7A 1NMBL 1RZGA 3FDWA 4E9TA 3PYCA 1LE9B 1BF8A 2VZVA 3ENEA 4CC4C 1E5ZA 3SDCB 1QR1A 1UWYA 4G43B 3D2UA 2Q7YB 3A6OA 4PY7B 5AB0A 5HDBB 5E9DB 2W80C 4GQ9L 4QHMB 3HA0A 3KLQA 2WIMA 3R18A 2W9DL 4UDUA 4GQ9H 5J9PA 4KVPA 4LK4A 4DOHE 1P2CA 2ATKB 4XO5A 1FSKB 2W9DH 3FCGA 2R2CA 2DM7A 4R4BB 1MVYA 2XFXB 1Y1UA 3IJ7A 4RMRA 4NLHA 5A3IC 2V37A 5JO5B 1KACB 4Q52A 1UQSA 1BQLL 3BWUF 1G7MA 3B6SB 5CIPH 1WCBA 1AJ7L 5CLYA 4U1NA 4MB5A 2JCCA 4KU1A 5HVHC 3DIVA 4UQIM 3U36A 4FHJA 3RWFA 3ERXA 4DK6A 5E95B 5GXBB 1BQLH 4ZZFA 2AFNA 2Y6SD 3HUJE 3V0EA 4L9DA 1AJ7H 1A2YA 2AQTA 1YYML 1F3RB 4NC1E 5EIVA 4ADJA 4DN3L 1IGCL 2Z93A 2ZYHA 1NDMB 1GYUA 4AL8L 2BDNL 4X6DA 1TG8A 4JPVL 1KYDA 4QRTA 4XP4L 2ZG1A 1T1WB 1QASA 1YYMH 3L54A 4DN3H 3MRIA 1BBJB 1IGCH 2AV7B 2X1OA 4HJJL 4HU2A 3H2QA 4KJYB 3L5XL 3TGXA 4AL8H 2BDNH 1S7UB 5DK3A 4NWTL 4ZYKB 3AM8C 1SXNA 4JPVH 2UYLA 2WZAA 4MNGB 2A4ZA 4R2GC 4XP4H 1TITA 3ZU8A 4Y5YB 3AQZA 4HJJH 2ETWA 3L5XH 1RLBA 4NWTH 2EDMA 4OBSA 2OPCA 1TSRA 3WKQA 4BEIA 4M7LL 2DWXA 1ASPA 2IH9A 1NFKA 4FQ2L 4NPKA 5C0RL 4HJTA 1AKPA 2WANA 1CCZA 4M7LH 4P4KC 1G6RL 4PM1A 3JVFC 2EDJA 3VO0A 4OJYA 4CAGA 1BW8A 1JRHL 4FQ2H 3EDKA 5C0RH 1MFDL 4X98A 3BP6A 1TT6A 4F7TA 3DUSA 4AG4L 1WBXA 4CRPA 1TTCA 3A6CL 3B8YA 3KBHE 4FQLL 1JRHH 1CVSC 1MFDH 1VFBB 4J6RL 4M1DL 3O3AA 2X0UA 4HD9A 3A6CH 2A6JA 2Z31C 4FQLH 4LOEA 4ANXA 2VZ1A 3AT9A 4J6RH 4M1DH 4MD0A 2UY6B 5BRPA 2G3XA 3ZHFA 1AR1B 3ULVL 3K46A 2B1HL 3CN3A 3AVEA 1ONQB 3L5WB 5F88A 4OJDH 4PJ5D 3MV9B 3KPRE 4FN0A 3HNVL 2B7DT 4Z3IA 4ICWA 3ULVH 4ACPA 1HKLL 2B1HH 3V6OC 4J12A 2V2TB 1M2VA 3DJZA 3MGAA 2Z91A 3L3GA 3GLZA 3HNVH 1DFBL 3DX2A 1HKLH 4OZ4A 4P5SA 3GBML 4JCWA 3U0WL 3RX5A 3WIHA 2EDWA 1E28A 4YS4A 2IPUG 5KVEE 3HE6B 2WB7A 3Q43A 5EIIB 4O02A 1DFBH 2YD8A 1I3RB 1XFPA 4K7PL 4M6OL 3U0WH 3GBMH 4GO8A 2I9LB 2WXOA 3CHOA 3BYTA 5EOCL 4KRMB 4DZ8A 1BVNP 4Q9RL 4AYID 1GZHC 4M6OH 1TCRB 4K7PH 5BZZA 3I50L 4KROD 2CWRA 3HZKB 4D8OA 1TYJA 5EOCH 4BGDA 4Q9RH 1JDAA 2CKBB 2BH0A 3BVUA 3I50H 3PHSA 1A8JH 4AQ1B 3CHPA 3F00A 4K2UL 3FC8A 3DI2B 4J3OC 3ULUE 5E8NB 5EU6E 5SWZE 2D8KA 4PWJA 1PZ5B 2ZOLB 1HZKA 3BGMB 4WGVB 3VXMA 5GZOC 2IMNA 1FE8L 4K2UH 4LLQA 3SB3A 4XMTA 3POHA 4TM9A 3MNWB 4NKDA 3UYPB 4NJAL 4K71C 