4IW4C

Crystal structure of the serine protease domain of masp-3 in complex with ecotin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
138
structure length
137
Chain Sequence
QPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ecotin
publication title The Serine Protease Domain of MASP-3: Enzymatic Properties and Crystal Structure in Complex with Ecotin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 17
structure length 137
sequence length 138
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4iw4C00
1AZZC 1XXDC 1N8OE 1SLVA 4NIYE 1XX9C 1SLXA 1EZUA 1ECZA 1IFGA 1ID5I 1SLUA 1FI8C 2Y6TE 1EZSA 4IW4C 1SLWA 1P0SE 1XXFC 1ECYA
chains in the Genus database with same CATH superfamily
4NJ9L 3PWPE 4NQCB 4A7UA 4Z9KB 5I1HH 2J56A 3R7QA 2VM4A 4MA1C 5CJOH 3DX4A 1OGAB 3SDAD 1G9NC 4O02B 5F9OL 3N44B 5JOFA 1HXYA 2APVA 2DI8A 2QQNL 3F58L 4XX5A 1NKGA 1UCTA 1MREH 3O81A 3FUJA 3BN9C 4PD4J 3Q05A 4EZJA 3O3EB 25C8H 1B4TA 2YD4A 4AW4A 2NNAB 3LH2L 1T89A 1AQKH 4C47A 2DJ4A 1RVFH 4QHNA 1X7TA 3BT2L 5E0QA 5E23A 2XVLA 5AAMA 4ORZC 2A38A 1H8SA 4MD5B 2D7TL 1IFHL 3D87B 3EF4A 1O5PA 3QUYD 1DEDA 4J3OG 3V6OC 2DEXX 1Z0MA 5F6IC 1XB3A 2VMFA 4RDQF 3WKML 3P1VA 5AW0B 5I1DA 3MA7B 1ZJBA 2XYCA 3PQYD 2X89D 4PUBL 1T5XB 2CK0H 1JPSH 2Z35A 1HZHH 1PDKB 1SJXA 2VR8A 3D39D 3ZYIA 3QIUA 2FT6A 3H9HB 5C0RH 1XB6A 3JV0A 3DO7B 1IBDA 4JKKA 4G3YL 1E3ZA 3CDZB 4EZLA 5FKAB 5IK3A 4K8RL 3WIFB 1MIEL 1CGSL 1QFUH 4P2YA 2CBPA 4EI5A 3VQ1C 1N59A 4N0UE 5BRQA 3D51A 3KR3H 4FQXB 4ZW8A 5BS0D 5HYEA 1RJLB 3CIQA 2V6HA 2Z9TA 5J1TC 1PD0A 5A2BA 4E41D 2R2BA 1DBJL 1GHFL 2F53A 3MUGA 1EO5A 2WSKA 1DLHB 5FYLH 4DESA 1S3KL 3L5XL 2N7AA 4XCFH 3C2SA 4O58H 2VW7A 4JL2A 2HH0L 2ZF9A 3M17B 3ABZA 4EDXA 2QVIA 2X4UB 5I8EB 2XA8H 4HQQH 3MLZH 5DUPL 1D2PA 3QFJB 4TVPL 3MV7D 2B0SH 2KDGA 3P30H 2XKNA 4MNHA 4WUKH 3QNZA 1UHVA 4H25B 1GZHA 1QBML 3N41F 1W72B 4G7YH 4U3HA 2A3TA 1M7DB 1K4CA 1VEMA 2G5BB 1OOAA 4UM9B 3NDZE 2QSCL 3S37X 2QFPA 5I1CH 4JEGB 3GYRA 1JXGA 5BZWA 3FOMA 2IAMD 3KYKH 4IHOA 4P9HH 2OMVA 5D1QC 2WANA 3D0LB 3CFKA 2VJXA 4D0CB 1FL6B 2JQZA 5I8OL 5F9AC 2YZ8A 2BP8A 3D33A 1FNEA 2OI9B 4LBEB 5F7FA 1LO0H 2A6IA 5AG9A 3UEQA 3L3JB 1YEKL 4E9XA 1ACYH 5CJXA 2P44B 3O2VL 4FEMA 4NERA 1G7JB 4H8QA 5F9JB 3TWYA 1T0NA 4NQVA 5FO8A 4HZAA 3MV8B 5L0QC 3Q8CA 2X4QB 3RFZC 1WUNT 1CLVA 3RZWA 1CFSB 3BN9D 4RFOH 3E9UA 4KPHL 4POUB 5DMKA 1ZY9A 1CDIA 4OZGF 4PSRA 1EHLH 2IBZX 1LO4L 4FQPA 3L4WA 2AVFA 5ABAA 1JPTH 1QP1A 2YAMA 2PPEA 1AZVA 3MACH 1Q9LB 5E8DL 4DP1X 4PY7A 3U7WL 2CPUA 3QUXA 1UM4L 2NUPB 3MYZA 4NJ9H 4YHIA 2G2PA 5TDOA 4AYEC 3A6CL 3VDAA 1T7ZA 4OH2A 2CMRL 2QPDB 1ES0B 2ZAHA 4XVUD 3SDDA 3VGBA 3MLVL 1CXLA 5F9OH 4NRXA 3GPEA 4BZ1L 2QQNH 3F58H 1AZBA 2DMCA 3ULUC 1A6PA 3IJEA 5C0BA 5D7SL 4XN2A 3A0OA 1ZDSA 3LH2H 4GXFA 4N90D 3KGRA 2CLZA 2L4OA 5DF0A 2EXYC 2HPOA 5D1XA 1O0VA 3BT2H 1R1CA 4LP4A 2D7TH 1IFHH 4XPHL 4JM2B 2F68X 3ORJA 3GTVA 4K3JL 4NYLA 1N8ZA 2DIBA 3IJYB 5E5MB 2ADGA 3IMVA 4LSDA 3BAWA 2GJJA 3PIQB 4ZI8A 2HLFC 1AGBA 4PJHE 1NUGA 4PUBH 2W65A 1OB1B 5TGBA 3SKOA 2IBBA 2WWNA 1L7IL 2X0WA 5AZEL 3TO4A 1IAKA 1VHPA 2NY5L 2X70A 1MFBL 3WLBA 4Z3JA 3QJZA 1VGEL 2BNQD 2PPFA 3ARFC 3BO8B 3LZOA 3VGAC 2HLEB 1KFAL 3U25A 1DQML 4G3YH 2ZXEB 4K8RH 3QVAA 1MIEH 3OC8A 3TNNB 1MAKA 1CGSH 5DMJB 2DBJA 3BSZA 4DKDC 5DEFB 3OC5A 5T1MA 4DHLA 4YDVA 1BFOB 1DVUA 1AXSB 1DBJH 4OFKA 2G0KA 4A2HA 5AEAA 2BVPA 2O6DA 2DLFL 4XRCB 4WHTA 1N2RB 3MRJA 3GMNB 3ECQA 5C0IB 3JWOL 5FDWA 2AQTA 3NZHL 1S3KH 3L5XH 2CG9X 5B4MD 2PO6C 4WI4A 2HH0H 1AXTL 1RPKA 5H8DA 4ZD3L 3STLB 5CGTA 1I9RL 1AGEB 3DI2B 4MZRA 2XFXA 4JCWA 5DUPH 2F8OA 3IKKA 5FW6A 4TVPH 1WISA 2E7HA 1HDMB 3EJJX 3OB0K 4FXLA 2ATKB 1QBMH 2EE9A 1ACXA 2WZ6A 2X2HA 3SPVA 4HA1A 2YQBA 1M9WA 3LXCA 4PD4K 1KB9J 1TPXB 2QSCH 4JFFE 2QL1A 3UBXG 4TUUA 5EUOE 4LEOA 1HZKA 4FG4A 1R3JB 2I60L 2BRQA 2CRZA 2IOOA 4JFOA 4OF0A 1KCUL 1L9PA 3QWOB 3IVKA 2DQDL 2V5YA 1ZHKA 4WNSA 2HKFL 5I8OH 5CLWA 1PNDA 3GSQB 1YMMA 1CDBA 3OZLA 4L3AA 5F7KC 1YEKH 4UT9L 1CICC 4MJ4A 3O2VH 2F0CA 4M7LL 4UDUA 1I9EA 4Y5XB 4QI3A 1EAQA 4FI7A 4KK8C 3V8CA 4AIXA 4JFUA 5BZZA 4GAJL 4EXPX 2EUZA 4F57L 1ASQA 1F4WL 1Y6NR 3MBEB 4KPHH 1T03L 3GSRA 4X7TA 4HIIA 5DMGC 3X12B 3O9WA 1N6QL 4X8JB 4CN6A 1QBLL 2Q9OA 3NN8A 5K39A 1EEUA 4YZFE 5D2NC 5FA4A 1P5VA 5CO1A 3VSVA 4ZX3A 2QVKA 4EIZC 5E8DH 2KUTA 3U7WH 1J8RA 3FFCA 3MV9D 4MNGA 1RPQA 3UBXA 1U8IA 2W38A 2LGNA 1UM4H 2F61A 3ETBF 4XODA 3QEQD 1JWUB 2DWYA 4HUVA 3A6CH 2CMRH 2RALA 4Q52A 4X9BA 3MLVH 2KI6A 4BZ1H 3CX5K 2F54B 4Y5YA 5DHEA 2BSSA 2GK0A 3EOBB 4J23A 4P05A 4NCC1 3IKCA 4K4KA 3E0GA 4Y4KD 5D7SH 5FA4B 4IMKC 2WD0A 1UT9A 4DP9X 3DRQA 5FA3B 2OS7A 3TO2B 3VD9A 3WSQL 3KPSB 5TF0A 4HLZG 1WFIA 3VG0L 5C08B 4XPHH 3RQ3A 3ZL2A 2BERA 4K3JH 2MHAB 3UTPD 3ZU8A 4BKLA 4PSPA 4J4PD 5A6LA 3ZTCC 1HCVA 3GPSA 2EVFA 2PXYC 3CVCA 5FEBA 4M1DL 1WTGT 1L7IH 5AZEH 5AAPA 1R5VA 5CD5C 2NY5H 5BZXA 1MFBH 4ZUVA 2LFEA 1VGEH 3LCYA 3TBTB 5K9QG 1KFAH 5AW9B 1DQMH 2NR6C 3EJUA 5L6YL 3M46A 4UTAA 2ZUUA 1BG9A 3EKCA 3TBVB 4Y2OA 4L4TE 2EDQA 4NQED 4QD2E 4AMXA 1WC7A 3JV6B 4FQHB 5CEYA 2DS4A 4HAKA 1LEKB 4NC1E 1I75A 2APTA 2DLFH 3BWUF 2Q6WA 3ZQWA 3PPSA 5G2NA 1JCVA 2ARJB 