4IW9A

Crystal structure of glutathione s-transferase mha_0454 (target efi-507015) from mannheimia haemolytica, gsh complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
210
structure length
210
Chain Sequence
SMKLYGLTGACSFVPHVALEWVKLRANQDYAFQAVSREFIKSAEYLALNPRGNVPLLVDGDLALTQNQAIVHYLDELYPEAKLFGSKTARDKAKAARWLAFFNSDVHKSFVPLFRLPSYAEGNETLTKTIRQQSAEQILEQLAFANAHLENHIFFGEEISVADAYLYIMLNWCRLLGLDFSHLSQLSAFMQRVEADQGVDNVREQEGLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione transferase
publication title Crystal Structure of Probable Glutathione S-Transferase Mha_0454 (Target Efi-507015) from Mannheimia Haemolytica
rcsb
source organism Mannheimia haemolytica phl213
molecule tags Transferase
total genus 76
structure length 210
sequence length 210
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4iw9A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4iw9A01
4K0NA 2B5EA 2GLRA 3M1GA 1A2JA 3EMXA 3GTUB 2IFQA 1AQVA 5F06A 1XOAA 1EWXA 2P0GA 3S9FA 4D73B 3BCKA 2X8CA 3UVHA 4IS0A 14GSA 3N5OA 2MBTA 1WOUA 2O85A 4TXOB 5E59A 5HR3A 2IMKA 4WKWA 2H1BA 3GL5A 5DCGA 1R5PA 1B9YC 4OCEA 2PUKC 2H01A 3GH6A 2B5YA 3KZQA 2F3MA 4O5RA 3UJ1A 3WT2A 2GSQA 1MEKA 5D9WA 3CTGA 3LXZA 2O87A 1ZYQB 1Z6MA 4KX4A 2C8UA 2H6YA 1G7OA 2L5OA 4NAXA 2HRFA 3F63A 5HR0A 2MMNA 5ID2A 2TRCP 1M0UA 5ECNB 2TIRA 1WPIA 3IR4A 4IQAA 3DXBA 4FIWA 1RW1A 1BAYA 1GSDA 4LMVA 1QFNA 1AW9A 5DJMA 3H79A 2H0HA 2YV9A 3GMFA 4HU9A 1V98A 3DMLA 1EV4A 1K0DA 4RI6A 2FA8A 4V1Ag 2ES7A 5B6NA 3MAKA 1TW9A 2CQ9A 4G0KA 2PVQA 1WP0A 3RPNA 4KUNA 5EVOA 4ECIA 3APOA 2EIOA 4P3YB 2H73A 3FR6A 1DBYA 3IC8A 4V1Ap 3F3QA 4BVXB 2LJRA 4MP4A 2N5FA 4F82A 2V32A 4WF4A 4WF5A 4NXIA 3QAWA 3C7MA 2IMIA 4MF6A 2UZ8A 3O76A 4LMWA 3PINA 3QR6A 5J9BA 2E7PA 2G2QA 4N30A 2E0QA 2H71A 2JZTA 4ULXA 4GCIA 5DQYA 3FR3A 2HYXA 1J9BA 2YJHA 2LTKA 4NV2A 3UMAA 1T1VA 3LSZA 3GX0A 1A8YA 1ZGNA 1IYIA 3D4MA 3L9SA 1Z9HA 2O8VB 7GSSA 4KGIA 1PSQA 3NOFA 5F05A 2B7JA 5KN0A 2XPDA 5GZZB 4GTUA 4IKHA 3GV1A 3KEBA 4G0IA 1EOGA 1X9WB 3HA9A 2WGRA 5E4WA 1DSBA 3GHAA 1EOHA 2VL9A 2P5QA 4WETA 1OKTA 4L8EA 3HHVA 4WEYA 1G6WA 3TRQA 1PGTA 4XS4A 1GTIA 1XWCA 1SK1A 1IYHA 3G7YA 2HSYA 3OR5A 4GSNA 3D4TA 4BL7B 1B9XC 3BBYA 1QK8A 4K8MA 4GWRA 5IPGA 4G0LA 3MSZA 1YDKA 3DYRA 4F0CA 1O8XA 3NIVA 2CVKA 2JZRA 1A0RP 3H4KA 2YV7A 3HYPA 3IE3A 4POLA 5IMFA 1JLVA 2H74A 2YN1A 3HZ4A 4QL7A 4OMVA 4F03A 1HYUA 1FG4A 1ZZYA 3RAZA 3P90A 3L9UA 2DC5A 3TKRA 5L71A 4ZB8A 3GSTA 5ECOB 2FWFA 4OO4A 1GSEA 3UEMA 3ZIVA 4DVCA 3MWHA 3CSJA 3HKRA 2CX4A 4GSSA 2AHEA 3WYWA 2V2GA 2LV3A 1KNGA 4O7HA 4N10A 2DMLA 5ELAA 1U3AA 3HXSA 4I2TA 4I8BA 4KE3A 1EP7A 4OD7A 3TCOA 5IOWA 5IPHA 2PN8A 3ZIJA 4I97A 4ZBBA 4EDZA 2ALBA 5J41A 1A23A 2LSTA 4JEDA 1ZOFA 4PNFA 3TJJA 3HDCA 2LJAA 1SJ6A 4FYBA 4JR6A 3AY8A 3ZZXA 1GSFA 2VCTA 3LXTA 1GTBA 1ERWA 4TRXA 1NSWA 4X43A 4POBA 4L0WA 5FT3A 5B7CA 1EEJA 5DBQA 3M0FA 2WCIA 4LLRA 4H86A 2QC7A 4I6XA 2RLIA 4PNGA 4ISDA 3QMXA 3LG6A 1K0CA 1R26A 5C00A 4JR4A 2H19A 3SWLA 3L4NA 4AJ8A 4K7IA 3DRNA 2HSMA 3KJYA 5GSTA 4TOPA 1OC3A 3H1NA 4OFNA 3GL3A 3F6FA 4ZBAA 5JWOB 3ERWA 2L4CA 3FEUA 4EL1A 3P8WA 3HVSA 3TB2A 4GXZA 3A2WA 2FGXA 4F9ZA 1TU7A 1OE7A 4YAPA 4AJ6A 2C3NA 1F3BA 2GQMA 3KD0A 1Y25A 3F8UA 3JCML 2MMAA 2JACA 1BYEA 3VK9A 1G6YA 4OFTA 2IL3A 4PQ1A 2F9SA 4TR1B 2PU9C 2OE3A 3E3EA 2A4VA 2HT9A 2RIIA 2OE0A 5ECKB 4ID0A 3FKFA 4TN8A 3C1SA 5G1LA 5ECPB 1QQ2A 4MH3A 1YY7A 2IJYA 1R7HA 2X64A 1XPVA 4MA9A 2DLXA 3M9KA 4MH2A 5LCZA 4HZ2A 2YPMA 5CRHA 1U87A 3EMPA 1XW5A 4RUVA 2OJLA 3UBLA 3DD3A 3CXGA 2DJ2A 1O7UA 2H66A 4TW5A 5D8IA 3IAS2 4DSRA 5DAKA 3VLNA 4G10A 2NVLA 5HFKA 3D21A 1TK8B 1AQWA 1M9AA 2LRNA 3PGTA 3CBUA 4ML6A 3TJBA 2F51A 5J4UA 4Q5FA 1XZOA 2YNXA 3C8EA 4GF0A 4WBRD 1DUGA 4FYCA 6GSWA 1YKAA 4JRRA 4ZB6A 5CREA 4PUAA 4DEJA 1MD4A 3RDWA 3KTBA 3LFLA 2XHFA 3TRXA 1ML6A 1CQGA 3KM6A 4EF0A 4E8EA 2B3SA 3ZRDA 5JCWA 3KH7A 1SU9A 5IMVA 3EE2A 2LEGA 1B4PA 5G30A 5INYA 2V41A 1AUCA 1AC1A 4EE0A 2LS5A 4OFMA 3GKKA 2RUEA 4OWYA 1XWGA 3GIXA 2J23A 2LJKA 3W8SA 3DKSA 2DSAA 3I69A 1PX7A 2PGTA 4NWYA 3J7Yb 1QUWA 4MPGA 1GUHA 4DSSB 1MTCA 2PMTA 1UN2A 3N9JA 2Z9SA 1GTAA 3GKXA 5CNWA 2DIYA 3V1WA 4XS1A 5KN3A 2HRAA 3M3MA 3KH9A 4HUAA 3VFIA 5KN2A 3DGQA 4OCFA 4K7OA 3HVXA 1TK0B 1UC7A 1WE0A 1EZKA 1F37A 1VF1A 5G2ZA 3TUEA 3WGDA 5CP1A 2H0IA 4GSTA 1PKZA 2VLVA 2DJJA 4MABA 3M9JA 2G0FA 1GTUA 5F07A 2H6XA 3IPZA 2OA7A 1O6JA 4EC0A 3TKSC 2QKEA 2YWOA 3M8NA 4PGTA 4BVYA 3UARA 3LEFA 3EU3A 3GURA 3IRAA 5COHA 2CAQA 2AYTA 3EU4A 1ZCPA 1A8LA 1Z5YE 1YJ6A 1K3YA 4ZILA 2CZ2A 4RQXA 3QAGA 4XRDA 2IFQB 2VD0A 1E2YA 1QGVA 4LA1A 4IBPA 4AJ7A 1FB6A 1DE1A 2GSTA 2YWIA 1HD2A 2JU5A 3DVWA 3HJPA 3LGCA 1SK2A 4KDYA 3C73A 2VUPA 1LBKA 3EWLA 2K18A 3U6VA 2OACA 6GSYA 2YANA 3F4TA 2YWMA 2HZFA 1OC9A 4MZWA 2KOKA 6GSSA 1TOFA 1B4QA 4KB3A 3ZL5A 3EVIA 1MDKA 1THOA 5IMDA 1U3IA 3FK8A 4IJIA 5DVBA 2M80A 1SL0B 5ID2B 2K6VA 3W6GA 4L5LA 2REMA 2VO4A 2YZUA 3FW2A 2C4JA 4CHSA 1XVWA 1M9BA 2WRTA 2H8LA 2WS2A 5AIVA 4J2FA 3P7XA 3KMOA 4E8HA 2GSRA 2V1MA 3BJ5A 1A2LA 1H4OA 3VWXA 3HCZA 3SBCA 3TKQA 4RI7A 1WIKA 2LNSA 5GAND 4XS6A 2C3TA 2NTOA 4WR4A 3CRUA 4ZIJA 2C0GA 3UBKA 1TK5B 1G7EA 4KCEA 3Q6OA 3O3TA 10GSA 4Q5RA 4ECBA 1Q4JA 2VCWA 4XHMA 1V2AA 1J08A 4MJEA 3FR9A 1TRWA 3LJRA 2PERA 1Q98A 2H76A 3CRTA 4LL4B 20GSA 1HNBA 4MJBA 3VPQA 4NHWA 1XW6A 3DIEA 4KSMA 4MZCA 1E6BA 1XXUA 2MZCA 3K8NA 4CW9A 4V2LA 4PQIA 2R4VA 1O73A 1T8EB 1PL1A 1AQXA 1U6TA 3FZ4A 3US3A 2IMFA 4K6XA 2HZEB 3TRPA 2VL3A 2L6CA 3HVVA 1O81A 3UAPA 2WDUA 5IO0A 1Z3EA 4HJ2A 3ERGA 5AISA 3CSHA 1ILOA 4DSQA 3FYGA 1BEDA 3L9VA 5D96A 1K0NA 1JLWA 2GT5A 4NV5A 3BCIA 4TR4A 1SK0A 1OE8A 5ECQB 4YAVA 1S3CA 5GAPD 2YJ7A 6GSTA 1OAZA 2NDOA 1N2AA 4EKZA 4QL9A 4PURA 5EY6A 2KLXA 2YWNA 3GX8A 4XS4B 2X99A 5BMUA 2A2SA 3TJGA 2GZPA 1I5GA 1YEXA 4Q5NA 2HXKA 3CTFA 3RPPA 4ML1A 2KP1A 1SKWB 5DQSA 4BPYA 2CV4A 3A2VA 1M99A 1OVNA 3CMIA 2KP2A 3RBTA 1ZL9A 2GQLA 4EVMA 3G7IA 3QFBC 1PN9A 3ISOA 3KP9A 3EYTA 3D5JA 3UIWA 3GUSA 5HQPA 2KHPA 3TDGA 3ZLPA 1ERVA 1J0FA 2R37A 1C72A 1S3AA 4POMA 1V40A 3IHQA 4FQUA 1FVKA 1GSSA 1SYXA 4K7NA 1AIUA 4ECCA 2EC4A 2PBJA 5J5NA 2J9HA 4KAEA 2LQOA 5IM9A 1SENA 4ZXGA 2M46A 3LQ7A 4BWQA 2NBSA 2JSYA 2C0DA 2MBSA 4MDCA 2FLSA 1T00A 1TI3A 1ACVA 1WWJA 2IWTA 5IOXA 1ON4A 1GP1A 1GUKA 2RM5A 1ERUA 4HJMA 4PQHA 3CSIA 3IBHA 1K0AA 4K9ZA 3TKSA 5CRDA 3QOUA 2A2RA 2HFDA 4J56E 2E2GA 4V2NA 2VOCA 4K2DA 1BX9A 3LYKA 1O8WA 3F0IA 1I9DA 2VAFA 3KXOA 4WBJA 3LORA 2ON7A 1AXDA 3ZTLA 18GSA 1T4ZA 1RQMA 3PH9A 2P31A 1DE2A 1MDIA 2YP6A 1EGRA 3IDVA 3W8JA 1SL2B 4MK3A 2R2JA 4O92A 4YQMA 4WR5A 2VM1A 1ZMAA 1XVQA 3P2AA 2WZ9A 3G9BA 2I9HA 1GNWA 1A2MA 3ZREA 1VF2A 2L59A 8GSSA 9GSSA 3IXRA 2HSMB 2HI7A 2RUFA 4RQRA 2DJ1A 3D6IA 4OO5A 1FW1A 1TRVA 2FA4A 1XWAA 2H1AA 4ZBDA 4XTSA 2H0GA 3DWVA 3VURA 2FWHA 2N5AA 3GH9A 3GKNA 4YQVA 3C1RA 5JCUA 3NZNA 5DALA 1EP8A 1F2EA 1JZDA 4HI7A 4FYUA 4YQUA 1PX6A 5D73A 1GSUA 2F8AA 2LKUA 4IELA 2GGTA 3QAVA 1GSQA 1N8JA 2YOIA 5ECIB 3DVXA 5DDLA 1M2DA 2XBIA 1KTEA 3MNGA 2DJKA 3TJFA 2ZUPA 2ON5A 4EUYA 3HY2A 3QPMA 4TKYA 2MYGA 3Q19A 3GTUA 3H93A 2XC2A 5DJLA 3ME8A 4D73A 3FZ5A 5H5SA 1UVZA 1NW2A 2C3QA 2GT6A 3ZVJD 4K1FA 4TXOA 1BQ7A 2K8SA 5ELGA 5F0GA 1GLPA 5DAKB 5KEJA 1SKRB 3U5RE 3HD5A 4HOJA 5LD0A 5B6MA 2DJ3A 5F8BA 1TKDB 5IMCA 2R6KA 2OBIA 4KDXA 3I6AA 5EL8A 2OBKA 5C04A 5CRGA 2JL4A 3TJKA 2LRCA 4IHUA 1GNEA 1FHEA 4HQZA 3IC4A 1V57A 3I43A 4F0BA 1EEMA 1NM3A 5GSSA 5FHIA 