1UOLA 5HJ3A 1MJJA 1QPXA 1FE8H 1XMWA 4L4TD 1KCWA 1A6PA 5T1LD 2X9XA 4NJAH 3K6DA 4YSDA 5MENB 5B1JA 3H9SB 3D05A 2G0LA 5EO1B 5A6MA 4WSJA 3F6JA 3H2PA 5DUBB 4IMLA 1MN4A 5AKTA 5DURD 3T2PA 2VDKB 3L13A 2PYED 4KZ0A 3RU8L 2UY7B 3OSVA 4BFIB 5IW3A 1NIAA 3WUWA 4HXAL 1WYJA 1P9MA 1XF4A 4R96A 5E6SB 4Q58C 3VYPA 4G59C 2OL3B 4Z8FL 5JPMA 4URTB 3RU8H 5I76B 5CR8A 2DJ4A 4ABQA 2P5WD 3SJVB 2DW5A 3RZCD 4HXAH 3LKNB 3QIWB 4JFVA 1L7TL 4UM9B 3VD1A 4Z8FH 4QRQA 3DVGA 5IB3A 5KSAA 1H3PL 4N0YL 2J73A 1L7TH 3L7EB 5I1LA 5DRWA 3VXPA 1CF1A 2QKIC 1DL7L 3G9VA 1HWGB 4HLZG 2RQ8A 1AGBB 1H3PH 1HE8A 1FH2A 4N0YH 4R9HA 4R7DA 5C3LD 3CVBA 1DL7H 2L04A 3ELAT 4FXLA 2ZOUA 5E6ID 3ZRSA 3Q06A 2BZDA 4HH8A 2X4PB 2Q8AL 2VMCA 4W93A 1LO4L 4GSXA 1RK0A 2Z0BA 5KSBA 3WENA 3FSZA 3BGFB 3DOIA 2C4XA 4JPQA 4WI3A 1QQDA 4X9HA 5EO9A 2Q8AH 1LO4H 1CTOA 3HKFA 1LNUB 4C54A 2NTFB 2QADD 4MZ3A 1A7OL 3VWKC 5KVFL 3KE0A 2JK5B 5GRWA 4LEOB 1HHKA 2AGJH 2W0FB 2WNKA 2E0PA 5HYSG 1A7OH 3B6SA 4AQEB 5KVFH 1O7SA 3VI3A 2MCPL 4OIFA 3QORB 2XV6B 3HAEA 4A2LA 4N5ED 4LPYA 1Y7VA 4HISA 2K78A 3K4AA 1SYSB 4NQDA 5BRZA 3U2IA 3B9KA 5ESAB 5GGTA 1RH8A 2MCPH 2NY3B 3JUZA 2J5LC 3BIKA 2Z34A 1XGRB 1HHGA 1JPTL 1F4WL 4WENB 4YJZL 2RQEA 3KWWA 1A1NA 5A2JH 1BOGB 4G8FB 4I85A 4K9JA 1AACA 3VH8B 2G3MA 1AGEB 2JH2A 4ZPVA 2ZIDA 1JPTH 1F4WH 1MCCA 2BCKA 3SYQA 4R26L 3DX1A 1PJ9A 1MQKL 3U9WA 4F2FA 3RKDD 2LE9A 2FWOB 1IKNA 4OVUA 4R26H 2CA4A 1MQKH 5JPNA 2VOTA 2JSFA 2C1OB 3QXAA 3VXOA 4LQ1A 3QNXB 4QEGA 2YPVA 3NTCL 4AMXA 1YEKL 4LLUB 3CN0A 3VFSB 2Y6TE 3HG1D 4EE2A 4AQ8A 2HLEB 5BS0E 4TF4A 3IGLA 1VZHA 4Z7WE 3T2QA 1F86A 3D9AL 3NTCH 4HP5A 2NY1D 3SGKC 5IVNA 1YEKH 1PLAA 4LCYB 2NY6D 1CFBA 2AI0L 3OKLA 3CZGA 5B3JF 4HMDA 2WD0A 3LVTA 1URZA 2DMKA 3D9AH 2H7WA 2EAEA 4UOZA 4OZGF 1MY5A 2RCSL 2ZUTA 5LNDA 3MGOA 2AI0H 1WFOA 4ZDHA 3ZT7A 2W65B 2FJGB 5DMYA 3BZEA 1MCBA 2RCSH 2X1QA 1T03L 5JZ7C 3LSOA 3N1QC 1ZVYA 3L3JB 4JL2A 5I24A 4P3WA 2DWDA 1JUFA 2VDMB 4Y5XC 3KJ4B 4KI5E 3FHAA 2FSEB 4XNUL 5F72S 5HGHB 5LBSL 5D7LB 3VFVA 4Z0BL 1BOYA 2DQEL 3QHTC 4XNUH 4PCKA 3RGVC 5LBSH 1GMIA 2X1WL 2OCFD 4HUCA 3RWGB 4Z0BH 1I3RA 2DQEH 3GRWA 2YEQA 4EOWL 3IDIA 2K7QA 4RMQA 4M7JL 1QEXA 3FQRB 5F0MB 5D7JA 5DLLA 1FNFA 4EOWH 