4IW7A

Crystal structure of 8-amino-7-oxononanoate synthase (biof) from francisella tularensis.
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
347
structure length
334
Chain Sequence
DDSIIDFTTSDYLNLSSAHNLKHAIVNGFDKYGFGSKTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYKHQQLSQLQDIYDGKSFITTEGVFSTSGSITQLDKLAKITPEKLIVDEAHSFGVLGKNGRGAINSFRISYKNCLICVFPLGKAFGGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENVNDNRARLQQNITFFNELCDAKDLELVSKDLSPIRSIQLNNANLAIRLKDKLFENKIIVSFRYPTQAILRFSLHSNNTFDQIQQALEIISKEVKYEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 8-amino-7-oxononanoate synthase (bioF) from Francisella tularensis.
rcsb
source organism Francisella tularensis subsp. tularensis schu s4
molecule tags Transferase
molecule keywords 8-amino-7-oxononanoate synthase
total genus 120
structure length 334
sequence length 347
ec nomenclature ec 2.3.1.47: 8-amino-7-oxononanoate synthase.
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4iw7A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4iw7A01
1GCKA 2BIGA 1J32A 4KYOA 4TN4A 3FFHA 2BIEA 3UWCA 2BWOA 4MKJA 5FT4A 2W7EA 4XJOA 1TATA 2V1PA 2D7ZA 3NUIA 2HORA 2NMPA 2ZYJA 2X5DA 1JF9A 3NYTA 4XJMA 3PAAA 1WYTA 2CH1A 2X3LA 3PDBB 3EI7A 4TV7A 1CJ0A 1EJIA 2O1BA 4JF1A 1BW0A 2FM1A 4RITA 2D5YA 2VMNA 3PD6B 1WYTB 4WB0A 3QI6A 3FQAA 4WYFA 1EQBA 3FZ8A 3PIUA 2ZY2A 4MSOA 2HUFA 4RM1A 5AX8A 1MGVA 1SF2A 2QB2A 1CQ7A 4OBUA 1AY8A 3ZZJA 4F5MA 2VMUA 1C4KA 4ZWMA 2CJHA 1LS3A 4AO4A 1ASMA 2HZPA 5LHAA 4M2JA 1D2FA 3BV0A 1ASNA 3GR9A 3QM2A 2HOYA 4MKKA 1YIYA 2DKBA 4R5ZA 1O69A 3G0TA 1W7NA 2ZSMA 1M0QA 4GSAA 5EIGB 2BYLA 4ZAHA 2YCPA 1LK9A 3ZZKA 3JW9A 1FC4A 3H14A 4LC3A 5G2PA 5G09A 1IVRA 4PFNA 1I29A 2ZP7A 3GJUA 3WX9A 4WYCA 2HUUA 2BIAA 3K7YA 1S08A 5EAVA 4R8DA 1YIZA 1VJOA 1AAMA 3NU8A 4K2MA 4RAEA 3W1HA 1LKCA 3ASAA 2CH2A 2JGTA 2DR1A 4M2MA 5BJ3A 2GMUA 1M0OA 2ZJGA 3FZ6A 1M4NA 1G7XA 3PGYA 2C81A 1ASDA 2OQXA 4A72A 3AV7A 2DOUA 5F8VA 2ZY3A 2R5CA 1LC7A 3NU7A 1IAXA 4IY7A 1DFOA 1M0NA 3A9ZA 3M5UA 2D65A 1G4VA 3TCMA 1BJ4A 2Z1YA 3RUYA 3ZRRA 4GDYA 2EZ2A 3ELEA 1TOKA 1YOOA 2WKAA 4JE5D 4XJLA 1X28A 2DKJA 1RVUA 2QMAA 2W7FA 3FTBA 2C7TA 3ASBA 2OKJA 2HP2A 3BWOA 5HXXA 1C7OA 3KGWA 1T3IA 2YCNA 3GBXA 4AOAA 4IX8A 3DR4A 3LV2A 1N31A 4WLJA 3VOMA 1M7YA 2VGSA 4RKCA 4WYDA 4FL0A 5HDMA 4ZM4A 1OHWA 2EGYA 3G7QA 4XK1A 5JAYA 2YKUA 2VGZA 4A0GA 4ZDPA 4GRXA 2JG2A 3B46A 4OTLA 4ADDA 2Z1ZA 2VLHA 2QA3A 5M4DA 3FDBA 4Q75A 4WBTA 1DKAA 5DJ1A 2W7LA 3K40A 5J8QA 3BC8A 2WK7A 1PMOA 3DR7A 4WYEA 4F5FA 3PD6A 4EB5A 1AAWA 1KMKA 3AEMC 4K2IA 2YCTA 2ORDA 2VMOA 2VMPA 2FNIA 1JS3A 1AKAA 5M4BA 2BI9A 3BWNC 3UE8A 3EIBA 3FZ7A 1AMSA 2W7JA 3OP7A 4ZSYA 4P3MA 1BJNA 1DGDA 1G7WA 3F0HA 2F8JA 4WYGA 3MAFB 1OXPA 5G0AA 4Y0IA 3N0LA 1B5OA 3E77A 2VGVA 3NTJA 3RI6A 1KL1A 1O61A 1RV4A 3I5TA 3II0A 3JZLA 1VP4A 4ZSWA 1E5EA 1GEWA 1LW4A 2AY5A 3CQ4A 3FDDA 2O7CA 4UQVA 1Y4IA 2CJDA 2HUIA 1MDOA 1AY4A 1X0MA 2ZY5A 3MAFA 2C44A 4GE4A 3RCHB 1UKJA 3NRAA 1CL1A 3TQXA 4WXBA 2AY9A 1IX7A 4ADBA 1D7UA 1SFFA 1AHYA 1SZSA 3MADA 2W7MA 2VIAA 1OHVA 1YNUA 3K28A 3I16A 3LVKA 4XAUA 1GD9A 4JEZA 3EI5A 1TOEA 3BCAA 4RJ0A 1N2TA 3USFA 4KAMA 2BWNA 4HF8A 1ELQA 2VGWA 3CAIA 1BJOA 3E6GA 4LNMA 1MDZA 4OMAA 3F6TA 3FKDA 3WGBA 1G4XA 5DJ9A 1W23A 4WLHA 3ECDA 1WYVA 4BA5A 1C0NA 2BWPA 1V2DA 4N0BA 2W8WA 4LW4A 1QJ3A 1B5PA 4NOGA 2QB3A 3IHJA 3WLXA 1D7VA 1SZUA 1YJSA 2YHKA 1U08A 3EZSA 4I8AA 2AEVA 4E3QA 1E5FA 1AHXA 3PA9A 1GC2A 3D6KA 2GQNA 5EUNA 2AY1A 2W7GA 4H51A 1UU1A 2FYFA 2CANA 2OGAA 4R2NA 1ASBA 2PB0A 3R4TA 4GE7A 4UOYA 5TF5A 3EI8A 4LNJA 4Y0HA 1ZOBA 2GSAA 1AHFA 3I4JA 3MC6A 3HQTA 4EB7A 1PG8A 5EAAA 5C6UA 3WCOA 4A0FA 2VMYA 1QISA 5FT8A 1M6SA 1MAPA 3RBFA 1H0CA 2X5FA 4E3RA 4UHNA 1B9HA 1ASGA 4BHDA 2CJGA 2BKWA 4EMYA 1ARSA 1GDEA 2AEUA 1W3UA 3HDOA 3HT4A 1D7SA 1GC4A 3TFUA 3QBOA 1WYVB 4F5LA 1IAYA 3B8XA 3E2ZA 4LW2A 4UHOA 1TOGA 3FQ8A 3B1DA 2OKKA 1M32A 4Y0DA 1OXOA 2ZSLA 1AX4A 1X29A 3GETA 4XQ2A 1ZC9A 3LVMA 1N8PA 1W7MA 5EFSA 4E77A 1V72A 2CB1A 4RJYA 4F5KA 1SVVA 2Z67A 1Z7DA 3FRKA 5EIGA 2D61A 1AJRA 2VLFA 1ELUA 1TOIA 5EUDA 5EQCA 2XBNA 4E1OA 3GZDA 4MQRA 2R5EA 3KE3A 1AKBA 2QLRA 1IUGA 1SPAA 3WCNA 2YKYA 5G4IA 4PFFA 3NDNA 1AHEA 1W7LA 2GB3A 3GSBA 2EZ1A 2W8JA 2HOXA 2TPLA 4W1WA 2Z20A 3ISLA 4AO9A 4ITGA 3NNKA 5EUEA 1ECXA 2CSTA 1B8GA 2PB2A 3AATA 1LW5A 4DBCA 3TFTA 2CY8A 3MAUA 4MGRA 3VAXA 2VGTA 4QGRA 3DC1A 4AZKA 1J04A 1DJEA 3LVLB 3AEOA 1RV3A 1CQ8A 2DGKA 4Q6RA 4EFFA 2AY4A 1FG3A 2VI8A 2E7JA 2Z9XA 3ACZA 4CBSA 3A9XA 4F5GA 1ARGA 1O62A 3CQ5A 1KL2A 1I48A 3NYUA 3HL2A 1C9CA 3DYDA 2CINA 1V2FA 1UU0A 4B98A 1BJWA 2C0RA 1SZKA 3E2YA 3FQ7A 4F5HA 1BQAA 2FQ6A 3GZCA 3LY1A 5E4ZA 1BKGA 2ZC0A 1WYUB 1I43A 3LVJA 1ARTA 1QIRA 3ZRPA 1ZODA 2VI9A 2W8VA 3RQ1A 4U2HA 4R5FA 4ZLVA 4ZM3A 3BCXA 1WSTA 1ORDA 1QZ9A 1AMAA 4RKDA 1CZCA 1WYUA 3AOWA 2AY8A 3VK4A 3QN6A 1YAAA 2E54A 1S07A 2E7IA 1OHYA 2O0RA 2W7KA 3BB8A 2FN6A 4JF0A 4JEYA 3QGUA 4U1TA 2AATA 3HMUA 1EG5A 3WGCA 3AEPA 1GBNA 3PJ0A 4L0OA 4P7YA 2E7UA 3DXVA 1TPLA 2G6WA 2WK8A 3JTXA 1LC8A 4GE9A 9AATA 1CL2A 3EZ1A 1IX8A 3QPGA 3T32A 1AMRA 2R0TA 1KKJA 1C7GA 4OC9A 3FVSA 4F5JA 1YJYA 2Z9WA 4ADEA 1ASFA 3MC6C 4M2KA 4A6UA 1BS0A 5G2QA 1QITA 4WB0B 1CS1A 2YKVA 1IBJA 4IXZA 3AEJC 5LH9A 4CVQA 3FSLA 4O6ZA 4PIWA 3DU4A 1TOJA 4TMRA 4XJPA 2W8UA 1GC0A 3RBLA 1ARIA 2BI5A 4ATPA 3PDBA 3FVUA 2X8UA 4UHMA 3HBXA 1BQDA 2QBTA 2R2NA 3IF2A 5I92A 1KKPA 2D64A 2VMVA 1BT4A 4GEBA 4AZJA 4WP0A 3DXWA 1S0AA 3A9YA 1O4SA 4AH3A 4Q31A 2VMQA 1MLZA 3FVXA 1AHGA 2W8TA 4LNLA 3E2FA 2EH6A 3PDXA 2GMSA 1S06A 2EO5A 3COGA 4JE5A 3HLMA 3W1IA 2Z9UA 4WYAA 5F9SA 4RIZA 2PO3A 2Z9VA 2W7HA 4FFCA 4BQ0A 2VMRA 4ZWVA 3E2ZB 4W91A 4B9BA 4WXGA 1IX6A 2WK9A 3KGXA 3NUBA 2BI2A 4A00A 2VMTA 4IYOB 1BJOB 4JEWA 3E9KA 2V0YA 3Q8NA 2VMXA 4A6RA 4ZDLA 1ASCA 3EIAA 4DQ6A 3AOVA 1H1CA 2D63A 2OGEA 3AENA 2BI3A 2HOZA 3DODA 1I41A 1ARHA 3ELPA 3BWNA 3EUCA 4WD2A 5E3KA 2YKXA 2JJGA 2DGLA 1PFFA 3WKSA 3RCHA 4OCAA 3JWBA 3CQ6A 2JJEA 4W8IA 3GZDC 1QGNA 3DZZA 1LC5A 1C7NA 2XH1A 3CBFA 3FFRA 2D7YA 1FG7A 8AATA 4BA4A 1ASEA 