1QW9A 3CCHB 3JWOH 3K1KC 3NZHH 2AI0H 4JRXB 1UZ6E 4KQ4L 3MVSA 4UWQB 4AM0A 3ZTEA 2B1AL 3SGDI 1AXTH 2P49B 3I6LE 4ZD3H 2A74A 1WWWX 1I9RH 2JIXA 5TDNA 2WJ5A 4EKJA 2P5WB 1HHHA 4WGVB 3PYCA 4YAQB 3A4DA 3SYOA 3WNJA 5HVGB 3UTQA 5IM7B 5FFGA 5GGUB 3RWGB 1JF1B 1NKOA 5FOBA 4Y2DD 1NGPL 5AVQB 3MRRA 4MDIB 3ZKQD 4M62L 3FRPG 4IEFA 3US9A 4K3HA 3MODL 2VISA 2OXHA 3LZFL 1SXCA 4K5OA 2I60H 1OHZA 1KCUH 1PY0A 2BXYA 5KSBE 2DQDH 2HKFH 1S7UB 3LKQB 1BBJB 3CQQA 1YJDH 4EOWL 4RGMB 4Z7UB 1CD1A 5AALA 3S8GB 4YBHA 4ZMLA 3SDAB 3D48R 1U8QA 3IF1B 1BZ9B 1EJ8A 2DF3A 1KLFA 4TYUA 4UT9H 1F6LL 5IIEB 4M6NL 4ZDHB 4M7LH 3BAYA 3S2AA 5AB0A 7TAAA 4I88A 5EEXA 2AQ2A 5IROD 3NT0A 1X5AA 5KYXB 4WJG3 3G5XA 3EJTA 4WO4D 3ZL1A 2CO3A 1GMIA 3NH7L 3DK2A 4I1RA 4GAJH 3D85D 3TFBA 4F57H 3RLSA 1F4WH 3GMLB 3UP1A 5DD0L 1T03H 1N6QH 2ITCB 2YD1A 2BWDA 3CBKB 4HU2A 1A3QA 1QBLH 3PP3K 1TJXA 2NX5D 3SJVB 2XPGA 2IH1B 2DZEA 4PG2A 5FFLA 1ID2A 3N42F 1I7TA 4TQHA 2JLLA 3ZE0E 2VIRA 4X80L 4X0NA 3RWIB 4LLVB 1W15A 2EUWA 3MLWL 4I89A 3BVWA 3UAEA 4H8WC 3V6FB 1XBDA 2Q3AA 4DN4L 2GJ6B 2NY2C 5DVKA 4ACTA 5A2IH 3RWCB 5GGQL 4B50A 4PCYA 1E8YA 1I8KA 1NBZB 4I1PA 2IANA 3HI5L 3RWEB 5FM5M 1TQVA 4QXTB 4Z7OB 1BQHA 1NGZB 2VDKB 3VWKD 2UXGA 2WY3B 4PCTA 4GUOA 1CGVA 3I6SA 5BVPL 2ZYSA 4XN4A 3WSQH 3RNKA 4IU2B 4HMDA 3VG0H 4L2LA 3MNZB 5GGRA 3A3YB 2Q0ZX 3F7KA 4QHUA 3DECA 1KB9K 5FYLE 1XH1A 4JRYE 2WIIA 4OJDH 2ETWA 3QIBB 1MCSA 2ENJA 1YY8B 4OUUB 3S37L 4JFDE 4B9KC 5IBUB 4FFTA 3U6XA 2NNFA 4LL9A 3TV8A 4R3SB 1WF5A 4M1DH 2J71A 3DSNA 2P7TB 5HVHB 2EVGA 4MXWL 3UEZA 4MDRA 5PAZA 4FA7B 2A99A 3NG5A 2NY3B 5EF3A 3G6JE 1GW0A 1PKQB 1C16A 3HE6A 3MTRA 5JW4M 4YMPA 1GYWA 4MCZA 1F6FB 5L6YH 1YPZB 4NLHA 4GEIA 5I8CB 2YXWA 3K6SA 2ADFL 2KZWA 4EQ3A 3P40A 4IRSC 2JLPA 5B1BB 2CGZA 3OHMB 2WQRA 5FYKE 3UCQA 3DXAB 1UXWA 4KQ4H 5IQLA 1M71A 1AY1L 1UCBL 2CM6A 1UENA 4H88L 2NYZA 4EKXA 2VWEE 1OWWA 2ZWSA 3QH3B 3L4CA 1Q1PA 2B1AH 4YDJA 2HWZL 4MA1B 3BEVB 3I02A 4GSDL 1D9KA 4NKMA 2PCFB 4IGBA 5FGBA 1ZGLB 1H19A 1JXKA 3PWLB 1PYWB 4KNTA 5I1LA 3WJJA 3SCMC 1EHAA 1T83A 1NGPH 3CHOA 3G7TA 4ONGL 5H4ZA 5JA9A 2EXTA 4Y16D 4WI6A 4M62H 3UIZA 4ZS6D 4ZW5A 2V3EA 3ULAB 2VERN 2P4AB 5DS8B 3H0TB 2BVOB 3PWUA 3MODH 3ZZQA 4I13B 1P7QB 3C9NA 3LZFH 2ZXCA 4P23D 3VE0B 1H0DB 1JTPA 3DOIA 1GXEA 5F6IB 4AUUA 3IGKA 4PJHF 4EOWH 4YE4L 3OMIB 3TV3L 3FB8B 1HU8A 4HSQA 2FR4B 1QEWA 1U3HA 3L1GA 4B97A 3QORC 3V7MA 1D5MA 1CBVH 3ZE2B 3KBFA 4M6NH 2B2XL 4GG6E 5C0CA 1FZOA 4HBQA 1TVHB 2YOAA 3G08B 3HMXL 5INDB 4IKJA 1SDDA 4AYDC 4H1LH 4MMXA 5DZNA 2E59A 2A6KA 4KMLB 4NRYA 2ZT9C 3NH7H 1MHPL 3DHUA 5GRXG 5DD0H 1P5UC 5T1LB 2J8UA 4YIQB 3MCYA 2E47A 3WELA 3QEHA 1NDGA 1PG7X 2AJUL 3ZRCC 4U05A 3HCVA 3UROR 3KYNB 4E5XG 2BH0A 2PWGA 3M45A 4X80H 1H3UA 4LSTL 4KRPD 2V7NB 1Q4NX 5D4JA 1X9RA 1JXDA 2A9DA 4P2RD 4DN4H 5SV4A 3CH8A 4BUQA 1BYPA 1E9QB 1N3NB 5E9NA 4PBVC 3S36H 5EOCJ 5GGQH 4BQ6A 3CC5B 3E6HB 5J3HD 3HI5H 4FADA 2OAAA 1UOWA 1TQBC 4QTHB 3JV4B 2BY0A 4RBPK 1MFCL 4M7ZC 1INQA 1X5KA 1LDPL 2OSXA 4KOCA 4M4PA 3MNWB 1NFIB 3KBHE 5BVPH 5EUOF 5JYMA 1UJ3C 2F8IA 4KK9D 4YHNB 4LNVA 5DI8B 4XVSH 1I7UA 1K2DB 4IU3B 4PRNA 5D1QB 2V9QA 2WLIA 1AAJA 4N9GA 2WZPD 4HJUA 1FVEA 4PI2A 3C5XA 3TM6A 2PWDA 2ID5A 4V1DE 2MKLC 5DEGA 3EZJB 3VFMA 3FUDA 3S37H 43CAA 4E5XA 4PLNC 1UZ8B 3HC0A 3T71A 4F92B 4YSUA 3IDGB 1IC0A 1JPFB 2W80C 4MDJB 4MXWH 3HHSB 4LZKA 4XX1E 3L5WA 2W9LA 4G70B 3HBGA 2BSEA 3FUHA 2AQNA 4PJFA 2PP7A 4PP1D 1LK3L 5L0QB 3RFZB 1S6NA 2CO6B 2G4GA 2WBXA 2FO8A 4PS8A 2XFGB 1YDPB 5F7UA 4CU8A 1QSFE 2NSMA 5SWSB 2ADFH 3SCMD 2PETA 1DCEA 3KLAA 3FXIC 3ARBA 3R18A 4NJAL 3P2BA 5M94B 3CBRA 4G8IA 5DZVA 5ESAA 5J06A 4OI7A 1T1YB 4UT6L 2EYRB 2ITEA 1AY1H 1UCBH 3UAJD 5ENWA 4H88H 1FZKB 4NO0B 1NC4B 3PY9A 4YHKL 1J0IA 3V0VA 3S9DB 2HWZH 4N1EA 4O2CA 4LLAA 4M5YL 3FB6B 5A7BA 4L9LC 3H42L 1VCAA 4GSDH 4FMVA 5C1MB 4UNIA 3IU4L 4QWWC 4LMQI 3MKKA 1I85C 5EZLA 4YN3A 1DVZA 1F4XL 2KL6A 4BHUA 1EZSA 4LLMA 4CVXA 2FCBA 1MCJA 3LY6A 5FK9A 4GO6B 3SD5A 1YAZA 3CSGA 4G42A 4ONGH 4QRQB 5H2BB 2GTWA 3ZTJH 1N9PA 3QRBA 3D8MA 3VFOB 4BCYA 4HCRA 1FVDA 1V3KA 4ONFL 3VM5A 5L8KB 2AK4E 1HHIB 2ENPA 2DEYX 1FFTB 4RAUA 5A16A 1IBBA 4HP5A 4YE4H 1VACA 3TV3H 3T9WA 3FTGA 3K3QA 2WM0A 1JZ4A 1W72L 3SDYH 1D5ZA 1UEYA 3WU1A 1DVSA 3IFOB 5FOJA 3SKUD 3HMXH 3ARFB 4Z7NB 3KNBB 3VGAB 5C97A 1TLMA 3DGGB 3APNA 4NDMA 5JIHA 3QQ9D 1MHPH 3MRQB 1J12A 1JWMA 3Q5YA 1NGWA 1G0DA 2OXGB 2Z7UA 1IGJB 3MJGX 1BD2E 3OBAA 4U6HA 5A43C 3FO1B 3MJ8A 4N8CL 3NBNA 2AJUH 1M57B 1KTRL 5EEUA 1UZ6F 5C0GA 4Y4FC 1YUKB 3UZVB 4ENEC 5HP5A 3KLKA 4RMQA 4NZUL 2PO6B 1KGCE 4LSTH 3UMNA 1MHHB 5IF0A 3K2UL 4MMYA 1BOYA 3GHEL 1JZ6A 4JKPL 1M4KA 4G2AA 2VN3A 3C6LD 5HYQA 1NCWL 2GB2A 3EGSA 1RZ7L 1MCBA 3ILPB 4M93C 5B1AB 1QNZL 5BO0D 4LCWB 3B9VA 1NCCL 1OEZW 3K6IA 4MQSB 2DQFB 5KOVC 3TOPA 4XXCA 1WZ1L 2FUTA 3M7OA 1LEGB 1MFCH 3M88A 3R0MA 3QO0A 4UF7C 3QT2A 1LDPH 2RQEA 1U41A 4PAZA 4OVVA 2ZPKL 5F9DC 3ZLQC 4IDLA 1II4E 1NBYB 1E42A 1RIUL 4YGAB 5ALCL 1KPRA 1H15B 1R3HB 2X5PA 1EHKB 2CGYA 2E7MA 2QHLA 3HC3L 1PD1A 1Q90A 4F7MB 3CD4A 1AE6L 4E42A 2CGRL 4O02H 3ZL4L 5IB2A 3CVDA 2DM4A 1AQDB 4F9LC 3V7AG 4UTBL 1W80A 2YS4A 4AENA 2VAJA 1CICB 1JNHA 1TJGL 4ODUB 3ASNB 1BQUA 