1WIPA 3SPCA 1TLKA 5TF0A 3TT3L 4M7JH 1V3MA 1QOKA 5B38G 3N3EA 2ZF9A 3DOSB 4L4VE 4NIYE 5EF3A 4MCYA 5D71L 1XR9B 1UOKA 3TT3H 3VTTA 3PFUA 3CH1B 1EHLL 3FRUA 4DW2L 3BUQA 1M9WA 4OD3L 3BZ4A 1UEYA 1Z32X 5CGYD 1PZ5A 1QYGL 3TT1L 1INEL 3EGDA 2FWUA 3KYNA 4WU7A 5D71H 3BGMA 1U8KA 5KVDL 4AYSA 1R4XA 1EHLH 4PTUB 3BPOC 4DW2H 4MCNA 4OD3H 3B43A 1QYGH 4FYTA 1INEH 2ADIA 3TT1H 4G72B 2Y7MA 1NOFA 1ZHBA 2X4NA 3K5SA 5KVDH 4WNQA 4DEPC 1XCTB 2ATPB 5F7WC 5GGUA 3L4XA 1AY1L 3MV8D 1CQKA 3GXPA 1PX4A 1TVHB 1B9KA 4LCWE 1OP5K 4FZEL 1ZIBA 2VLKB 1HILB 4J8RA 4C55A 2GSGB 1AY1H 2D3NA 2KQNA 3B37A 2ZXWB 4NRYB 1NGXB 2I60L 5ACZB 4FZEH 3UDWC 4OJEH 2VB5A 4MJ6A 1J11A 2PKDA 1FZMA 1ZD6A 2A6IA 4X9FA 2I60H 3KL5A 5H94B 4YSSA 3L3HA 5C0NC 1KBVA 4P57A 3PGCA 3QUMA 2CO3A 4L0YA 4H25B 3EGSA 4JDVA 2ZOKB 3FQXA 3MBWA 5CZXD 2IGLA 2XVLA 3TTSA 1R24A 2H8PB 3DXAD 3AWGA 5E9NA 4IOIB 3IAGC 3OL2A 4QOKD 1LD9A 1P4IL 4WTZA 4XO9A 3FTXA 1H5BA 2UVFA 3SEPA 2DWEB 5J3HC 4XHQA 4KDWA 4XXCA 3GJEB 5C0CE 3TF7C 1P4IH 1G6VK 5EU3B 1CGXA 2O5ZL 4XX1E 3OQRA 2IBBA 5J4MA 5JNYB 1FL3A 2JIXB 3QCUL 4P2RD 2AK4B 2FJHA 2O5ZH 4OZGB 4JN2A 1WIUA 4L4TA 1X5LA 4PAZA 4B0MB 1ZHNB 2KUTA 2F8IA 4NX0A 1P0SE 3HS9A 5T1LA 3D1MC 3QCUH 1T66C 2GITA 2ZOOA 1YY8B 3RIAK 3LKQB 2F53B 3U79A 2GUOA 4DO6A 4XOAA 4Y2LA 1CFQA 1SHXA 2BS8A 2NTFA 1TEYA 1JWSA 3O6FB 2F74A 5IVZA 3L1EA 2XTJC 2P8MA 3E6HA 4R4NC 2Y2WA 3PDOA 3CD4A 3IJHB 4PRNA 5J0BA 4PJFE 2OM5A 4YDJB 2XY1A 1BD2E 3RZCA 4NO5A 3QSKB 3E3QE 2BW5A 5DFTA 3DI3B 3QDJA 4GFTB 1OM9A 2DDQL 4JQXC 4MNQD 4MQXC 1L9SA 4DKTA 3KPLA 3VFRA 4QGYA 3TV8A 2DDQH 3LXBA 1P84K 3T4YB 4N25A 4TUUA 4EN3C 1WAEA 1AHWA 1ZV5A 3QUZC 4N6QA 3ZL2A 4EF3A 4QCIB 4WRLA 1BJMA 1MFCL 2YLKA 2F15A 1MF2L 3JWOC 4FI7A 4A2HA 3RUGE 4P99A 2OXHB 2GK2A 3LTVA 2YBGA 1KXQA 2XA3A 2JKJA 1MFCH 1MF2H 5F7LB 3D7PA 2V2XA 4ACTA 1TZHB 1I8LA 4N0CD 1I85C 4HIHA 5F7HA 1ACCA 2DWTA 1BJ1J 1AZNA 3V4VA 4AIZA 4PWGA 5SX5K 4Y1AE 2FYYA 5JUEL 3HG2A 4MAUL 1HJBC 4F33A 3CXHJ 3I9AA 4NAMA 5I8EA 5ICZB 3L4WA 5SWSB 1D6VL 3CX5J 3P9MB 1CS6A 5JUEH 1ZVSB 4CN6A 4MAUH 2PETA 2R2BB 1BXXA 1J0JA 3VFMB 4Y8AA 1RZIB 1D6VH 1PD6A 1NANH 3UBXG 3DC0A 4OBRA 3SYAA 1P5UC 1I82A 1IJNA 3DX7A 4K15A 3DSNA 2OLDA 3L4ZA 3N9GL 3C60C 