1M0PA 1WKHA 3A2BA 1AJSA 3N5MA 5E5IA 3BN1A 3TATA 1KMJA 4EU1A 4F4EA 1GEXA 5D95A 1ASAA 1AICA 4KXKA 1X2AA 3MBBA 4PVFA 4A6TA 1CQ6A 1PMMA 1MDXA 3WKRA 3P1TA 4J5UA 3EI9A 2Z61A 2AY7A 2CFBA 4JEXA 4N0WA 2VMWA 3VP6A 2AY6A 4WXFA 2DGMA 2JJHA 2BYJA 3B1EA 3VK3A 1Z3ZA 2RFVA 4OYTA 1OATA 3H7FA 3MEBA 3NYSA 4K2BA 3WY7A 1QJ5A 2W7IA 1ASLA 1DTYA 4IYOA 1MAQA 2YRIA 3BS8A 5DB5A 4ATQA 2D66A 3AEMA 4ZASA 3BCBA 2W7DA 1IJIA 7AATA 1TASA 3ZRQA 1MLYA 3QHXA 3NX3A 3A8UX 3L44A 3L8AA 3FD0A 1GEYA 5FT5A 4CXRA 1XEYA 1AJSB 4CBRA 3EI6A 2JJFA 3B1CA 1XI9A 1AY5A 2VMSA 1WKGA 2ZUKA 2YRRA 3F9TA 3W1JA 3N75A 1P3WA 1UU2A 4ISYA 4DGTA 1DJUA 5M49A 2FNUA 3P6KA 5DX5A 5BJ4A 3AELA 4XEWA 2BHXA 2JISA 5G4JA 4JEVA 4MQPA 4W5KA 4OT8A 3LWSA 2VMZA 3AEJA 4IW7A 4IXOA 4A0HA 1AMQA 2HP1A 3DRDA 5K8BA 5IWQA 3UAKA 2VGUA 4A0RA 1AIAA 3OKSA 3WZFA 4MY5A 3G8MA 3R9AA 4CXQA 1JG8A 2CTZA 3KKIA 5HHYA 4OBVA 2VIBA 5D5SA 1YJZA 2AY3A 3AENB 3ATHA 1TARA 1S09A 2Q7WA 4W1VA 3VK2A 2VYCA 2BI1A 4IXSA 4W1XA 1VEFA 2YOBA 4BMKA 1B4XA 3GWPA 2OATA 3LG0A 5FT6A 4HVKA 1RVYA 2EPJA 1V2EA 3FCRA 4Q76A 1AIBA 3JWAA 4RLGA 4F5IA 4J8LA 1DJ9A 3PPLA 1D7RA 1DGEA 5M46A 1AKCA 3JU7A 4ZDOA 2AY2A 4ITXA 4ADCA 2ZY4A 1GC3A 1CZEA 1JS6A 3HVYA 1B9IA 3MKJA 2R5CB 4MQQA
chains in the Genus database with same CATH superfamily
1GCKA 2BIGA 1J32A 4KYOA 4TN4A 3FFHA 2BIEA 3N4SA 3UWCA 2BWOA 4MKJA 5FT4A 2W7EA 4XJOA 1TATA 2V1PA 2D7ZA 3NUIA 2HORA 2NMPA 2ZYJA 2X5DA 1JF9A 3NYTA 4XJMA 3PAAA 1WYTA 2CH1A 2X3LA 3PDBB 3EI7A 4TV7A 1CJ0A 1EJIA 2O1BA 4JF1A 1BW0A 2FM1A 4RITA 2D5YA 2VMNA 3PD6B 1WYTB 4WB0A 3QI6A 3FQAA 4WYFA 1EQBA 3FZ8A 3PIUA 2ZY2A 4MSOA 2HUFA 4RM1A 5AX8A 1MGVA 1SF2A 2QB2A 1CQ7A 4OBUA 1AY8A 3ZZJA 4F5MA 2VMUA 4H63Q 1C4KA 4ZWMA 2CJHA 1LS3A 4AO4A 1ASMA 2HZPA 5LHAA 4M2JA 1D2FA 3BV0A 1ASNA 3GR9A 3QM2A 2HOYA 4MKKA 1YIYA 2DKBA 4R5ZA 1O69A 3G0TA 1W7NA 2ZSMA 1M0QA 4GSAA 5EIGB 2BYLA 4ZAHA 2YCPA 1LK9A 3ZZKA 3JW9A 1FC4A 3H14A 4LC3A 5G2PA 5G09A 1IVRA 4PFNA 1I29A 2ZP7A 3GJUA 2WB6A 3WX9A 4WYCA 2HUUA 2BIAA 3K7YA 1S08A 5EAVA 4R8DA 1YIZA 1VJOA 1AAMA 3NU8A 4K2MA 4RAEA 3W1HA 1LKCA 5KTBA 3ASAA 2CH2A 2JGTA 2DR1A 4M2MA 5BJ3A 2GMUA 1M0OA 2ZJGA 3FZ6A 1M4NA 1G7XA 3PGYA 2C81A 1ASDA 2OQXA 4A72A 3AV7A 2DOUA 5F8VA 2ZY3A 2R5CA 1LC7A 3NU7A 1IAXA 4IY7A 1DFOA 1M0NA 3A9ZA 3M5UA 2D65A 1G4VA 3TCMA 1BJ4A 2Z1YA 3RUYA 3ZRRA 4GDYA 2EZ2A 3ELEA 1TOKA 1YOOA 2WKAA 4JE5D 4XJLA 1X28A 2DKJA 1RVUA 2QMAA 2W7FA 3FTBA 2C7TA 3ASBA 2OKJA 2HP2A 3BWOA 5HXXA 1C7OA 3KGWA 1T3IA 2YCNA 3GBXA 4AOAA 4IX8A 3DR4A 3LV2A 1N31A 4WLJA 3VOMA 1M7YA 2VGSA 4RKCA 4WYDA 4FL0A 5HDMA 4ZM4A 1OHWA 2EGYA 3G7QA 4XK1A 5JAYA 2YKUA 2VGZA 4A0GA 4ZDPA 4GRXA 2JG2A 3B46A 4OTLA 4ADDA 2Z1ZA 2VLHA 2QA3A 5M4DA 3FDBA 4Q75A 4WBTA 1DKAA 5DJ1A 2W7LA 3K40A 5J8QA 3BC8A 2WK7A 1PMOA 3DR7A 4WYEA 4F5FA 3PD6A 4EB5A 1AAWA 1KMKA 3AEMC 4K2IA 2YCTA 2ORDA 2VMOA 2VMPA 2FNIA 1JS3A 1AKAA 5M4BA 2BI9A 3BWNC 3UE8A 3EIBA 3FZ7A 2A1VA 1AMSA 2W7JA 3OP7A 4ZSYA 4P3MA 1BJNA 1DGDA 1G7WA 3F0HA 2F8JA 4WYGA 3MAFB 1OXPA 5G0AA 4Y0IA 3N0LA 1B5OA 3E77A 2VGVA 3NTJA 3RI6A 1KL1A 1O61A 1RV4A 3I5TA 3II0A 3JZLA 1VP4A 4ZSWA 1E5EA 1GEWA 1LW4A 2AY5A 3CQ4A 3FDDA 2O7CA 4UQVA 1Y4IA 2CJDA 2HUIA 1MDOA 1AY4A 1X0MA 2ZY5A 3MAFA 2C44A 4GE4A 3RCHB 1UKJA 3NRAA 1CL1A 3TQXA 4WXBA 2AY9A 1IX7A 4ADBA 1D7UA 1SFFA 1AHYA 1SZSA 3MADA 2W7MA 2VIAA 1OHVA 1YNUA 3K28A 3I16A 3LVKA 4XAUA 1GD9A 4JEZA 3EI5A 1TOEA 3BCAA 4RJ0A 1N2TA 3USFA 4KAMA 2BWNA 4HF8A 1ELQA 2VGWA 3CAIA 1BJOA 3E6GA 4LNMA 1MDZA 4OMAA 3F6TA 3FKDA 3WGBA 1G4XA 5DJ9A 1W23A 4WLHA 3ECDA 1WYVA 4BA5A 2EYQA 1C0NA 2BWPA 1V2DA 4N0BA 2W8WA 4LW4A 1QJ3A 1B5PA 4NOGA 2QB3A 3IHJA 3WLXA 1D7VA 1SZUA 1YJSA 2YHKA 1U08A 3EZSA 4I8AA 2AEVA 4E3QA 1E5FA 1AHXA 3PA9A 3N4RA 1GC2A 3D6KA 2GQNA 5EUNA 2AY1A 2W7GA 4H51A 1UU1A 2FYFA 2CANA 2OGAA 4R2NA 1ASBA 2PB0A 3R4TA 4GE7A 4UOYA 5TF5A 3EI8A 4LNJA 4Y0HA 1ZOBA 2GSAA 1AHFA 3I4JA 3MC6A 3HQTA 4EB7A 1PG8A 5EAAA 5C6UA 3WCOA 4A0FA 2VMYA 1QISA 5FT8A 1M6SA 1MAPA 3RBFA 1H0CA 2X5FA 4E3RA 4UHNA 1B9HA 1ASGA 4BHDA 2CJGA 2BKWA 4EMYA 1ARSA 1GDEA 2AEUA 1W3UA 3HDOA 3HT4A 1D7SA 1GC4A 3TFUA 3QBOA 1WYVB 4F5LA 1IAYA 3B8XA 3E2ZA 4LW2A 4UHOA 1TOGA 3FQ8A 3B1DA 2OKKA 1M32A 4Y0DA 1OXOA 2ZSLA 1AX4A 1X29A 3GETA 4XQ2A 1ZC9A 3LVMA 1N8PA 1W7MA 5EFSA 4E77A 1V72A 2CB1A 4RJYA 4F5KA 1SVVA 2Z67A 1Z7DA 3FRKA 5EIGA 2D61A 1AJRA 2VLFA 1ELUA 1TOIA 5EUDA 5EQCA 2XBNA 4E1OA 3GZDA 4MQRA 2R5EA 3KE3A 1AKBA 2QLRA 1IUGA 1SPAA 3WCNA 2YKYA 5G4IA 4PFFA 3NDNA 1AHEA 1W7LA 2GB3A 3GSBA 2EZ1A 2W8JA 2HOXA 2TPLA 4W1WA 2Z20A 3ISLA 4AO9A 4ITGA 3NNKA 5EUEA 1ECXA 2CSTA 1B8GA 2PB2A 3AATA 1LW5A 4DBCA 3TFTA 2CY8A 3MAUA 4MGRA 3VAXA 2VGTA 4QGRA 3DC1A 4AZKA 1J04A 1DJEA 3LVLB 3AEOA 1RV3A 1CQ8A 2DGKA 4Q6RA 4EFFA 2AY4A 1FG3A 2VI8A 2E7JA 2Z9XA 3ACZA 4CBSA 3A9XA 4F5GA 1ARGA 1O62A 3CQ5A 1KL2A 1I48A 3NYUA 3HL2A 1C9CA 3DYDA 2CINA 1V2FA 1UU0A 4B98A 1BJWA 2C0RA 1SZKA 3E2YA 3FQ7A 4F5HA 1BQAA 2FQ6A 3GZCA 3LY1A 5E4ZA 2QSRA 1BKGA 2ZC0A 1WYUB 1I43A 3LVJA 1KAFA 1ARTA 1QIRA 3ZRPA 1ZODA 2VI9A 2W8VA 3RQ1A 4U2HA 4R5FA 4ZLVA 4ZM3A 3BCXA 1WSTA 1ORDA 1QZ9A 1AMAA 4RKDA 1CZCA 1WYUA 3AOWA 2AY8A 3VK4A 3QN6A 1YAAA 2E54A 1S07A 2E7IA 1OHYA 2O0RA 2W7KA 3BB8A 2FN6A 4JF0A 4JEYA 3QGUA 4U1TA 2AATA 3HMUA 1EG5A 3WGCA 3AEPA 1GBNA 3PJ0A 4L0OA 4P7YA 2E7UA 3DXVA 1TPLA 2G6WA 2WK8A 3JTXA 1LC8A 4GE9A 9AATA 1CL2A 3EZ1A 1IX8A 3QPGA 3T32A 1AMRA 2R0TA 1KKJA 1C7GA 4OC9A 3FVSA 4F5JA 1YJYA 2Z9WA 4ADEA 1ASFA 3MC6C 4M2KA 4A6UA 1BS0A 5G2QA 1QITA 4WB0B 1CS1A 2YKVA 1IBJA 4IXZA 3AEJC 5LH9A 4CVQA 3FSLA 4O6ZA 4PIWA 3DU4A 1TOJA 4TMRA 4XJPA 2W8UA 1GC0A 3RBLA 1ARIA 2BI5A 4ATPA 3PDBA 3FVUA 2X8UA 4UHMA 3HBXA 1BQDA 2QBTA 2R2NA 3IF2A 5I92A 1KKPA 2D64A 2VMVA 1BT4A 4GEBA 4AZJA 4WP0A 3DXWA 1S0AA 3A9YA 1O4SA 4AH3A 4Q31A 2VMQA 1MLZA 3FVXA 1AHGA 2W8TA 4LNLA 3E2FA 4K05A 2EH6A 3PDXA 2GMSA 1S06A 2EO5A 3COGA 4JE5A 3HLMA 3W1IA 2Z9UA 4WYAA 5F9SA 4RIZA 2PO3A 2Z9VA 2W7HA 4FFCA 4BQ0A 2VMRA 4ZWVA 3E2ZB 4W91A 4B9BA 4WXGA 1IX6A 2WK9A 3KGXA 3NUBA 2BI2A 4A00A 2VMTA 4IYOB 1BJOB 4JEWA 3E9KA 2V0YA 3Q8NA 2VMXA 4A6RA 4ZDLA 