1LHZA 5DA0B 2VQ4A 5LBVA 2WLMA 4WUUB 4X4YA 4OZFG 1C9SA 1FWXA 1LK3H 1SFHA 1JXJA 1DSFL 2ENSA 1R3IL 3IMRA 2IGFL 1HHJA 4RMTA 1GGIL 2F74A 4WI0B 4AJVA 3BAJA 2FBRA 3RBGA 4Y9CA 2AJYL 3J27A 4LHUB 5D2NB 1H5BC 3D50A 3QWRD 4NJAH 1MI5E 5B7FA 1N4XL 1N0LB 1BJ1J 4UT6H 3B1TA 1ZS2A 4DSYA 5E9DE 3NFNA 5IFHL 2EDTA 4ODHL 3S98A 4YHKH 1AR1C 2E6PA 3ZDWA 4PJEE 3ZVVA 1X9LA 4PJDE 4M5YH 1AQHA 3H42H 2GK2A 3ZYZA 1M56B 3FDWA 1KG0A 1CDCA 3IU4H 4YXHL 2YRPA 4IIQC 4QOKD 5TE6L 4YHYC 2HFTA 3BZ4A 4ZSOB 1F4XH 1BVOA 3NABL 3VFNB 1YEHH 3GXUB 2HLAB 4HKBA 4DKTA 1F2QA 1ZT4B 2EEAA 4QGTA 4OGAC 4RX4A 4OZFA 5CBEA 1UOKA 4MYPA 1XGRB 1KXVC 2IIJA 4N22A 1CG9B 1ET5A 2KLTA 4HWZA 5K33A 1KTDB 1WWBX 2MCMA 3BMWA 4ONFH 3Q43A 3MNDA 2WBJA 1J11A 4I9XA 3DBSA 4JFED 3MRDB 5CINL 1GGYA 4G71B 4PRHB 1UJTA 3IMSA 4AX3A 3BUTA 2OR7A 2PXYB 1W72H 2JCWA 4OV5A 1PNCA 4JS7A 2Y72A 4IIZA 4PJIE 2WYZA 4WU7B 1EA9C 4EZKA 2Y1AA 4OGYL 4QXWA 2VZSA 1YEEL 5CIPA 5KAQF 3GZKA 4F7PA 1J9CT 4Z0XA 3TURA 3VRJA 3GDCA 5AW5B 2WWMD 5F7DA 3FQRB 4PJFF 1XT5A 4Z3TA 3P9WB 4GMSL 4NZDA 4Z7WA 2WLLB 2FQDA 1IGYB 4G9FB 3ULVF 4IJTA 1DVFA 2Z31C 3LRMA 2PYED 3HPLA 1KTLB 2HTKC 4YC2C 4UTCA 2HCZX 3ZKXC 4F7CA 4XI5C 2BCMA 4G5ZL 5IOKA 3K2UH 4L18A 1U8KA 3GHEH 1Z9SB 4JKPH 1UEMA 5I71C 3WG7B 3ARDA 5AVRB 1BG1A 1NCWH 4GXUN 4WSKA 3U7AA 3B9EA 3MR9A 3WHXA 3VXMA 3MUHL 3DHMA 3FT9A 3DX7A 4GAFB 4X6CA 3W5NA 1QNZH 3VUAA 1EDYA 2NLJB 1SXSA 1WZ1H 5EBGA 2DL2A 5CCJA 2WKOF 4AQ1C 1RZ8A 4GFTB 1ZWIA 5HHOA 2AQ3A 2GBVA 2X6MA 2ZPKH 4OGQC 4N9OB 3V9EA 4C83A 1GS8A 1RIUH 5ALCH 4UDTA 4FULA 1S7TB 3HC3H 1AIFA 5SX4H 1AE6H 5EO9A 2H3XC 3C6SA 3TIEB 1QRNA 3ESMA 4Z7VB 4L3EA 3ZL4H 4JNXA 4TV3A 5EU5B 3L3DA 4UTBH 3N1FC 3BDXA 4PM1A 1QFWH 5A3ID 4AEFA 3HG1B 3DHPA 3R0NA 4BM7A 1TJGH 5KYUB 2CR6A 4V11A 1AKPA 4QAMB 2XNAB 1S8DA 5F0MB 2JCCA 4W81A 3BWAB 3BGMA 1XGTA 2E5EA 2VR5A 1WV7T 3DTDA 1DSFH 5F7NC 1R3IH 2IGFH 1GYVA 2DWEB 5MEPA 3MROB 3HPJA 4QXUL 3PV6B 2FWSA 1GGIH 4A7GF 4IQHA 3MRLA 2RR3A 4OGAD 3F7YB 4B3VA 1W16A 2VJ8A 1BHGA 5HDBB 4OLWL 1N5AA 3OKEA 2P42B 5AW1B 3WFBL 2FLMA 1JUFA 1N4XH 4MJJA 5GGVL 3GBDA 2BW4A 1I8IB 4TNGA 1R47A 1UKSA 4EEEA 3MRNB 3MOQA 5IFHH 4ODHH 3GHPA 2JQAA 1PG7L 5KWYC 3FAXA 4HJJL 1SHMA 2NY2B 2YSTA 3WI9A 3H3BC 5L2KE 2H47C 1FPTL 1SDAB 4YXHH 2E8YA 3B4NA 5TE6H 1P1ZB 3C60D 1IKNA 4DUWA 1XHHA 1Q9WA 1DUZA 3MRKB 3U83A 2ZXDA 1X4ZA 3NABH 1T0OA 3QG6B 1U8CA 3IU3A 2RA1A 3K72B 3KWWA 4U1LB 4MS6A 4U1MB 5IV2B 4N6QA 2BVYA 3GUTA 1BYNA 4LLQB 5GZOC 3LKOA 2YOCA 5EZJB 1LD9A 1GGUA 1G7IB 5AB9A 3UERA 3BH9B 5CBAB 1IM3A 2XN2A 3LNFA 3OB8A 4WDIB 3UTSA 1SXBA 3ARZA 3ZR6A 1TZHA 5HDRA 1C08A 5CINH 4P2RB 2P5ED 2EDWA 4LSQL 2F7QA 3QDMB 3GSOB 3FB7B 3TIDB 2FZ3A 4JVUA 2V3FA 4XMVA 3VRIB 4DGYL 2FYYB 4JY5L 5JO5A 3W1ZA 2M8XA 2ZX9A 4HUWA 4OGYH 1L9QA 1YEEH 4KI5F 4P46A 3WFHA 2BPBA 3RWDB 1OAQL 4I9WE 5MERB 1ORSA 4O51B 1KLGA 4J3XA 4FD0A 4OKDA 4FZEL 5TD4A 3OSVA 3LKNB 3MLTB 4GMSH 1LTXA 4IRSB 3Q2CA 5FYKU 3C5SB 4IRJA 1NIDA 4XP5L 3UP6A 1CXIA 1K8DB 4ODSL 4IRZA 1EHNA 2BSRA 3B8SA 3AZUA 3MLYL 4LP5A 2F5AL 2YR3A 4BH7A 4F91B 1BQSA 3WE6B 4G5ZH 2XRAL 3ZDZB 2F08A 1U8HA 1DSWA 3GT6A 3TPKA 4HJ0C 4E9WA 1HFUA 4GLRI 4PN6A 5KN5B 4I3GA 4APQD 1SVZA 2X2UA 3TVMD 1TOXA 3PDDA 4AQAA 1V3JA 3T6WA 2FUQA 2H32A 4JO2L 1B2WL 2WKGA 2AMUA 5LG1A 3FMGL 4D9RE 3FPYA 3SCMB 4GS7C 5KBKA 4YNYA 3RVWD 4A66A 4BWUA 3INUL 4QHKI 5HYJA 4KVNL 4N5EC 2WXGA 4Y19E 4X6DF 4YXLL 5FUZL 3U36B 5E1IA 2V2WA 3F62A 4I7ZC 3CZFA 3G6DL 2QTVA 4HG4J 2CU9A 1G87A 4XMUA 1IC7L 2C9RA 3LKRB 2YPKB 3A4AA 3WENA 3O8XD 1P6FA 4K94C 5C0AD 2J1YA 5B21A 2WXKA 2OP4L 1XZ0B 2XG5B 2VDKL 3QORB 1OGTB 2PW2A 4PJ7E 1TTUA 3RTQD 4BFOA 2F6AA 3MX0B 2MCG1 3CFTA 3QQ3B 4AJYV 4JDVB 3GSWB 3QB7C 5TF1L 1R9FA 3TL5A 4JE0A 4K9EL 4MFHA 1O5DT 2MTAA 4U1KB 4JY6B 3IXTA 2YBRA 2CE6A 1P5UB 1QASA 3F6IA 4QXUH 3CZNA 3UTTA 1YYML 4EIGB 3P9LB 3IRCA 1XV8A 2YBGA 4F33B 3PAZA 4OLWH 3OLEA 2QR0B 3NSJA 3WFBH 1DO5A 3QFDA 5GGVH 1XSJA 4OGZA 1QLRA 1WAPA 2B9AA 4YZWA 5ICUA 1XDTT 3ZDXB 1PG7H 2V9RA 3J8F7 5JXEA 3ZGIA 4HJJH 4A2GA 1CWVA 1LQSR 4KVPA 3E6FA 4XN8A 5LN8A 4AEHL 4FL4C 1JGIA 4X8XA 1FPTH 2XIIA 3CFBA 1KEGL 3EJYD 3QQNA 4DAGL 2E0PA 4KTEL 3VFUA 3CQPA 4CSZA 2FH6A 2JELL 1TQBB 3W37A 4WFFE 2BP0B 3PS6A 4LU5L 4M7ZB 1WCBB 3BJ91 1OM9A 5DS1A 1TZIB 4MKMA 3I6KA 2DKMA 4OLEA 5DMYA 4X6CF 1UJ3B 4N0FA 5DZJA 4MBOA 4ICXA 3QI9D 4JQVA 4NQDB 4G6KL 4OM0L 3SYCA 3JVFC 2X1WL 4LEXL 1ESOA 4PJXE 2D7MA 4LLDB 2I5YL 1E40A 4LLYA 4LSQH 3MGTB 1EAOA 1XF3B 4I87A 2NZ9C 4A67A 5ISZD 4URKA 3SYPA 4XBPB 4DGYH 4JY5H 3JVGC 4JCLA 1M6OA 4XOCA 3GF8A 3IJ9A 3BDYL 1MRFL 5SX5K 4HETA 3J2PA 3HZKA 1CJYA 2YAOA 2R23B 3D3VD 3O45B 4NHCH 1TYJA 2XV3A 3I9PA 1OAQH 1G7HB 3CPLA 5DRXA 3ZMRA 4Z78A 2MEJB 5JHDD 1T7WA 1W9XA 2JCCF 4FZEH 3ATEA 2XZQL 4NQCE 2NY1D 1KGUA 2HG5A 2AS5M 2DQIL 4ZFZB 3P77A 3QDGB 4UIMA 5B1JC 1OGAE 1DQJA 4XP5H 1IILE 4OV6F 1A6AB 1A7RL 1IAII 5SWZA 3UO8B 4ODSH 4XH2A 3MLYH 1I9IL 2FD6L 2F5AH 2UY7B 3CLWA 4OT1L 2AAVA 5F71A 5JIKA 2XRAH 3VXQB 4I0PA 4OY9A 1EAPA 2B5IC 1OARL 3BPCB 5AVYB 3NSFA 4YGVB 4L9LB 4BINA 3D2UA 4L8SA 3FQ4A 2MOVA 4AIOA 5AKVA 4JO2H 4BQCA 2A0LD 1AD0B 3UCRA 2O26U 1B2WH 1OGSA 2H9GA 3FMGH 4OFIA 3V0DA 3MRPA 3ZUNC 2IXQB 