4KH7A 1XIYA 3APSA 4X1UA 2HRKB 3KMNA 5G1KA 3KGKA 2OE1A 4BA7A 1TU8A 3LYPA 1S3DA 3ME7A 4TR3A 5LNKe 1T4YA 2B6MA 2HSHA 1M7TA 1NHOA 2V6KA 2L6DA 2AUVA 2C0EA 4NMUA 4MZBA 2OKAA 3WD6A 3F9UA 1U88A 2FCHA 3ZMKA 2I1UA 1PRXA 2CVBA 1GH2A 3HZ8A 4XRAA 1QXHA 4ZL8A 5FWGA 3GN3A 3E9JB 1B8XA 2HE3A 16GSA 1BJXA 4BVXA 4IP1A 3QCPA 4N11A 2GTUA 3UVTA 1T7PB 1YKCA 3ZVJA 1OYJA 3VPTA 1TRUA 5D9VA 2YCDA 4FH8A 2F8FA 1PL2A 1HQOA 1XOBA 4F2IA 2GQKA 2I3YA 3KP8A 1RK4A 3RHCA 4KNDA 2AAWA 3IA1A 1FO5A 5JWRB 3ZYWA 4BVYB 5JCGA 5A4WA 1URMA 1SJIA 2FWEA 3GSSA 1YF1A 3TKPA 2GS3A 4MJAA 4O32A 3TOUA 2H72A 2GVPA 1FOVA 4GQCA 3R3EA 1XWBA 5HR2A 1XBSA 5DCHA 1XCCA 4MF7A 5IIZA 1K0BA 4ACSA 4GRFA 1Z7RA 12GSA 3E0UA 1CQHA 2C1YA 4BWSA 2VL2A 1TRSA 2H30A 1QMVA 3VWUA 3VI5A 1O85A 3IK7A 3CYNA 2BMXA 2H6ZA 4MF5A 5ECRB 3IOSA 4LL1B 1ABAA 5IO2A 2HNLA 1BG5A 1T3BA 4EO3A 4XIHA 3FY7A 1R4WA 1MD3A 4QQ7A 1V9WA 1VRSD 4TXVA 4CDOA 2CAIA 2FHEA 3ZFLA 1PMTA 4EDYA 3BOAA 3GNJA 4G19A 4KW6A 5ABRA 2LRTA 5G31A 1OC9B 1AAZA 2B7KA 2GSSA 2FNOA 3IAM2 1SL1B 2VLUA 3VI7A 4BL7A 2HZEA 3A5WA 1TTZA 2AV4A 2PPTA 1XWKA 2C80A 3VWVA 3FZAA 2X8GA 4TR0A 1X9MB 1K3OA 5IMAA 4Q5QA 1XFLA 1USBA 5H5RA 3J7Yk 2R5GA 1JFUA 2VCZA 1JHBA 3RHBA 1K0OA 1FAAA 4MMMA 2H75A 3F6DA 13GSA 3ED3A 2DMMA 1ERTA 1PA3A 1X9SB 1KBNA 4AF2A 2K8VA 3GRXA 1WJKA 3VWWA 3GA4A 1TP9A 4JE1A 3ZITA 2E2MA 2VCVA 3R2QA 2XPEA 1K3LA 3F3RA 4IP6A 2NPBA 1SD8A 4JZQA 2QSIA 2ZNMA 5J9CA 1V58A 1GULA 1A0FA 4ZL7A 5A4VA 4HZ4A 2B5XA 2GDRA 5JWQB 2IMEA 4J57E 4TVEA 1X0RA 1F9MA 4KSOA 1X5EA 3GKMA 3APQA 2VCXA 3ZFBA 4L0UA 4KCAA 4WXTA 2H1GA 4AGSA 4FO5A 2IIYA 3C71A 5ECSA 3Q74A 1HNAA 4KDUA 2I81A 4NHZA 5G5EA 2M72A 1SD9A 1JZWA 4IGJA 2FY6A 4IW9A 2CA8A 5J3RA 1TDIA 3F4RA 2N5BA 2WJUA 4MPFA 4ZB9A 1GRXA 1PQNA 2WFCA 2ZCTA 1WMJA 1K0MA 3L78A 2WULA 5HR1A 1W89A 1YZXA 1WRYA 4GLTA 5HFIA 1TJDA 1A24A 2IN3A 3EC3A 2TRXA 5ECMB 5IQYA 3ZMLA 2FWGA 2DIZA 5A5KA 2OADA 2FUG2 3EURA 3FRCA 3UOMA 19GSA 2VL2C 4I2UA 3I9V2 2BTOT 2B1KA 1KEBA 1GWCA 2O7KA 1SJZA 2IMDA 1B48A 1F6MC 1Z6NA 2CVDA 4IVFA 3WGXA 4K0GA 2GZYA 1YEPA 2EIRA 2VLTA 4JU5A 1ST9A 3TOTA 1OC8A 3DEXA 4NPBA 2DBCA 2LUSA 3TGZA 4MJCA 3PR8A 2LNTA 4HDEA 3ERFA 3Q18A 1TXXA 5B8AA 3MDKA 3LWAA 2AJQB 4JBBA 1X5DA 4X0XA 1VF4A 1G0TA 4HQSA 2EIQA 4TR1A 3UL3A 5A4UA 2B1LA 2XBQA 2CX3A 2RM6A 2JADA 3O6TA 4G9HA 2GZZA 1M2BA 3FZ9A 1UA5A 3IV4A 1OKDA 4KF9A 4ECJA 5EPFA 2IPAA 3GFKA 2QGVA 2L5LA 2PWJA 1YQ1A 2AB6A 5H5QA 3WGEA 3H8QA 5HFGA 6GSXA 3G7JA 5AN1A 2CZ3A 5ECLB 5ECHB 3WT1A 2VM2A 4PUFC 4PTSA 6GSVA 1F3AA 4ILFA 2I4AA 3QDNA 2FD3A 1R5AA 6GSUA 1VGLA 5CO3A 3TKSE 3HJMA 1GUMA 4HS1A 1LU4A 1JZRA 2HLSA 3BD2A 2X8HA 3KIJA 4KA0A 2HRNA 4POKA 2VCQA 3L0HA 3D22A 2JZSA 4XCSA 4EXJA 1ZYEA 2L4QA 5CRWA 4MLYA 5AIXA 5CYYA 4V2MA 2DJ0A 1Z7PA 4G2EA 3IK9A 2BJXA 4IJ3A 1NHYA 5AGYA 5KN1A 11GSA 1HNCA 2CT6A 2L57A 2C0FA 1M2AA 4USSA 2H1DA 1PD21 2MMOA 1H75A 3FHKA 4Z7XA 2VD1A 2JSZA 2HQTA 4MCUA 2PVOC 1PKWA 1Y6EA 2HSNB 4L5OA 5D93A 3PPUA 1GLQA 1THXA 4I5QA 1GSYA 5ENUA 5G5FA 1TI1A 4PX1A 1JZOA 1YF0A 2R3XA 22GSA 4IN0A 2WB9A 1VF3A 3D0ZA 4DSSA 1EGOA 3EINA 4HEA2 1W4VA 3KTLA 4ZL9A 3A2XA 2K9FA 4N0VA 1SKSB 2D2ZA 5IMZA 2O89A 2YZHA 1GL8A 4GQFA 5DALB 3KCMA 17GSA 1X5CA 3HJOA 1XW9A 2V6OA 4HU7A 1LJRA 2P5RA 2LQQA 2MMZA 2HRKA 5D9TA 2VIMA 4N0ZA 3GYKA 3QFAC 1FB0A 1EV9A 2H70A 4YH2A 3F4SA 1MDJA 2KUCA 5B8BA 5CAXA 1SYRA 3QD9A 4PXOA 5D9XA 3A3TA 1FVJA 4IQ1A
chains in the Genus database with same CATH superfamily
4K0NA 2B5EA 2GLRA 3M1GA 1A2JA 3EMXA 3GTUB 2IFQA 1AQVA 5F06A 1XOAA 1EWXA 2P0GA 3S9FA 4D73B 3BCKA 2X8CA 3UVHA 4IS0A 14GSA 2WW1A 3N5OA 2MBTA 1WOUA 2O85A 4TXOB 5E59A 2WW2A 5HR3A 2IMKA 4WKWA 2H1BA 3GL5A 5DCGA 1R5PA 1B9YC 4OCEA 2PUKC 2H01A 3GH6A 2B5YA 3KZQA 2F3MA 4O5RA 3UJ1A 3WT2A 2GSQA 1MEKA 5D9WA 3CTGA 3LXZA 1FOHA 2EFCA 2O87A 1ZYQB 1Z6MA 4KX4A 2C8UA 5A34B 2H6YA 1G7OA 2L5OA 4NAXA 2HRFA 3F63A 5HR0A 2MMNA 4PI2C 5ID2A 2TRCP 1M0UA 1S4BP 5ECNB 2TIRA 1WPIA 3IR4A 4IQAA 3DXBA 4FIWA 1RW1A 1BAYA 1GSDA 4LMVA 1QFNA 1AW9A 5DJMA 3H79A 2H0HA 2YV9A 3GMFA 4HU9A 1V98A 3DMLA 1EV4A 1K0DA 4RI6A 2FA8A 4V1Ag 2ES7A 5B6NA 3MAKA 1TW9A 2CQ9A 4G0KA 2PVQA 1WP0A 3RPNA 4KUNA 1BG1A 5EVOA 4ECIA 3APOA 2EIOA 4P3YB 2H73A 4Z2UA 3FR6A 1SVLA 1DBYA 3IC8A 4V1Ap 3F3QA 4BVXB 2LJRA 4MP4A 2N5FA 4F82A 2DKIA 2V32A 4WF4A 4WF5A 4NXIA 4PI0C 3QAWA 3C7MA 2IMIA 4MF6A 2UZ8A 3O76A 4LMWA 3PINA 3QR6A 5J9BA 2EFHA 2E7PA 2G2QA 4N30A 2E0QA 2H71A 2JZTA 4ULXA 4GCIA 5DQYA 3FR3A 2HYXA 1J9BA 2YJHA 2LTKA 4NV2A 1I1IP 3UMAA 1T1VA 3LSZA 4PHZC 3GX0A 1A8YA 1ZGNA 1IYIA 3D4MA 3L9SA 1Z9HA 2O8VB 7GSSA 4KGIA 1PSQA 3NOFA 5F05A 2B7JA 5KN0A 2XPDA 5GZZB 4GTUA 4IKHA 3GV1A 3TU3B 3KEBA 4G0IA 1EOGA 4G01A 1X9WB 3HA9A 2WGRA 5E4WA 1DSBA 4O5QA 3GHAA 4GDFA 1EOHA 2VL9A 2P5QA 4WETA 1OKTA 4L8EA 3HHVA 4WEYA 1G6WA 3TRQA 1PGTA 4XS4A 1GTIA 1XWCA 1SK1A 1IYHA 3G7YA 2O5VA 2HSYA 3OR5A 4GSNA 3D4TA 3RFRC 4BL7B 1B9XC 3BBYA 1QK8A 4K8MA 4GWRA 5IPGA 4G0LA 3MSZA 1YDKA 3DYRA 4F0CA 1O8XA 1YVLA 3NIVA 2CVKA 2JZRA 1A0RP 3H4KA 2YV7A 3HYPA 3IE3A 4MNNA 2O36A 4POLA 5IMFA 1JLVA 2H74A 2YN1A 3HZ4A 4QL7A 4OMVA 4F03A 1HYUA 1FG4A 1ZZYA 3RAZA 3P90A 3L9UA 2DC5A 3TKRA 5L71A 4ZB8A 3GSTA 5ECOB 2FWFA 4OO4A 1GSEA 3UEMA 3ZIVA 4DVCA 3MWHA 3CSJA 3HKRA 2CX4A 4GSSA 2AHEA 3WYWA 2V2GA 2LV3A 1KNGA 4O7HA 4N10A 2DMLA 5ELAA 1U3AA 3HXSA 4I2TA 4I8BA 4KE3A 1EP7A 4OD7A 3TCOA 5IOWA 5IPHA 2PN8A 3ZIJA 4I97A 4ZBBA 1PFOA 4EDZA 2ALBA 5J41A 1A23A 2LSTA 4JEDA 1ZOFA 4PNFA 3TJJA 3HDCA 2LJAA 1SJ6A 4FYBA 4CY6A 4JR6A 3AY8A 3ZZXA 1GSFA 2VCTA 3LXTA 1GTBA 1ERWA 4TRXA 1NSWA 4X43A 4POBA 4L0WA 5FT3A 2DKHA 5B7CA 1EEJA 5DBQA 3M0FA 2OT3A 2WCIA 4LLRA 4H86A 2QC7A 4I6XA 2RLIA 4PNGA 4ISDA 3QMXA 3LG6A 1K0CA 1R26A 5C00A 4JR4A 2H19A 3SWLA 3L4NA 4AKXB 4AJ8A 5KOXA 4K7IA 3DRNA 2HSMA 3KJYA 5GSTA 4TOPA 1OC3A 3H1NA 4OFNA 5J47A 3GL3A 3F6FA 4ZBAA 5JWOB 3ERWA 2L4CA 3FEUA 4EL1A 3P8WA 3HVSA 3TB2A 4GXZA 3A2WA 4K2XA 2FGXA 4F9ZA 1TU7A 1OE7A 4YAPA 4AJ6A 2C3NA 1F3BA 2GQMA 3KD0A 1Y25A 3F8UA 3JCML 2MMAA 2JACA 1BYEA 2VKZG 3VK9A 1G6YA 4OFTA 2IL3A 4PQ1A 2F9SA 5J4VA 4TR1B 2PU9C 2OE3A 3E3EA 2A4VA 2HT9A 2RIIA 2OE0A 5ECKB 4ID0A 3FKFA 4TN8A 3C1SA 5G1LA 5ECPB 1QQ2A 4MH3A 3HVNA 1YY7A 5J40A 2IJYA 1R7HA 2X64A 1XPVA 4MA9A 2DLXA 3M9KA 4MH2A 1N25A 5LCZA 4HZ2A 2YPMA 5CRHA 1U87A 1SVMA 2EFDA 3EMPA 1XW5A 4RUVA 2OJLA 3UBLA 3DD3A 3CXGA 2DJ2A 1O7UA 2H66A 4TW5A 1TXUA 5D8IA 3IAS2 4DSRA 5DAKA 3VLNA 4G10A 2NVLA 5HFKA 3D21A 1TK8B 1AQWA 1M9AA 2LRNA 3PGTA 3CBUA 4ML6A 3TJBA 2F51A 5J4UA 4Q5FA 1XZOA 2YNXA 3C8EA 4GF0A 4WBRD 1DUGA 4FYCA 6GSWA 1YKAA 4ZB6A 4JRRA 5CREA 4PUAA 4DEJA 1MD4A 3RDWA 3KTBA 3LFLA 2XHFA 3TRXA 1ML6A 1CQGA 3KM6A 4EF0A 4E8EA 2B3SA 3ZRDA 5JCWA 3KH7A 1SU9A 5IMVA 3EE2A 2LEGA 1B4PA 5G30A 5INYA 2V41A 1AUCA 1AC1A 4EE0A 2LS5A 4OFMA 3GKKA 1M3IA 2RUEA 4OWYA 1XWGA 3GIXA 2J23A 2LJKA 3W8SA 3DKSA 2DSAA 3I69A 4Z2RA 1PX7A 2PGTA 4NWYA 3J7Yb 1QUWA 4MPGA 1GUHA 4DSSB 1MTCA 2PMTA 1UN2A 3N9JA 2Z9SA 1GTAA 3GKXA 5CNWA 2DIYA 3V1WA 4XS1A 5KN3A 2HRAA 3CQFA 3M3MA 3KH9A 4HUAA 3VFIA 5KN2A 3DGQA 4OCFA 4K7OA 3HVXA 1TK0B 1UC7A 1WE0A 1EZKA 1F37A 1VF1A 5G2ZA 3TUEA 3WGDA 5CP1A 2H0IA 4GSTA 1PKZA 2VLVA 2DJJA 4MABA 3M9JA 2G0FA 1GTUA 5F07A 2H6XA 4QMKA 3IPZA 2OA7A 1O6JA 4EC0A 3TKSC 2QKEA 2YWOA 3M8NA 4PGTA 4BVYA 3UARA 3LEFA 3EU3A 3GURA 3IRAA 5COHA 2CAQA 2AYTA 3EU4A 1ZCPA 1A8LA 2WVYA 1Z5YE 1YJ6A 1K3YA 4ZILA 2CZ2A 3FMWA 4RQXA 3QAGA 4XRDA 2IFQB 2VD0A 1E2YA 1QGVA 