1ASCA 3EIAA 4DQ6A 3AOVA 1H1CA 2D63A 2OGEA 3AENA 2BI3A 2HOZA 3DODA 1I41A 1ARHA 3ELPA 3BWNA 3EUCA 4WD2A 5E3KA 2YKXA 2JJGA 2DGLA 1PFFA 3WKSA 3RCHA 4OCAA 3JWBA 3CQ6A 2JJEA 4W8IA 3GZDC 1QGNA 3DZZA 1LC5A 1C7NA 2XH1A 3CBFA 3FFRA 2D7YA 1FG7A 8AATA 4BA4A 1ASEA 1M0PA 1WKHA 3A2BA 1AJSA 3N5MA 5E5IA 3BN1A 3TATA 1KMJA 4EU1A 4F4EA 3N4XA 1GEXA 5D95A 1ASAA 1AICA 4KXKA 1X2AA 3MBBA 4PVFA 4A6TA 1CQ6A 1PMMA 1MDXA 3WKRA 3P1TA 2FKIA 4J5UA 3EI9A 2Z61A 2AY7A 2CFBA 4JEXA 2KFPA 4N0WA 2VMWA 3VP6A 2AY6A 4WXFA 2DGMA 2JJHA 2BYJA 3B1EA 3VK3A 1Z3ZA 2RFVA 4OYTA 1OATA 3H7FA 3MEBA 3NYSA 4K2BA 3WY7A 2G7JA 1QJ5A 2W7IA 1ASLA 1DTYA 4IYOA 1MAQA 2YRIA 3BS8A 5DB5A 4ATQA 2D66A 3AEMA 4ZASA 3BCBA 2W7DA 1IJIA 7AATA 1TASA 3ZRQA 1MLYA 3QHXA 3NX3A 3A8UX 3L44A 3L8AA 3FD0A 1GEYA 5FT5A 4CXRA 1XEYA 1AJSB 4CBRA 3EI6A 2JJFA 3B1CA 1XI9A 1AY5A 2VMSA 1WKGA 2ZUKA 2YRRA 3F9TA 3W1JA 3N75A 1P3WA 1UU2A 4ISYA 4DGTA 1DJUA 5M49A 2FNUA 3P6KA 5DX5A 5BJ4A 3AELA 4XEWA 2BHXA 2JISA 5G4JA 4JEVA 4MQPA 4W5KA 4OT8A 3LWSA 2VMZA 3AEJA 4IW7A 4IXOA 4A0HA 1AMQA 2HP1A 3DRDA 5K8BA 5IWQA 3H9XA 3UAKA 2VGUA 4A0RA 1AIAA 3OKSA 3WZFA 4MY5A 3G8MA 3R9AA 4CXQA 1JG8A 2CTZA 3KKIA 5HHYA 4OBVA 2VIBA 5D5SA 1YJZA 2AY3A 3AENB 3ATHA 1TARA 1S09A 2Q7WA 4W1VA 3VK2A 2VYCA 2BI1A 4IXSA 4W1XA 1VEFA 2YOBA 4BMKA 1B4XA 3GWPA 2OATA 3LG0A 5FT6A 4HVKA 1RVYA 2EPJA 1V2EA 3FCRA 4Q76A 1AIBA 3JWAA 4RLGA 4F5IA 4J8LA 1DJ9A 3PPLA 1D7RA 1DGEA 5M46A 1AKCA 3N7NA 3JU7A 4ZDOA 2AY2A 4ITXA 4ADCA 2ZY4A 1GC3A 1CZEA 1JS6A 3HVYA 1B9IA 3MKJA 2R5CB 4MQQA
chains in the Genus database with same CATH topology
1GCKA 2BIGA 1J32A 4KYOA 4TN4A 3FFHA 2BIEA 3N4SA 3UWCA 2BWOA 4MKJA 5FT4A 2W7EA 4XJOA 1TATA 2V1PA 2D7ZA 3NUIA 2HORA 2NMPA 2ZYJA 2X5DA 1JF9A 3NYTA 4XJMA 3PAAA 1WYTA 2CH1A 2X3LA 3PDBB 3EI7A 4TV7A 1CJ0A 1EJIA 2O1BA 4JF1A 1BW0A 2FM1A 4RITA 2D5YA 2VMNA 3PD6B 1WYTB 4WB0A 3QI6A 3FQAA 4WYFA 1EQBA 3FZ8A 3PIUA 2ZY2A 4MSOA 2HUFA 4RM1A 5AX8A 1MGVA 1SF2A 2QB2A 1CQ7A 4OBUA 1AY8A 3ZZJA 4F5MA 2VMUA 4H63Q 1C4KA 4ZWMA 2CJHA 1LS3A 4AO4A 1ASMA 2HZPA 5LHAA 4M2JA 1D2FA 3BV0A 1ASNA 3GR9A 3QM2A 2HOYA 4MKKA 1YIYA 2DKBA 4R5ZA 1O69A 3G0TA 1W7NA 2ZSMA 1M0QA 4GSAA 5EIGB 2BYLA 4ZAHA 2YCPA 1LK9A 3ZZKA 3JW9A 1FC4A 3H14A 4LC3A 5G2PA 5G09A 1IVRA 4PFNA 1I29A 2ZP7A 3GJUA 2WB6A 3WX9A 4WYCA 2HUUA 2BIAA 3K7YA 1S08A 5EAVA 4R8DA 1YIZA 1VJOA 1AAMA 3NU8A 4K2MA 4RAEA 3W1HA 1LKCA 5KTBA 3ASAA 2CH2A 2JGTA 2DR1A 4M2MA 5BJ3A 2GMUA 1M0OA 2ZJGA 3FZ6A 1M4NA 1G7XA 3PGYA 2C81A 1ASDA 2OQXA 4A72A 3AV7A 2DOUA 5F8VA 2ZY3A 2R5CA 1LC7A 3NU7A 1IAXA 4IY7A 1DFOA 1M0NA 3A9ZA 3M5UA 2D65A 1G4VA 3TCMA 1BJ4A 2Z1YA 3RUYA 3ZRRA 4GDYA 2EZ2A 3ELEA 1TOKA 1YOOA 2WKAA 4JE5D 4XJLA 1X28A 2DKJA 1RVUA 2QMAA 2W7FA 3FTBA 2C7TA 3ASBA 2OKJA 2HP2A 3BWOA 5HXXA 1C7OA 3KGWA 1T3IA 2YCNA 3GBXA 4AOAA 4IX8A 3DR4A 3LV2A 1N31A 4WLJA 3VOMA 1M7YA 2VGSA 4RKCA 4WYDA 4FL0A 5HDMA 4ZM4A 1OHWA 2EGYA 3G7QA 4XK1A 5JAYA 2YKUA 2VGZA 4A0GA 4ZDPA 4GRXA 2JG2A 3B46A 4OTLA 4ADDA 2Z1ZA 2VLHA 2QA3A 5M4DA 3FDBA 4Q75A 4WBTA 1DKAA 5DJ1A 2W7LA 3K40A 5J8QA 3BC8A 2WK7A 1PMOA 3DR7A 4WYEA 4F5FA 3PD6A 4EB5A 1AAWA 1KMKA 3AEMC 4K2IA 2YCTA 2ORDA 2VMOA 2VMPA 2FNIA 1JS3A 1AKAA 5M4BA 2BI9A 3BWNC 3UE8A 3EIBA 3FZ7A 2A1VA 1AMSA 2W7JA 3OP7A 4ZSYA 4P3MA 1BJNA 1DGDA 1G7WA 3F0HA 2F8JA 4WYGA 3MAFB 1OXPA 5G0AA 4Y0IA 3N0LA 1B5OA 3E77A 2VGVA 3NTJA 3RI6A 1KL1A 1O61A 1RV4A 3I5TA 3II0A 3JZLA 1VP4A 4ZSWA 1E5EA 1GEWA 1LW4A 2AY5A 3CQ4A 3FDDA 2O7CA 4UQVA 1Y4IA 2CJDA 2HUIA 1MDOA 1AY4A 1X0MA 2ZY5A 3MAFA 2C44A 4GE4A 3RCHB 1UKJA 3NRAA 1CL1A 3TQXA 4WXBA 2AY9A 1IX7A 4ADBA 1D7UA 1SFFA 1AHYA 1SZSA 3MADA 2W7MA 2VIAA 1OHVA 1YNUA 3K28A 3I16A 3LVKA 4XAUA 1GD9A 4JEZA 3EI5A 1TOEA 3BCAA 4RJ0A 1N2TA 3USFA 4KAMA 2BWNA 4HF8A 1ELQA 2VGWA 3CAIA 1BJOA 3E6GA 4LNMA 1MDZA 4OMAA 3F6TA 3FKDA 3WGBA 1G4XA 5DJ9A 1W23A 4WLHA 3ECDA 1WYVA 4BA5A 2EYQA 1C0NA 2BWPA 1V2DA 4N0BA 2W8WA 4LW4A 1QJ3A 1B5PA 4NOGA 2QB3A 3IHJA 3WLXA 1D7VA 1SZUA 1YJSA 2YHKA 1U08A 3EZSA 4I8AA 2AEVA 4E3QA 1E5FA 1AHXA 3PA9A 3N4RA 1GC2A 3D6KA 2GQNA 5EUNA 2AY1A 2W7GA 4H51A 1UU1A 2FYFA 2CANA 2OGAA 4R2NA 1ASBA 2PB0A 3R4TA 4GE7A 4UOYA 5TF5A 3EI8A 4LNJA 4Y0HA 1ZOBA 2GSAA 1AHFA 3I4JA 3MC6A 3HQTA 4EB7A 1PG8A 5EAAA 5C6UA 3WCOA 4A0FA 2VMYA 1QISA 5FT8A 1M6SA 1MAPA 3RBFA 1H0CA 2X5FA 4E3RA 4UHNA 1B9HA 1ASGA 4BHDA 2CJGA 2BKWA 4EMYA 1ARSA 1GDEA 2AEUA 1W3UA 3HDOA 3HT4A 1D7SA 1GC4A 3TFUA 3QBOA 1WYVB 4F5LA 1IAYA 3B8XA 3E2ZA 4LW2A 4UHOA 1TOGA 3FQ8A 3B1DA 2OKKA 1M32A 4Y0DA 1OXOA 2ZSLA 1AX4A 1X29A 3GETA 4XQ2A 1ZC9A 3LVMA 1N8PA 1W7MA 5EFSA 4E77A 1V72A 2CB1A 4RJYA 4F5KA 1SVVA 2Z67A 1Z7DA 3FRKA 5EIGA 2D61A 1AJRA 2VLFA 1ELUA 1TOIA 5EUDA 5EQCA 2XBNA 4E1OA 3GZDA 4MQRA 2R5EA 3KE3A 1AKBA 2QLRA 1IUGA 1SPAA 3WCNA 2YKYA 5G4IA 4PFFA 3NDNA 1AHEA 1W7LA 2GB3A 3GSBA 2EZ1A 2W8JA 2HOXA 2TPLA 4W1WA 2Z20A 3ISLA 4AO9A 4ITGA 3NNKA 5EUEA 1ECXA 2CSTA 1B8GA 2PB2A 3AATA 1LW5A 4DBCA 3TFTA 2CY8A 3MAUA 4MGRA 3VAXA 2VGTA 4QGRA 3DC1A 4AZKA 1J04A 1DJEA 3LVLB 3AEOA 1RV3A 1CQ8A 2DGKA 4Q6RA 4EFFA 2AY4A 1FG3A 2VI8A 2E7JA 2Z9XA 3ACZA 4CBSA 3A9XA 4F5GA 1ARGA 1O62A 3CQ5A 1KL2A 1I48A 3NYUA 3HL2A 1C9CA 3DYDA 2CINA 1V2FA 1UU0A 4B98A 1BJWA 2C0RA 1SZKA 3E2YA 3FQ7A 4F5HA 1BQAA 2FQ6A 3GZCA 3LY1A 5E4ZA 2QSRA 1BKGA 2ZC0A 1WYUB 1I43A 3LVJA 1ARTA 1QIRA 3ZRPA 1ZODA 2VI9A 2W8VA 3RQ1A 4U2HA 4R5FA 4ZLVA 4ZM3A 3BCXA 1WSTA 1ORDA 1QZ9A 1AMAA 4RKDA 1CZCA 1WYUA 3AOWA 2AY8A 3VK4A 3QN6A 1YAAA 2E54A 1S07A 2E7IA 1OHYA 2O0RA 2W7KA 3BB8A 2FN6A 4JF0A 4JEYA 3QGUA 4U1TA 2AATA 3HMUA 1EG5A 3WGCA 3AEPA 1GBNA 3PJ0A 4L0OA 4P7YA 2E7UA 3DXVA 1TPLA 2G6WA 2WK8A 3JTXA 1LC8A 4GE9A 9AATA 1CL2A 3EZ1A 1IX8A 3QPGA 3T32A 1AMRA 2R0TA 1KKJA 1C7GA 4OC9A 3FVSA 4F5JA 1YJYA 2Z9WA 4ADEA 1ASFA 3MC6C 4M2KA 4A6UA 1BS0A 5G2QA 1QITA 4WB0B 1CS1A 2YKVA 1IBJA 4IXZA 3AEJC 5LH9A 4CVQA 3FSLA 4O6ZA 4PIWA 3DU4A 1TOJA 4TMRA 4XJPA 2W8UA 1GC0A 3RBLA 1ARIA 2BI5A 4ATPA 3PDBA 3FVUA 2X8UA 4UHMA 3HBXA 1BQDA 2QBTA 2R2NA 3IF2A 5I92A 1KKPA 2D64A 2VMVA 1BT4A 4GEBA 4AZJA 4WP0A 3DXWA 1S0AA 3A9YA 1O4SA 4AH3A 4Q31A 2VMQA 