2E9GA 4GW5A 4QRRB 3INUH 1YC7A 3U2JA 1IEBB 1TYEB 4KVNH 3F5WB 1ICTA 4IK7A 3ZZ1A 1T1XB 3EBIA 4QRPB 5EORL 5FUZH 4LPCA 4YXLH 4LEEA 4C56D 4XNBA 5KSUA 2PTVA 3FONB 4UOJA 4FABL 3RVVC 1BXUA 1JZJA 4XZ4A 2ATPB 3X14B 2OQJA 3G6DH 4OZHA 3TZVC 1ZVSA 4KXDA 3EJZC 4MKTA 2B77A 3E1ZA 1HE8A 4P5RA 2WAHA 3MV11 4WWKA 1V54B 4R0LA 3EG9A 3HHMA 2OP4H 4TOYH 2VDKH 1PX8A 3GSXA 4G59C 4QHMA 5KVEH 2HKHL 1FYTA 2Q7YA 3BUIA 3WS3B 1L0PA 3ZHDA 5GZND 1E28A 4LPVA 5LGYA 3H4HA 2PCXA 5TF1H 1HN1A 4K9EH 5A1AA 3W11C 5CGYD 4NN7C 4EF3A 3QUZD 1YYMH 4YHML 1BVLA 4NENA 1M2VA 1PS3A 1ILSA 4GIPD 3QXAA 3QFJE 5IBLC 1BM3H 2BMKB 4Y4FB 4PJ9C 1RUKL 3TN0C 1JAEA 5LNDA 3GHBL 3DC0A 5FHAL 1FIEA 3L17A 3SZ6A 1XH3A 1JHKL 3LV3A 4QCIB 3LB6D 2VQUA 3B2XA 4W9EC 2GSMB 3K91A 1HQRA 2W60A 4K0OA 1N18A 3MN8A 1CDYA 3HUJB 4JLRA 4LEBA 3T0VA 3AWFA 2CKBB 3UZEA 4AEHH 3VNZA 1HJCA 2R0WL 2JQMA 1KEGH 4DAGH 4B0MB 12E8L 4M93B 4KTEH 3WDHA 1E2WA 1HEJC 2H0FA 4D0BB 1I1YB 2JELH 4XN1A 4UQAA 2EEDA 4LU5H 4F7TB 2E75C 2WINA 3H7BA 5DYOA 1JYVA 3B37A 2WXLA 1HSBB 4MJIB 4UINL 5AAMC 5I23A 5D96C 1BEYL 2HVJA 2Y7QA 3ZYOA 4PGDB 4JN2B 2JFCA 3V2AR 4OM0H 1XIWD 3HIZA 4G6KH 4PGCB 3WL9B 5C86A 4YSTA 4LEXH 4HK3J 3V95A 4HUCA 1EIBA 3M86A 2R2EA 3MV8E 4XWGL 2BVUA 3WJMA 3PG2A 3ULUL 4J3VA 3QAZC 2I9LA 4ES8A 1N8OE 2H2SD 4AGLA 3T0EA 4AMWA 4M7KL 1FH2A 1RUML 3GSUB 4HG4K 1FN4B 2OL3B 5HGBA 5C9JB 1DQLL 4GBXD 1EH9A 5KBMA 2FJHA 3S6CA 3BDYH 4JHZA 1MRFH 2DQ6A 4JK0D 2Z93B 4ELMA 4XE5B 1QAWA 2MNJB 4N8VG 1MCIA 4N1CA 1J9QA 3L9RA 4Q74A 3MJ7A 3A47A 4S1RL 2XZQH 5DUBB 3VXUD 2DQIH 1FHNA 1H5BB 1MJ8L 2FX7L 3SY0A 1A7RH 2CM5A 2EEFA 3RVVD 4PR5A 5L2JA 1FL5A 1I9IH 2CAKA 3QPXL 5D2LA 2FD6H 3UPRA 4HWNA 4OT1H 5IHZB 2XQBL 1AR1B 4U1JA 1IM9A 4Y1AB 3RRQA 3EYOB 3VXRD 1OARH 2F7RA 1KIRB 4JDZB 3U7YL 1I8MA 4HPHA 4F5CE 4JQXA 1WWCA 2J20A 3PABB 3U4BL 4LLUB 5J9PB 4X8GA 3VFRA 5JHLH 3ZMEA 1T66C 2XWJA 4EPSA 5IVZA 3VXPB 3VD1A 4IIQB 4YHYB 1U42A 1XR8A 5EC1A 4AYBA 3GTTA 4U0QB 4PGEA 3PWJA 1H9DA 1P4LB 4RZKA 4UILL 3T3PB 3ZUCA 1X7QB 1OPOA 1LL1A 2YQGA 1K9TA 3CLFL 1Z3RA 4N8VA 5EORH 2O6PA 5KVMC 1DE4B 4JJHA 4FABH 3VQMA 5HGHB 1RV6X 1I7RA 1NDTA 4ZAKA 1WD9A 4X9YA 5IBLD 2J57A 2ICCA 5D7LD 1I3UA 1XR9B 3ZRSA 3QDJB 1CGYA 4K71C 4BFFA 4C59B 5JIQA 1WBYB 1UWEL 1M9SA 4JG1L 2ZOUA 3DJRA 2HKHH 1SY6A 2BSDA 3FBKA 3S48A 3AU1A 1CE1L 2QQQA 3OKMA 4XAWH 3VWJA 3HHRB 3SBWA 2F58L 4TS6A 2WUCL 2OFQA 5BQ7A 3BWUC 3FT3B 4OIBA 2NUTA 3WIHA 5IUCA 2VITB 2YAHA 2VLLA 2ZKWA 3RJOA 4YHMH 1NEPA 1O6SA 1JGEA 1QATA 2D3NA 1NFKA 2Z31B 1FAIH 1PFCA 5DJDB 5DWPA 4RIRA 1RUKH 5MENA 4L4JA 4YC2B 3LN5A 3GHBH 5FHAH 4EN3A 3GJFB 5GSRA 1JHKH 4ZFFA 3ETSA 5CSZA 4N68A 4XAKD 1JXFA 1TIUA 2EYTB 4PREB 5I71B 5EBWA 5DR5L 3X1EA 4GUPA 3K6OA 4N6RA 1VEPA 3OJDB 2YPLA 2R0WH 3OR7B 4XMKL 5CGBA 12E8H 1J8HA 5E00B 2ICWA 4PRPA 3IE4A 2X1QA 1H3GA 1KIPA 5DCCA 3QIUD 4FXGA 4GUQA 2VAAA 4AQ1B 5C07B 1FZJB 2ARWA 5IFAL 5D1XC 2QQLL 5GRVK 4UINH 1TNNA 4U6VL 1BEYH 3NJVA 4EI5D 4TKWA 2X12A 4R26L 1E5CA 2PR9A 3BP7B 2NY6C 2NYYD 1A4KB 1PY4A 1ZKAA 2F53D 2VRQA 4K73A 4XWGH 4P59L 1ACCA 3ULUH 2Y2WA 1KBWA 3HR6A 3VXNA 1A1OA 4M7KH 1RUMH 3DMMA 3LX9A 3ECWA 3PWVA 1AHWC 1W0VB 2VXVL 4H8PA 1I82A 4P2QA 2OJZL 3FCGA 1DQLH 1YUHA 4TUOA 1RI8A 4JFYA 5HHPB 5IR1A 5IFJA 2GJZB 1U21A 2Y6TE 3ZZLA 2AHIA 3F83A 1DVYA 4CW1A 2Z92A 4CC4A 4S1RH 5J6HA 3OZ9L 5DJAB 3HN3A 4MVBD 3ZTNL 5HVFB 3VNYA 5D1ZI 3PXJA 3T0XA 5A7EA 3B7RL 2HRPL 3RJQB 4WNQB 3DUSB 1MJ8H 4NHUA 2O61A 1JV5A 2FX7H 1MFNA 4FXTA 2NY0C 1IT9L 3QPXH 1WA0X 2XC8A 3MRIA 3QA3B 2XQBH 4GKLA 3L7FA 3H7LA 2W59A 1LJMA 2WZAA 4ZQKB 3U7YH 4XR8C 2VL4A 3KPSE 3U4BH 5T3XE 4LLWA 4BCZA 4L8DA 1UA6L 3IGUA 4ZMVA 3WNKA 3MMEA 4BSWB 4FF9A 4IOIB 2GHZA 4GXVL 3L3OC 5AD0B 4AYID 1WD8A 1FL3B 4NQSB 3BZFA 3CLFH 3CHRA 3QISA 4I3SL 5HDOA 4LPWA 4A38A 3GMPA 4Y4HA 2R1YA 3I3BA 4QRSB 2V5TA 1OY3B 2C9PA 3WEXA 2QLYA 5AQ0A 5BW7A 3VGDA 5CD3A 5J4MA 3U48A 1UWEH 1BV8A 3QUXD 5ICZA 5DJ2B 1D7DA 3O6ML 2VDMB 2VLRB 1A9EA 2D4DA 5DC0A 2WLKA 3T09A 4HIHB 5KYWB 3CFEA 1CE1H 1TQSA 3O2DA 1OK0A 3SDDD 3MRFA 1FIGH 2F58H 3CSYA 4HIEB 4WNJA 4BZYA 2WUCH 5FWRA 1J0HA 5GSVA 4BUHA 2MCAA 4LKXA 4MA8L 4ZZKA 3FCSB 3WNNA 5AVSB 1TMCB 4ELMF 2O72A 2P5WE 3BVUA 5D1XD 5JR1L 3QQXA 3KEHA 3PHOB 2CO4A 2AQRA 3B7YA 2ICEA 4AY0A 3EZ8A 2A83B 4IMLB 5EHFA 1HOEA 2GEEA 2VUOA 4HUXB 1RFDL 4JUTA 3EO1B 4YFDB 1JD7A 2HT4C 2NDGA 4HCIA 4HK3N 2DMHA 4BFEA 1KCVL 3SBRA 3A22A 4XNMA 5IMLB 4PI0A 2DMKA 4IJ3C 2VLKA 1J86A 2XICA 1OLZA 4XMKH 5E4EC 3DX6B 3TO4D 4Y5YC 3V4LA 3ARGD 1U92A 3MGAA 1U6AL 2LT9A 3JWNC 2WNGA 1BREA 2BINA 3BH8A 3L7EA 4GS7B 5B3JF 5IFAH 3AABA 4Z7UE 3EJQA 2QQLH 3H9SB 2IEPA 2XVBA 4U6VH 2YGOA 3DVGA 3W9EB 5LLIC 5IGXH 5KG9A 4H8WL 2E4FA 4R26H 3KPOB 1SOKA 1OE2A 2TAAA 1XH0A 2HB0A 2VZ1A 1O7DC 4DTGL 2E7LA 3DA0A 3O41B 1A4JB 4P59H 1FGNL 4G7RB 4JFFA 1QG3A 4M8QA 5AVUB 1EXHA 2X3BA 4UBDD 4ZO7A 4HGWA 1HQ4A 2UXVA 3FU3A 3NACL 4RQQA 1NKRA 2OMXA 4KKAD 2VXVH 3SE3C 2OJZH 2L04A 3O3AB 2CLRB 3IPFA 4LSVH 1BZDA 4U6TA 4JR9L 3OWEA 5EU6B 2E86A 1YN7A 3FTXA 3IDIB 2NW2B 1QUNB 3AITA 2CO7B 4IBTA 1L5GA 1D7FA 3OZ9H 4KNQA 2HVBA 5F88B 3ZTNH 5KS9A 2GJ6E 2R27A 2HRPH 4PJBB 3FO9A 4AMKL 4X50A 4FQCL 3O6FC 3NEOA 1WICA 4AEEA 3IJHA 2HMID 