3FONB 4RZKA 1L9NA 5DHMC 4U31A 1TJIL 4RSYA 4L1TA 5IQ9B 1JZ5A 3VD0A 3MCLL 1A4CA 3RNKB 2IQ9L 7CGTA 5I19L 3N9GH 4KK8D 3WEBA 3Q9PA 2KH2B 4YNYB 3FULA 3CFBB 3PV6A 4Z7NF 2WINA 3UBHA 1TJIH 3PIQA 1NBYB 2JJTC 3MCLH 3VXRE 4G6AD 2IQ9H 5DC2A 5I19H 5L0QC 5KYYB 5K59F 5DVKA 2EVIA 1H8LA 3L3KB 4EZLA 3IVKB 2ILLA 3RWGA 3MU3A 2CA3A 3MUY1 1MDTA 5PCYA 2WKOF 2DBJA 4ZZKA 2YSSA 3GSOA 4HALA 3O2DA 4JGNA 2TRHA 3HG1A 1W91A 3FQRA 5C9KA 5EC1A 4X5XB 4KY1L 2E7BA 4D9LL 4MMZA 4DF9A 3QRFM 1IQWL 4FKEA 2J1YA 2SEBA 2KZWA 3HMWL 5F7AA 4JRYE 4DEWA 4KY1H 2GSMB 1MHPL 4N2HA 5GS3A 4D9LH 4DAGL 1IQWH 1DDTA 4JDZB 4MKMA 3LNGA 4PRAB 1E2WA 3P2DA 5CU9A 4D8PA 2RMNA 5FGCE 3NSDA 3OVUB 1S5HA 5E8EB 3HMWH 1KYFA 1MHPH 4DAGH 5D2LF 4E9RA 1XF1A 4ES8A 2CNZA 3VD4A 2R51A 4L3EE 4ALAC 1RAMA 4N8VB 4XOCA 3RURA 2XWXA 4Q6IB 2F5AL 4KUZL 1I1FB 1EDHA 2XXCB 2ENSA 4RX4D 4RWHA 4JM2C 4IRSB 4WSGA 1I9EA 1CL7I 2KT6A 4KKLD 5EC2B 1ADQL 5I6MA 1PY0A 4CJ0A 2Y7QA 2F5AH 4A67A 4KUZH 5GS1B 3HPLB 3WKML 2FIKA 2F2HA 4KY2A 2FYVA 1ADQH 3O0RL 5LGYA 4JFDD 4WU5B 4L8SA 4UUJA 4P3CL 1XGPB 3DMMB 1NLBL 5AUMA 5HGAB 3VVWA 3WKMH 4JX0A 3WEOA 3LQMA 4QTFA 4I9WE 3O0RH 1FZOA 1SLWA 4N1CA 4FNQA 3FRPA 5FYLD 3IRZA 4P3CH 1NLBH 3ZQXA 4FFYL 4N22A 3KYKL 5JHBA 1E3ZA 4WW1A 2WBXA 4DK5A 5CJBA 1U3NA 2NW3B 2VISA 4AYGA 5I5RA 3DGGA 1JHTB 5DO2C 2M1KA 4UOW1 2XZQL 2NYYC 4FFYH 3KYKH 5B7FA 1G5GA 3TNMA 1V54B 5JQIB 1DHKA 4NRXA 4TKWA 3ECQA 4E5XG 3GSNB 2XZQH 4NS0A 2VMJA 3NCCB 3LZLA 4I3SL 3S7GA 3K6IA 1ZGLM 4AMWA 3L45A 1ZA6A 1J8HD 4FKHA 3SDAB 3ARFD 2WXQA 2E3VA 4JZJB 4I3SH 3LN9A 4PRPE 4PVBA 5IVXA 2KC0A 4XMKL 1UJ3A 1AGDB 3OX8B 1S7QA 1YRKA 5DVOA 5AW2B 4LF3B 3VGHA 5E03A 5ADPL 1FFOB 3MV8A 1W6WA 4WIQA 2JKXA 3NABL 3PWJA 3ARDC 2YSTA 4XMKH 5J1TC 4QHLB 3ROOA 5BO0D 1S4IA 4WCYL 3P77B 5ADPH 5FC9A 5FKPA 2W0LA 1OW0A 2EXYC 3NABH 4O2EB 5A2CA 2Q7NA 1LE5B 4WCYH 3WS6C 4UT9A 1XD0A 1O75A 1JF1B 3KS0H 1OT4A 4FTVE 3R06A 5K9QG 5D6CB 5IEHB 1FBIL 3D2TA 4PJHF 3RVVD 2C9PA 3FQUB 4Z7NB 4ODXB 3LN5B 3LNDA 3EUDA 4XNBA 2VXQL 2HN7B 3QUXB 1BF5A 4DUVA 5D7IE 3HG5A 1FBIH 4EI0A 2CMRL 1BQRA 5I1IL 1W8EA 2X6AA 3IPFA 3OKDB 2WO3B 1ZTXL 1JNHA 3MNZB 3FT3B 2CMRH 1U8IB 2H6PA 1KEML 4GLRI 4MLSA 4PLKC 4Y4KB 5I1IH 4APQC 