4LA1A 2H1LA 4IBPA 4AJ7A 1FB6A 1DE1A 2GSTA 2YWIA 1HD2A 2JU5A 3DVWA 3HJPA 3LGCA 1SK2A 4KDYA 3C73A 2VUPA 1LBKA 3EWLA 2K18A 3U6VA 2OACA 6GSYA 2YANA 3F4TA 2YWMA 2HZFA 1OC9A 5A5HA 4MZWA 2KOKA 6GSSA 1TOFA 1B4QA 4KB3A 3ZL5A 3EVIA 1MDKA 1THOA 5IMDA 1U3IA 3FK8A 4IJIA 5DVBA 1PN0A 2M80A 1SL0B 5ID2B 2K6VA 3EPTA 3W6GA 4L5LA 2REMA 2VO4A 2YZUA 3FW2A 2C4JA 4CHSA 1XVWA 1M9BA 2WRTA 2H8LA 2WS2A 5J4YA 5AIVA 4ZB7A 4J2FA 3P7XA 3KMOA 4E8HA 2GSRA 2V1MA 3BJ5A 1A2LA 1H4OA 3VWXA 3HCZA 3SBCA 3TKQA 4RI7A 2R0GA 1WIKA 2LNSA 5GAND 4XS6A 2C3TA 2NTOA 4WR4A 3CRUA 4ZIJA 2C0GA 3UBKA 1TK5B 1G7EA 4KCEA 3Q6OA 3O3TA 10GSA 4Q5RA 4ECBA 1Q4JA 2VCWA 4XHMA 1V2AA 1J08A 4MJEA 3FR9A 1TRWA 3LJRA 2PERA 1Q98A 2H76A 3CRTA 4LL4B 20GSA 1HNBA 4MJBA 3VPQA 4NHWA 1XW6A 2QA1A 3DIEA 4KSMA 4MZCA 1E6BA 1XXUA 2MZCA 3K8NA 4CW9A 4V2LA 4PQIA 2R4VA 1O73A 1T8EB 1PL1A 1AQXA 1U6TA 5BRTA 3FZ4A 3US3A 2IMFA 4K6XA 2HZEB 3TRPA 2VL3A 2L6CA 3HVVA 1O81A 4EIQA 1Y1UA 3UAPA 2WDUA 5IO0A 1Z3EA 4HJ2A 3ERGA 5AISA 3CSHA 1ILOA 4ICYA 4DSQA 3FYGA 1BEDA 3L9VA 5A1NA 5D96A 1K0NA 1JLWA 1ZYPA 2GT5A 4NV5A 3BCIA 4TR4A 1SK0A 2WW0A 1XG8A 1OE8A 5ECQB 4YAVA 1S3CA 5GAPD 2YJ7A 3CHXC 6GSTA 1OAZA 2NDOA 1N2AA 4EKZA 4QL9A 4PURA 5EY6A 2KLXA 2YWNA 3GX8A 4XS4B 2WVXA 4N3ZA 2X99A 5BMUA 4X4JA 2A2SA 3TJGA 2GZPA 1I5GA 1YEXA 4Q5NA 2HXKA 3CTFA 3RPPA 4ML1A 2KP1A 1SKWB 5DQSA 4BPYA 2CV4A 3A2VA 1M99A 1OVNA 3CMIA 2KP2A 3RBTA 1ZL9A 2GQLA 4EVMA 3G7IA 3QFBC 1PN9A 3ISOA 3KP9A 3EYTA 3D5JA 3UIWA 3GUSA 5HQPA 2KHPA 3TDGA 3ZLPA 1ERVA 1J0FA 2R37A 1C72A 4AI6A 1S3AA 4POMA 1V40A 3IHQA 4FQUA 1FVKA 1GSSA 1SYXA 4K7NA 1AIUA 4ECCA 2EC4A 2PBJA 5J5NA 2J9HA 4KAEA 2LQOA 5IM9A 3RGBC 1SENA 4ZXGA 2M46A 3LQ7A 4BWQA 2NBSA 2JSYA 2C0DA 2MBSA 4MDCA 2FLSA 1T00A 1TI3A 1ACVA 1WWJA 2IWTA 5IOXA 1ON4A 1GP1A 2UV8G 1GUKA 2RM5A 1ERUA 4HJMA 4PQHA 3CSIA 3IBHA 1K0AA 4K9ZA 3TKSA 3CWGA 5CRDA 3QOUA 2A2RA 2HFDA 4J56E 2E2GA 4V2NA 2VOCA 4K2DA 1BX9A 2X4AA 3LYKA 1O8WA 3F0IA 1I9DA 2VAFA 3KXOA 4WBJA 3LORA 2ON7A 1AXDA 3ZTLA 18GSA 1T4ZA 1RQMA 3PH9A 2P31A 1DE2A 1MDIA 2YP6A 1EGRA 3IDVA 3W8JA 1SL2B 4MK3A 2R2JA 4O92A 4YQMA 4WR5A 2VM1A 1ZMAA 1XVQA 3P2AA 3MIXA 2WZ9A 2HSNA 3G9BA 2I9HA 1GNWA 1A2MA 3ZREA 1VF2A 2L59A 8GSSA 9GSSA 3IXRA 2HSMB 1ZYNA 2HI7A 2RUFA 4RQRA 2R0PA 2DJ1A 3D6IA 4OO5A 1FW1A 1TRVA 2FA4A 1XWAA 2H1AA 4ZBDA 4XTSA 2H0GA 3DWVA 3VURA 2FWHA 2N5AA 3GH9A 3GKNA 4YQVA 3C1RA 5JCUA 3NZNA 5DALA 1EP8A 1F2EA 1JZDA 4HI7A 4FYUA 4YQUA 4HSCX 1PX6A 4K5SA 2WZSA 5D73A 1GSUA 2F8AA 2LKUA 4IELA 2GGTA 2A4HA 3QAVA 1GSQA 1N8JA 2YOIA 5ECIB 3DVXA 5DDLA 1M2DA 2XBIA 1KTEA 3MNGA 2DJKA 3TJFA 2ZUPA 2ON5A 4EUYA 3HY2A 2QA2A 3QPMA 4TKYA 2MYGA 3Q19A 3GTUA 3H93A 2XC2A 5DJLA 3MYDA 3ME8A 4D73A 3FZ5A 5H5SA 1UVZA 1NW2A 2C3QA 2GT6A 3ZVJD 4K1FA 4TXOA 3A5IA 1BQ7A 2K8SA 5ELGA 5F0GA 1GLPA 5DAKB 5KEJA 1SVOA 1SKRB 3U5RE 3HD5A 4HOJA 5LD0A 5B6MA 2DJ3A 5F8BA 1TKDB 5IMCA 2R6KA 2OBIA 4KDXA 3I6AA 5EL8A 2OBKA 5C04A 5CRGA 5A34A 2JL4A 3TJKA 2LRCA 4IHUA 1GNEA 1FHEA 4HQZA 3IC4A 1V57A 3I43A 4F0BA 1EEMA 1NM3A 5GSSA 3LW9A 5FHIA 4KH7A 1XIYA 3APSA 4X1UA 2HRKB 3KMNA 4AKGA 5G1KA 3KGKA 2OE1A 4BA7A 1TU8A 3LYPA 1S3DA 3ME7A 4TR3A 5LNKe 1T4YA 2B6MA 2HSHA 1M7TA 1NHOA 2V6KA 2L6DA 2AUVA 2C0EA 4NMUA 4MZBA 2OKAA 3WD6A 3F9UA 1U88A 2FCHA 3ZMKA 2I1UA 1PRXA 2CVBA 1GH2A 3HZ8A 4XRAA 1QXHA 4ZL8A 5FWGA 3GN3A 3E9JB 1B8XA 2HE3A 16GSA 4E68A 1BJXA 4BVXA 4IP1A 3QCPA 4N11A 2GTUA 4AKIA 3UVTA 1T7PB 1YKCA 3ZVJA 1OYJA 3VPTA 1TRUA 5D9VA 2YCDA 4FH8A 2F8FA 1PL2A 1HQOA 1XOBA 4F2IA 2GQKA 2I3YA 3KP8A 1RK4A 5KOWA 3RHCA 4KNDA 4W66A 2AAWA 3IA1A 1FO5A 5JWRB 1YEWC 3ZYWA 4BVYB 5JCGA 5A4WA 1URMA 1SJIA 2FWEA 3GSSA 1YF1A 3TKPA 2GS3A 4MJAA 4O32A 3TOUA 2H72A 2GVPA 1FOVA 4GQCA 1BF5A 3R3EA 1M3JA 1XWBA 5HR2A 1XBSA 5DCHA 1XCCA 4MF7A 5IIZA 1K0BA 4ACSA 4GRFA 1Z7RA 12GSA 3E0UA 1CQHA 2C1YA 4BWSA 4FXYP 2VL2A 1TRSA 2H30A 1QMVA 3VWUA 3VI5A 1O85A 3IK7A 3CYNA 2BMXA 2H6ZA 4MF5A 5ECRB 3IOSA 4LL1B 4BIKA 1ABAA 5IO2A 2HNLA 1BG5A 1T3BA 4EO3A 4XIHA 3FY7A 1R4WA 1MD3A 4QQ7A 1V9WA 1VRSD 4TXVA 4CDOA 2CAIA 2FHEA 3ZFLA 1PMTA 4EDYA 3BOAA 3GNJA 4G19A 4KW6A 5ABRA 2LRTA 2R0CA 5G31A 1OC9B 1AAZA 5A5HB 2B7KA 2GSSA 2FNOA 3HMJG 3IAM2 1SL1B 2VLUA 3VI7A 4BL7A 2HZEA 3A5WA 2O3EA 1TTZA 2AV4A 2PPTA 1XWKA 2C80A 3VWVA 3FZAA 2X8GA 4TR0A 1X9MB 1K3OA 5IMAA 4Q5QA 1XFLA 1USBA 5H5RA 3J7Yk 2R5GA 1JFUA 2VCZA 1JHBA 3RHBA 1K0OA 1FAAA 4MMMA 2H75A 3F6DA 13GSA 3ED3A 2DMMA 1ERTA 1PA3A 1X9SB 1KBNA 4AF2A 2K8VA 3GRXA 1WJKA 3VWWA 3GA4A 1TP9A 4JE1A 3ZITA 2E2MA 2VCVA 3R2QA 2XPEA 1K3LA 3F3RA 4IP6A 2NPBA 1SD8A 4JZQA 2QSIA 2ZNMA 5J9CA 1V58A 1GULA 1A0FA 4ZL7A 5A4VA 4HZ4A 2B5XA 2GDRA 5JWQB 2IMEA 4J57E 4TVEA 1X0RA 1F9MA 4KSOA 1X5EA 3GKMA 3APQA 2VCXA 3ZFBA 4L0UA 4KCAA 4WXTA 2H1GA 4AGSA 4FO5A 2IIYA 3C71A 5ECSA 3Q74A 1HNAA 4KDUA 2I81A 4NHZA 5G5EA 2M72A 1SD9A 1JZWA 4IGJA 2FY6A 4IW9A 2CA8A 5J3RA 1TDIA 3F4RA 2N5BA 2WJUA 4MPFA 4ZB9A 1GRXA 1PQNA 2WFCA 2ZCTA 5A1NB 1WMJA 1K0MA 3L78A 4A5PA 2WULA 5HR1A 1W89A 1YZXA 1WRYA 4GLTA 5HFIA 1TJDA 1A24A 2IN3A 3EC3A 2TRXA 5ECMB 5IQYA 3ZMLA 2FWGA 2DIZA 5A5KA 4O5UA 2OADA 2FUG2 3EURA 3FRCA 3UOMA 19GSA 2VL2C 2X49A 4I2UA 3I9V2 2BTOT 2B1KA 2WVXB 1KEBA 1GWCA 2O7KA 1SJZA 2IMDA 1B48A 1F6MC 1Z6NA 2CVDA 4IVFA 3WGXA 5BMUB 4K0GA 2GZYA 1YEPA 2EIRA 2VLTA 4JU5A 1ST9A 3TOTA 1OC8A 3DEXA 4NPBA 2DBCA 2LUSA 3TGZA 2WVZA 4MJCA 3PR8A 2LNTA 4HDEA 3ERFA 3Q18A 1TXXA 5B8AA 3MDKA 3LWAA 2AJQB 4JBBA 4K5RA 1X5DA 4X0XA 1VF4A 1G0TA 4HQSA 2EIQA 4TR1A 3UL3A 5A4UA 2B1LA 2XBQA 2CX3A 2RM6A 2JADA 3O6TA 4G9HA 2GZZA 1M2BA 3FZ9A 1UA5A 3IV4A 1OKDA 4KF9A 4ECJA 5EPFA 2IPAA 3GFKA 2QGVA 2L5LA 2PWJA 1YQ1A 2AB6A 5H5QA 3WGEA 3H8QA 5HFGA 6GSXA 3G7JA 5AN1A 2CZ3A 5ECLB 5ECHB 3WT1A 2VM2A 4PUFC 4PTSA 6GSVA 4EIPA 1F3AA 4ILFA 2I4AA 3QDNA 2FD3A 1R5AA 2A2PA 4AKHA 6GSUA 1VGLA 5CO3A 3TKSE 3HJMA 1GUMA 4HS1A 1LU4A 1JZRA 2HLSA 3BD2A 2X8HA 3KIJA 4KA0A 2EFEA 2HRNA 4POKA 2VCQA 3L0HA 3D22A 2JZSA 4XCSA 4EXJA 1ZYEA 2L4QA 5CRWA 4MLYA 5AIXA 4CY8A 5CYYA 4V2MA 2DJ0A 1Z7PA 4G2EA 3IK9A 2BJXA 4IJ3A 1NHYA 1S3RA 5AGYA 5KN1A 11GSA 1HNCA 2CT6A 2L57A 2C0FA 1M2AA 4USSA 2H1DA 1PD21 2MMOA 1H75A 3FHKA 4Z7XA 2VD1A 2JSZA 2HQTA 4MCUA 2PVOC 1PKWA 1Y6EA 2HSNB 4L5OA 5D93A 3PPUA 4YKFA 1GLQA 1THXA 4I5QA 1GSYA 5ENUA 5G5FA 1TI1A 4PX1A 1JZOA 1YF0A 2R3XA 22GSA 4IN0A 2WB9A 1VF3A 2WW3A 3D0ZA 4DSSA 1EGOA 3EINA 4YKGA 4HEA2 1W4VA 3KTLA 4ZL9A 3A2XA 2K9FA 4N0VA 1SKSB 2D2ZA 5IMZA 2O89A 2YZHA 3IHGA 1GL8A 4GQFA 5DALB 3KCMA 17GSA 1X5CA 3HJOA 1XW9A 2V6OA 4HU7A 4Z2TA 1LJRA 2P5RA 2LQQA 2MMZA 2HRKA 5D9TA 2VIMA 4N0ZA 3GYKA 3QFAC 1FB0A 1EV9A 2H70A 4YH2A 3F4SA 1MDJA 2KUCA 5B8BA 5CAXA 1SYRA 3QD9A 4PXOA 5D9XA 3A3TA 1FVJA 4IQ1A
chains in the Genus database with same CATH topology