1IT9H 1IL1B 1OTTD 2ODHA 2XVGA 4H7VA 2YWZA 5IQ9B 2VDQB 4Z7OE 3H6JA 2FE0A 1KZQA 4E41E 4BYHA 3QJFB 4YQXL 5KVEE 4MD0B 5C2BL 2V5MA 1CLCA 1YMMD 3N41B 4LOUD 1VKXA 4FL4B 4Z77B 3OAZK 2B3IA 2DM2A 1UA6H 3HR5A 4A6YA 1IGCL 2ESVB 5DEJA 4DKFL 5EH1A 2AV1A 4HDIA 4X6BA 2GC4C 4XZUB 1BF8A 4GXVH 3V52L 2WNKA 3F6LA 5I0YA 1IGTA 1K5NA 3MV7E 2HVKA 5GIRB 1PPIA 4MSWB 3V0FA 4D7PA 4I3SH 5FF6A 2P8PB 5DJ0B 1FNLA 3LHPL 1XF1A 3O9WD 4GY4A 4DP5X 5C0JB 5DJYB 4B6ZA 1NANH 1NUNB 5T5FL 2F7IA 2FO4B 4XBGB 2N3JA 1N6VA 1PKQE 1S78C 2CDGA 2FYVA 1MCFA 3AAZB 2HT3D 4N86A 1Y18A 3ML9A 4OJFL 3ALXA 1YPZE 3FFCD 6PCYA 3US1A 2R7EB 1T6BX 3O6MH 3CFUA 6TAAA 3RI5F 3QEUB 1MXDA 1GZPB 3AS3A 4OCNC 3FO2B 3THML 3KD4A 2Z8SA 3O2WH 3OG4B 2CUHA 4OZGB 5I16B 3T6XA 2BCKB 1A6UL 3P0YL 4XOEA 5EU4A 1UATA 2H3NB 1R5WB 3Q2LA 2ADYA 3RZCA 2JXMB 2VZTA 1N7ML 3S5ZA 4MA8H 1DZBA 3Q0HA 3CFMA 4F93B 1PW3A 2FATL 3LRKA 3P0GB 4E68A 2X4OA 4I2XE 4HFWA 4LF3A 3QO1A 2IH9A 3DPBA 4XP9L 2WXJA 5JR1H 5KSAA 4GRLA 4PG2C 2DYPA 2G9HA 3PL6C 1XF5A 1ETJA 4M1CC 3FAWA 4L4TA 1EUTA 4N87A 3BHBA 3FSAA 4I77L 1RFDH 2YQ3A 5AG8A 2B5IB 2K3TA 5D7JA 3W39A 1K8IA 1KCVH 3L2NA 1YG9A 3RILA 2NYKA 4DP6X 3CX2A 3B9AA 1QZNA 4JFTA 3VI4A 3V6OE 3BAEL 1BMGA 2AXGA 1U6AH 3KPMB 4UMSA 3B3BA 4RWYL 4C4BA 3HZYB 4X6EA 4BA8A 4CN4A 5HJDA 1JL8A 3TP4A 4UQ2A 3GSVB 4H8WH 1EQWA 3ZE2E 1B0WA 1P7KB 3ARVA 3QUYA 5GISL 2OZ4L 3QFGA 4K3DL 3DIFA 3EO0A 5T1KA 1GCYA 4HKJA 4MAYC 2IADB 5D6CA 3TZVB 1PZCA 4DTGH 5C0EB 3KYMA 4FNTA 1FGNH 1OAXL 2W5PA 2FEDD 4BFKA 4XPAL 4JDTL 1G84A 1PQZA 2F7PA 2OTUA 2X9XA 3PRZA 4HJ1A 3NACH 5KSBA 4MA7L 5DHYB 1SOSA 2YXVA 3D39A 3O6LH 5DJZB 2DM3A 3TPUA 1H9VA 3KLQA 1HHKA 3UC2A 1SBSL 4JR9H 4ZMZA 2L7JA 5I17B 3HE6C 2W94A 3FF7A 2B59B 4ZYKA 4DQOL 1LO2L 1AGCA 4NN7B 4ZNEA 5DVOA 2K70A 2RH0A 2R51A 5E8PA 1G1OA 2H6OA 2C9QA 1JG9A 2J43A 3KM2A 4M29A 4M5ZL 4AMKH 4XO3A 2H1LM 7PAZA 1S7SA 3OAYK 4PJ9B 1AGFB 1FLTX 1WGOA 3TN0B 4QNPF 3LNIA 5DHVA 4U7MA 3SDCC 2YD3A 2XXFA 4Z7QE 4AH2B 1SEBA 1UOVA 4YQXH 2DH3A 5C2BH 1MRDL 1B6UA 1S9KC 1D9KC 2YJQA 3LJ3A 5F93C 3OJMB 1ND0B 2ZUXA 4B27A 1HXYB 5D1QE 2BIHA 2WTRA 4MYWB 1NLBL 4DKFH 5F2FA 1M6UA 5HJ3A 2HFFB 3V52H 3F7RA 3SE9L 5DO2C 1T83C 1XL4A 5JLZA 4QHNB 4WV1A 3ZY7A 3SPGA 8FABB 2VRKA 4PHXA 5D96B 4EE2A 4MB4A 3S5LB 3VD5A 2VSDA 1I1CA 4G43A 4MNQB 3X3GL 3LHPH 3IFPB 5HJGA 1X5MA 1EEZB 5T5FH 2E6QA 1O7VA 2DQMA 4C4KT 1RK7A 3TEZA 2I85A 3PUCA 4G6AC 4YDKL 4OJFH 3QAZB 1D3CA 2BFVL 5GQBA 3DIDA 3KPLA 2CIKA 1U3HC 4JGMA 5C09D 4BKTC 5C6WH 5D6DC 3OKLB 5SWSE 1BIHA 1S7XB 4JRYA 5GGVY 5E51A 3C2AL 3THMH 2Y6SC 1ZLVK 1MQKL 4MJ6A 3BRDA 2KH2B 1S46A 3QK0A 1A6UH 3P0YH 4XPFL 3HRZB 4MA3A 3MCG1 3BLBA 1RJCA 1N7MH 3HB3D 2IAND 2WB7A 1AXIB 1QQDB 1IKFL 1MFDL 1M7IA 2EDOA 2FATH 3CDGA 1ZJAA 4OFDA 5EIIA 1LE5B 1P9MC 3DV6B 1ROWA 1KV7A 1ZSHA 1JHTA 2YD6A 1UC6A 3X11B 3IDYC 3BEWB 3G5YB 4XP9H 3SQOL 1D5BB 5HDLA 3KE0A 2Y5QA 1IVTA 3ULUE 1DUYB 1SPDA 3UPCA 5KS9F 3UGXA 4I77H 1YQ2A 4EDXB 2X44D 2B14A 4HCFA 5FECA 4EZMA 2BOLA 5D5MA 2NXZC 2VL5B 5D7EA 1PZ5B 5IEHB 1IUZA 5D8JL 4AYFB 3FQYA 5HYSG 4GQRA 2FJFA 2PNDA 2XKNB 4L3FA 5DC2A 3QNZB 4HHAB 3MGOB 5KANG 1CXHA 1E43A 4HUNB 1OSZA 5T1DL 3QEQE 3S3CB 3CFDB 3D06A 2DI7A 4RWYH 1T21B 2WVVB 3FH7A 2CIIB 4WLCA 2DMBA 1EFXA 1H3WM 5GISH 5BZWB 3FOMB 1S4IA 2OZ4H 4K3DH 1KWGA 2HX7A 2H1XA 4Z7NE 2CKBL 2Q3XA 2WXMA 1OAXH 4FTVB 4K71B 1FNEB 3RWHB 4XPAH 2J44A 4JDTH 5CMAA 5B1KA 2A6IB 2JV6A 3UMTA 4DH2A 4BDVA 2YLHA 1QTSA 1O9WA 2FECI 4MA7H 4TLSA 2BNQA 4Q6IA 1TG8A 5JPMA 4DW2L 2LQRA 1CFBA 1SBSH 1NIFA 1UASA 3PLYA 3HBZA 4IGBD 2DLTA 4N3UA 2UWEA 3ULVC 4LRIC 2GSGA 5EG6C 1GGBL 4DQOH 3FULA 1H3TA 1LO2H 1QZ1A 1RQ5A 2L3BA 2ROXA 2QSVA 2QVFB 3PWPB 4M3JA 2WTOA 4E9VA 3TF7C 4XO9A 2EH8L 4M5ZH 3NJFA 3EOYG 4NC0B 4JRFA 4MJ5A 1U3JA 3SD2A 3BXNA 5MHSE 1YEJL 3TYFA 1YZZA 3L54A 5K39B 1A6ZB 4JPIB 4LCWE 3P3SA 3OR6B 4NQEE 4YHIB 4NKOA 4PV8B 5FS5A 1NSNL 5TDOB 4AUJA 1NGXA 1W0YT 4NKDA 2P52A 3MOBL 5JW4Q 1MRDH 4G6AD 3VFVB 4QTIL 2R1XA 1IE4A 5E7FA 3QULB 1SEQL 4NRXB 5EU7C 5INCA 3NCEB 4CNIA 1A2YA 4KO9A 4ZUWB 3BGFC 1NLBH 1TITA 5D7HA 1U36A 2OSLA 1BBDL 1E30A 5DEZA 5C0BB 2VW4A 5C0CD 2JI2A 3SE9H 1KJ3L 3T8MA 2XTSA 4MXVF 4S11A 5D1XB 3AUWB 4L37A 5I6XC 3VI4F 4U1SB 5HHQB 4JO5A 4QTFA 3X3GH 3DETC 2NY6B 5GJSL 2V9TA 4NYLB 1EO8L 1VFBA 1GC1C 2DOCA 2JJSA 2Z6FA 3NOIA 4WAFA 2KPWA 4FFYL 1A64A 4YDKH 4ZMAT 4K7PX 5HSFA 5IREA 1JYWA 2BFVH 2KHAA 4G1EB 4L0PB 5HI4C 3U30C 2CRIA 4N0UB 2ZP9A 4PQXA 3WV0A 3X1NA 1AHWB 2VE6A 4QRTA 3D9AL 1ETZB 1IAKB 4BA0A 4JHAL 3C2AH 2Y25A 1MQKH 2OJEA 1KBKA 3S4SG 2MQ0A 2DMGA 2I07A 4BFJA 4IOFC 3DBXA 4XPFH 1L6ZA 1MCKA 1OAJA 3QE5A 1F18A 3N42B 2EIMB 3T1WA 1IKFH 1MFDH 2P24A 2K7QA 3PWNA 5BUPA 5L8JB 4TNVF 2YGPA 2BVPB 5J0BA 2X9YA 3QG7L 3SQOH 2OMTA 3MRJB 3MV9A 2Y69B 5FDWB 1QSFA 2NY0B 4QF1B 2CHWA 4ZSOE 1LE9A 5HDWA 4E0RB 3OLDA 3JZ7A 1KGIA 1SF3A 2NX5E 4LOEA 1WQVT 2XJKA 2N01B 2EIDA 5T33L 2XFXB 3T77B 3GRWL 5D8JH 2VR6A 3O4OC 2Y5TA 4HKXA 1ZANL 1OT4A 2WLYA 4IDJL 2ZE0A 4Y4KA 1E6JL 5T1DH 4XBMA 3L3OB 5I8KL 3SPVB 4FNPA 4W9FC 4S1SL 3VVWA 4JREC 1RP9A 4FXKC 1QVOA 5D1ZC 5IOPB 2KDYA 3N43F 3ZJAA 2KC0A 4HUKB 3IDUA 4FQQB 2V5SA 3BZ5A 2WQVA 4HT1L 3L3KA 1NBQA 4LEOB 1UH2A 5A2FA 