4BWTA 4LLYB 1ZTXH 1NFDE 2VLJA 3WJJA 1KEMH 2JJSA 5HHVL 1F41A 1GTNA 4G83A 3JV0A 2XX0A 4Y4FD 5CZVL 3UJJL 4R6UA 4XN5A 1YQVL 4Y4HD 1RD6A 5HHVH 4MAYC 5TDPA 1OGAB 4M93B 3O0LA 5D2LB 3TJPA 3LHAA 5CZVH 3UJJH 2FQFA 1IBZA 1EAQA 4HF5L 1HH9B 5KBNC 1YQVH 4YUEL 1QZ1A 1UD5A 2XKUA 5EU4B 2WQXA 5ANMB 1RI8A 5I1DB 2HT2D 2CRMA 4HF5H 4UTBL 4YUEH 3MLPA 1S78D 3DHJA 4LQFL 3VXQB 1OY3B 4KRPD 5I71B 3WLWD 4KJQC 4UTBH 1YEJH 3UADA 2BIQA 4PJGF 5H2BA 1SM3L 2XXGA 5E4OA 5D4IA 4LQFH 3UO1L 3KPPA 2ZKYA 3BLPX 1XZ0A 2IWEA 3AFLA 5CLTA 3JVGA 2YD5A 4MNQA 1SM3H 2WWNA 3C9NA 3CLFL 3UO1H 2WGXA 4KK9C 3R8QA 5I66B 4OGQC 4UM8B 3L5HA 4R7VA 4NKOB 2OBGA 4AQAB 3OGCA 5J5EA 1M1SA 3CLFH 3QEQB 5D1QE 2C34A 1ADWA 3BVDB 1EEYA 2EILB 2VDRB 4HWZB 3VSQA 5AVXB 1JWMA 4YXHL 1MCNA 4DWHA 5CD3A 3K6SA 2X6CA 4BD4A 4JFSA 4YXHH 3A24A 4X6BA 3OWEA 4WHYH 1ZSDB 2WOBA 1SMOA 2P7TB 3ESOA 2QBWA 4XBGB 3AG4B 4LLWB 1XR8A 3OJMB 4HK3N 1HSAB 4KK6C 1CICB 2YGQA 2DM3A 3H1ZA 4LLDB 3LXUX 2W1NA 1S7TB 5JQ6L 3W9DB 2YN3A 1DDHB 2BIHA 2C9XA 4M29A 4RA0C 2OMZA 4ZAKB 3LMJL 4BCXA 5C2BL 3MRCA 4JPIB 1UKQA 3MRHB 4IIQB 2BRRL 5JQ6H 5G5DB 1GY1A 4X6FB 2ENQA 3QYNA 3ARQA 3LMJH 3PFQA 5CGTA 3V6ZB 5C2BH 3UP1A 3MN8A 4F92B 4FA6A 1B4RA 15C8L 2BRRH 3APCA 2BY1A 3QJZA 5MHSE 1BFVL 1WZLA 2YN5A 1L5GA 4LKCB 1BZEA 15C8H 4MLIA 1FZJA 4PJHB 3QO1A 4A7GF 1BFVH 2OSLB 3K2KA 5I8OL 2XV3A 3JV6B 1KN4L 3AMKA 4WWKB 5JOPE 4JG5A 5HDBE 3HC4L 5E9DE 3WGUB 1DVSA 1PDKA 2QPUA 5KSBE 5I8OH 5E1QA 1NWPA 1KN4H 5EIIG 3CPUA 3QI9C 5E1AB 3HC4H 4DTGL 4U7SA 4AYFB 4R7NA 3O4OB 1C08A 1EFXD 3QPKA 3FO9A 2AABL 5AB1A 1RIUL 3CDZB 2WBJB 4Y2NA 5B7EA 4DTGH 4N85A 1ZVNA 2E56A 2AABH 4G1MB 1D9KD 1RIUH 5ENWB 3D4CA 2Q9OA 3BWAA 4AT6A 2QJDA 1O6SB 3L95A 3VDAA 3IPBA 4XMWA 3F7VA 1JXKA 5EDXA 2EIKB 4M62L 4F93B 5AAMA 3W82A 4FADA 3FT9A 1K8DA 5ITBL 5IJBC 5HYJD 2XIBA 4IRJC 3BGAA 1Q38A 2E5EA 1M2OA 1TYEB 5E6RB 2R59A 4M62H 4MCZB 3Q5OA 3TYGL 2VL5B 5ITBH 1WV7T 2PP8A 2VUKA 5HY9B 5E0FA 4X4YA 1N67A 2B59A 2VUYA 4J3BA 4NYLA 1GYAA 4BCYA 4A04A 3QR1A 3CSTA 4PJGB 4EZKA 3TYGH 4RX4A 4J23A 4EIBA 4C4BA 1F4AA 4MNGE 2RD0A 4WO4D 4F8QA 3QO0B 4JKNA 2HAZA 3OB8A 3NIGE 3BDBA 3PPEA 3P77A 2J55A 3P69A 3L1OL 3DV6A 4QR7A 1TQCC 1ZVHA 1NC2B 3GMNA 3MREA 