4K0NA 2B5EA 2GLRA 3M1GA 1A2JA 3EMXA 3GTUB 2IFQA 1AQVA 5F06A 1XOAA 1EWXA 2P0GA 3S9FA 4D73B 3BCKA 2X8CA 3UVHA 4IS0A 14GSA 3N5OA 2MBTA 1WOUA 2O85A 4TXOB 5E59A 5HR3A 2IMKA 4WKWA 2H1BA 3GL5A 5DCGA 1R5PA 1B9YC 4OCEA 2PUKC 2H01A 3GH6A 2B5YA 3KZQA 2F3MA 4O5RA 3UJ1A 3WT2A 2GSQA 1MEKA 5D9WA 3CTGA 3LXZA 1FOHA 2EFCA 2O87A 1ZYQB 1Z6MA 4KX4A 2C8UA 5A34B 2H6YA 1G7OA 2L5OA 4NAXA 2HRFA 3F63A 5HR0A 2MMNA 5ID2A 2TRCP 1M0UA 5ECNB 2TIRA 1WPIA 3IR4A 4IQAA 3DXBA 4FIWA 1RW1A 1BAYA 1GSDA 4LMVA 1QFNA 1AW9A 5DJMA 3H79A 2H0HA 2YV9A 3GMFA 4HU9A 1V98A 3DMLA 1EV4A 1K0DA 4RI6A 2FA8A 4V1Ag 2ES7A 5B6NA 3MAKA 1TW9A 2CQ9A 4G0KA 2PVQA 1WP0A 3RPNA 4KUNA 1BG1A 5EVOA 4ECIA 3APOA 2EIOA 4P3YB 2H73A 4Z2UA 3FR6A 1SVLA 1DBYA 3IC8A 4V1Ap 3F3QA 4BVXB 2LJRA 4MP4A 2N5FA 4F82A 2DKIA 2V32A 4WF4A 4WF5A 4NXIA 3QAWA 3C7MA 2IMIA 4MF6A 2UZ8A 3O76A 4LMWA 3PINA 3QR6A 5J9BA 2EFHA 2E7PA 2G2QA 4N30A 2E0QA 2H71A 2JZTA 4ULXA 4GCIA 5DQYA 3FR3A 2HYXA 1J9BA 2YJHA 2LTKA 4NV2A 3UMAA 1T1VA 3LSZA 3GX0A 1A8YA 1ZGNA 1IYIA 3D4MA 3L9SA 1Z9HA 2O8VB 7GSSA 4KGIA 1PSQA 3NOFA 5F05A 2B7JA 5KN0A 2XPDA 5GZZB 4GTUA 4IKHA 3GV1A 3TU3B 3KEBA 4G0IA 1EOGA 4G01A 1X9WB 3HA9A 2WGRA 5E4WA 1DSBA 4O5QA 3GHAA 4GDFA 1EOHA 2VL9A 2P5QA 4WETA 1OKTA 4L8EA 3HHVA 4WEYA 1G6WA 3TRQA 1PGTA 4XS4A 1GTIA 1XWCA 1SK1A 1IYHA 3G7YA 2O5VA 2HSYA 3OR5A 4GSNA 3D4TA 4BL7B 1B9XC 3BBYA 1QK8A 4K8MA 4GWRA 5IPGA 4G0LA 3MSZA 1YDKA 3DYRA 4F0CA 1O8XA 1YVLA 3NIVA 2CVKA 2JZRA 1A0RP 3H4KA 2YV7A 3HYPA 3IE3A 4MNNA 4POLA 5IMFA 1JLVA 2H74A 2YN1A 3HZ4A 4QL7A 4OMVA 4F03A 1HYUA 1FG4A 1ZZYA 3RAZA 3P90A 3L9UA 2DC5A 3TKRA 5L71A 4ZB8A 3GSTA 5ECOB 2FWFA 4OO4A 1GSEA 3UEMA 3ZIVA 4DVCA 3MWHA 3CSJA 3HKRA 2CX4A 4GSSA 2AHEA 3WYWA 2V2GA 2LV3A 1KNGA 4O7HA 4N10A 2DMLA 5ELAA 1U3AA 3HXSA 4I2TA 4I8BA 4KE3A 1EP7A 4OD7A 3TCOA 5IOWA 5IPHA 2PN8A 3ZIJA 4I97A 4ZBBA 4EDZA 2ALBA 5J41A 1A23A 2LSTA 4JEDA 1ZOFA 4PNFA 3TJJA 3HDCA 2LJAA 1SJ6A 4FYBA 4CY6A 4JR6A 3AY8A 3ZZXA 1GSFA 2VCTA 3LXTA 1GTBA 1ERWA 4TRXA 1NSWA 4X43A 4POBA 4L0WA 5FT3A 2DKHA 5B7CA 1EEJA 5DBQA 3M0FA 2OT3A 2WCIA 4LLRA 4H86A 2QC7A 4I6XA 2RLIA 4PNGA 4ISDA 3QMXA 3LG6A 1K0CA 1R26A 5C00A 4JR4A 2H19A 3SWLA 3L4NA 4AKXB 4AJ8A 5KOXA 4K7IA 3DRNA 2HSMA 3KJYA 5GSTA 4TOPA 1OC3A 3H1NA 4OFNA 5J47A 3GL3A 3F6FA 4ZBAA 5JWOB 3ERWA 2L4CA 3FEUA 4EL1A 3P8WA 3HVSA 3TB2A 4GXZA 3A2WA 4K2XA 2FGXA 4F9ZA 1TU7A 1OE7A 4YAPA 4AJ6A 2C3NA 1F3BA 2GQMA 3KD0A 1Y25A 3F8UA 3JCML 2MMAA 2JACA 1BYEA 2VKZG 3VK9A 1G6YA 4OFTA 2IL3A 4PQ1A 2F9SA 5J4VA 4TR1B 2PU9C 2OE3A 3E3EA 2A4VA 2HT9A 2RIIA 2OE0A 5ECKB 4ID0A 3FKFA 4TN8A 3C1SA 5G1LA 5ECPB 1QQ2A 4MH3A 1YY7A 5J40A 2IJYA 1R7HA 2X64A 1XPVA 4MA9A 2DLXA 3M9KA 4MH2A 1N25A 5LCZA 4HZ2A 2YPMA 5CRHA 1U87A 1SVMA 2EFDA 3EMPA 1XW5A 4RUVA 2OJLA 3UBLA 3DD3A 3CXGA 2DJ2A 1O7UA 2H66A 4TW5A 1TXUA 5D8IA 3IAS2 4DSRA 5DAKA 3VLNA 4G10A 2NVLA 5HFKA 3D21A 1TK8B 1AQWA 1M9AA 2LRNA 3PGTA 3CBUA 4ML6A 3TJBA 2F51A 5J4UA 4Q5FA 1XZOA 2YNXA 3C8EA 4GF0A 4WBRD 1DUGA 4FYCA 6GSWA 1YKAA 4ZB6A 4JRRA 5CREA 4PUAA 4DEJA 1MD4A 3RDWA 3KTBA 3LFLA 2XHFA 3TRXA 1ML6A 1CQGA 3KM6A 4EF0A 4E8EA 2B3SA 3ZRDA 5JCWA 3KH7A 1SU9A 5IMVA 3EE2A 2LEGA 1B4PA 5G30A 5INYA 2V41A 1AUCA 1AC1A 4EE0A 2LS5A 4OFMA 3GKKA 2RUEA 4OWYA 1XWGA 3GIXA 2J23A 2LJKA 3W8SA 3DKSA 2DSAA 3I69A 4Z2RA 1PX7A 2PGTA 4NWYA 3J7Yb 1QUWA 4MPGA 1GUHA 4DSSB 1MTCA 2PMTA 1UN2A 3N9JA 2Z9SA 1GTAA 3GKXA 5CNWA 2DIYA 3V1WA 4XS1A 5KN3A 2HRAA 3M3MA 3KH9A 4HUAA 3VFIA 5KN2A 3DGQA 4OCFA 4K7OA 3HVXA 1TK0B 1UC7A 1WE0A 1EZKA 1F37A 1VF1A 5G2ZA 3TUEA 3WGDA 5CP1A 2H0IA 4GSTA 1PKZA 2VLVA 2DJJA 4MABA 3M9JA 2G0FA 1GTUA 5F07A 2H6XA 4QMKA 3IPZA 2OA7A 1O6JA 4EC0A 3TKSC 2QKEA 2YWOA 3M8NA 4PGTA 4BVYA 3UARA 3LEFA 3EU3A 3GURA 3IRAA 5COHA 2CAQA 2AYTA 3EU4A 1ZCPA 1A8LA 1Z5YE 1YJ6A 1K3YA 4ZILA 2CZ2A 3FMWA 4RQXA 3QAGA 4XRDA 2IFQB 2VD0A 1E2YA 1QGVA 4LA1A 2H1LA 4IBPA 4AJ7A 1FB6A 1DE1A 2GSTA 2YWIA 1HD2A 2JU5A 3DVWA 3HJPA 3LGCA 1SK2A 4KDYA 3C73A 2VUPA 1LBKA 3EWLA 2K18A 3U6VA 2OACA 6GSYA 2YANA 3F4TA 2YWMA 2HZFA 1OC9A 5A5HA 4MZWA 2KOKA 6GSSA 1TOFA 1B4QA 4KB3A 3ZL5A 3EVIA 1MDKA 1THOA 5IMDA 1U3IA 3FK8A 4IJIA 5DVBA 1PN0A 2M80A 1SL0B 5ID2B 2K6VA 3EPTA 3W6GA 4L5LA 2REMA 2VO4A 2YZUA 3FW2A 2C4JA 4CHSA 1XVWA 1M9BA 2WRTA 2H8LA 2WS2A 5J4YA 5AIVA 4ZB7A 4J2FA 3P7XA 3KMOA 4E8HA 2GSRA 2V1MA 3BJ5A 1A2LA 1H4OA 3VWXA 3HCZA 3SBCA 3TKQA 4RI7A 2R0GA 1WIKA 2LNSA 5GAND 4XS6A 2C3TA 2NTOA 4WR4A 3CRUA 4ZIJA 2C0GA 3UBKA 1TK5B 1G7EA 4KCEA 3Q6OA 3O3TA 10GSA 4Q5RA 4ECBA 1Q4JA 2VCWA 4XHMA 1V2AA 1J08A 4MJEA 3FR9A 1TRWA 3LJRA 2PERA 1Q98A 2H76A 3CRTA 4LL4B 20GSA 1HNBA 4MJBA 3VPQA 4NHWA 1XW6A 2QA1A 3DIEA 4KSMA 4MZCA 1E6BA 1XXUA 2MZCA 3K8NA 4CW9A 4V2LA 4PQIA 2R4VA 1O73A 1T8EB 1PL1A 1AQXA 1U6TA 5BRTA 3FZ4A 3US3A 2IMFA 4K6XA 2HZEB 3TRPA 2VL3A 2L6CA 3HVVA 1O81A 4EIQA 1Y1UA 3UAPA 2WDUA 5IO0A 1Z3EA 4HJ2A 3ERGA 5AISA 3CSHA 1ILOA 4ICYA 4DSQA 3FYGA 1BEDA 3L9VA 5A1NA 5D96A 1K0NA 1JLWA 1ZYPA 2GT5A 4NV5A 3BCIA 4TR4A 1SK0A 1OE8A 5ECQB 4YAVA 1S3CA 5GAPD 2YJ7A 6GSTA 1OAZA 2NDOA 1N2AA 4EKZA 4QL9A 4PURA 5EY6A 2KLXA 2YWNA 3GX8A 4XS4B 4N3ZA 2X99A 5BMUA 4X4JA 2A2SA 3TJGA 2GZPA 1I5GA 1YEXA 4Q5NA 2HXKA 3CTFA 3RPPA 4ML1A 2KP1A 1SKWB 5DQSA 4BPYA 2CV4A 3A2VA 1M99A 1OVNA 3CMIA 2KP2A 3RBTA 1ZL9A 2GQLA 4EVMA 3G7IA 3QFBC 1PN9A 3ISOA 3KP9A 3EYTA 3D5JA 3UIWA 3GUSA 5HQPA 2KHPA 3TDGA 3ZLPA 1ERVA 1J0FA 2R37A 1C72A 4AI6A 1S3AA 4POMA 1V40A 3IHQA 4FQUA 1FVKA 1GSSA 1SYXA 4K7NA 1AIUA 4ECCA 2EC4A 2PBJA 5J5NA 2J9HA 4KAEA 2LQOA 5IM9A 1SENA 4ZXGA 2M46A 3LQ7A 4BWQA 2NBSA 2JSYA 2C0DA 2MBSA 4MDCA 2FLSA 1T00A 1TI3A 1ACVA 1WWJA 2IWTA 5IOXA 1ON4A 1GP1A 2UV8G 1GUKA 2RM5A 1ERUA 4HJMA 4PQHA 3CSIA 3IBHA 1K0AA 4K9ZA 3TKSA 3CWGA 5CRDA 3QOUA 2A2RA 2HFDA 4J56E 2E2GA 4V2NA 2VOCA 4K2DA 1BX9A 2X4AA 3LYKA 1O8WA 3F0IA 1I9DA 2VAFA 3KXOA 4WBJA 3LORA 2ON7A 1AXDA 3ZTLA 18GSA 1T4ZA 1RQMA 3PH9A 2P31A 1DE2A 1MDIA 2YP6A 1EGRA 3IDVA 3W8JA 1SL2B 4MK3A 2R2JA 4O92A 4YQMA 4WR5A 2VM1A 1ZMAA 1XVQA 3P2AA 3MIXA 2WZ9A 2HSNA 3G9BA 2I9HA 1GNWA 1A2MA 3ZREA 1VF2A 2L59A 8GSSA 9GSSA 3IXRA 2HSMB 1ZYNA 2HI7A 2RUFA 4RQRA 2R0PA 2DJ1A 3D6IA 4OO5A 1FW1A 1TRVA 2FA4A 1XWAA 2H1AA 4ZBDA 4XTSA 2H0GA 3DWVA 3VURA 2FWHA 2N5AA 3GH9A 3GKNA 4YQVA 3C1RA 5JCUA 3NZNA 5DALA 1EP8A 1F2EA 1JZDA 4HI7A 4FYUA 4YQUA 1PX6A 4K5SA 5D73A 1GSUA 2F8AA 2LKUA 4IELA 2GGTA 2A4HA 3QAVA 1GSQA 1N8JA 2YOIA 5ECIB 3DVXA 5DDLA 1M2DA 2XBIA 1KTEA 3MNGA 2DJKA 3TJFA 2ZUPA 2ON5A 4EUYA 3HY2A 2QA2A 3QPMA 4TKYA 2MYGA 3Q19A 3GTUA 3H93A 2XC2A 5DJLA 3MYDA 3ME8A 4D73A 3FZ5A 5H5SA 1UVZA 1NW2A 2C3QA 2GT6A 3ZVJD 4K1FA 4TXOA 3A5IA 1BQ7A 2K8SA 5ELGA 5F0GA 1GLPA 5DAKB 5KEJA 1SVOA 1SKRB 3U5RE 3HD5A 4HOJA 5LD0A 5B6MA 2DJ3A 5F8BA 1TKDB 5IMCA 2R6KA 2OBIA 4KDXA 3I6AA 5EL8A 2OBKA 5C04A 5CRGA 5A34A 2JL4A 3TJKA 2LRCA 4IHUA 1GNEA 1FHEA 4HQZA 3IC4A 1V57A 3I43A 4F0BA 1EEMA 1NM3A 5GSSA 3LW9A 5FHIA 4KH7A 1XIYA 3APSA 4X1UA 2HRKB 3KMNA 4AKGA 5G1KA 3KGKA 2OE1A 4BA7A 1TU8A 3LYPA 1S3DA 3ME7A 4TR3A 5LNKe 1T4YA 2B6MA 2HSHA 1M7TA 1NHOA 2V6KA 2L6DA 2AUVA 2C0EA 4NMUA 4MZBA 2OKAA 3WD6A 3F9UA 1U88A 2FCHA 3ZMKA 2I1UA 1PRXA 2CVBA 1GH2A 3HZ8A 4XRAA 1QXHA 4ZL8A 5FWGA 3GN3A 3E9JB 1B8XA 2HE3A 16GSA 4E68A 1BJXA 4BVXA 4IP1A 3QCPA 4N11A 2GTUA 4AKIA 3UVTA 1T7PB 1YKCA 3ZVJA 1OYJA 3VPTA 1TRUA 5D9VA 2YCDA 4FH8A 2F8FA 1PL2A 1HQOA 1XOBA 4F2IA 2GQKA 2I3YA 3KP8A 1RK4A 5KOWA 3RHCA 4KNDA 4W66A 2AAWA 3IA1A 1FO5A 5JWRB 3ZYWA 4BVYB 5JCGA 5A4WA 1URMA 1SJIA 2FWEA 3GSSA 1YF1A 3TKPA 2GS3A 4MJAA 4O32A 3TOUA 2H72A 2GVPA 1FOVA 4GQCA 1BF5A 3R3EA 1XWBA 5HR2A 1XBSA 5DCHA 1XCCA 4MF7A 5IIZA 1K0BA 4ACSA 4GRFA 1Z7RA 12GSA 3E0UA 1CQHA 2C1YA 4BWSA 2VL2A 1TRSA 2H30A 1QMVA 3VWUA 3VI5A 1O85A 3IK7A 3CYNA 2BMXA 2H6ZA 4MF5A 5ECRB 3IOSA 4LL1B 1ABAA 5IO2A 2HNLA 1BG5A 1T3BA 4EO3A 4XIHA 3FY7A 1R4WA 1MD3A 4QQ7A 1V9WA 1VRSD 4TXVA 4CDOA 2CAIA 2FHEA 3ZFLA 1PMTA 4EDYA 3BOAA 3GNJA 4G19A 4KW6A 5ABRA 2LRTA 2R0CA 5G31A 1OC9B 1AAZA 5A5HB 2B7KA 2GSSA 2FNOA 3HMJG 3IAM2 1SL1B 2VLUA 3VI7A 4BL7A 2HZEA 3A5WA 1TTZA 2AV4A 2PPTA 1XWKA 2C80A 3VWVA 3FZAA 2X8GA 4TR0A 1X9MB 1K3OA 