2CKBH 3IVKB 3VFGL 2YXFA 3L81A 4J4PA 1XTMA 3ARBD 2ADIA 4XXDB 3BAKA 3FH5A 4GFXA 2XWRA 4MAUL 2K6WA 3FTVA 1XO8A 4KI5C 1HI6B 4M8RA 4YHLL 2E74C 5GRJL 2AV7A 3MNVA 1I4FB 4FMKA 4R4ND 5TE7L 1FRGL 4CMHB 4DW2H 2JJTA 3EGXA 3V55A 1CO1A 4ES9A 2WN2A 4A2LA 2F9BT 1C8QA 1GGBH 3CH1A 3ALPA 4X7TB 2F5BL 4NT6B 1N10A 4HUUB 5IQOA 4NI6A 4MXQC 2VDLB 3QXDA 2EH8H 1ZXKA 2OL3H 3VD3A 1WFUA 2OW7A 2VMEA 2DY2A 2QSQA 4TTDD 1YEJH 2UV3A 1NFDF 1OHQA 4MNGB 4FQIL 1U8IB 2Z8RA 1BD2A 5MEOA 4LCIL 5LNEA 2UYLA 4D9LL 3DOSA 2XSKA 1NSNH 4G1MB 4AI7A 5CLTA 1GJIA 4HUVB 2FX8L 2Q20A 3DUUA 3MOBH 4PTTA 4QTIH 1WFOA 3KDMB 4IJ3B 5HI4D 1SEQH 4R96A 3NEXA 5E4EB 3T2PA 2IPKB 4Y5YB 2BSSB 2GK0B 3MSPA 2O4EA 1BBDH 5D5MF 3IKCB 4Z7VE 4DT2A 3FB5A 2B9BA 3RIAK 4Y2DA 1KJ3H 4J1UA 4GAGL 5DFAA 4PY8J 3OXRA 1G4MA 1P84J 2EO1A 2SEBB 4PJHB 3JTSA 2G3NA 3GEFA 3HG1E 1V3MA 2I24N 1P2CA 2WBJC 3BN3B 1MWAA 4UANA 5GJSH 4R7XA 1EO8H 2GJPA 4XBEL 4FFYH 3CN2A 4PB0L 4WTZG 3Q6FB 4A04A 1CLYL 4YJZL 5CKAA 4FX5A 1LYQA 2OLDA 2X10A 3D9AH 4B53A 4KBPA 4YX2L 4JHAH 1U8OA 4KKLD 5HDBE 3RPKA 4WO4A 4HF5L 2WZ5A 3IWUA 1TTRA 3D85A 1KEML 1EMTL 2CDFB 3WTUA 3TEWA 1SQ2N 3GJEB 1ZAGA 2DWTA 5HHMD 1AYOA 1AKJB 3O3DB 4Y88A 4LVHC 2F8VA 3O11A 1VZIA 3BSGA 1NUDA 2VDML 3NZ8A 3NJMA 3O6FB 3QG7H 4WFHD 4Z7QF 2K4WA 1MLBA 3FU6A 5DK2A 2JKNA 3GDBA 1DHKA 4RSVA 3LKPA 1FNGA 5J56B 4G72B 1WIUA 4DP8X 5A6IA 2YAQA 3UGUA 3ZPDA 2JIXB 4WTZA 5T33H 3SE8L 3ARDC 1HHHB 3GRWH 2ZX6A 3M07A 2NXYC 3OAWA 5EF0A 1ML0A 4M3HA 1FH5L 2PTTA 5EUOB 3UTQB 1ZANH 2CDEB 3QHZL 4IDJH 1WAAE 4UT9A 3K80A 1E6JH 4A2EA 1DQDL 3VWKA 2XN9B 2CHDA 5GRYA 5I8KH 4P2RE 3MRRB 4JG5A 4S1SH 2WXOA 2MTPA 3CGTA 3GJFH 3QDME 4IEFB 2ZYRA 2DWDB 1QFWI 2PYFB 3EJCA 5L7XL 3C12A 2VISB 2OXHB 4QO1A 3MBWB 3Q2NA 4HT1H 4X4XB 3A5VA 2W95A 1A9VA 3VFGH 35C8L 4W6YB 4H0IA 2WO2B 4YO0B 1CD1B 1N12A 2F1EA 4RISL 4Z6AT 2Y2YA 3GB7B 3KEDA 4MAUH 4L1HA 3PDGA 1SNRA 4YHLH 4PVNA 1RU9L 5A6MA 5GRJH 2X6BA 3N04A 1MW2A 4WWPA 4BK4A 4MQXC 5TE7H 4KK5C 4U6YA 5AYUL 1FRGH 1JGVL 3I75A 3VI3A 3VXSA 3P4OB 1RPUA 1IC5L 1XAUA 4B3EA 4JZOB 1HH6B 3VFWB 1ZLWK 4HJGA 2KZBA 5CP7A 4BKSC 3ZDZE 4DETA 2F5BH 3WO3B 2COVD 3SGDH 1M53A 3LD8C 4K94L 4RX4D 3TA3C 7CGTA 1IC1A 2O5ZL 2XPGB 3ABLB 3GMOA 4KZDL 4JAMA 5B39G 3PL6B 4WI2A 5EZIL 3L4UA 4FQIH 2P1YA 4KKRA 4Z18A 4ALAC 4NUGL 1AZNA 1SLXA 2CBMA 4LCIH 4D9LH 3RDJA 4PS4L 2FX8H 3BZEA 4KKBC 4KGLA 1WT5C 3BP4B 4AIEA 4G80A 4WTXA 1IKNC 5CHNB 1I8KB 1L0QA 2AQ1A 2ZKMX 4XE0A 1BQHB 1U8LA 5IBTL 4W9IC 1U8MA 4Y16A 2R4SL 4GAGH 3F7VA 4L29A 3K74B 5EB9A 3WKNA 1I1AA 1Q94A 1Z6JT 2LLLA 2VDQL 3NMEA 4UI2A 5CLYA 2Z4TA 3WUWB 3S34L 1ZLUK 2HTLC 4P23A 4DGWC 5GGRB 4QHUB 4MAYB 2WIIB 3VTAA 5IB3B 4XBEH 1VZGA 1DVFD 4PB0H 4G8EA 4BIKA 2DD8L 5B39A 3U1SL 1CLYH 4X5RA 4NZTL 5ERWA 5KOMC 4KKNA 5C71A 3DSNB 3NGBC 5T8IA 4D3CL 1MCNA 2APWA 4YX2H 3UC0L 3GBNL 5DK3A 3WJLA 1R17A 2ZCLL 4Q9QL 2GAZB 3ARDD 3DV4A 4H1LG 1C16B 3DDGA 3HE6B 3M1BA 5I1GL 2WLHA 3VXMD 3MFFB 5C6TL 4YDNA 1KEMH 1CL7I 1QABA 2VMCA 4ODWA 3K6SB 3ZDXE 1KENL 5DZ9A 1OE1A 1E5ZA 3GS0A 1T3FB 1VGKA 1LO5B 3K0WA 1FFPB 3FTUA 3BRFA 2VDMH 1NIBA 3FQWB 4Z7IA 4FMFA 1E5UI 3ZR5A 3EYUL 1XGQA 1M71B 1PL3A 4U0RC 3SDCB 1BAGA 1KJMB 3EH5B 3HS9A 3L16A 1QRND 4L3ED 4YDJB 4JZNA 4AKQA 2ZD0A 1TENA 5FLVA 3I02B 4HH9A 3SE8H 1D9KB 4MWFA 4NKMB 4NO5B 2NCEA 3PUUA 1FH5H 5DUML 1IQDB 1KF9B 3QHZH 5I1LB 2TRHA 3JUZA 1DQDH 5DGRA 5DQJB 2C3VA 5LDSA 5IVXA 5L2KA 1A47A 1IVLA 4DEUA 2L8AA 3HNVL 5EF2A 1S7QB 3ZSSA 1JDAA 2A77L 1C5DA 3PWUB 5L7XH 5AOLA 5EFIB 4AZ8A 3C9NB 1XB8A 1H6TA 3ELQA 1RSFA 2B8OT 1GCFA 2QFRA 4OFPA 1P84K 3MRBB 35C8H 1CIDA 5GRZA 4RISH 4P3CL 1QEWB 1HS6A 1U3HB 3U0TB 3GO1L 1ZS8A 1RU9H 1V05A 4QHKJ 3MQIA 4N2BA 3BH4A 2GY5A 1JPGB 1SDDB 5AYUH 1JGVH 3ROOB 1RULL 2A6KB 2VLJD 4K7PL 5CJBA 3TC9A 5IQMA 1IC5H 4NRYB 1NAMB 1PU0A 3NCYP 2OTWA 2X9WA 1CYGA 4KQ3L 3L1FA 1HKFA 4D9QD 4GRMA 1ZGLM 3KGSA 5B1CA 4DKEL 4H2CA 4J6IA 2AXFA 1JVKA 4K94H 3QEHB 4XMZA 2FIKB 2O5ZH 3IDYB 3AWGA 4LNRA 3HCVB 4NOFA 4KZDH 3QJHB 5JOPD 5EZIH 4TQPA 3UTSD 4FFVD 4ISVB 4NUGH 4ZMXA 2DW5A 5JXAL 1QOKA 4KZEL 5BRZA 4ENZA 3IXAA 3RUGA 2ZJSH 4KUZL 4PS4H 5JXEC 2CCLA 3QYNA 3C5ZD 2NXZB 2W92A 3N06B 2IPUG 4GINA 4QRPE 5DT1L 2HJKA 2Z7YA 2VN6A 1AO7D 3G5ZA 5IG7B 3NK4A 2BOCA 2GT9A 2G75A 2OMNA 4G8AC 3QEGL 2X41A 3SDXA 5D4QA 1EVUA 5IBTH 1INQB 4P46D 5E70A 2R4SH 4A7SA 3MFGB 2VR9A 5AAWA 4JFDB 1WITA 2VDQH 1W6LA 3ZTJG 1W0WA 3S34H 1G0XA 3QZLA 4JQVC 5FC9A 1FQ9C 3IM1A 3O0RL 4PRNB 3SPCA 4N9GB 1QSEA 1FVEB 2EDLA 1JZ2A 3B2DC 2DJUA 4N8PA 4IRJD 3G6JB 1YYLL 1A9BB 2IWFA 4KROC 2GHWB 4M4RA 2DD8H 3U1SH 2FLBT 3L95A 3QZWB 2FWOB 4NZTH 4MS8D 4D3CH 2XI9A 2H26A 4OIIL 5E1AA 2A6DA 1G1CA 1KJVA 3L5WB 3BVNA 3UC0H 3GBNH 3WNOA 2J2ZB 2ZCLH 4PJGF 1A1NA 4CMMB 3OV6A 3DX8A 1KBBA 4Q9QH 4PJFB 5ADPL 1UACL 3LQZA 5I1GH 3KPQA 5C6TH 5D4HA 3RPIA 3T65A 2H0JA 1FNHA 2C7FA 4F8QA 2VKXA 5DZLA 3ILQC 1KENH 4DP7X 2KZ1B 3U79A 4YLCA 3VI3F 3QQDB 3ZQXA 4QHPA 1RIVL 4EIUA 3HUJE 4JVPA 4PRDA 5DK0B 1CFMA 2EDRA 5JZ7C 5ESAB 2W0FA 3EYUH 5PCYA 3CZKA 4ELKA 1P4BL 4YHZL 5ENWB 5F72S 1SJEB 2A9BA 2EC9T 2EKSB 4L8CA 3RVTC 3P02A 2WVSA 4I0PC 3PGCA 3V0VB 3KBPA 5EEZA 1JK9B 4K15A 2QMKA 4FLOA 4MJIE 5HI3C 5LWYL 1XWVA 