1MLZA 3FVXA 1AHGA 2W8TA 4LNLA 3E2FA 4K05A 2EH6A 3PDXA 2GMSA 1S06A 2EO5A 3COGA 4JE5A 3HLMA 3W1IA 2Z9UA 4WYAA 5F9SA 4RIZA 2PO3A 2Z9VA 2W7HA 4FFCA 4BQ0A 2VMRA 4ZWVA 3E2ZB 4W91A 4B9BA 4WXGA 1IX6A 2WK9A 3KGXA 3NUBA 2BI2A 4A00A 2VMTA 4IYOB 1BJOB 4JEWA 3E9KA 2V0YA 3Q8NA 2VMXA 4A6RA 4ZDLA 1ASCA 3EIAA 4DQ6A 3AOVA 1H1CA 2D63A 2OGEA 3AENA 2BI3A 2HOZA 3DODA 1I41A 1ARHA 3ELPA 3BWNA 3EUCA 4WD2A 5E3KA 2YKXA 2JJGA 2DGLA 1PFFA 3WKSA 3RCHA 4OCAA 3JWBA 3CQ6A 2JJEA 4W8IA 3GZDC 1QGNA 3DZZA 1LC5A 1C7NA 2XH1A 3CBFA 3FFRA 2D7YA 1FG7A 8AATA 4BA4A 1ASEA 1M0PA 1WKHA 3A2BA 1AJSA 3N5MA 5E5IA 3BN1A 3TATA 1KMJA 4EU1A 4F4EA 3N4XA 1GEXA 5D95A 1ASAA 1AICA 4KXKA 1X2AA 3MBBA 4PVFA 4A6TA 1CQ6A 1PMMA 1MDXA 3WKRA 3P1TA 2FKIA 4J5UA 3EI9A 2Z61A 2AY7A 2CFBA 4JEXA 2KFPA 4N0WA 2VMWA 3VP6A 2AY6A 4WXFA 2DGMA 2JJHA 2BYJA 3B1EA 3VK3A 1Z3ZA 2RFVA 4OYTA 1OATA 3H7FA 3MEBA 3NYSA 4K2BA 3WY7A 2G7JA 1QJ5A 2W7IA 1ASLA 1DTYA 4IYOA 1MAQA 2YRIA 3BS8A 5DB5A 4ATQA 2D66A 3AEMA 4ZASA 3BCBA 2W7DA 1IJIA 7AATA 1TASA 3ZRQA 1MLYA 3QHXA 3NX3A 3A8UX 3L44A 3L8AA 3FD0A 1GEYA 5FT5A 4CXRA 1XEYA 1AJSB 4CBRA 3EI6A 2JJFA 3B1CA 1XI9A 1AY5A 2VMSA 1WKGA 2ZUKA 2YRRA 3F9TA 3W1JA 3N75A 1P3WA 1UU2A 4ISYA 4DGTA 1DJUA 5M49A 2FNUA 3P6KA 5DX5A 5BJ4A 3AELA 4XEWA 2BHXA 2JISA 5G4JA 4JEVA 4MQPA 4W5KA 4OT8A 3LWSA 2VMZA 3AEJA 4IW7A 4IXOA 4A0HA 1AMQA 2HP1A 3DRDA 5K8BA 5IWQA 3H9XA 3UAKA 2VGUA 4A0RA 1AIAA 3OKSA 3WZFA 4MY5A 3G8MA 3R9AA 4CXQA 1JG8A 2CTZA 3KKIA 5HHYA 4OBVA 2VIBA 5D5SA 1YJZA 2AY3A 3AENB 3ATHA 1TARA 1S09A 2Q7WA 4W1VA 3VK2A 2VYCA 2BI1A 4IXSA 4W1XA 1VEFA 2YOBA 4BMKA 1B4XA 3GWPA 2OATA 3LG0A 5FT6A 4HVKA 1RVYA 2EPJA 1V2EA 3FCRA 4Q76A 1AIBA 3JWAA 4RLGA 4F5IA 4J8LA 1DJ9A 3PPLA 1D7RA 1DGEA 5M46A 1AKCA 3N7NA 3JU7A 4ZDOA 2AY2A 4ITXA 4ADCA 2ZY4A 1GC3A 1CZEA 1JS6A 3HVYA 1B9IA 3MKJA 2R5CB 4MQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GCK A;  2BIG A;  1J32 A;  4KYO A;  4TN4 A;  3FFH A;  2BIE A;  3UWC A;  2BWO A;  4MKJ A;  5FT4 A;  2W7E A;  4XJO A;  1TAT A;  2V1P A;  2D7Z A;  3NUI A;  2HOR A;  2NMP A;  2ZYJ A;  2X5D A;  1JF9 A;  3NYT A;  4XJM A;  3PAA A;  1WYT A;  2CH1 A;  2X3L A;  3PDB B;  3EI7 A;  4TV7 A;  1CJ0 A;  1EJI A;  2O1B A;  4JF1 A;  1BW0 A;  2FM1 A;  4RIT A;  2D5Y A;  2VMN A;  3PD6 B;  1WYT B;  4WB0 A;  3QI6 A;  3FQA A;  4WYF A;  1EQB A;  3FZ8 A;  3PIU A;  2ZY2 A;  4MSO A;  2HUF A;  4RM1 A;  5AX8 A;  1MGV A;  1SF2 A;  2QB2 A;  1CQ7 A;  4OBU A;  1AY8 A;  3ZZJ A;  4F5M A;  2VMU A;  1C4K A;  4ZWM A;  2CJH A;  1LS3 A;  4AO4 A;  1ASM A;  2HZP A;  5LHA A;  4M2J A;  1D2F A;  3BV0 A;  1ASN A;  3GR9 A;  3QM2 A;  2HOY A;  4MKK A;  1YIY A;  2DKB A;  4R5Z A;  1O69 A;  3G0T A;  1W7N A;  2ZSM A;  1M0Q A;  4GSA A;  5EIG B;  2BYL A;  4ZAH A;  2YCP A;  1LK9 A;  3ZZK A;  3JW9 A;  1FC4 A;  3H14 A;  4LC3 A;  5G2P A;  5G09 A;  1IVR A;  4PFN A;  1I29 A;  2ZP7 A;  3GJU A;  3WX9 A;  4WYC A;  2HUU A;  2BIA A;  3K7Y A;  1S08 A;  5EAV A;  4R8D A;  1YIZ A;  1VJO A;  1AAM A;  3NU8 A;  4K2M A;  4RAE A;  3W1H A;  1LKC A;  3ASA A;  2CH2 A;  2JGT A;  2DR1 A;  4M2M A;  5BJ3 A;  2GMU A;  1M0O A;  2ZJG A;  3FZ6 A;  1M4N A;  1G7X A;  3PGY A;  2C81 A;  1ASD A;  2OQX A;  4A72 A;  3AV7 A;  2DOU A;  5F8V A;  2ZY3 A;  2R5C A;  1LC7 A;  3NU7 A;  1IAX A;  4IY7 A;  1DFO A;  1M0N A;  3A9Z A;  3M5U A;  2D65 A;  1G4V A;  3TCM A;  1BJ4 A;  2Z1Y A;  3RUY A;  3ZRR A;  4GDY A;  2EZ2 A;  3ELE A;  1TOK A;  1YOO A;  2WKA A;  4JE5 D;  4XJL A;  1X28 A;  2DKJ A;  1RVU A;  2QMA A;  2W7F A;  3FTB A;  2C7T A;  3ASB A;  2OKJ A;  2HP2 A;  3BWO A;  5HXX A;  1C7O A;  3KGW A;  1T3I A;  2YCN A;  3GBX A;  4AOA A;  4IX8 A;  3DR4 A;  3LV2 A;  1N31 A;  4WLJ A;  3VOM A;  1M7Y A;  2VGS A;  4RKC A;  4WYD A;  4FL0 A;  5HDM A;  4ZM4 A;  1OHW A;  2EGY A;  3G7Q A;  4XK1 A;  5JAY A;  2YKU A;  2VGZ A;  4A0G A;  4ZDP A;  4GRX A;  2JG2 A;  3B46 A;  4OTL A;  4ADD A;  2Z1Z A;  2VLH A;  2QA3 A;  5M4D A;  3FDB A;  4Q75 A;  4WBT A;  1DKA A;  5DJ1 A;  2W7L A;  3K40 A;  5J8Q A;  3BC8 A;  2WK7 A;  1PMO A;  3DR7 A;  4WYE A;  4F5F A;  3PD6 A;  4EB5 A;  1AAW A;  1KMK A;  3AEM C;  4K2I A;  2YCT A;  2ORD A;  2VMO A;  2VMP A;  2FNI A;  1JS3 A;  1AKA A;  5M4B A;  2BI9 A;  3BWN C;  3UE8 A;  3EIB A;  3FZ7 A;  1AMS A;  2W7J A;  3OP7 A;  4ZSY A;  4P3M A;  1BJN A;  1DGD A;  1G7W A;  3F0H A;  2F8J A;  4WYG A;  3MAF B;  1OXP A;  5G0A A;  4Y0I A;  3N0L A;  1B5O A;  3E77 A;  2VGV A;  3NTJ A;  3RI6 A;  1KL1 A;  1O61 A;  1RV4 A;  3I5T A;  3II0 A;  3JZL A;  1VP4 A;  4ZSW A;  1E5E A;  1GEW A;  1LW4 A;  2AY5 A;  3CQ4 A;  3FDD A;  2O7C A;  4UQV A;  1Y4I A;  2CJD A;  2HUI A;  1MDO A;  1AY4 A;  1X0M A;  2ZY5 A;  3MAF A;  2C44 A;  4GE4 A;  3RCH B;  1UKJ A;  3NRA A;  1CL1 A;  3TQX A;  4WXB A;  2AY9 A;  1IX7 A;  4ADB A;  1D7U A;  1SFF A;  1AHY A;  1SZS A;  3MAD A;  2W7M A;  2VIA A;  1OHV A;  1YNU A;  3K28 A;  3I16 A;  3LVK A;  4XAU A;  1GD9 A;  4JEZ A;  3EI5 A;  1TOE A;  3BCA A;  4RJ0 A;  1N2T A;  3USF A;  4KAM A;  2BWN A;  4HF8 A;  1ELQ A;  2VGW A;  3CAI A;  1BJO A;  3E6G A;  4LNM A;  1MDZ A;  4OMA A;  3F6T A;  3FKD A;  3WGB A;  1G4X A;  5DJ9 A;  1W23 A;  4WLH A;  3ECD A;  1WYV A;  4BA5 A;  1C0N A;  2BWP A;  1V2D A;  4N0B A;  2W8W A;  4LW4 A;  1QJ3 A;  1B5P A;  4NOG A;  2QB3 A;  3IHJ A;  3WLX A;  1D7V A;  1SZU A;  1YJS A;  2YHK A;  1U08 A;  3EZS A;  4I8A A;  2AEV A;  4E3Q A;  1E5F A;  1AHX A;  3PA9 A;  1GC2 A;  3D6K A;  2GQN A;  5EUN A;  2AY1 A;  2W7G A;  4H51 A;  1UU1 A;  2FYF A;  2CAN A;  2OGA A;  4R2N A;  1ASB A;  2PB0 A;  3R4T A;  4GE7 A;  4UOY A;  5TF5 A;  3EI8 A;  4LNJ A;  4Y0H A;  1ZOB A;  2GSA A;  1AHF A;  3I4J A;  3MC6 A;  3HQT A;  4EB7 A;  1PG8 A;  5EAA A;  5C6U A;  3WCO A;  4A0F A;  2VMY A;  1QIS A;  5FT8 A;  1M6S A;  1MAP A;  3RBF A;  1H0C A;  2X5F A;  4E3R A;  4UHN A;  1B9H A;  1ASG A;  4BHD A;  2CJG A;  2BKW A;  4EMY A;  1ARS A;  1GDE A;  2AEU A;  1W3U A;  3HDO A;  3HT4 A;  1D7S A;  1GC4 A;  3TFU A;  3QBO A;  1WYV B;  4F5L A;  