5IMAA 4Q5QA 1XFLA 1USBA 5H5RA 3J7Yk 2R5GA 1JFUA 2VCZA 1JHBA 3RHBA 1K0OA 1FAAA 4MMMA 2H75A 3F6DA 13GSA 3ED3A 2DMMA 1ERTA 1PA3A 1X9SB 1KBNA 4AF2A 2K8VA 3GRXA 1WJKA 3VWWA 3GA4A 1TP9A 4JE1A 3ZITA 2E2MA 2VCVA 3R2QA 2XPEA 1K3LA 3F3RA 4IP6A 2NPBA 1SD8A 4JZQA 2QSIA 2ZNMA 5J9CA 1V58A 1GULA 1A0FA 4ZL7A 5A4VA 4HZ4A 2B5XA 2GDRA 5JWQB 2IMEA 4J57E 4TVEA 1X0RA 1F9MA 4KSOA 1X5EA 3GKMA 3APQA 2VCXA 3ZFBA 4L0UA 4KCAA 4WXTA 2H1GA 4AGSA 4FO5A 2IIYA 3C71A 5ECSA 3Q74A 1HNAA 4KDUA 2I81A 4NHZA 5G5EA 2M72A 1SD9A 1JZWA 4IGJA 2FY6A 4IW9A 2CA8A 5J3RA 1TDIA 3F4RA 2N5BA 2WJUA 4MPFA 4ZB9A 1GRXA 1PQNA 2WFCA 2ZCTA 5A1NB 1WMJA 1K0MA 3L78A 4A5PA 2WULA 5HR1A 1W89A 1YZXA 1WRYA 4GLTA 5HFIA 1TJDA 1A24A 2IN3A 3EC3A 2TRXA 5ECMB 5IQYA 3ZMLA 2FWGA 2DIZA 5A5KA 4O5UA 2OADA 2FUG2 3EURA 3FRCA 3UOMA 19GSA 2VL2C 2X49A 4I2UA 3I9V2 2BTOT 2B1KA 1KEBA 1GWCA 2O7KA 1SJZA 2IMDA 1B48A 1F6MC 1Z6NA 2CVDA 4IVFA 3WGXA 5BMUB 4K0GA 2GZYA 1YEPA 2EIRA 2VLTA 4JU5A 1ST9A 3TOTA 1OC8A 3DEXA 4NPBA 2DBCA 2LUSA 3TGZA 4MJCA 3PR8A 2LNTA 4HDEA 3ERFA 3Q18A 1TXXA 5B8AA 3MDKA 3LWAA 2AJQB 4JBBA 4K5RA 1X5DA 4X0XA 1VF4A 1G0TA 4HQSA 2EIQA 4TR1A 3UL3A 5A4UA 2B1LA 2XBQA 2CX3A 2RM6A 2JADA 3O6TA 4G9HA 2GZZA 1M2BA 3FZ9A 1UA5A 3IV4A 1OKDA 4KF9A 4ECJA 5EPFA 2IPAA 3GFKA 2QGVA 2L5LA 2PWJA 1YQ1A 2AB6A 5H5QA 3WGEA 3H8QA 5HFGA 6GSXA 3G7JA 5AN1A 2CZ3A 5ECLB 5ECHB 3WT1A 2VM2A 4PUFC 4PTSA 6GSVA 4EIPA 1F3AA 4ILFA 2I4AA 3QDNA 2FD3A 1R5AA 2A2PA 4AKHA 6GSUA 1VGLA 5CO3A 3TKSE 3HJMA 1GUMA 4HS1A 1LU4A 1JZRA 2HLSA 3BD2A 2X8HA 3KIJA 4KA0A 2EFEA 2HRNA 4POKA 2VCQA 3L0HA 3D22A 2JZSA 4XCSA 4EXJA 1ZYEA 2L4QA 5CRWA 4MLYA 5AIXA 4CY8A 5CYYA 4V2MA 2DJ0A 1Z7PA 4G2EA 3IK9A 2BJXA 4IJ3A 1NHYA 5AGYA 5KN1A 11GSA 1HNCA 2CT6A 2L57A 2C0FA 1M2AA 4USSA 2H1DA 1PD21 2MMOA 1H75A 3FHKA 4Z7XA 2VD1A 2JSZA 2HQTA 4MCUA 2PVOC 1PKWA 1Y6EA 2HSNB 4L5OA 5D93A 3PPUA 4YKFA 1GLQA 1THXA 4I5QA 1GSYA 5ENUA 5G5FA 1TI1A 4PX1A 1JZOA 1YF0A 2R3XA 22GSA 4IN0A 2WB9A 1VF3A 3D0ZA 4DSSA 1EGOA 3EINA 4YKGA 4HEA2 1W4VA 3KTLA 4ZL9A 3A2XA 2K9FA 4N0VA 1SKSB 2D2ZA 5IMZA 2O89A 2YZHA 3IHGA 1GL8A 4GQFA 5DALB 3KCMA 17GSA 1X5CA 3HJOA 1XW9A 2V6OA 4HU7A 4Z2TA 1LJRA 2P5RA 2LQQA 2MMZA 2HRKA 5D9TA 2VIMA 4N0ZA 3GYKA 3QFAC 1FB0A 1EV9A 2H70A 4YH2A 3F4SA 1MDJA 2KUCA 5B8BA 5CAXA 1SYRA 3QD9A 4PXOA 5D9XA 3A3TA 1FVJA 4IQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0N A;  2B5E A;  2GLR A;  3M1G A;  1A2J A;  3EMX A;  3GTU B;  2IFQ A;  1AQV A;  5F06 A;  1XOA A;  1EWX A;  2P0G A;  3S9F A;  4D73 B;  3BCK A;  2X8C A;  3UVH A;  4IS0 A;  14GS A;  3N5O A;  2MBT A;  1WOU A;  2O85 A;  4TXO B;  5E59 A;  5HR3 A;  2IMK A;  4WKW A;  2H1B A;  3GL5 A;  5DCG A;  1R5P A;  1B9Y C;  4OCE A;  2PUK C;  2H01 A;  3GH6 A;  2B5Y A;  3KZQ A;  2F3M A;  4O5R A;  3UJ1 A;  3WT2 A;  2GSQ A;  1MEK A;  5D9W A;  3CTG A;  3LXZ A;  2O87 A;  1ZYQ B;  1Z6M A;  4KX4 A;  2C8U A;  2H6Y A;  1G7O A;  2L5O A;  4NAX A;  2HRF A;  3F63 A;  5HR0 A;  2MMN A;  5ID2 A;  2TRC P;  1M0U A;  5ECN B;  2TIR A;  1WPI A;  3IR4 A;  4IQA A;  3DXB A;  4FIW A;  1RW1 A;  1BAY A;  1GSD A;  4LMV A;  1QFN A;  1AW9 A;  5DJM A;  3H79 A;  2H0H A;  2YV9 A;  3GMF A;  4HU9 A;  1V98 A;  3DML A;  1EV4 A;  1K0D A;  4RI6 A;  2FA8 A;  4V1A g;  2ES7 A;  5B6N A;  3MAK A;  1TW9 A;  2CQ9 A;  4G0K A;  2PVQ A;  1WP0 A;  3RPN A;  4KUN A;  5EVO A;  4ECI A;  3APO A;  2EIO A;  4P3Y B;  2H73 A;  3FR6 A;  1DBY A;  3IC8 A;  4V1A p;  3F3Q A;  4BVX B;  2LJR A;  4MP4 A;  2N5F A;  4F82 A;  2V32 A;  4WF4 A;  4WF5 A;  4NXI A;  3QAW A;  3C7M A;  2IMI A;  4MF6 A;  2UZ8 A;  3O76 A;  4LMW A;  3PIN A;  3QR6 A;  5J9B A;  2E7P A;  2G2Q A;  4N30 A;  2E0Q A;  2H71 A;  2JZT A;  4ULX A;  4GCI A;  5DQY A;  3FR3 A;  2HYX A;  1J9B A;  2YJH A;  2LTK A;  4NV2 A;  3UMA A;  1T1V A;  3LSZ A;  3GX0 A;  1A8Y A;  1ZGN A;  1IYI A;  3D4M A;  3L9S A;  1Z9H A;  2O8V B;  7GSS A;  4KGI A;  1PSQ A;  3NOF A;  5F05 A;  2B7J A;  5KN0 A;  2XPD A;  5GZZ B;  4GTU A;  4IKH A;  3GV1 A;  3KEB A;  4G0I A;  1EOG A;  1X9W B;  3HA9 A;  2WGR A;  5E4W A;  1DSB A;  3GHA A;  1EOH A;  2VL9 A;  2P5Q A;  4WET A;  1OKT A;  4L8E A;  3HHV A;  4WEY A;  1G6W A;  3TRQ A;  1PGT A;  4XS4 A;  1GTI A;  1XWC A;  1SK1 A;  1IYH A;  3G7Y A;  2HSY A;  3OR5 A;  4GSN A;  3D4T A;  4BL7 B;  1B9X C;  3BBY A;  1QK8 A;  4K8M A;  4GWR A;  5IPG A;  4G0L A;  3MSZ A;  1YDK A;  3DYR A;  4F0C A;  1O8X A;  3NIV A;  2CVK A;  2JZR A;  1A0R P;  3H4K A;  2YV7 A;  3HYP A;  3IE3 A;  4POL A;  5IMF A;  1JLV A;  2H74 A;  2YN1 A;  3HZ4 A;  4QL7 A;  4OMV A;  4F03 A;  1HYU A;  1FG4 A;  1ZZY A;  3RAZ A;  3P90 A;  3L9U A;  2DC5 A;  3TKR A;  5L71 A;  4ZB8 A;  3GST A;  5ECO B;  2FWF A;  4OO4 A;  1GSE A;  3UEM A;  3ZIV A;  4DVC A;  3MWH A;  3CSJ A;  3HKR A;  2CX4 A;  4GSS A;  2AHE A;  3WYW A;  2V2G A;  2LV3 A;  1KNG A;  4O7H A;  4N10 A;  2DML A;  5ELA A;  1U3A A;  3HXS A;  4I2T A;  4I8B A;  4KE3 A;  1EP7 A;  4OD7 A;  3TCO A;  5IOW A;  5IPH A;  2PN8 A;  3ZIJ A;  4I97 A;  4ZBB A;  4EDZ A;  2ALB A;  5J41 A;  1A23 A;  2LST A;  4JED A;  1ZOF A;  4PNF A;  3TJJ A;  3HDC A;  2LJA A;  1SJ6 A;  4FYB A;  4JR6 A;  3AY8 A;  3ZZX A;  1GSF A;  2VCT A;  3LXT A;  1GTB A;  1ERW A;  4TRX A;  1NSW A;  4X43 A;  4POB A;  4L0W A;  5FT3 A;  5B7C A;  1EEJ A;  5DBQ A;  3M0F A;  2WCI A;  4LLR A;  4H86 A;  2QC7 A;  4I6X A;  2RLI A;  4PNG A;  4ISD A;  3QMX A;  3LG6 A;  1K0C A;  1R26 A;  5C00 A;  4JR4 A;  2H19 A;  3SWL A;  3L4N A;  4AJ8 A;  4K7I A;  3DRN A;  2HSM A;  3KJY A;  5GST A;  4TOP A;  1OC3 A;  3H1N A;  4OFN A;  3GL3 A;  3F6F A;  4ZBA A;  5JWO B;  3ERW A;  2L4C A;  3FEU A;  4EL1 A;  3P8W A;  3HVS A;  3TB2 A;  4GXZ A;  3A2W A;  2FGX A;  4F9Z A;  1TU7 A;  1OE7 A;  4YAP A;  4AJ6 A;  2C3N A;  1F3B A;  2GQM A;  3KD0 A;  1Y25 A;  3F8U A;  3JCM L;  2MMA A;  2JAC A;  1BYE A;  3VK9 A;  1G6Y A;  4OFT A;  2IL3 A;  4PQ1 A;  2F9S A;  4TR1 B;  2PU9 C;  2OE3 A;  3E3E A;  2A4V A;  2HT9 A;  2RII A;  2OE0 A;  5ECK B;  4ID0 A;  3FKF A;  4TN8 A;  3C1S A;  5G1L A;  5ECP B;  1QQ2 A;  4MH3 A;  1YY7 A;  2IJY A;  1R7H A;  2X64 A;  1XPV A;  4MA9 A;  2DLX A;  3M9K A;  4MH2 A;  5LCZ A;  4HZ2 A;  2YPM A;  5CRH A;  1U87 A;  3EMP A;  1XW5 A;  4RUV A;  2OJL A;  3UBL A;  3DD3 A;  3CXG A;  2DJ2 A;  1O7U A;  2H66 A;  4TW5 A;  5D8I A;  3IAS 2;  4DSR A;  5DAK A;  3VLN A;  4G10 A;  2NVL A;  5HFK A;  3D21 A;  1TK8 B;  1AQW A;  1M9A A;  2LRN A;  3PGT A;  3CBU A;  4ML6 A;  3TJB A;  2F51 A;  5J4U A;  4Q5F A;  1XZO A;  2YNX A;  3C8E A;  4GF0 A;  4WBR D;  1DUG A;  4FYC A;  6GSW A;  1YKA A;  4JRR A;  4ZB6 A;  5CRE A;  4PUA A;  4DEJ A;  1MD4 A;  3RDW A;  3KTB A;  3LFL A;  2XHF A;  3TRX A;  1ML6 A;  1CQG A;  3KM6 A;  4EF0 A;  4E8E A;  2B3S A;  3ZRD A;  5JCW A;  3KH7 A;  1SU9 A;  5IMV A;  3EE2 A;  2LEG A;  1B4P A;  5G30 A;  5INY A;  2V41 A;  1AUC A;  1AC1 A;  4EE0 A;  2LS5 A;  4OFM A;  3GKK A;  2RUE A;  4OWY A;  1XWG A;  3GIX A;  2J23 A;  2LJK A;  3W8S A;  3DKS A;  2DSA A;  3I69 A;  1PX7 A;  2PGT A;  4NWY A;  3J7Y b;  1QUW A;  4MPG A;  1GUH A;  4DSS B;  1MTC A;  2PMT A;  1UN2 A;  3N9J A;  2Z9S A;  1GTA A;  3GKX A;  5CNW A;  2DIY A;  3V1W A;  4XS1 A;  5KN3 A;  2HRA A;  3M3M A;  3KH9 A;  4HUA A;  3VFI A;  5KN2 A;  3DGQ A;  4OCF A;  4K7O A;  3HVX A;  1TK0 B;  1UC7 A;  1WE0 A;  1EZK A;  1F37 A;  