4HZLA 5T5NG 4NNXA 1MJ7L 4I3RL 5DUMH 3BGFB 2F19H 4ZFQA 3FT4A 2JWYA 3WD5H 3U46A 4LCVA 4LLMB 4CVXB 3LNGA 4WWID 5FK9B 1D7BA 4H26A 3ZMNA 4P5MA 3ML8A 4G42B 5M7QA 4AYSA 2GTWB 5IJKC 3PDOA 3DGDA 1ITBB 4U2YA 1DBAL 3HNVH 5I6XB 2AJ3A 3II3A 5MEQB 2A77H 3A21A 4MD4A 1G4RA 3LQAC 3UTTD 3GLZA 3FUFA 1UVQA 2IWEA 3HI1A 3QUKB 4RAUB 4UQ3A 3V0EA 2P8LA 4IS6A 1BVKA 2LV4A 3I9AA 4ZNCD 4ZMNA 5CZXD 4XB3A 4XNXH 4P3CH 3FTGB 3U30B 1KPUA 4YHPA 3GO1H 1IMHC 5B7MA 1D5ZB 3IRZA 5E8OB 1HCYA 1BEXA 3BISA 4GAYA 4PJXA 4X5XA 3V4VA 3JT0A 4I18A 4BRVA 4XWOD 1RULH 4K7PH 5B8CA 1MCPL 1G6RB 3H3PL 3ETTA 3MCKA 2A4EA 4JO8A 1JWMB 4KQ3H 4QRFA 3FT0A 2VUKA 1G7MB 4DKEH 4Y1AE 3T08A 1X5FA 4U6HB 1FJ1B 3MJ8B 1LNUA 4ONHB 2HJLA 1B90A 3QWRA 4IKIA 3UDWA 2XZCL 2EE6A 1LXMA 4B5EA 2RGSA 1V8HA 2VUYA 4HC1A 5JXAH 4CBZA 4Z5RB 4UCFA 5IF0B 4KZEH 4KUZH 2F7OA 3T3PE 3UH8A 4HVBA 1ILUA 3F85A 3D1MC 3UZEC 2JTYA 5DT1H 3O4OB 1E4KC 2ALWA 4QOKA 3O3EA 5E6IC 3BC9A 2ITDA 4F24A 3QEGH 2NTFB 3WKPA 5I1JL 4RMBA 4KJWC 4WJ5B 1BQLL 3QO0B 3QDJE 1CFVL 1VFUA 2CHZA 4MD5A 4PV9B 4JREB 4FXKB 5D1ZB 3B3IA 1FAKT 4FFWD 4QPEA 2BK8A 2ED8A 3ATFA 3GM0A 4JX0A 1HWWA 4AG4L 3O0RH 4WTQA 1JD9A 5IVXF 3GM8A 3MA7A 1GPOL 1IAOB 1ZRUA 1LEIB 1YYLH 2DQJL 2ED6A 3K4ZA 3IGAB 3TWCL 5G5DB 2HKAA 5SWZD 1VFAA 1OANA 1PDKA 4J3WA 2E8ZA 4OIIH 3RVTD 2E6JA 4C8XA 4ZX4A 1SUHA 4UAHA 1UB5B 3T6ZA 5ADPH 4JVWA 2CALA 2P5EE 1UACH 2XY2A 2YN3A 4P48A 3RDTC 3AG4B 2OMYB 5I66B 1RJLA 4BRJA 1JZEA 2C3GA 2F74B 3ATBA 2CWRA 1J10A 1RIVH 2A6JA 5AFAA 2PYEA 3BD4A 4NZJA 4JMXA 1S7VA 1AD9B 3CSFA 2WB1A 1P4BH 1NAKL 4YHZH 3NJXA 2X4UA 4GRWF 4G7SB 4J3BA 5I8EA 4WWKD 5C07E 3X17A 3CK0L 3S3PA 1SRDA 5AOIA 1E8WA 5T3ZL 5K9KA 4OF3A 2I7OA 1KFGA 3FUKA 4XPGH 1ULVA 3BSZL 1R5IA 4Y7MA 3AGWA 5BZDA 5LWYH 3D30A 1KG0B 5A2JH 4H25A 5F0LB 4UQEA 5DSCA 1MJ7H 4I3RH 4X6DB 3RUGF 1FYTD 1W72A 2Q3ZA 3S0PA 1XQ4A 1M7DA 2D3JA 4X5WB 3SY6A 5IW6B 4UM9A 4RMUA 1CR9L 4ERSL 1Z2KA 5CBEB 5ETUB 1EVTC 1G9EA 1DBAH 4WZ9A 3SDXF 2P43B 3D0LA 3W0WD 3KYAA 1FL6A 2QELA 2FIRT 2ZOLB 1CI3M 2WBJB 1AS6A 4HPYL 4ZAKC 1NPNA 2V2TB 5BOPA 2IFFL 2RD0A 3L3JA 3HVDA 1TFPA 4Q56A 1MXGA 3HZMA 1G7JA 5F9JA 1HYSD 1RIHL 2P5PA 5B3NA 3OMZA 2NDFA 5K59F 2Z0UA 4ZMWA 5CIPB 1IARB 1CFSA 1MCPH 4L9DA 1I1FB 3H3PH 2JK5B 3UOAB 2BHFA 3G3LA 1CD9B 2X2IA 2G4EA 3SGKA 3UBGA 1F45A 3KJ4C 4GI6A 5F7DB 5JW3L 2XCMC 4LVHB 5AOZA 3KWTA 1Q9LA 1KXHA 4JY4A 1E8XA 2XZCH 3Q9QA 4AW7A 2NUPA 3HPLB 3NIDF 4EQ2A 4EN3C 5IQNA 4F7CB 3HBQA 3QZMA 4HXAL 4X4MA 1MUJB 1F97A 1BWMA 1K85A 3EYFA 3SKMA 1BOGA 3UAAA 4ZMTA 3T0ED 4G6JL 2V17L 4YPGA 4O00A 1RLBA 3FH8A 2NXYB 3MU3A 3O4LD 5F1NB 3WHXB 3ZBMA 3DX7B 4X6CB 2VDLL 4PG9B 5I1JH 4J3TA 3L6FA 1P1VA 4FXGC 2C3XA 5A40E 1BQLH 1ZPLA 1RZ8B 1CFVH 1ZWIB 4H0GA 4WW1A 4C83B 4N2IA 5HHOB 4FNSA 3WEMA 3V6BR 4JM2A 4UDTB 4YWGL 4KX7A 3VGEA 1TU2A 3ZHFA 2VXUL 5LAPA 3IJYA 1AIFB 5F70A 4AG4H 5E5MA 4GMTL 3C6SB 1NEZA 3K6DA 1GPOH 1TVDA 1X3DA 3B9KD 4X5PA 1YNTA 5IHUL 1KULA 2XTJD 4UYPA 3FK3A 2DQJH 5AL0A 1OPGL 3TWCH 1OB1A 1DYZA 3HKZA 3SSGA 1PJ9A 1SYVB 1OIOA 3TEXA 1IIKA 3SBQA 5FKPB 5IHLB 1ZVNA 1MFVA 4OCXL 2OW6A 3BO8A 1WCQA 1IM9D 1NDMB 2WXQA 5E1GA 2JCCB 4F27A 2O5YL 4JFHE 3ZKND 4MLSA 3BGMB 3P73B 2K8MA 1I7ZB 1CZ8L 1WEJL 1L9TA 5DEFA 2X6VA 5ISZE 3LKSA 1BFOA 4OCSL 1AXSA 1HHGA 2FJSA 4XCCL 3BIKB 4KJPD 3LD8B 4XRCA 3TA3B 4A2MA 4LBAA 1N2RA 2WLJA 3GMNA 5C0IA 3AS1A 3D3VE 4WW2B 5T5NF 1S7RA 3M7FB 2VSMB 4LP8A 1EEYA 1NAKH 4FYRA 4UB0L 5DURB 2YUXA 4J7RA 4ZAKD 1U91B 2F18A 4TLKA 1AGEA 3K1DA 4XP1L 5IMMB 5KSVB 4UTAL 5T3ZH 5EIQA 3H9SE 1HE7A 2YA1A 2VZUA 4QYOA 3TVMA 3BSZH 2P47B 4M5SA 3PHQB 3ARED 5E56A 1Y1UA 2E7BA 5AL8A 1AOZA 1DUZB 4MBRA 1N5YL 4CC0A 4KX8A 2UUDK 3KWWB 2RACA 1CR9H 2YK1L 2C4FT 3VWJD 4KDWA 4ERSH 4PJ8C 3MRGB 5JDSA 3LKOB 1BX2B 1ZTMA 2EVIA 2PP8A 1OTSC 4GW4B 4TNFA 2C9AA 4TNVK 3ISWA 3PU7A 5FAAA 1IM3B 1G1YA 2WTPA 3K8KA 5I9QC 3H53A 4OCRL 4HPYH 4B5ZA 5BW7C 4GKSA 1GYUA 2KQMA 2IFFH 1PSKL 4IK6A 1U8JA 2CNZA 3HLKA 4LOVA 5EU6E 5C0AA 1XSOA 2QZQA 5MEND 1UT2A 2CBOA 1A7PL 1OCWL 5DLLA 2IQAB 5GPRA 4ETQA 3EUUA 1PKOA 4P2OC 2FZ3B 4XMWA 2AAAA 1RIHH 5LO7A 3NGBB 1JMXA 5I30L 2NOYA 4M8UA 5FV1L 2R69A 3RKDC 3RTQA 3WKYA 1HVXA 3P2TA 5LGJB 1A6TB 1PTZA 3WFHB 3MBEA 2M1KA 1V7NL 2YPLD 1V10A 2YPVL 1XGPB 1C12A 1FSKC 2FGWL 1J8HD 1KLGB 2N59A 3VYNA 3P3UA 4X99B 3L3HA 4HSAC 5BCAA 4FI8A 5D7IA 2JJVA 5JW3H 5ESQA 3ZXAC 5F3BB 4P07A 3LRLA 4F8OA 3WN6A 2Q87A 2ICEC 1QMUA 2EVHA 2ESVE 3LZPA 3RVUC 2BSRB 4U0RB 2CJUL 4BK8A 3EYQD 1JWUA 1NGYB 1AS8A 4BH7B 2W9EL 3FT2B 4HXAH 1LQBC 3NSDA 2F54A 2OX5B 2ZX5A 1DCLA 1UQSB 2JH2A 2V17H 4G6JH 4G6FD 3DMMD 1KTJA 4BFGA 4K7FB 4XNDA 3CSTA 2VDLH 1TCMA 2K6ZA 3F7PC 5FA3A 3TO2A 4YNYB 4D0DA 2FGZA 4YR6B 4LPUA 2BSTA 2TSBA 3FN0L 3EFOA 1SN5A 4P4KD 2EIKB 5HYJB 5C08A 5EZPA 4RWHA 3IT8D 4YWGH 1HILA 3BVDB 2C5DC 1SM3L 2VXUH 3IBOA 3BKML 2JKLA 3CZFB 2WV3A 4OZ4B 4GMTH 3SYQA 4NPYA 4OZGE 5IHUH 5J12C 2E7LC 3CXFA 3VQLA 2QGDA 2GSIB 3QRFM 1OPGH 1A8ZA 3T2NL 1MVUB 2XG4A 3ROLB 3GTNA 2VCOA 2PW1B 1KT2A 3IDJB 3J07A 3IPEA 4OCXH 2NY4C 2PW2B 2OYLA 1IFGA 1MN4A 1U58A 2HFGL 4MX7A 5E5LA 2EDDA 2O5YH 1BVZA 3P11L 1MG3C 4UT7L 3TBVA 1WEJH 1CZ8H 4FZ8L 5JHDA 5IQ7L 3N40F 4Q8BA 3FL7A 3JV6A 4FQHA 