4JFDA 4UI2A 2MRYA 4QXTB 4MHHI 3MLTA 1QSVA 2DIJA 3PP3K 5DK0A 1OCOB 3ILQD 1PYWA 4QT5B 3L1OH 1P7QA 3L7FA 1DUZA 1Y6NR 4DKDC 2QVKA 2WGNB 1AANA 1T22A 1FNEA 4A1RA 2EYSB 3BHBB 3DBSA 2PPDA 4NKMB 4LL1A 4JKLA 4XOBA 1OZUA 2Z7YA 2G30A 4DEUA 2W07B 4CU8A 1GR7A 3OQ3B 4A55A 3KPQA 2XIDA 3AREB 3IGUA 5H35B 2LW3A 2RBLA 4ZW5A 3IK2A 4HQQL 1MXDA 1TVBB 5EZJB 2CDEA 5FFGA 3CPLA 2BOLA 1NQBA 3NDYE 2EVHA 1YN6B 4YSTA 2NT0A 3F5WA 1WAPA 3MAWA 1J8HA 4IOFD 3QZLA 3VAEA 2R83A 3DRQB 5JOFB 1KCLA 4HQQH 1COBA 4PHXA 3MV9E 3OAWA 4ZMPA 2P5EB 2ICEA 3STLB 1AG6A 3EYSL 4I89A 1TJGH 3UXFA 1JZ3A 3EYSH 2I26N 2RH0A 3LD8B 5EU4A 4GH7B 5CGBA 5D8JL 2NLJA 5FUZL 1FCCA 1QTYT 3DIFB 4D3CL 5DC4B 3RI5K 4JFEA 1DVFD 1BZ9B 3CUPA 3S5LB 3VFNA 2QQKL 5D8JH 5FUZH 2WWKT 3TA3B 4D3CH 2YXWA 1ZA3A 4KNTA 2C9QA 2WLIB 1PJWA 3V9FA 3VVVA 2PO6D 4HCIA 2QQKH 1BIIB 3IKCA 3U1SL 3G6AB 2AQRA 4ONHA 4BH7B 2R69A 5JW4M 3CH8A 2A6KB 4F15C 1FFPB 4WUUD 1LO5A 5DF0A 3VH8G 1AIZA 3U1SH 3IYLW 3WE1A 4FQHB 4H1LA 4PR5B 2YXFA 2QMKA 4IEFA 4Y19B 4YC2B 1QATA 2W0PA 5IHUL 2IAND 4NM8L 3QK0A 4HWZA 2IDTA 4QRSB 5CCKL 4WWOA 4KO5A 3QQDA 5IHUH 4NM8H 1KJMA 4Y4FA 3T9WA 1J12A 4LSPL 4MDIA 4Y4HA 1RZ8A 5CCKH 5MENE 2IOMA 4ZRGA 2H1LM 3SY0A 5GGRA 2OMNA 4X0KB 5MEQA 1I8IA 1D7DA 1BYPA 2X2HA 4LSPH 3FSWA 2OJZL 2OR9L 1I3GL 1TXKA 1N70A 4A2EA 4XVOA 3IKKA 4NUMA 2F7RA 1JYVA 1T89A 4Y9CA 1KG0B 3LKOB 2OJZH 2OR9H 1I3GH 2WXIA 5T1MB 1J0HA 5E2WL 1Z0MA 1BFOA 5FO9A 4AVJA 2WLLA 3SJVE 5J8OA 5KBLA 2HLFD 3BKJL 1M1XB 1YAZA 1MDAA 1V7NL 2CXGA 3RZWA 2OW7A 3LPWA 3MMEB 5E2WH 3AUWB 2ZTBA 5K1NA 1MSPA 5IHLB 1LEKA 1DEEB 3BKJH 4KDVA 1V7NH 4OT1L 1Q9LB 1AOZA 3KPOA 1JPFB 2NY4B 4FLQA 2EDKA 3BKYL 1T1YA 3IDYC 3RWEB 4B41A 4M5ZL 3UTSD 1RK7A 4PJ7F 4CVUA 3WN6A 2P9RA 4OT1H 5FAAA 5I5JA 5KUMA 2J5WA 3BKYH 1GHFL 4ZS6C 4ZOCA 2WLNA 4HJ0D 1D5XA 2YAEA 4M5ZH 1WG3A 3NMEA 1B2WL 1CGVA 3NYKA 4PRHD 3WO4C 5B3SB 2PCPA 1GHFH 4L2YA 4LIQE 5T33H 1L0PA 1B2WH 1NIDA 5AAWA 4PREA 3EHBC 1DR9A 2NUPB 4JVWA 3MACL 3VGDA 5L2JA 1GKOA 3MYZA 2JVUA 3W39A 4X99A 2ZSWB 3PAVA 2A99A 1NC4D 1VADA 4CBPA 2ENPA 4A7QA 1V5JA 3MACH 4XBEH 4QWWC 4UQ3A 5AOMA 1SUJA 4AVHA 3T0BA 1BEYL 3R0MA 2R2HA 3KLKA 4LU5L 2A73A 3BKML 4IBYA 4EUPH 4F7PB 2PXYD 1R3LB 