1VF1 A;  5G2Z A;  3TUE A;  3WGD A;  5CP1 A;  2H0I A;  4GST A;  1PKZ A;  2VLV A;  2DJJ A;  4MAB A;  3M9J A;  2G0F A;  1GTU A;  5F07 A;  2H6X A;  3IPZ A;  2OA7 A;  1O6J A;  4EC0 A;  3TKS C;  2QKE A;  2YWO A;  3M8N A;  4PGT A;  4BVY A;  3UAR A;  3LEF A;  3EU3 A;  3GUR A;  3IRA A;  5COH A;  2CAQ A;  2AYT A;  3EU4 A;  1ZCP A;  1A8L A;  1Z5Y E;  1YJ6 A;  1K3Y A;  4ZIL A;  2CZ2 A;  4RQX A;  3QAG A;  4XRD A;  2IFQ B;  2VD0 A;  1E2Y A;  1QGV A;  4LA1 A;  4IBP A;  4AJ7 A;  1FB6 A;  1DE1 A;  2GST A;  2YWI A;  1HD2 A;  2JU5 A;  3DVW A;  3HJP A;  3LGC A;  1SK2 A;  4KDY A;  3C73 A;  2VUP A;  1LBK A;  3EWL A;  2K18 A;  3U6V A;  2OAC A;  6GSY A;  2YAN A;  3F4T A;  2YWM A;  2HZF A;  1OC9 A;  4MZW A;  2KOK A;  6GSS A;  1TOF A;  1B4Q A;  4KB3 A;  3ZL5 A;  3EVI A;  1MDK A;  1THO A;  5IMD A;  1U3I A;  3FK8 A;  4IJI A;  5DVB A;  2M80 A;  1SL0 B;  5ID2 B;  2K6V A;  3W6G A;  4L5L A;  2REM A;  2VO4 A;  2YZU A;  3FW2 A;  2C4J A;  4CHS A;  1XVW A;  1M9B A;  2WRT A;  2H8L A;  2WS2 A;  5AIV A;  4J2F A;  3P7X A;  3KMO A;  4E8H A;  2GSR A;  2V1M A;  3BJ5 A;  1A2L A;  1H4O A;  3VWX A;  3HCZ A;  3SBC A;  3TKQ A;  4RI7 A;  1WIK A;  2LNS A;  5GAN D;  4XS6 A;  2C3T A;  2NTO A;  4WR4 A;  3CRU A;  4ZIJ A;  2C0G A;  3UBK A;  1TK5 B;  1G7E A;  4KCE A;  3Q6O A;  3O3T A;  10GS A;  4Q5R A;  4ECB A;  1Q4J A;  2VCW A;  4XHM A;  1V2A A;  1J08 A;  4MJE A;  3FR9 A;  1TRW A;  3LJR A;  2PER A;  1Q98 A;  2H76 A;  3CRT A;  4LL4 B;  20GS A;  1HNB A;  4MJB A;  3VPQ A;  4NHW A;  1XW6 A;  3DIE A;  4KSM A;  4MZC A;  1E6B A;  1XXU A;  2MZC A;  3K8N A;  4CW9 A;  4V2L A;  4PQI A;  2R4V A;  1O73 A;  1T8E B;  1PL1 A;  1AQX A;  1U6T A;  3FZ4 A;  3US3 A;  2IMF A;  4K6X A;  2HZE B;  3TRP A;  2VL3 A;  2L6C A;  3HVV A;  1O81 A;  3UAP A;  2WDU A;  5IO0 A;  1Z3E A;  4HJ2 A;  3ERG A;  5AIS A;  3CSH A;  1ILO A;  4DSQ A;  3FYG A;  1BED A;  3L9V A;  5D96 A;  1K0N A;  1JLW A;  2GT5 A;  4NV5 A;  3BCI A;  4TR4 A;  1SK0 A;  1OE8 A;  5ECQ B;  4YAV A;  1S3C A;  5GAP D;  2YJ7 A;  6GST A;  1OAZ A;  2NDO A;  1N2A A;  4EKZ A;  4QL9 A;  4PUR A;  5EY6 A;  2KLX A;  2YWN A;  3GX8 A;  4XS4 B;  2X99 A;  5BMU A;  2A2S A;  3TJG A;  2GZP A;  1I5G A;  1YEX A;  4Q5N A;  2HXK A;  3CTF A;  3RPP A;  4ML1 A;  2KP1 A;  1SKW B;  5DQS A;  4BPY A;  2CV4 A;  3A2V A;  1M99 A;  1OVN A;  3CMI A;  2KP2 A;  3RBT A;  1ZL9 A;  2GQL A;  4EVM A;  3G7I A;  3QFB C;  1PN9 A;  3ISO A;  3KP9 A;  3EYT A;  3D5J A;  3UIW A;  3GUS A;  5HQP A;  2KHP A;  3TDG A;  3ZLP A;  1ERV A;  1J0F A;  2R37 A;  1C72 A;  1S3A A;  4POM A;  1V40 A;  3IHQ A;  4FQU A;  1FVK A;  1GSS A;  1SYX A;  4K7N A;  1AIU A;  4ECC A;  2EC4 A;  2PBJ A;  5J5N A;  2J9H A;  4KAE A;  2LQO A;  5IM9 A;  1SEN A;  4ZXG A;  2M46 A;  3LQ7 A;  4BWQ A;  2NBS A;  2JSY A;  2C0D A;  2MBS A;  4MDC A;  2FLS A;  1T00 A;  1TI3 A;  1ACV A;  1WWJ A;  2IWT A;  5IOX A;  1ON4 A;  1GP1 A;  1GUK A;  2RM5 A;  1ERU A;  4HJM A;  4PQH A;  3CSI A;  3IBH A;  1K0A A;  4K9Z A;  3TKS A;  5CRD A;  3QOU A;  2A2R A;  2HFD A;  4J56 E;  2E2G A;  4V2N A;  2VOC A;  4K2D A;  1BX9 A;  3LYK A;  1O8W A;  3F0I A;  1I9D A;  2VAF A;  3KXO A;  4WBJ A;  3LOR A;  2ON7 A;  1AXD A;  3ZTL A;  18GS A;  1T4Z A;  1RQM A;  3PH9 A;  2P31 A;  1DE2 A;  1MDI A;  2YP6 A;  1EGR A;  3IDV A;  3W8J A;  1SL2 B;  4MK3 A;  2R2J A;  4O92 A;  4YQM A;  4WR5 A;  2VM1 A;  1ZMA A;  1XVQ A;  3P2A A;  2WZ9 A;  3G9B A;  2I9H A;  1GNW A;  1A2M A;  3ZRE A;  1VF2 A;  2L59 A;  8GSS A;  9GSS A;  3IXR A;  2HSM B;  2HI7 A;  2RUF A;  4RQR A;  2DJ1 A;  3D6I A;  4OO5 A;  1FW1 A;  1TRV A;  2FA4 A;  1XWA A;  2H1A A;  4ZBD A;  4XTS A;  2H0G A;  3DWV A;  3VUR A;  2FWH A;  2N5A A;  3GH9 A;  3GKN A;  4YQV A;  3C1R A;  5JCU A;  3NZN A;  5DAL A;  1EP8 A;  1F2E A;  1JZD A;  4HI7 A;  4FYU A;  4YQU A;  1PX6 A;  5D73 A;  1GSU A;  2F8A A;  2LKU A;  4IEL A;  2GGT A;  3QAV A;  1GSQ A;  1N8J A;  2YOI A;  5ECI B;  3DVX A;  5DDL A;  1M2D A;  2XBI A;  1KTE A;  3MNG A;  2DJK A;  3TJF A;  2ZUP A;  2ON5 A;  4EUY A;  3HY2 A;  3QPM A;  4TKY A;  2MYG A;  3Q19 A;  3GTU A;  3H93 A;  2XC2 A;  5DJL A;  3ME8 A;  4D73 A;  3FZ5 A;  5H5S A;  1UVZ A;  1NW2 A;  2C3Q A;  2GT6 A;  3ZVJ D;  4K1F A;  4TXO A;  1BQ7 A;  2K8S A;  5ELG A;  5F0G A;  1GLP A;  5DAK B;  5KEJ A;  1SKR B;  3U5R E;  3HD5 A;  4HOJ A;  5LD0 A;  5B6M A;  2DJ3 A;  5F8B A;  1TKD B;  5IMC A;  2R6K A;  2OBI A;  4KDX A;  3I6A A;  5EL8 A;  2OBK A;  5C04 A;  5CRG A;  2JL4 A;  3TJK A;  2LRC A;  4IHU A;  1GNE A;  1FHE A;  4HQZ A;  3IC4 A;  1V57 A;  3I43 A;  4F0B A;  1EEM A;  1NM3 A;  5GSS A;  5FHI A;  4KH7 A;  1XIY A;  3APS A;  4X1U A;  2HRK B;  3KMN A;  5G1K A;  3KGK A;  2OE1 A;  4BA7 A;  1TU8 A;  3LYP A;  1S3D A;  3ME7 A;  4TR3 A;  5LNK e;  1T4Y A;  2B6M A;  2HSH A;  1M7T A;  1NHO A;  2V6K A;  2L6D A;  2AUV A;  2C0E A;  4NMU A;  4MZB A;  2OKA A;  3WD6 A;  3F9U A;  1U88 A;  2FCH A;  3ZMK A;  2I1U A;  1PRX A;  2CVB A;  1GH2 A;  3HZ8 A;  4XRA A;  1QXH A;  4ZL8 A;  5FWG A;  3GN3 A;  3E9J B;  1B8X A;  2HE3 A;  16GS A;  1BJX A;  4BVX A;  4IP1 A;  3QCP A;  4N11 A;  2GTU A;  3UVT A;  1T7P B;  1YKC A;  3ZVJ A;  1OYJ A;  3VPT A;  1TRU A;  5D9V A;  2YCD A;  4FH8 A;  2F8F A;  1PL2 A;  1HQO A;  1XOB A;  4F2I A;  2GQK A;  2I3Y A;  3KP8 A;  1RK4 A;  3RHC A;  4KND A;  2AAW A;  3IA1 A;  1FO5 A;  5JWR B;  3ZYW A;  4BVY B;  5JCG A;  5A4W A;  1URM A;  1SJI A;  2FWE A;  3GSS A;  1YF1 A;  3TKP A;  2GS3 A;  4MJA A;  4O32 A;  3TOU A;  2H72 A;  2GVP A;  1FOV A;  4GQC A;  3R3E A;  1XWB A;  5HR2 A;  1XBS A;  5DCH A;  1XCC A;  4MF7 A;  5IIZ A;  1K0B A;  4ACS A;  4GRF A;  1Z7R A;  12GS A;  3E0U A;  1CQH A;  2C1Y A;  4BWS A;  2VL2 A;  1TRS A;  2H30 A;  1QMV A;  3VWU A;  3VI5 A;  1O85 A;  3IK7 A;  3CYN A;  2BMX A;  2H6Z A;  4MF5 A;  5ECR B;  3IOS A;  4LL1 B;  1ABA A;  5IO2 A;  2HNL A;  1BG5 A;  1T3B A;  4EO3 A;  4XIH A;  3FY7 A;  1R4W A;  1MD3 A;  4QQ7 A;  1V9W A;  1VRS D;  4TXV A;  4CDO A;  2CAI A;  2FHE A;  3ZFL A;  1PMT A;  4EDY A;  3BOA A;  3GNJ A;  4G19 A;  4KW6 A;  5ABR A;  2LRT A;  5G31 A;  1OC9 B;  1AAZ A;  2B7K A;  2GSS A;  2FNO A;  3IAM 2;  1SL1 B;  2VLU A;  3VI7 A;  4BL7 A;  2HZE A;  3A5W A;  1TTZ A;  2AV4 A;  2PPT A;  1XWK A;  2C80 A;  3VWV A;  3FZA A;  2X8G A;  4TR0 A;  1X9M B;  1K3O A;  5IMA A;  4Q5Q A;  1XFL A;  1USB A;  5H5R A;  3J7Y k;  2R5G A;  1JFU A;  2VCZ A;  1JHB A;  3RHB A;  1K0O A;  1FAA A;  4MMM A;  2H75 A;  3F6D A;  13GS A;  3ED3 A;  2DMM A;  1ERT A;  1PA3 A;  1X9S B;  1KBN A;  4AF2 A;  2K8V A;  3GRX A;  1WJK A;  3VWW A;  3GA4 A;  1TP9 A;  4JE1 A;  3ZIT A;  2E2M A;  2VCV A;  3R2Q A;  2XPE A;  1K3L A;  3F3R A;  4IP6 A;  2NPB A;  1SD8 A;  4JZQ A;  2QSI A;  2ZNM A;  5J9C A;  1V58 A;  1GUL A;  1A0F A;  4ZL7 A;  5A4V A;  4HZ4 A;  2B5X A;  2GDR A;  5JWQ B;  2IME A;  4J57 E;  4TVE A;  1X0R A;  1F9M A;  4KSO A;  1X5E A;  3GKM A;  3APQ A;  2VCX A;  3ZFB A;  4L0U A;  4KCA A;  4WXT A;  2H1G A;  4AGS A;  4FO5 A;  2IIY A;  3C71 A;  5ECS A;  3Q74 A;  1HNA A;  4KDU A;  2I81 A;  4NHZ A;  5G5E A;  2M72 A;  1SD9 A;  1JZW A;  4IGJ A;  2FY6 A;  4IW9 A;  2CA8 A;  5J3R A;  1TDI A;  3F4R A;  2N5B A;  2WJU A;  4MPF A;  4ZB9 A;  1GRX A;  1PQN A;  2WFC A;  2ZCT A;  1WMJ A;  1K0M A;  3L78 A;  2WUL A;  5HR1 A;  