1IAY A;  3B8X A;  3E2Z A;  4LW2 A;  4UHO A;  1TOG A;  3FQ8 A;  3B1D A;  2OKK A;  1M32 A;  4Y0D A;  1OXO A;  2ZSL A;  1AX4 A;  1X29 A;  3GET A;  4XQ2 A;  1ZC9 A;  3LVM A;  1N8P A;  1W7M A;  5EFS A;  4E77 A;  1V72 A;  2CB1 A;  4RJY A;  4F5K A;  1SVV A;  2Z67 A;  1Z7D A;  3FRK A;  5EIG A;  2D61 A;  1AJR A;  2VLF A;  1ELU A;  1TOI A;  5EUD A;  5EQC A;  2XBN A;  4E1O A;  3GZD A;  4MQR A;  2R5E A;  3KE3 A;  1AKB A;  2QLR A;  1IUG A;  1SPA A;  3WCN A;  2YKY A;  5G4I A;  4PFF A;  3NDN A;  1AHE A;  1W7L A;  2GB3 A;  3GSB A;  2EZ1 A;  2W8J A;  2HOX A;  2TPL A;  4W1W A;  2Z20 A;  3ISL A;  4AO9 A;  4ITG A;  3NNK A;  5EUE A;  1ECX A;  2CST A;  1B8G A;  2PB2 A;  3AAT A;  1LW5 A;  4DBC A;  3TFT A;  2CY8 A;  3MAU A;  4MGR A;  3VAX A;  2VGT A;  4QGR A;  3DC1 A;  4AZK A;  1J04 A;  1DJE A;  3LVL B;  3AEO A;  1RV3 A;  1CQ8 A;  2DGK A;  4Q6R A;  4EFF A;  2AY4 A;  1FG3 A;  2VI8 A;  2E7J A;  2Z9X A;  3ACZ A;  4CBS A;  3A9X A;  4F5G A;  1ARG A;  1O62 A;  3CQ5 A;  1KL2 A;  1I48 A;  3NYU A;  3HL2 A;  1C9C A;  3DYD A;  2CIN A;  1V2F A;  1UU0 A;  4B98 A;  1BJW A;  2C0R A;  1SZK A;  3E2Y A;  3FQ7 A;  4F5H A;  1BQA A;  2FQ6 A;  3GZC A;  3LY1 A;  5E4Z A;  1BKG A;  2ZC0 A;  1WYU B;  1I43 A;  3LVJ A;  1ART A;  1QIR A;  3ZRP A;  1ZOD A;  2VI9 A;  2W8V A;  3RQ1 A;  4U2H A;  4R5F A;  4ZLV A;  4ZM3 A;  3BCX A;  1WST A;  1ORD A;  1QZ9 A;  1AMA A;  4RKD A;  1CZC A;  1WYU A;  3AOW A;  2AY8 A;  3VK4 A;  3QN6 A;  1YAA A;  2E54 A;  1S07 A;  2E7I A;  1OHY A;  2O0R A;  2W7K A;  3BB8 A;  2FN6 A;  4JF0 A;  4JEY A;  3QGU A;  4U1T A;  2AAT A;  3HMU A;  1EG5 A;  3WGC A;  3AEP A;  1GBN A;  3PJ0 A;  4L0O A;  4P7Y A;  2E7U A;  3DXV A;  1TPL A;  2G6W A;  2WK8 A;  3JTX A;  1LC8 A;  4GE9 A;  9AAT A;  1CL2 A;  3EZ1 A;  1IX8 A;  3QPG A;  3T32 A;  1AMR A;  2R0T A;  1KKJ A;  1C7G A;  4OC9 A;  3FVS A;  4F5J A;  1YJY A;  2Z9W A;  4ADE A;  1ASF A;  3MC6 C;  4M2K A;  4A6U A;  1BS0 A;  5G2Q A;  1QIT A;  4WB0 B;  1CS1 A;  2YKV A;  1IBJ A;  4IXZ A;  3AEJ C;  5LH9 A;  4CVQ A;  3FSL A;  4O6Z A;  4PIW A;  3DU4 A;  1TOJ A;  4TMR A;  4XJP A;  2W8U A;  1GC0 A;  3RBL A;  1ARI A;  2BI5 A;  4ATP A;  3PDB A;  3FVU A;  2X8U A;  4UHM A;  3HBX A;  1BQD A;  2QBT A;  2R2N A;  3IF2 A;  5I92 A;  1KKP A;  2D64 A;  2VMV A;  1BT4 A;  4GEB A;  4AZJ A;  4WP0 A;  3DXW A;  1S0A A;  3A9Y A;  1O4S A;  4AH3 A;  4Q31 A;  2VMQ A;  1MLZ A;  3FVX A;  1AHG A;  2W8T A;  4LNL A;  3E2F A;  2EH6 A;  3PDX A;  2GMS A;  1S06 A;  2EO5 A;  3COG A;  4JE5 A;  3HLM A;  3W1I A;  2Z9U A;  4WYA A;  5F9S A;  4RIZ A;  2PO3 A;  2Z9V A;  2W7H A;  4FFC A;  4BQ0 A;  2VMR A;  4ZWV A;  3E2Z B;  4W91 A;  4B9B A;  4WXG A;  1IX6 A;  2WK9 A;  3KGX A;  3NUB A;  2BI2 A;  4A00 A;  2VMT A;  4IYO B;  1BJO B;  4JEW A;  3E9K A;  2V0Y A;  3Q8N A;  2VMX A;  4A6R A;  4ZDL A;  1ASC A;  3EIA A;  4DQ6 A;  3AOV A;  1H1C A;  2D63 A;  2OGE A;  3AEN A;  2BI3 A;  2HOZ A;  3DOD A;  1I41 A;  1ARH A;  3ELP A;  3BWN A;  3EUC A;  4WD2 A;  5E3K A;  2YKX A;  2JJG A;  2DGL A;  1PFF A;  3WKS A;  3RCH A;  4OCA A;  3JWB A;  3CQ6 A;  2JJE A;  4W8I A;  3GZD C;  1QGN A;  3DZZ A;  1LC5 A;  1C7N A;  2XH1 A;  3CBF A;  3FFR A;  2D7Y A;  1FG7 A;  8AAT A;  4BA4 A;  1ASE A;  1M0P A;  1WKH A;  3A2B A;  1AJS A;  3N5M A;  5E5I A;  3BN1 A;  3TAT A;  1KMJ A;  4EU1 A;  4F4E A;  1GEX A;  5D95 A;  1ASA A;  1AIC A;  4KXK A;  1X2A A;  3MBB A;  4PVF A;  4A6T A;  1CQ6 A;  1PMM A;  1MDX A;  3WKR A;  3P1T A;  4J5U A;  3EI9 A;  2Z61 A;  2AY7 A;  2CFB A;  4JEX A;  4N0W A;  2VMW A;  3VP6 A;  2AY6 A;  4WXF A;  2DGM A;  2JJH A;  2BYJ A;  3B1E A;  3VK3 A;  1Z3Z A;  2RFV A;  4OYT A;  1OAT A;  3H7F A;  3MEB A;  3NYS A;  4K2B A;  3WY7 A;  1QJ5 A;  2W7I A;  1ASL A;  1DTY A;  4IYO A;  1MAQ A;  2YRI A;  3BS8 A;  5DB5 A;  4ATQ A;  2D66 A;  3AEM A;  4ZAS A;  3BCB A;  2W7D A;  1IJI A;  7AAT A;  1TAS A;  3ZRQ A;  1MLY A;  3QHX A;  3NX3 A;  3A8U X;  3L44 A;  3L8A A;  3FD0 A;  1GEY A;  5FT5 A;  4CXR A;  1XEY A;  1AJS B;  4CBR A;  3EI6 A;  2JJF A;  3B1C A;  1XI9 A;  1AY5 A;  2VMS A;  1WKG A;  2ZUK A;  2YRR A;  3F9T A;  3W1J A;  3N75 A;  1P3W A;  1UU2 A;  4ISY A;  4DGT A;  1DJU A;  5M49 A;  2FNU A;  3P6K A;  5DX5 A;  5BJ4 A;  3AEL A;  4XEW A;  2BHX A;  2JIS A;  5G4J A;  4JEV A;  4MQP A;  4W5K A;  4OT8 A;  3LWS A;  2VMZ A;  3AEJ A;  4IW7 A;  4IXO A;  4A0H A;  1AMQ A;  2HP1 A;  3DRD A;  5K8B A;  5IWQ A;  3UAK A;  2VGU A;  4A0R A;  1AIA A;  3OKS A;  3WZF A;  4MY5 A;  3G8M A;  3R9A A;  4CXQ A;  1JG8 A;  2CTZ A;  3KKI A;  5HHY A;  4OBV A;  2VIB A;  5D5S A;  1YJZ A;  2AY3 A;  3AEN B;  3ATH A;  1TAR A;  1S09 A;  2Q7W A;  4W1V A;  3VK2 A;  2VYC A;  2BI1 A;  4IXS A;  4W1X A;  1VEF A;  2YOB A;  4BMK A;  1B4X A;  3GWP A;  2OAT A;  3LG0 A;  5FT6 A;  4HVK A;  1RVY A;  2EPJ A;  1V2E A;  3FCR A;  4Q76 A;  1AIB A;  3JWA A;  4RLG A;  4F5I A;  4J8L A;  1DJ9 A;  3PPL A;  1D7R A;  1DGE A;  5M46 A;  1AKC A;  3JU7 A;  4ZDO A;  2AY2 A;  4ITX A;  4ADC A;  2ZY4 A;  1GC3 A;  1CZE A;  1JS6 A;  3HVY A;  1B9I A;  3MKJ A;  2R5C B;  4MQQ A; 
#chains in the Genus database with same CATH topology