5EUOA 1BEYH 1WEJL 4WTWA 1NGYA 4LU5H 2DWYA 4NUJB 2UXVA 2YOCA 3KVPA 4N87A 4XNMA 5F7DA 3BKMH 2XFGB 5LAPA 5B1JC 5EEVA 5EUKB 2XT1B 4P46B 2HVJB 2N7AA 2IDFA 3FU6A 1WEJH 2P8LB 1YMMD 2YQGA 4X4MA 4Z78B 4F20A 1KIQB 4OQTA 2X40A 3TPUA 3ZR5A 1A6ZA 1SZNA 2NY5C 2X1PA 5LDUA 1M53A 3RBGA 3ZZQA 2ESVB 1EZVY 3ZRFC 3TEUA 4Z1PA 3IDJA 1P9MC 4DPBX 3MA7A 1TQWA 4OIAA 3HNSL 1KLUA 4BSWA 4AM0A 1URLA 5JPMC 4X5LA 1H0DB 4NKQB 3TP4A 5EHFA 5HJBA 4IRZA 3QEHA 4ZS7L 1BX2B 3D87B 3AG2B 3MRFA 4NB7A 4MMYB 3HNSH 1EFXA 1YNLL 3AY4A 5MI0B 2E6PA 3HKZA 3DRTA 4ZS7H 5IQOA 5G4OA 3L9RA 1CT8B 4H0LC 1YNLH 1KF9B 1D9KA 3A23A 1UXLA 2VXUL 1Z5LA 5I2IA 1Z3GL 5F0JB 1P1VA 3MRBA 4YK4B 1JGVL 1XF5B 1U8NA 2QGEA 2VXUH 4POZD 1Z3GH 2BSRB 1GW6A 2DIAA 1DQJA 4FFTA 5HPMA 3BYYA 3ZQ9A 5LCVL 1JGVH 2Y1VA 1YN6A 4AC4A 2C7FA 2X10A 4U1HA 4XXDB 1SFHA 4MMXB 3IGFA 1TJXA 2V2WA 4TSBL 5LCVH 3K6NA 5HYFA 1F1DA 1I1YB 1MCDA 2EH8L 2AF2A 3CCHA 4YXKL 3STLA 4NCDA 5EF1A 4TSBH 4DGVL 4N0UA 5D7LE 3T77B 2EH8H 3BDXA 4AM0Q 4EMZA 1OF2B 3NSJA 3HRZB 1FQ9C 3KXFB 1M4KA 4P5MA 4ZXBD 3NCXA 4YXKH 4W9GC 4DGVH 5CSGA 5GRYA 2DN7A 2X7LA 2XKSA 4G8GB 3F7YA 3B9KC 1RJYA 2N0KA 1QSZA 4I0CC 4TS6A 4PJ7B 3S35L 5KVEL 3GGWB 2YD9A 4BJLA 2YD2A 1WBZB 2CIIB 2APBA 2BC4A 3WY1A 4UU9A 1N0LB 4ORGA 3S35H 5KVEH 4HUVA 3MRKB 3ZE1F 5KYXA 2G2NA 3ZHLA 2E9IA 1RCYA 2E8ZA 35C8L 3RTQB 3DYPA 2X4OB 3IM1A 4ZUTB 2O1AA 4AI7A 3U9UB 2D0GA 5F3HA 4DVRL 3O81A 2XC8A 1IKNC 5GRVL 3I74A 3ARUA 3GJFH 3MOQA 1MLBB 4MA1B 3ULUL 1SHSA 3BOVA 1KFGA 5JPNC 4LSSL 4DVRH 5HGGS 1JTOA 4RZCB 3ZTNL 1G7IA 1XX9C 2F54B 3TBTB 3FKUS 5EWIL 3ULUH 2VN5A 2OULB 4AQ8C 1ND0A 2YIHA 4LSSH 3RL2B 4NAJA 1ZMYA 3LN4B 3TNNB 2P43B 5DI8B 3ZTNH 3GINA 1S9YB 1U93A 5EWIH 3K71A 5FF6A 1DFXA 2CPCA 5INCA 1P4UA 2VLKE 1MHHB 1MVFA 1PW3A 1XH1A 1ULVA 3N04A 4X0KA 2PYFA 1QACA 3KGUA 1NCGA 3ZY7A 3CVHL 5B1BB 4I1NB 1A7QL 5BXFA 2AQQA 2Y6SC 4R84A 3QA3A 2EIDA 1MY7A 3H9HB 2LVEA 3CVHH 1DVFA 1A7QH 4GAGL 4HIEA 2EVFA 5TQ2L 5JHLA 4EI5D 2NSXA 1NBQA 1CFSB 2A74B 1EH9A 4XCNB 1FO0B 2ZT9C 4GAGH 2PO6A 1MG3C 1KXHA 2KKQA 4V33A 4QUOA 1WGOA 5TQ2H 1ZE3C 2BK8A 2FX9L 1QFWI 3ZT6A 1BREA 3F05A 2BVQB 1D2OA 3W11D 1S6NA 2FX9H 2XQYG 4HEME 1AIFB 3V55A 5IBLD 2R1WA 1VF5C 4Z3TA 