1W89 A;  1YZX A;  1WRY A;  4GLT A;  5HFI A;  1TJD A;  1A24 A;  2IN3 A;  3EC3 A;  2TRX A;  5ECM B;  5IQY A;  3ZML A;  2FWG A;  2DIZ A;  5A5K A;  2OAD A;  2FUG 2;  3EUR A;  3FRC A;  3UOM A;  19GS A;  2VL2 C;  4I2U A;  3I9V 2;  2BTO T;  2B1K A;  1KEB A;  1GWC A;  2O7K A;  1SJZ A;  2IMD A;  1B48 A;  1F6M C;  1Z6N A;  2CVD A;  4IVF A;  3WGX A;  4K0G A;  2GZY A;  1YEP A;  2EIR A;  2VLT A;  4JU5 A;  1ST9 A;  3TOT A;  1OC8 A;  3DEX A;  4NPB A;  2DBC A;  2LUS A;  3TGZ A;  4MJC A;  3PR8 A;  2LNT A;  4HDE A;  3ERF A;  3Q18 A;  1TXX A;  5B8A A;  3MDK A;  3LWA A;  2AJQ B;  4JBB A;  1X5D A;  4X0X A;  1VF4 A;  1G0T A;  4HQS A;  2EIQ A;  4TR1 A;  3UL3 A;  5A4U A;  2B1L A;  2XBQ A;  2CX3 A;  2RM6 A;  2JAD A;  3O6T A;  4G9H A;  2GZZ A;  1M2B A;  3FZ9 A;  1UA5 A;  3IV4 A;  1OKD A;  4KF9 A;  4ECJ A;  5EPF A;  2IPA A;  3GFK A;  2QGV A;  2L5L A;  2PWJ A;  1YQ1 A;  2AB6 A;  5H5Q A;  3WGE A;  3H8Q A;  5HFG A;  6GSX A;  3G7J A;  5AN1 A;  2CZ3 A;  5ECL B;  5ECH B;  3WT1 A;  2VM2 A;  4PUF C;  4PTS A;  6GSV A;  1F3A A;  4ILF A;  2I4A A;  3QDN A;  2FD3 A;  1R5A A;  6GSU A;  1VGL A;  5CO3 A;  3TKS E;  3HJM A;  1GUM A;  4HS1 A;  1LU4 A;  1JZR A;  2HLS A;  3BD2 A;  2X8H A;  3KIJ A;  4KA0 A;  2HRN A;  4POK A;  2VCQ A;  3L0H A;  3D22 A;  2JZS A;  4XCS A;  4EXJ A;  1ZYE A;  2L4Q A;  5CRW A;  4MLY A;  5AIX A;  5CYY A;  4V2M A;  2DJ0 A;  1Z7P A;  4G2E A;  3IK9 A;  2BJX A;  4IJ3 A;  1NHY A;  5AGY A;  5KN1 A;  11GS A;  1HNC A;  2CT6 A;  2L57 A;  2C0F A;  1M2A A;  4USS A;  2H1D A;  1PD2 1;  2MMO A;  1H75 A;  3FHK A;  4Z7X A;  2VD1 A;  2JSZ A;  2HQT A;  4MCU A;  2PVO C;  1PKW A;  1Y6E A;  2HSN B;  4L5O A;  5D93 A;  3PPU A;  1GLQ A;  1THX A;  4I5Q A;  1GSY A;  5ENU A;  5G5F A;  1TI1 A;  4PX1 A;  1JZO A;  1YF0 A;  2R3X A;  22GS A;  4IN0 A;  2WB9 A;  1VF3 A;  3D0Z A;  4DSS A;  1EGO A;  3EIN A;  4HEA 2;  1W4V A;  3KTL A;  4ZL9 A;  3A2X A;  2K9F A;  4N0V A;  1SKS B;  2D2Z A;  5IMZ A;  2O89 A;  2YZH A;  1GL8 A;  4GQF A;  5DAL B;  3KCM A;  17GS A;  1X5C A;  3HJO A;  1XW9 A;  2V6O A;  4HU7 A;  1LJR A;  2P5R A;  2LQQ A;  2MMZ A;  2HRK A;  5D9T A;  2VIM A;  4N0Z A;  3GYK A;  3QFA C;  1FB0 A;  1EV9 A;  2H70 A;  4YH2 A;  3F4S A;  1MDJ A;  2KUC A;  5B8B A;  5CAX A;  1SYR A;  3QD9 A;  4PXO A;  5D9X A;  3A3T A;  1FVJ A;  4IQ1 A; 
#chains in the Genus database with same CATH topology
 4K0N A;  2B5E A;  2GLR A;  3M1G A;  1A2J A;  3EMX A;  3GTU B;  2IFQ A;  1AQV A;  5F06 A;  1XOA A;  1EWX A;  2P0G A;  3S9F A;  4D73 B;  3BCK A;  2X8C A;  3UVH A;  4IS0 A;  14GS A;  2WW1 A;  3N5O A;  2MBT A;  1WOU A;  2O85 A;  4TXO B;  5E59 A;  2WW2 A;  5HR3 A;  2IMK A;  4WKW A;  2H1B A;  3GL5 A;  5DCG A;  1R5P A;  1B9Y C;  4OCE A;  2PUK C;  2H01 A;  3GH6 A;  2B5Y A;  3KZQ A;  2F3M A;  4O5R A;  3UJ1 A;  3WT2 A;  2GSQ A;  1MEK A;  5D9W A;  3CTG A;  3LXZ A;  1FOH A;  2EFC A;  2O87 A;  1ZYQ B;  1Z6M A;  4KX4 A;  2C8U A;  5A34 B;  2H6Y A;  1G7O A;  2L5O A;  4NAX A;  2HRF A;  3F63 A;  5HR0 A;  2MMN A;  4PI2 C;  5ID2 A;  2TRC P;  1M0U A;  1S4B P;  5ECN B;  2TIR A;  1WPI A;  3IR4 A;  4IQA A;  3DXB A;  4FIW A;  1RW1 A;  1BAY A;  1GSD A;  4LMV A;  1QFN A;  1AW9 A;  5DJM A;  3H79 A;  2H0H A;  2YV9 A;  3GMF A;  4HU9 A;  1V98 A;  3DML A;  1EV4 A;  1K0D A;  4RI6 A;  2FA8 A;  4V1A g;  2ES7 A;  5B6N A;  3MAK A;  1TW9 A;  2CQ9 A;  4G0K A;  2PVQ A;  1WP0 A;  3RPN A;  4KUN A;  1BG1 A;  5EVO A;  4ECI A;  3APO A;  2EIO A;  4P3Y B;  2H73 A;  4Z2U A;  3FR6 A;  1SVL A;  1DBY A;  3IC8 A;  4V1A p;  3F3Q A;  4BVX B;  2LJR A;  4MP4 A;  2N5F A;  4F82 A;  2DKI A;  2V32 A;  4WF4 A;  4WF5 A;  4NXI A;  4PI0 C;  3QAW A;  3C7M A;  2IMI A;  4MF6 A;  2UZ8 A;  3O76 A;  4LMW A;  3PIN A;  3QR6 A;  5J9B A;  2EFH A;  2E7P A;  2G2Q A;  4N30 A;  2E0Q A;  2H71 A;  2JZT A;  4ULX A;  4GCI A;  5DQY A;  3FR3 A;  2HYX A;  1J9B A;  2YJH A;  2LTK A;  4NV2 A;  1I1I P;  3UMA A;  1T1V A;  3LSZ A;  4PHZ C;  3GX0 A;  1A8Y A;  1ZGN A;  1IYI A;  3D4M A;  3L9S A;  1Z9H A;  2O8V B;  7GSS A;  4KGI A;  1PSQ A;  3NOF A;  5F05 A;  2B7J A;  5KN0 A;  2XPD A;  5GZZ B;  4GTU A;  4IKH A;  3GV1 A;  3TU3 B;  3KEB A;  4G0I A;  1EOG A;  4G01 A;  1X9W B;  3HA9 A;  2WGR A;  5E4W A;  1DSB A;  4O5Q A;  3GHA A;  4GDF A;  1EOH A;  2VL9 A;  2P5Q A;  4WET A;  1OKT A;  4L8E A;  3HHV A;  4WEY A;  1G6W A;  3TRQ A;  1PGT A;  4XS4 A;  1GTI A;  1XWC A;  1SK1 A;  1IYH A;  3G7Y A;  2O5V A;  2HSY A;  3OR5 A;  4GSN A;  3D4T A;  3RFR C;  4BL7 B;  1B9X C;  3BBY A;  1QK8 A;  4K8M A;  4GWR A;  5IPG A;  4G0L A;  3MSZ A;  1YDK A;  3DYR A;  4F0C A;  1O8X A;  1YVL A;  3NIV A;  2CVK A;  2JZR A;  1A0R P;  3H4K A;  2YV7 A;  3HYP A;  3IE3 A;  4MNN A;  2O36 A;  4POL A;  5IMF A;  1JLV A;  2H74 A;  2YN1 A;  3HZ4 A;  4QL7 A;  4OMV A;  4F03 A;  1HYU A;  1FG4 A;  1ZZY A;  3RAZ A;  3P90 A;  3L9U A;  2DC5 A;  3TKR A;  5L71 A;  4ZB8 A;  3GST A;  5ECO B;  2FWF A;  4OO4 A;  1GSE A;  3UEM A;  3ZIV A;  4DVC A;  3MWH A;  3CSJ A;  3HKR A;  2CX4 A;  4GSS A;  2AHE A;  3WYW A;  2V2G A;  2LV3 A;  1KNG A;  4O7H A;  4N10 A;  2DML A;  5ELA A;  1U3A A;  3HXS A;  4I2T A;  4I8B A;  4KE3 A;  1EP7 A;  4OD7 A;  3TCO A;  5IOW A;  5IPH A;  2PN8 A;  3ZIJ A;  4I97 A;  4ZBB A;  1PFO A;  4EDZ A;  2ALB A;  5J41 A;  1A23 A;  2LST A;  4JED A;  1ZOF A;  4PNF A;  3TJJ A;  3HDC A;  2LJA A;  1SJ6 A;  4FYB A;  4CY6 A;  4JR6 A;  3AY8 A;  3ZZX A;  1GSF A;  2VCT A;  3LXT A;  1GTB A;  1ERW A;  4TRX A;  1NSW A;  4X43 A;  4POB A;  4L0W A;  5FT3 A;  2DKH A;  5B7C A;  1EEJ A;  5DBQ A;  3M0F A;  2OT3 A;  2WCI A;  4LLR A;  4H86 A;  2QC7 A;  4I6X A;  2RLI A;  4PNG A;  4ISD A;  3QMX A;  3LG6 A;  1K0C A;  1R26 A;  5C00 A;  4JR4 A;  2H19 A;  3SWL A;  3L4N A;  4AKX B;  4AJ8 A;  5KOX A;  4K7I A;  3DRN A;  2HSM A;  3KJY A;  5GST A;  4TOP A;  1OC3 A;  3H1N A;  4OFN A;  5J47 A;  3GL3 A;  3F6F A;  4ZBA A;  5JWO B;  3ERW A;  2L4C A;  3FEU A;  4EL1 A;  3P8W A;  3HVS A;  3TB2 A;  4GXZ A;  3A2W A;  4K2X A;  2FGX A;  4F9Z A;  1TU7 A;  1OE7 A;  4YAP A;  4AJ6 A;  2C3N A;  1F3B A;  2GQM A;  3KD0 A;  1Y25 A;  3F8U A;  3JCM L;  2MMA A;  2JAC A;  1BYE A;  2VKZ G;  3VK9 A;  1G6Y A;  4OFT A;  2IL3 A;  4PQ1 A;  2F9S A;  5J4V A;  4TR1 B;  2PU9 C;  2OE3 A;  3E3E A;  2A4V A;  2HT9 A;  2RII A;  2OE0 A;  5ECK B;  4ID0 A;  3FKF A;  4TN8 A;  3C1S A;  5G1L A;  5ECP B;  1QQ2 A;  4MH3 A;  3HVN A;  1YY7 A;  5J40 A;  2IJY A;  1R7H A;  2X64 A;  1XPV A;  4MA9 A;  2DLX A;  3M9K A;  4MH2 A;  1N25 A;  5LCZ A;  4HZ2 A;  2YPM A;  5CRH A;  1U87 A;  1SVM A;  2EFD A;  3EMP A;  1XW5 A;  4RUV A;  2OJL A;  3UBL A;  3DD3 A;  3CXG A;  2DJ2 A;  1O7U A;  2H66 A;  4TW5 A;  1TXU A;  5D8I A;  3IAS 2;  4DSR A;  5DAK A;  3VLN A;  4G10 A;  2NVL A;  5HFK A;  3D21 A;  1TK8 B;  1AQW A;  1M9A A;  2LRN A;  3PGT A;  3CBU A;  4ML6 A;  3TJB A;  2F51 A;  5J4U A;  4Q5F A;  1XZO A;  2YNX A;  3C8E A;  4GF0 A;  4WBR D;  1DUG A;  4FYC A;  6GSW A;  1YKA A;  4ZB6 A;  4JRR A;  5CRE A;  4PUA A;  4DEJ A;  1MD4 A;  3RDW A;  3KTB A;  3LFL A;  2XHF A;  3TRX A;  1ML6 A;  1CQG A;  3KM6 A;  4EF0 A;  4E8E A;  2B3S A;  3ZRD A;  5JCW A;  3KH7 A;  1SU9 A;  5IMV A;  3EE2 A;  2LEG A;  1B4P A;  5G30 A;  5INY A;  2V41 A;  1AUC A;  1AC1 A;  4EE0 A;  2LS5 A;  4OFM A;  3GKK A;  1M3I