 1GCK A;  2BIG A;  1J32 A;  4KYO A;  4TN4 A;  3FFH A;  2BIE A;  3N4S A;  3UWC A;  2BWO A;  4MKJ A;  5FT4 A;  2W7E A;  4XJO A;  1TAT A;  2V1P A;  2D7Z A;  3NUI A;  2HOR A;  2NMP A;  2ZYJ A;  2X5D A;  1JF9 A;  3NYT A;  4XJM A;  3PAA A;  1WYT A;  2CH1 A;  2X3L A;  3PDB B;  3EI7 A;  4TV7 A;  1CJ0 A;  1EJI A;  2O1B A;  4JF1 A;  1BW0 A;  2FM1 A;  4RIT A;  2D5Y A;  2VMN A;  3PD6 B;  1WYT B;  4WB0 A;  3QI6 A;  3FQA A;  4WYF A;  1EQB A;  3FZ8 A;  3PIU A;  2ZY2 A;  4MSO A;  2HUF A;  4RM1 A;  5AX8 A;  1MGV A;  1SF2 A;  2QB2 A;  1CQ7 A;  4OBU A;  1AY8 A;  3ZZJ A;  4F5M A;  2VMU A;  4H63 Q;  1C4K A;  4ZWM A;  2CJH A;  1LS3 A;  4AO4 A;  1ASM A;  2HZP A;  5LHA A;  4M2J A;  1D2F A;  3BV0 A;  1ASN A;  3GR9 A;  3QM2 A;  2HOY A;  4MKK A;  1YIY A;  2DKB A;  4R5Z A;  1O69 A;  3G0T A;  1W7N A;  2ZSM A;  1M0Q A;  4GSA A;  5EIG B;  2BYL A;  4ZAH A;  2YCP A;  1LK9 A;  3ZZK A;  3JW9 A;  1FC4 A;  3H14 A;  4LC3 A;  5G2P A;  5G09 A;  1IVR A;  4PFN A;  1I29 A;  2ZP7 A;  3GJU A;  2WB6 A;  3WX9 A;  4WYC A;  2HUU A;  2BIA A;  3K7Y A;  1S08 A;  5EAV A;  4R8D A;  1YIZ A;  1VJO A;  1AAM A;  3NU8 A;  4K2M A;  4RAE A;  3W1H A;  1LKC A;  5KTB A;  3ASA A;  2CH2 A;  2JGT A;  2DR1 A;  4M2M A;  5BJ3 A;  2GMU A;  1M0O A;  2ZJG A;  3FZ6 A;  1M4N A;  1G7X A;  3PGY A;  2C81 A;  1ASD A;  2OQX A;  4A72 A;  3AV7 A;  2DOU A;  5F8V A;  2ZY3 A;  2R5C A;  1LC7 A;  3NU7 A;  1IAX A;  4IY7 A;  1DFO A;  1M0N A;  3A9Z A;  3M5U A;  2D65 A;  1G4V A;  3TCM A;  1BJ4 A;  2Z1Y A;  3RUY A;  3ZRR A;  4GDY A;  2EZ2 A;  3ELE A;  1TOK A;  1YOO A;  2WKA A;  4JE5 D;  4XJL A;  1X28 A;  2DKJ A;  1RVU A;  2QMA A;  2W7F A;  3FTB A;  2C7T A;  3ASB A;  2OKJ A;  2HP2 A;  3BWO A;  5HXX A;  1C7O A;  3KGW A;  1T3I A;  2YCN A;  3GBX A;  4AOA A;  4IX8 A;  3DR4 A;  3LV2 A;  1N31 A;  4WLJ A;  3VOM A;  1M7Y A;  2VGS A;  4RKC A;  4WYD A;  4FL0 A;  5HDM A;  4ZM4 A;  1OHW A;  2EGY A;  3G7Q A;  4XK1 A;  5JAY A;  2YKU A;  2VGZ A;  4A0G A;  4ZDP A;  4GRX A;  2JG2 A;  3B46 A;  4OTL A;  4ADD A;  2Z1Z A;  2VLH A;  2QA3 A;  5M4D A;  3FDB A;  4Q75 A;  4WBT A;  1DKA A;  5DJ1 A;  2W7L A;  3K40 A;  5J8Q A;  3BC8 A;  2WK7 A;  1PMO A;  3DR7 A;  4WYE A;  4F5F A;  3PD6 A;  4EB5 A;  1AAW A;  1KMK A;  3AEM C;  4K2I A;  2YCT A;  2ORD A;  2VMO A;  2VMP A;  2FNI A;  1JS3 A;  1AKA A;  5M4B A;  2BI9 A;  3BWN C;  3UE8 A;  3EIB A;  3FZ7 A;  2A1V A;  1AMS A;  2W7J A;  3OP7 A;  4ZSY A;  4P3M A;  1BJN A;  1DGD A;  1G7W A;  3F0H A;  2F8J A;  4WYG A;  3MAF B;  1OXP A;  5G0A A;  4Y0I A;  3N0L A;  1B5O A;  3E77 A;  2VGV A;  3NTJ A;  3RI6 A;  1KL1 A;  1O61 A;  1RV4 A;  3I5T A;  3II0 A;  3JZL A;  1VP4 A;  4ZSW A;  1E5E A;  1GEW A;  1LW4 A;  2AY5 A;  3CQ4 A;  3FDD A;  2O7C A;  4UQV A;  1Y4I A;  2CJD A;  2HUI A;  1MDO A;  1AY4 A;  1X0M A;  2ZY5 A;  3MAF A;  2C44 A;  4GE4 A;  3RCH B;  1UKJ A;  3NRA A;  1CL1 A;  3TQX A;  4WXB A;  2AY9 A;  1IX7 A;  4ADB A;  1D7U A;  1SFF A;  1AHY A;  1SZS A;  3MAD A;  2W7M A;  2VIA A;  1OHV A;  1YNU A;  3K28 A;  3I16 A;  3LVK A;  4XAU A;  1GD9 A;  4JEZ A;  3EI5 A;  1TOE A;  3BCA A;  4RJ0 A;  1N2T A;  3USF A;  4KAM A;  2BWN A;  4HF8 A;  1ELQ A;  2VGW A;  3CAI A;  1BJO A;  3E6G A;  4LNM A;  1MDZ A;  4OMA A;  3F6T A;  3FKD A;  3WGB A;  1G4X A;  5DJ9 A;  1W23 A;  4WLH A;  3ECD A;  1WYV A;  4BA5 A;  2EYQ A;  1C0N A;  2BWP A;  1V2D A;  4N0B A;  2W8W A;  4LW4 A;  1QJ3 A;  1B5P A;  4NOG A;  2QB3 A;  3IHJ A;  3WLX A;  1D7V A;  1SZU A;  1YJS A;  2YHK A;  1U08 A;  3EZS A;  4I8A A;  2AEV A;  4E3Q A;  1E5F A;  1AHX A;  3PA9 A;  3N4R A;  1GC2 A;  3D6K A;  2GQN A;  5EUN A;  2AY1 A;  2W7G A;  4H51 A;  1UU1 A;  2FYF A;  2CAN A;  2OGA A;  4R2N A;  1ASB A;  2PB0 A;  3R4T A;  4GE7 A;  4UOY A;  5TF5 A;  3EI8 A;  4LNJ A;  4Y0H A;  1ZOB A;  2GSA A;  1AHF A;  3I4J A;  3MC6 A;  3HQT A;  4EB7 A;  1PG8 A;  5EAA A;  5C6U A;  3WCO A;  4A0F A;  2VMY A;  1QIS A;  5FT8 A;  1M6S A;  1MAP A;  3RBF A;  1H0C A;  2X5F A;  4E3R A;  4UHN A;  1B9H A;  1ASG A;  4BHD A;  2CJG A;  2BKW A;  4EMY A;  1ARS A;  1GDE A;  2AEU A;  1W3U A;  3HDO A;  3HT4 A;  1D7S A;  1GC4 A;  3TFU A;  3QBO A;  1WYV B;  4F5L A;  1IAY A;  3B8X A;  3E2Z A;  4LW2 A;  4UHO A;  1TOG A;  3FQ8 A;  3B1D A;  2OKK A;  1M32 A;  4Y0D A;  1OXO A;  2ZSL A;  1AX4 A;  1X29 A;  3GET A;  4XQ2 A;  1ZC9 A;  3LVM A;  1N8P A;  1W7M A;  5EFS A;  4E77 A;  1V72 A;  2CB1 A;  4RJY A;  4F5K A;  1SVV A;  2Z67 A;  1Z7D A;  3FRK A;  5EIG A;  2D61 A;  1AJR A;  2VLF A;  1ELU A;  1TOI A;  5EUD A;  5EQC A;  2XBN A;  4E1O A;  3GZD A;  4MQR A;  2R5E A;  3KE3 A;  1AKB A;  2QLR A;  1IUG A;  1SPA A;  3WCN A;  2YKY A;  5G4I A;  4PFF A;  3NDN A;  1AHE A;  1W7L A;  2GB3 A;  3GSB A;  2EZ1 A;  2W8J A;  2HOX A;  2TPL A;  4W1W A;  2Z20 A;  3ISL A;  4AO9 A;  4ITG A;  3NNK A;  5EUE A;  1ECX A;  2CST A;  1B8G A;  2PB2 A;  3AAT A;  1LW5 A;  4DBC A;  3TFT A;  2CY8 A;  3MAU A;  4MGR A;  3VAX A;  2VGT A;  4QGR A;  3DC1 A;  4AZK A;  1J04 A;  1DJE A;  3LVL B;  3AEO A;  1RV3 A;  1CQ8 A;  2DGK A;  4Q6R A;  4EFF A;  2AY4 A;  1FG3 A;  2VI8 A;  2E7J A;  2Z9X A;  3ACZ A;  4CBS A;  3A9X A;  4F5G A;  1ARG A;  1O62 A;  3CQ5 A;  1KL2 A;  1I48 A;  3NYU A;  3HL2 A;  1C9C A;  3DYD A;  2CIN A;  1V2F A;  1UU0 A;  4B98 A;  1BJW A;  2C0R A;  1SZK A;  3E2Y A;  3FQ7 A;  4F5H A;  1BQA A;  2FQ6 A;  3GZC A;  3LY1 A;  5E4Z A;  2QSR A;  1BKG A;  2ZC0 A;  1WYU B;  1I43 A;  3LVJ A;  1KAF A;  1ART A;  1QIR A;  3ZRP A;  1ZOD A;  2VI9 A;  2W8V A;  3RQ1 A;  4U2H A;  4R5F A;  4ZLV A;  4ZM3 A;  3BCX A;  1WST A;  1ORD A;  1QZ9 A;  1AMA A;  4RKD A;  1CZC A;  1WYU A;  3AOW A;  2AY8 A;  3VK4 A;  3QN6 A;  1YAA A;  2E54 A;  1S07 A;  2E7I A;  1OHY A;  2O0R A;  2W7K A;  3BB8 A;  2FN6 A;  4JF0 A;  4JEY A;  3QGU A;  4U1T A;  2AAT A;  3HMU A;  1EG5 A;  3WGC A;  3AEP A;  1GBN A;  3PJ0 A;  4L0O A;  4P7Y A;  2E7U A;  3DXV A;  1TPL A;  2G6W A;  2WK8 A;  3JTX A;  1LC8 A;  4GE9 A;  9AAT A;  1CL2 A;  3EZ1 A;  1IX8 A;  3QPG A;  3T32 A;  1AMR A;  2R0T A;  1KKJ A;  1C7G A;  4OC9 A;  3FVS A;  4F5J A;  1YJY A;  2Z9W A;  4ADE A;  1ASF A;  3MC6 C;  4M2K A;  4A6U A;  1BS0 A;  5G2Q A;  1QIT A;  4WB0 B;  1CS1 A;  2YKV A;  1IBJ A;  4IXZ A;  3AEJ C;  5LH9 A;  4CVQ A;  3FSL A;  4O6Z A;  4PIW A;  3DU4 A;  1TOJ A;  4TMR A;  4XJP A;  2W8U A;  1GC0 A;  3RBL A;  1ARI A;  2BI5 A;  4ATP A;  3PDB A;  3FVU A;  2X8U A;  4UHM A;  3HBX A;  1BQD A;  2QBT A;  2R2N A;  3IF2 A;  5I92 A;  1KKP A;  2D64 A;  2VMV A;  1BT4 A;  4GEB A;  4AZJ A;  4WP0 A;  3DXW A;  1S0A A;  3A9Y A;  1O4S A;  4AH3 A;  4Q31 A;  2VMQ A;  1MLZ A;  3FVX A;  1AHG A;  2W8T A;  4LNL A;  3E2F A;  4K05 A;  2EH6 A;  3PDX A;  2GMS A;  1S06 A;  2EO5 A;  3COG A;  4JE5 A;  3HLM A;  3W1I A;  2Z9U A;  4WYA A;  5F9S A;  4RIZ A;  2PO3 A;  2Z9V A;  2W7H A;  