4OCSH 2Q10A 5EN3A 4XCCH 3HG2A 3P9MB 4XCEB 3WNMA 4R4BA 4H44C 3QWNA 4I48B 2ZXBA 4PMFA 2AJSL 1OTSD 2X4NA 4JRXA 3QFDB 3U4EA 1YMHA 2PN5A 4RMRA 1IKOP 4Y4HD 3SKJL 3RL1A 4UB0H 1SOXA 3JUYA 1LLAA 3IK2A 3S35L 4YSSA 4XP1H 3N55A 4KI1A 3D0VA 4UTAH 2A73B 3F04A 4FHKA 5IM7A 2XV0A 2EECA 1TZ8A 5JUEH 3VFUB 1GY2A 3QNYA 4QXGL 1N5YH 1I31A 3ERXA 3HAEB 4E9QA 4KDVA 4RNRB 2YK1H 1FUNA 4ADJA 1YO4A 1ZHNB 2V8MA 3PFUA 3FFOA 4C56A 4N0FB 1PZUB 2AANA 1JRHI 3WFEL 3CHXA 1EFQA 2GG1A 3CMOL 4YXKL 1S7UA 3LKQA 1PX4A 1BBJA 1KCBA 4OCRH 3CUPB 5I6KA 4JM2F 4NZ8A 2Y1YA 4KROB 1PSKH 4OTXL 4KTDL 1HAUA 1IRAY 3IF1A 1BZ9A 1IIIA 2X7LA 5IIEA 1A7PH 1OCWH 4LLYB 5JYLA 4ZDHA 5J8OA 2JKXA 3B5GA 2C7UB 2N0KA 3D05A 1YNTF 5I30H 5KYXA 2K45A 1JDCA 1MW1A 3APCA 1M6OB 3F00A 3S3SA 5KZCB 5GZNA 4F8NA 2ZWLT 2VLKD 5JIPA 1U9KA 3O3UN 1V7NH 1U4EA 2C1PA 2XXGA 3WLWC 4Z78B 3RZCC 2FGWH 1FZMB 1SZNA 4XCYA 3SJVA 5E5UB 3NTCL 2VB5A 1HYRC 5G4NA 1CC3A 3CFJB 4JQIL 5IBUG 4P5KB 3P77B 4UIMB 3MDJA 1X5XA 3U0WL 3RWIA 2KERA 2MNUA 2B39A 4F58L 4DK3A 1HOCB 2CJUH 1E67A 1K72A 1OSYA 3NCXA 4PGBA 2GJ6A 2W9EH 1A5FL 1DLFL 4I0PB 1EAPB 1NAML 3BOVA 3HBPA 2RTTA 3OKOB 1ZVYA 4JFFD 4XCNA 1NCAL 3D2UB 3LIZA 3DYMA 1UOLA 3RWEA 5ID1B 4QXTA 2GEQA 5JOEA 1NGZA 1FO0B 1Q9KA 3WTXA 3GZPA 3MRPB 5C0RL 4BXSV 4XAKE 4R83A 4X8CA 5LBSL 3IGLA 3FN0H 3DO4A 4LL1A 3CN0A 2OCJA 2WCSA 3APDA 1SM3H 1DQKA 3QUYC 1XIWA 5D72L 3BKMH 5E2TL 3RIFK 3HN8A 3QIBA 3HRPA 2OQJB 1RHHB 4CU6A 1YY8A 4N0CD 1ZVSB 4DO5A 5CZVL 2UX6A 5AVXB 4HULB 1JN6B 2FTAA 3NFPB 1B9ZA 1JI2A 5C0ND 4J5VA 3MLXL 4K23L 3T2NH 2P7TA 1ORQB 2AEIT 3HLAA 2VYRE 2ZKYA 3GSXB 3ASOB 2PKDA 2A9AA 1YC8A 3WDJA 1KBVA 1PKQA 4LDEB 2HFGH 3BQVA 1NCIA 5K93A 5GS0D 2F53E 1F4YL 4JFXB 1YPZA 3P11H 1E28B 1OAYL 1AVAA 2IQ9L 2J12B 4JPSA 4UT7H 4WKZB 1M3IA 4A7TA 5I8CA 4FZ8H 4PBDA 3ZO0A 4ZT1A 5AW2B 4B7IA 3EAKA 1KCWA 5IQ7H 2YLKA 4BQ8A 5EO0A 2KYIA 1YY9D 3QXTA 3DO3A 1F41A 3VXUA 4CVUA 1BVLB 1L7TL 4NENB 3DXAA 3STBA 2AJSH 4DK5A 1CUOA 1WIPA 4HJTA 4WFED 5D7IF 5I76A 3SKJH 1XH3B 3S35H 4XC3L 5FYKL 2ILLA 2LAGB 3LV3B 4KZCA 3VXRA 3ULVL 4XPTL 1MJJA 2PCFA 2YAFA 2W60B 3D4YA 2D73A 1W8EA 5ICXB 4NUMA 2D4FA 4JLRB 1ZGLA 3PWLA 1PYWA 4R5TA 2EH7L 4GKOA 5E6IB 1HL9A 3ESOA 2BC4A 4QXGH 3W82A 3Q44A 3FCBA 5DS8A 4OJYA 3H0TA 3H7BB 4WV1C 5BQDA 3US0A 1P7QA 4S0TD 4ZOCA 1KWKA 1P6AB 3Q8FA 3V6OA 2Y7QB 2AK1L 3E3QC 4XMPL 2IAMC 3WFEH 1PLAA 3CMOH 5EOTB 3DLQR 2CRMA 4YXKH 4AXWB 1U8NA 4IBQA 1YEWA 2IAAC 2FR4A 3FB8A 3PAUA 5D7LA 5KSAD 4GRLD 4MQ7B 2DYPD 4KTDH 4OTXH 4PJAA 2FEEI 3LPOA 1J9TA 1N6UA 4L4TD 2ZSWA 4PJ5A 3HS8A 3LZLA 3NJLA 5INDA 3SQBB 1DN2A 4YS4A 2JF1A 3LRSA 1UD6A 5D7JD 2FJHB 2VQ1B 4KXBA 4NZFA 3REVB 4R9HA 4HCRL 3ABGA 2EABA 2AKRB 1G7LB 1E6OL 4ELMB 2BWQA 3WO4C 5T1LA 3RDTB 1GC1L 4HJIA 4YIQA 2BSCA 2XZZA 4FFZL 2EKJA 4MQTB 2W88A 3NTCH 2Y24A 3KS0H 4NIKB 4JQIH 1GMEA 3KYNA 3HG0A 2Z4QB 3Q13A 3U0WH 4GNKB 1BYOA 4NCC2 5CUSL 3V4UL 4F58H 2IALB 2V7NA 5T1KD 1KJ2A 5KBLA 1GVIA 3K4DA 5C0BE 1Z32X 3CE1A 1A5FH 1DLFH 1G6RL 2R0KL 1NAMH 1UH3A 2H0EA 1N3NA 5D1XE 1R4XA 2ERJC 1OTUD 4XVUC 1NCAH 3V6ZB 2HP4A 3CC5A 4WGKA 4POZD 3L08A 5IVZB 3X1FA 4MMZA 2OCCB 3JV4A 1LEIA 1K5WA 1XR8B 2OBGA 5EC1B 4BSVB 5F1SA 3IAGC 5LBSH 5IESL 5AW3B 3AWEA 5DI8A 2BNRB 2PLTA 5FV2A 4N2FA 3UJIL 1WZKA 3K71B 5D72H 5E2TH 2DLGA 2YRZA 1AGDB 1UD3A 1I7RB 5CWSB 3VB8A 4ZAKB 2JKTM 5EUKB 1RZKC 1VIWA 5HXMA 5CZVH 3NYKA 3OG6B 1HL5A 1UZ8A 3BSHA 3MLXH 4K23H 3S36X 3IDGA 5T3ZE 1JPFA 4MDJA 3HHSA 3OTTA 4F2FA 2E7DA 1WFTA 1TZGL 5CEZL 4UZSA 2EDJA 1OP5K 4Q6IC 3DJTA 3RFZA 2CO6A 5JPMC 3OKMB 1F4YH 3QPQC 3TEUA 1YDPA 1OAYH 2IQ9H 4JW3A 4NAMA 3OWRA 2X28A 4MZ3A 1NL0L 5SWSA 4EMZA 1QWNA 2VXSL 1JV2B 2X1XR 4KNSA 4NOBA 4EAEA 3D34A 1HZLA 3KJ4B 1AMXA 3B83A 4P5TD 2ALAA 1L7TH 4ONOA 3P0VL 5FDYA 1T1YA 3FTYA 2CD0A 2EYRA 5FHBL 4ODVL 1R3KB 4YSPA 4NO0A 3RB7A 1VCBC 1E4WL 4EN3B 4Z3HA 5B4MC 4XC3H 4AYMC 5FYKH 3ARPA 3FB6A 4JFQB 4TRPL 4ZFFB 5CSZB 3ULVH 4GJTB 4XPTH 4ZPTA 5EBWB 4GAAA 4N6RB 5I5IA 3DVNB 3SYAA 4TULL 5FYLD 2EH7H 1XXDC 2Q86A 4JRYD 5ANMA 2R9HD 3WEOA 5CJQL 2ICWB 4PRPB 5H2BA 1H6EA 1KIPB 2K78A 3AT9A 3OL2A 5CAYB 4FXGB 2BVEA 5DGQA 3VFOA 1WIOA 5EF1A 1YMME 2E76C 2VT0A 2AFNA 2X4PB 2AK1H 4K7PY 5F7EL 1B4JL 4XMPH 3VXOB 3VXTA 5GJTL 3SPIA 2BW5A 2XN1A 2EZ0D 2C3WA 1S9XB 3CXDL 1ZT7A 3WMSA 2Y7LA 2MQ3A 3PJLA 4PRIB 3BFOA 1FNAA 1C1EL 3PWVB 4AE1A 4N2AA 4P2QB 5JQ6L 3KNBA 4GW1B 3RX9A 4NFCA 3DGGA 3T4AA 1U8PB 2YMTA 1YUHB 3NDYE 1JVLA 5IKCA 3NRQA 5IFJB 3MRQA 4HCRH 4KDTA 1E6OH 2FB4L 2KS0A 5ACZB 3FFCE 4MNGE 1J05B 1GC1H 4MHHI 2AJZB 1XL6A 3FO1A 4CW1B 2Z92B 4FFZH 3K4AA 5J6HB 1SMOA 4NUQA 3W9DB 4KRNA 3UZVA 5JA8B 4OFYA 1UH4A 3QQ4B 4NHUB 2DQTL 4ZW6A 2O61B 1REIA 2PO6A 2EXWD 2FL5B 1EFXD 1MHHA 5CUSH 3V4UH 3ZT5A 1SFDA 2VABB 3ABKB 5FR3A 2AEQL 3JWNE 2LTQC 3MRIB 3D69A 1G6RH 2R0KH 1F5WA 3QJQB 1E4JA 1RZJC 3DROA 3TGXA 3ILPA 5F7YC 4F9PA 4DPAX 4LLWB 3TXAA 2BIIA 4N20A 2DJSA 2DQFA 4TSAL 2AXWA 5JW4R 4LSUL 3ARGA 1LEGA 3BQUD 3L5IA 4LHUG 4Y4KC 2BP5M 2G3XA 1O7DE 2MPVA 2ZZUT 3AS0A 1T4KB 3LXUX 1NBYA 4NN5C 2BOBB 1M42A 1H15A 1R3HA 3QPQD 5IESH 1WLHA 4PJ8B 4DWHA 3MUY1 2HAZA 4XP6L 4F7MA 2VJ0A 1GTFA 1GS7A 3MUUA 4ORGA 4OFVA 3UJIH 3GMPB 4UOZA 2R1YB 3E80A