1U8PA 2IANA 1SQ2N 5B3JE 3P0GB 2E27L 5KG9B 2W92A 1F13A 1XF3A 1ETJA 1Y6KR 2AK4E 5MEOA 5D7JC 1LO3L 3D4YA 1CGYA 3L6FB 3EYUL 3OPUA 4POUB 3HPJB 4ZUWB 1FYTB 2E27H 4BZ2L 1MVUB 2F53E 4HH9B 4U1SB 1LO3H 4YHPA 1ODAA 3EYUH 2YARA 4Q7DA 3OKYA 3O8XA 3FQNB 4NKIL 4RQQA 4ADGA 4BZ2H 4ZMYA 5FYJE 1IBDA 5JIDA 3PDGA 2GHZA 2UX6A 3FT4B 4S11A 2HJKA 3ARZA 1RZQA 1J5OL 3P3RA 4KKPA 4NKIH 3BWUC 4G1EA 5IVOA 3U30C 4HUXA 1T6BX 4B9CA 1BG1A 2X4TA 1N6QL 3N43F 4F2EA 4HS3A 2ZSVA 1J5OH 4WW2A 3U9PL 1JZGA 1HC1A 4BXVA 4L0PB 1PQZB 1N6QH 4N8VG 5E8PA 1ZLUH 2EDDA 1FVDA 3VXUD 2YA2A 4PG2A 4BWUA 3U9PH 2HJFA 4XH2B 4HPHA 5C71A 2BP5M 5AVVB 1K6QL 2R27A 1IB5A 2D7QA 2GB2A 1PG7L 3ZE1B 2DH2A 4I48A 5FO7B 4DP5X 1MPAL 4TN9A 4CMMB 1ACZA 1TO4A 1E5YA 2ZCKL 3ETBF 4B3VA 1K6QH 3RL1B 1PG7H 3GPSA 4B9YA 2YUVA 2EUWA 5CM1A 3RWJA 1MPAH 2ZCKH 2X44D 5SV3A 2AJZA 2X6VA 1E27B 3CXHK 2KQMA 5ID1B 4JE4B 3SSGA 3D50A 2LFGA 4FFZL 5HGDB 3FZUC 2CPUA 4PV9B 3MA9L 1LL1A 2BXYA 4CADB 3D3VD 4U6YB 4WLCA 2NZ1A 3TA4D 2ZXEB 5C8JA 1H5BC 1UB5B 4FFZH 2GYSA 4PUBL 3ESNA 5IW1A 4JJOA 3MA9H 4N86A 4XXCC 2VLLA 1NC4A 4WI6A 1IEAB 2BSBA 5SWSE 4PUBH 1H6TA 4CMHC 4JDEA 1DQDL 3Q1EA 4Y9EA 3NFSL 2J8UA 1WICA 2Q2LA 1F2XK 2BNQD 4FNTA 2GTWB 2YOAA 5E6YA 1Q0EA 2DIBA 2PXYA 3OAYK 1DQDH 3V6FA 3NFSH 3VFTB 1UB6B 5D1XA 3CFDA 4XPFL 4U0RB 1J5HA 1AO7B 1AHMA 4ZFOB 1FIEA 1DZBA 3QXTA 1ECZA 1NCAL 1ROWA 1PS3A 4ZX4A 4XPFH 4ZNCD 4OCNC 5ITFB 3TCLB 3IU3B 4YSQA 3BQUD 1F3DJ 3WU1A 4WEMB 5BVPL 1NCAH 5CZKA 4JFYA 4LSRH 1KTRL 2VLMD 5IBTH 2CD0A 4FL4B 4HLZH 4KROB 5IY5B 3QORC 3WTWA 5CIPA 3SKMB 5I17A 3RZCC 4WDIA 5BVPH 5I5IA 3TFKD 5E4AA 5ABZA 4IMKA 4P9HL 3KCWA 3DDFA 4UT7L 1RK1B 3T8XA 1T4KB 3KPMA 1YAIA 4QLWA 4UBDC 2BHZA 4G42B 4P9HH 2YRBA 4NQVB 4UT7H 1X5HA 1UHVA 3D06A 2DY2A 1AHWC 3ZN6A 3WELA 2C7UB 4UNVA 2EEBA 3Q8FA 3TIEB 5IJVA 4Z18A 4NZJA 4GRWH 3AS1A 1SXBA 3SKNB 4U1KA 3T2OA 3QJFA 2AEOA 2YPKB 3QXWA 1XH0A 3VFPB 1BVKA 3QEUB 1DE4B 3QWOB 2Z6FA 5C0AB 1U4FA 4Z9KB 4QF1B 2F54A 5F1IB 3FB6B 1N3NA 1I8LC 1U2YA 2XVKA 3N43B 2QADC 2ADJA 4CVZB 3QCTL 3TBSA 2PYEB 4Y16D 5DXWA 1B2YA 2DMGA 1QBAA 2P42B 3V9EA 5CLWA 5I9QC 2AC0A 2FH8A 3QCTH 5F7YC 1JZ8A 4HOZA 3N50A 1W0WA 2ITEA 2XI9A 4ISVB 4EN2A 4BZ1L 4ZXBA 4JN1L