4FFC A;  4BQ0 A;  2VMR A;  4ZWV A;  3E2Z B;  4W91 A;  4B9B A;  4WXG A;  1IX6 A;  2WK9 A;  3KGX A;  3NUB A;  2BI2 A;  4A00 A;  2VMT A;  4IYO B;  1BJO B;  4JEW A;  3E9K A;  2V0Y A;  3Q8N A;  2VMX A;  4A6R A;  4ZDL A;  1ASC A;  3EIA A;  4DQ6 A;  3AOV A;  1H1C A;  2D63 A;  2OGE A;  3AEN A;  2BI3 A;  2HOZ A;  3DOD A;  1I41 A;  1ARH A;  3ELP A;  3BWN A;  3EUC A;  4WD2 A;  5E3K A;  2YKX A;  2JJG A;  2DGL A;  1PFF A;  3WKS A;  3RCH A;  4OCA A;  3JWB A;  3CQ6 A;  2JJE A;  4W8I A;  3GZD C;  1QGN A;  3DZZ A;  1LC5 A;  1C7N A;  2XH1 A;  3CBF A;  3FFR A;  2D7Y A;  1FG7 A;  8AAT A;  4BA4 A;  1ASE A;  1M0P A;  1WKH A;  3A2B A;  1AJS A;  3N5M A;  5E5I A;  3BN1 A;  3TAT A;  1KMJ A;  4EU1 A;  4F4E A;  3N4X A;  1GEX A;  5D95 A;  1ASA A;  1AIC A;  4KXK A;  1X2A A;  3MBB A;  4PVF A;  4A6T A;  1CQ6 A;  1PMM A;  1MDX A;  3WKR A;  3P1T A;  2FKI A;  4J5U A;  3EI9 A;  2Z61 A;  2AY7 A;  2CFB A;  4JEX A;  2KFP A;  4N0W A;  2VMW A;  3VP6 A;  2AY6 A;  4WXF A;  2DGM A;  2JJH A;  2BYJ A;  3B1E A;  3VK3 A;  1Z3Z A;  2RFV A;  4OYT A;  1OAT A;  3H7F A;  3MEB A;  3NYS A;  4K2B A;  3WY7 A;  2G7J A;  1QJ5 A;  2W7I A;  1ASL A;  1DTY A;  4IYO A;  1MAQ A;  2YRI A;  3BS8 A;  5DB5 A;  4ATQ A;  2D66 A;  3AEM A;  4ZAS A;  3BCB A;  2W7D A;  1IJI A;  7AAT A;  1TAS A;  3ZRQ A;  1MLY A;  3QHX A;  3NX3 A;  3A8U X;  3L44 A;  3L8A A;  3FD0 A;  1GEY A;  5FT5 A;  4CXR A;  1XEY A;  1AJS B;  4CBR A;  3EI6 A;  2JJF A;  3B1C A;  1XI9 A;  1AY5 A;  2VMS A;  1WKG A;  2ZUK A;  2YRR A;  3F9T A;  3W1J A;  3N75 A;  1P3W A;  1UU2 A;  4ISY A;  4DGT A;  1DJU A;  5M49 A;  2FNU A;  3P6K A;  5DX5 A;  5BJ4 A;  3AEL A;  4XEW A;  2BHX A;  2JIS A;  5G4J A;  4JEV A;  4MQP A;  4W5K A;  4OT8 A;  3LWS A;  2VMZ A;  3AEJ A;  4IW7 A;  4IXO A;  4A0H A;  1AMQ A;  2HP1 A;  3DRD A;  5K8B A;  5IWQ A;  3H9X A;  3UAK A;  2VGU A;  4A0R A;  1AIA A;  3OKS A;  3WZF A;  4MY5 A;  3G8M A;  3R9A A;  4CXQ A;  1JG8 A;  2CTZ A;  3KKI A;  5HHY A;  4OBV A;  2VIB A;  5D5S A;  1YJZ A;  2AY3 A;  3AEN B;  3ATH A;  1TAR A;  1S09 A;  2Q7W A;  4W1V A;  3VK2 A;  2VYC A;  2BI1 A;  4IXS A;  4W1X A;  1VEF A;  2YOB A;  4BMK A;  1B4X A;  3GWP A;  2OAT A;  3LG0 A;  5FT6 A;  4HVK A;  1RVY A;  2EPJ A;  1V2E A;  3FCR A;  4Q76 A;  1AIB A;  3JWA A;  4RLG A;  4F5I A;  4J8L A;  1DJ9 A;  3PPL A;  1D7R A;  1DGE A;  5M46 A;  1AKC A;  3N7N A;  3JU7 A;  4ZDO A;  2AY2 A;  4ITX A;  4ADC A;  2ZY4 A;  1GC3 A;  1CZE A;  1JS6 A;  3HVY A;  1B9I A;  3MKJ A;  2R5C B;  4MQQ A; 
#chains in the Genus database with same CATH homology
 1GCK A;  2BIG A;  1J32 A;  4KYO A;  4TN4 A;  3FFH A;  2BIE A;  3N4S A;  3UWC A;  2BWO A;  4MKJ A;  5FT4 A;  2W7E A;  4XJO A;  1TAT A;  2V1P A;  2D7Z A;  3NUI A;  2HOR A;  2NMP A;  2ZYJ A;  2X5D A;  1JF9 A;  3NYT A;  4XJM A;  3PAA A;  1WYT A;  2CH1 A;  2X3L A;  3PDB B;  3EI7 A;  4TV7 A;  1CJ0 A;  1EJI A;  2O1B A;  4JF1 A;  1BW0 A;  2FM1 A;  4RIT A;  2D5Y A;  2VMN A;  3PD6 B;  1WYT B;  4WB0 A;  3QI6 A;  3FQA A;  4WYF A;  1EQB A;  3FZ8 A;  3PIU A;  2ZY2 A;  4MSO A;  2HUF A;  4RM1 A;  5AX8 A;  1MGV A;  1SF2 A;  2QB2 A;  1CQ7 A;  4OBU A;  1AY8 A;  3ZZJ A;  4F5M A;  2VMU A;  4H63 Q;  1C4K A;  4ZWM A;  2CJH A;  1LS3 A;  4AO4 A;  1ASM A;  2HZP A;  5LHA A;  4M2J A;  1D2F A;  3BV0 A;  1ASN A;  3GR9 A;  3QM2 A;  2HOY A;  4MKK A;  1YIY A;  2DKB A;  4R5Z A;  1O69 A;  3G0T A;  1W7N A;  2ZSM A;  1M0Q A;  4GSA A;  5EIG B;  2BYL A;  4ZAH A;  2YCP A;  1LK9 A;  3ZZK A;  3JW9 A;  1FC4 A;  3H14 A;  4LC3 A;  5G2P A;  5G09 A;  1IVR A;  4PFN A;  1I29 A;  2ZP7 A;  3GJU A;  2WB6 A;  3WX9 A;  4WYC A;  2HUU A;  2BIA A;  3K7Y A;  1S08 A;  5EAV A;  4R8D A;  1YIZ A;  1VJO A;  1AAM A;  3NU8 A;  4K2M A;  4RAE A;  3W1H A;  1LKC A;  5KTB A;  3ASA A;  2CH2 A;  2JGT A;  2DR1 A;  4M2M A;  5BJ3 A;  2GMU A;  1M0O A;  2ZJG A;  3FZ6 A;  1M4N A;  1G7X A;  3PGY A;  2C81 A;  1ASD A;  2OQX A;  4A72 A;  3AV7 A;  2DOU A;  5F8V A;  2ZY3 A;  2R5C A;  1LC7 A;  3NU7 A;  1IAX A;  4IY7 A;  1DFO A;  1M0N A;  3A9Z A;  3M5U A;  2D65 A;  1G4V A;  3TCM A;  1BJ4 A;  2Z1Y A;  3RUY A;  3ZRR A;  4GDY A;  2EZ2 A;  3ELE A;  1TOK A;  1YOO A;  2WKA A;  4JE5 D;  4XJL A;  1X28 A;  2DKJ A;  1RVU A;  2QMA A;  2W7F A;  3FTB A;  2C7T A;  3ASB A;  2OKJ A;  2HP2 A;  3BWO A;  5HXX A;  1C7O A;  3KGW A;  1T3I A;  2YCN A;  3GBX A;  4AOA A;  4IX8 A;  3DR4 A;  3LV2 A;  1N31 A;  4WLJ A;  3VOM A;  1M7Y A;  2VGS A;  4RKC A;  4WYD A;  4FL0 A;  5HDM A;  4ZM4 A;  1OHW A;  2EGY A;  3G7Q A;  4XK1 A;  5JAY A;  2YKU A;  2VGZ A;  4A0G A;  4ZDP A;  4GRX A;  2JG2 A;  3B46 A;  4OTL A;  4ADD A;  2Z1Z A;  2VLH A;  2QA3 A;  5M4D A;  3FDB A;  4Q75 A;  4WBT A;  1DKA A;  5DJ1 A;  2W7L A;  3K40 A;  5J8Q A;  3BC8 A;  2WK7 A;  1PMO A;  3DR7 A;  4WYE A;  4F5F A;  3PD6 A;  4EB5 A;  1AAW A;  1KMK A;  3AEM C;  4K2I A;  2YCT A;  2ORD A;  2VMO A;  2VMP A;  2FNI A;  1JS3 A;  1AKA A;  5M4B A;  2BI9 A;  3BWN C;  3UE8 A;  3EIB A;  3FZ7 A;  2A1V A;  1AMS A;  2W7J A;  3OP7 A;  4ZSY A;  4P3M A;  1BJN A;  1DGD A;  1G7W A;  3F0H A;  2F8J A;  4WYG A;  3MAF B;  1OXP A;  5G0A A;  4Y0I A;  3N0L A;  1B5O A;  3E77 A;  2VGV A;  3NTJ A;  3RI6 A;  1KL1 A;  1O61 A;  1RV4 A;  3I5T A;  3II0 A;  3JZL A;  1VP4 A;  4ZSW A;  1E5E A;  1GEW A;  1LW4 A;  2AY5 A;  3CQ4 A;  3FDD A;  2O7C A;  4UQV A;  1Y4I A;  2CJD A;  2HUI A;  1MDO A;  1AY4 A;  1X0M A;  2ZY5 A;  3MAF A;  2C44 A;  4GE4 A;  3RCH B;  1UKJ A;  3NRA A;  1CL1 A;  3TQX A;  4WXB A;  2AY9 A;  1IX7 A;  4ADB A;  1D7U A;  1SFF A;  1AHY A;  1SZS A;  3MAD A;  2W7M A;  2VIA A;  1OHV A;  1YNU A;  3K28 A;  3I16 A;  3LVK A;  4XAU A;  1GD9 A;  4JEZ A;  3EI5 A;  1TOE A;  3BCA A;  4RJ0 A;  1N2T A;  3USF A;  4KAM A;  2BWN A;  4HF8 A;  1ELQ A;  2VGW A;  3CAI A;  1BJO A;  3E6G A;  4LNM A;  1MDZ A;  4OMA A;  3F6T A;  3FKD A;  3WGB A;  1G4X A;  5DJ9 A;  1W23 A;  4WLH A;  3ECD A;  1WYV A;  4BA5 A;  2EYQ A;  1C0N A;  2BWP A;  1V2D A;  4N0B A;  2W8W A;  4LW4 A;  1QJ3 A;  1B5P A;  4NOG A;  2QB3 A;  3IHJ A;  3WLX A;  1D7V A;  1SZU A;  1YJS A;  2YHK A;  1U08 A;  3EZS A;  4I8A A;  2AEV A;  4E3Q A;  1E5F A;  1AHX A;  3PA9 A;  3N4R A;  1GC2 A;  3D6K A;  2GQN A;  5EUN A;  2AY1 A;  2W7G A;  4H51 A;  1UU1 A;  2FYF A;  2CAN A;  2OGA A;  4R2N A;  1ASB A;  2PB0 A;  3R4T A;  4GE7 A;  4UOY A;  5TF5 A;  3EI8 A;  4LNJ A;  4Y0H A;  1ZOB A;  2GSA A;  1AHF A;  3I4J A;  3MC6 A;  3HQT A;  4EB7 A;  1PG8 A;  5EAA A;  5C6U A;  3WCO A;  4A0F A;  2VMY A;  1QIS A;  5FT8 A;  1M6S A;  1MAP A;  3RBF A;  1H0C A;  2X5F A;  4E3R A;  4UHN A;  1B9H A;  1ASG A;  4BHD A;  2CJG A;  2BKW A;  4EMY A;  1ARS A;  1GDE A;  2AEU A;  1W3U A;  3HDO A;  3HT4 A;  1D7S A;  1GC4 A;  3TFU A;  3QBO A;  1WYV B;  4F5L A;  1IAY A;  3B8X A;  3E2Z A;  4LW2 A;  4UHO A;  1TOG A;  3FQ8 A;  3B1D A;  2OKK A;  1M32 A;  4Y0D A;  1OXO A;  2ZSL A;  1AX4 A;  1X29 A;  3GET A;  4XQ2 A;  1ZC9 A;  3LVM A;  1N8P A;  1W7M A;  5EFS A;  4E77 A;  1V72 A;  2CB1 A;  4RJY A;  4F5K A;  1SVV A;  2Z67 A;  1Z7D A;  3FRK A;  5EIG A;  2D61 A;  1AJR A;  2VLF A;  1ELU A;  1TOI A;  5EUD A;  5EQC A;  2XBN A;  4E1O A;  3GZD A;  4MQR A;  2R5E A;  3KE3 A;  1AKB A;  2QLR A;  1IUG A;  1SPA A;  3WCN A;  2YKY A;  5G4I A;  4PFF A;  3NDN A;  1AHE A;  1W7L A;  2GB3 A;  3GSB A;  2EZ1 A;  2W8J A;  2HOX A;  2TPL A;  4W1W A;  2Z20 A;  3ISL A;  4AO9 A;  4ITG A;  3NNK A;  5EUE A;  1ECX A;  2CST A;  1B8G A;  2PB2 A;  3AAT A;  1LW5 A;  4DBC A;  3TFT A;  2CY8 A;  3MAU A;  4MGR A;  3VAX A;  2VGT A;  4QGR A;  3DC1 A;  4AZK A;  1J04 A;  1DJE A;  3LVL B;  3AEO A;  1RV3 A;  1CQ8 A;  2DGK A;  4Q6R A;  4EFF A;  2AY4 A;  1FG3 A;  2VI8 A;  2E7J A;  2Z9X A;  3ACZ A;  4CBS A;  3A9X A;  4F5G A;  1ARG A;  1O62 A;  3CQ5 A;  1KL2 A;  1I48 A;  3NYU A;  3HL2 A;  1C9C A;  3DYD A;  2CIN A;  1V2F A;  1UU0 A;  4B98 A;  1BJW A;  2C0R A;  1SZK A;  3E2Y A;  3FQ7 A;  4F5H A;  1BQA A;  2FQ6 A;  3GZC A;  3LY1 A;  5E4Z A;  2QSR A;  1BKG A;  2ZC0 A;  1WYU B;  1I43 A;  3LVJ A;  1ART A;  1QIR A;  3ZRP A;  1ZOD A;  2VI9 A;  2W8V A;  3RQ1 A;  4U2H A;  4R5F A;  4ZLV A;  4ZM3 A;  3BCX A;  1WST A;  1ORD A;  1QZ9 A;  1AMA A;  4RKD A;  1CZC A;  1WYU A;  3AOW A;  2AY8 A;  3VK4 A;  3QN6 A;  1YAA A;  2E54 A;  1S07 A;  2E7I A;  1OHY A;  2O0R A;  2W7K A;  3BB8 A;  2FN6 A;  4JF0 A;  4JEY A;  3QGU A;  4U1T A;  2AAT A;  3HMU A;  1EG5 A;  3WGC A;  3AEP A;  1GBN A;  3PJ0 A;  4L0O A;  4P7Y A;  2E7U A;  3DXV A;  1TPL A;  2G6W A;  2WK8 A;  3JTX A;  1LC8 A;  4GE9 A;  9AAT A;  1CL2 A;  3EZ1 A;  1IX8 A;  3QPG A;  3T32 A;  1AMR A;  2R0T A;  1KKJ A;  1C7G A;  4OC9 A;  3FVS A;  4F5J A;  1YJY A;  2Z9W A;  4ADE A;  1ASF A;  3MC6 C;  4M2K A;  4A6U A;  1BS0 A;  5G2Q A;  1QIT A;  4WB0 B;  1CS1 A;  2YKV A;  1IBJ A;  4IXZ A;  3AEJ C;  5LH9 A;  4CVQ A;  3FSL A;  4O6Z A;  4PIW A;  3DU4 A;  1TOJ A;  4TMR A;  4XJP A;  2W8U A;  1GC0 A;  3RBL A;  1ARI A;  2BI5 A;  4ATP A;  3PDB A;  3FVU A;  2X8U A;  4UHM A;  3HBX A;  1BQD A;  2QBT A;  2R2N A;  3IF2 A;  5I92 A;  1KKP A;  2D64 A;  2VMV A;  1BT4 A;  4GEB A;  4AZJ A;  4WP0 A;  3DXW A;  1S0A A;  3A9Y A;  1O4S A;  4AH3 A;  4Q31 A;  2VMQ A;  1MLZ A;  3FVX A;  1AHG A;  2W8T A;  4LNL A;  3E2F A;  4K05 A;  2EH6 A;  3PDX A;  2GMS A;  1S06 A;  2EO5 A;  3COG A;  4JE5 A;  3HLM A;  3W1I A;  2Z9U A;  4WYA A;  5F9S A;  4RIZ A;  2PO3 A;  2Z9V A;  2W7H A;  4FFC A;  4BQ0 A;  2VMR A;  4ZWV A;  3E2Z B;  4W91 A;  4B9B A;  4WXG A;  1IX6 A;  2WK9 A;  3KGX A;  3NUB A;  2BI2 A;  4A00 A;  2VMT A;  4IYO B;  1BJO B;  4JEW A;  3E9K A;  2V0Y A;  3Q8N A;  2VMX A;  4A6R A;  4ZDL A;  1ASC A;  3EIA A;  4DQ6 A;  3AOV A;  1H1C A;  2D63 A;  2OGE A;  3AEN A;  2BI3 A;  2HOZ A;  3DOD A;  1I41 A;  1ARH A;  3ELP A;  3BWN A;  3EUC A;  4WD2 A;  5E3K A;  2YKX A;  2JJG A;  2DGL A;  1PFF A;  3WKS A;  3RCH A;  4OCA A;  3JWB A;  3CQ6 A;  2JJE A;  4W8I A;  3GZD C;  1QGN A;  3DZZ A;  1LC5 A;  1C7N A;  2XH1 A;  3CBF A;  3FFR A;  2D7Y A;  1FG7 A;  8AAT A;  4BA4 A;  1ASE A;  1M0P A;  1WKH A;  3A2B A;  1AJS A;  3N5M A;  5E5I A;  3BN1 A;  3TAT A;  1KMJ A;  4EU1 A;  4F4E A;  3N4X A;  1GEX A;  5D95 A;  1ASA A;  1AIC A;  4KXK A;  1X2A A;  3MBB A;  4PVF A;  4A6T A;  1CQ6 A;  1PMM A;  1MDX A;  3WKR A;  3P1T A;  2FKI A;  4J5U A;  3EI9 A;  2Z61 A;  2AY7 A;  2CFB A;  4JEX A;  2KFP A;  4N0W A;  2VMW A;  3VP6 A;  2AY6 A;  4WXF A;  2DGM A;  2JJH A;  2BYJ A;  3B1E A;  3VK3 A;  1Z3Z A;  2RFV A;  4OYT A;  1OAT A;  3H7F A;  3MEB A;  3NYS A;  4K2B A;  3WY7 A;  2G7J A;  1QJ5 A;  2W7I A;  1ASL A;  1DTY A;  4IYO A;  1MAQ A;  2YRI A;  3BS8 A;  5DB5 A;  4ATQ A;  2D66 A;  3AEM A;  4ZAS A;  3BCB A;  2W7D A;  1IJI A;  7AAT A;  1TAS A;  3ZRQ A;  1MLY A;  3QHX A;  3NX3 A;  3A8U X;  3L44 A;  3L8A A;  3FD0 A;  1GEY A;  5FT5 A;  4CXR A;  1XEY A;  1AJS B;  4CBR A;  3EI6 A;  2JJF A;  3B1C A;  1XI9 A;  1AY5 A;  2VMS A;  1WKG A;  2ZUK A;  2YRR A;  3F9T A;  3W1J A;  3N75 A;  1P3W A;  1UU2 A;  4ISY A;  4DGT A;  1DJU A;  5M49 A;  2FNU A;  3P6K A;  5DX5 A;  5BJ4 A;  3AEL A;  4XEW A;  2BHX A;  2JIS A;  5G4J A;  4JEV A;  4MQP A;  4W5K A;  4OT8 A;  3LWS A;  2VMZ A;  3AEJ A;  4IW7 A;  4IXO A;  4A0H A;  1AMQ A;  2HP1 A;  3DRD A;  5K8B A;  5IWQ A;  3H9X A;  3UAK A;  2VGU A;  4A0R A;  1AIA A;  3OKS A;  3WZF A;  4MY5 A;  3G8M A;  3R9A A;  4CXQ A;  1JG8 A;  2CTZ A;  3KKI A;  5HHY A;  4OBV A;  2VIB A;  5D5S A;  1YJZ A;  2AY3 A;  3AEN B;  3ATH A;  1TAR A;  1S09 A;  2Q7W A;  4W1V A;  3VK2 A;  2VYC A;  2BI1 A;  4IXS A;  4W1X A;  1VEF A;  2YOB A;  4BMK A;  1B4X A;  3GWP A;  2OAT A;  3LG0 A;  5FT6 A;  4HVK A;  1RVY A;  2EPJ A;  1V2E A;  3FCR A;  4Q76 A;  1AIB A;  3JWA A;  4RLG A;  4F5I A;  4J8L A;  1DJ9 A;  3PPL A;  1D7R A;  1DGE A;  5M46 A;  1AKC A;  3N7N A;  3JU7 A;  4ZDO A;  2AY2 A;  4ITX A;  4ADC A;  2ZY4 A;  1GC3 A;  1CZE A;  1JS6 A;  3HVY A;  1B9I A;  3MKJ A;  2R5C B;  4MQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...