A;  2RUE A;  4OWY A;  1XWG A;  3GIX A;  2J23 A;  2LJK A;  3W8S A;  3DKS A;  2DSA A;  3I69 A;  4Z2R A;  1PX7 A;  2PGT A;  4NWY A;  3J7Y b;  1QUW A;  4MPG A;  1GUH A;  4DSS B;  1MTC A;  2PMT A;  1UN2 A;  3N9J A;  2Z9S A;  1GTA A;  3GKX A;  5CNW A;  2DIY A;  3V1W A;  4XS1 A;  5KN3 A;  2HRA A;  3CQF A;  3M3M A;  3KH9 A;  4HUA A;  3VFI A;  5KN2 A;  3DGQ A;  4OCF A;  4K7O A;  3HVX A;  1TK0 B;  1UC7 A;  1WE0 A;  1EZK A;  1F37 A;  1VF1 A;  5G2Z A;  3TUE A;  3WGD A;  5CP1 A;  2H0I A;  4GST A;  1PKZ A;  2VLV A;  2DJJ A;  4MAB A;  3M9J A;  2G0F A;  1GTU A;  5F07 A;  2H6X A;  4QMK A;  3IPZ A;  2OA7 A;  1O6J A;  4EC0 A;  3TKS C;  2QKE A;  2YWO A;  3M8N A;  4PGT A;  4BVY A;  3UAR A;  3LEF A;  3EU3 A;  3GUR A;  3IRA A;  5COH A;  2CAQ A;  2AYT A;  3EU4 A;  1ZCP A;  1A8L A;  2WVY A;  1Z5Y E;  1YJ6 A;  1K3Y A;  4ZIL A;  2CZ2 A;  3FMW A;  4RQX A;  3QAG A;  4XRD A;  2IFQ B;  2VD0 A;  1E2Y A;  1QGV A;  4LA1 A;  2H1L A;  4IBP A;  4AJ7 A;  1FB6 A;  1DE1 A;  2GST A;  2YWI A;  1HD2 A;  2JU5 A;  3DVW A;  3HJP A;  3LGC A;  1SK2 A;  4KDY A;  3C73 A;  2VUP A;  1LBK A;  3EWL A;  2K18 A;  3U6V A;  2OAC A;  6GSY A;  2YAN A;  3F4T A;  2YWM A;  2HZF A;  1OC9 A;  5A5H A;  4MZW A;  2KOK A;  6GSS A;  1TOF A;  1B4Q A;  4KB3 A;  3ZL5 A;  3EVI A;  1MDK A;  1THO A;  5IMD A;  1U3I A;  3FK8 A;  4IJI A;  5DVB A;  1PN0 A;  2M80 A;  1SL0 B;  5ID2 B;  2K6V A;  3EPT A;  3W6G A;  4L5L A;  2REM A;  2VO4 A;  2YZU A;  3FW2 A;  2C4J A;  4CHS A;  1XVW A;  1M9B A;  2WRT A;  2H8L A;  2WS2 A;  5J4Y A;  5AIV A;  4ZB7 A;  4J2F A;  3P7X A;  3KMO A;  4E8H A;  2GSR A;  2V1M A;  3BJ5 A;  1A2L A;  1H4O A;  3VWX A;  3HCZ A;  3SBC A;  3TKQ A;  4RI7 A;  2R0G A;  1WIK A;  2LNS A;  5GAN D;  4XS6 A;  2C3T A;  2NTO A;  4WR4 A;  3CRU A;  4ZIJ A;  2C0G A;  3UBK A;  1TK5 B;  1G7E A;  4KCE A;  3Q6O A;  3O3T A;  10GS A;  4Q5R A;  4ECB A;  1Q4J A;  2VCW A;  4XHM A;  1V2A A;  1J08 A;  4MJE A;  3FR9 A;  1TRW A;  3LJR A;  2PER A;  1Q98 A;  2H76 A;  3CRT A;  4LL4 B;  20GS A;  1HNB A;  4MJB A;  3VPQ A;  4NHW A;  1XW6 A;  2QA1 A;  3DIE A;  4KSM A;  4MZC A;  1E6B A;  1XXU A;  2MZC A;  3K8N A;  4CW9 A;  4V2L A;  4PQI A;  2R4V A;  1O73 A;  1T8E B;  1PL1 A;  1AQX A;  1U6T A;  5BRT A;  3FZ4 A;  3US3 A;  2IMF A;  4K6X A;  2HZE B;  3TRP A;  2VL3 A;  2L6C A;  3HVV A;  1O81 A;  4EIQ A;  1Y1U A;  3UAP A;  2WDU A;  5IO0 A;  1Z3E A;  4HJ2 A;  3ERG A;  5AIS A;  3CSH A;  1ILO A;  4ICY A;  4DSQ A;  3FYG A;  1BED A;  3L9V A;  5A1N A;  5D96 A;  1K0N A;  1JLW A;  1ZYP A;  2GT5 A;  4NV5 A;  3BCI A;  4TR4 A;  1SK0 A;  2WW0 A;  1XG8 A;  1OE8 A;  5ECQ B;  4YAV A;  1S3C A;  5GAP D;  2YJ7 A;  3CHX C;  6GST A;  1OAZ A;  2NDO A;  1N2A A;  4EKZ A;  4QL9 A;  4PUR A;  5EY6 A;  2KLX A;  2YWN A;  3GX8 A;  4XS4 B;  2WVX A;  4N3Z A;  2X99 A;  5BMU A;  4X4J A;  2A2S A;  3TJG A;  2GZP A;  1I5G A;  1YEX A;  4Q5N A;  2HXK A;  3CTF A;  3RPP A;  4ML1 A;  2KP1 A;  1SKW B;  5DQS A;  4BPY A;  2CV4 A;  3A2V A;  1M99 A;  1OVN A;  3CMI A;  2KP2 A;  3RBT A;  1ZL9 A;  2GQL A;  4EVM A;  3G7I A;  3QFB C;  1PN9 A;  3ISO A;  3KP9 A;  3EYT A;  3D5J A;  3UIW A;  3GUS A;  5HQP A;  2KHP A;  3TDG A;  3ZLP A;  1ERV A;  1J0F A;  2R37 A;  1C72 A;  4AI6 A;  1S3A A;  4POM A;  1V40 A;  3IHQ A;  4FQU A;  1FVK A;  1GSS A;  1SYX A;  4K7N A;  1AIU A;  4ECC A;  2EC4 A;  2PBJ A;  5J5N A;  2J9H A;  4KAE A;  2LQO A;  5IM9 A;  3RGB C;  1SEN A;  4ZXG A;  2M46 A;  3LQ7 A;  4BWQ A;  2NBS A;  2JSY A;  2C0D A;  2MBS A;  4MDC A;  2FLS A;  1T00 A;  1TI3 A;  1ACV A;  1WWJ A;  2IWT A;  5IOX A;  1ON4 A;  1GP1 A;  2UV8 G;  1GUK A;  2RM5 A;  1ERU A;  4HJM A;  4PQH A;  3CSI A;  3IBH A;  1K0A A;  4K9Z A;  3TKS A;  3CWG A;  5CRD A;  3QOU A;  2A2R A;  2HFD A;  4J56 E;  2E2G A;  4V2N A;  2VOC A;  4K2D A;  1BX9 A;  2X4A A;  3LYK A;  1O8W A;  3F0I A;  1I9D A;  2VAF A;  3KXO A;  4WBJ A;  3LOR A;  2ON7 A;  1AXD A;  3ZTL A;  18GS A;  1T4Z A;  1RQM A;  3PH9 A;  2P31 A;  1DE2 A;  1MDI A;  2YP6 A;  1EGR A;  3IDV A;  3W8J A;  1SL2 B;  4MK3 A;  2R2J A;  4O92 A;  4YQM A;  4WR5 A;  2VM1 A;  1ZMA A;  1XVQ A;  3P2A A;  3MIX A;  2WZ9 A;  2HSN A;  3G9B A;  2I9H A;  1GNW A;  1A2M A;  3ZRE A;  1VF2 A;  2L59 A;  8GSS A;  9GSS A;  3IXR A;  2HSM B;  1ZYN A;  2HI7 A;  2RUF A;  4RQR A;  2R0P A;  2DJ1 A;  3D6I A;  4OO5 A;  1FW1 A;  1TRV A;  2FA4 A;  1XWA A;  2H1A A;  4ZBD A;  4XTS A;  2H0G A;  3DWV A;  3VUR A;  2FWH A;  2N5A A;  3GH9 A;  3GKN A;  4YQV A;  3C1R A;  5JCU A;  3NZN A;  5DAL A;  1EP8 A;  1F2E A;  1JZD A;  4HI7 A;  4FYU A;  4YQU A;  4HSC X;  1PX6 A;  4K5S A;  2WZS A;  5D73 A;  1GSU A;  2F8A A;  2LKU A;  4IEL A;  2GGT A;  2A4H A;  3QAV A;  1GSQ A;  1N8J A;  2YOI A;  5ECI B;  3DVX A;  5DDL A;  1M2D A;  2XBI A;  1KTE A;  3MNG A;  2DJK A;  3TJF A;  2ZUP A;  2ON5 A;  4EUY A;  3HY2 A;  2QA2 A;  3QPM A;  4TKY A;  2MYG A;  3Q19 A;  3GTU A;  3H93 A;  2XC2 A;  5DJL A;  3MYD A;  3ME8 A;  4D73 A;  3FZ5 A;  5H5S A;  1UVZ A;  1NW2 A;  2C3Q A;  2GT6 A;  3ZVJ D;  4K1F A;  4TXO A;  3A5I A;  1BQ7 A;  2K8S A;  5ELG A;  5F0G A;  1GLP A;  5DAK B;  5KEJ A;  1SVO A;  1SKR B;  3U5R E;  3HD5 A;  4HOJ A;  5LD0 A;  5B6M A;  2DJ3 A;  5F8B A;  1TKD B;  5IMC A;  2R6K A;  2OBI A;  4KDX A;  3I6A A;  5EL8 A;  2OBK A;  5C04 A;  5CRG A;  5A34 A;  2JL4 A;  3TJK A;  2LRC A;  4IHU A;  1GNE A;  1FHE A;  4HQZ A;  3IC4 A;  1V57 A;  3I43 A;  4F0B A;  1EEM A;  1NM3 A;  5GSS A;  3LW9 A;  5FHI A;  4KH7 A;  1XIY A;  3APS A;  4X1U A;  2HRK B;  3KMN A;  4AKG A;  5G1K A;  3KGK A;  2OE1 A;  4BA7 A;  1TU8 A;  3LYP A;  1S3D A;  3ME7 A;  4TR3 A;  5LNK e;  1T4Y A;  2B6M A;  2HSH A;  1M7T A;  1NHO A;  2V6K A;  2L6D A;  2AUV A;  2C0E A;  4NMU A;  4MZB A;  2OKA A;  3WD6 A;  3F9U A;  1U88 A;  2FCH A;  3ZMK A;  2I1U A;  1PRX A;  2CVB A;  1GH2 A;  3HZ8 A;  4XRA A;  1QXH A;  4ZL8 A;  5FWG A;  3GN3 A;  3E9J B;  1B8X A;  2HE3 A;  16GS A;  4E68 A;  1BJX A;  4BVX A;  4IP1 A;  3QCP A;  4N11 A;  2GTU A;  4AKI A;  3UVT A;  1T7P B;  1YKC A;  3ZVJ A;  1OYJ A;  3VPT A;  1TRU A;  5D9V A;  2YCD A;  4FH8 A;  2F8F A;  1PL2 A;  1HQO A;  1XOB A;  4F2I A;  2GQK A;  2I3Y A;  3KP8 A;  1RK4 A;  5KOW A;  3RHC A;  4KND A;  4W66 A;  2AAW A;  3IA1 A;  1FO5 A;  5JWR B;  1YEW C;  3ZYW A;  4BVY B;  5JCG A;  5A4W A;  1URM A;  1SJI A;  2FWE A;  3GSS A;  1YF1 A;  3TKP A;  2GS3 A;  4MJA A;  4O32 A;  3TOU A;  2H72 A;  2GVP A;  1FOV A;  4GQC A;  1BF5 A;  3R3E A;  1M3J A;  1XWB A;  5HR2 A;  1XBS A;  5DCH A;  1XCC A;  4MF7 A;  5IIZ A;  1K0B A;  4ACS A;  4GRF A;  1Z7R A;  12GS A;  3E0U A;  1CQH A;  2C1Y A;  4BWS A;  4FXY P;  2VL2 A;  1TRS A;  2H30 A;  1QMV A;  3VWU A;  3VI5 A;  1O85 A;  3IK7 A;  3CYN A;  2BMX A;  2H6Z A;  4MF5 A;  5ECR B;  3IOS A;  4LL1 B;  4BIK A;  1ABA A;  5IO2 A;  2HNL A;  1BG5 A;  1T3B A;  4EO3 A;  4XIH A;  3FY7 A;  1R4W A;  1MD3 A;  4QQ7 A;  1V9W A;  1VRS D;  4TXV A;  4CDO A;  2CAI A;  2FHE A;  3ZFL A;  1PMT A;  4EDY A;  3BOA A;  3GNJ A;  4G19 A;  4KW6 A;  5ABR A;  2LRT A;  2R0C A;  5G31 A;  1OC9 B;  1AAZ A;  5A5H B;  2B7K A;  2GSS A;  2FNO A;  3HMJ G;  3IAM 2;  1SL1 B;  2VLU A;  3VI7 A;  4BL7 A;  2HZE A;  3A5W A;  2O3E A;  1TTZ A;  2AV4 A;  2PPT A;  1XWK A;  2C80 A;  3VWV A;  3FZA A;  2X8G A;  4TR0 A;  1X9M B;  1K3O A;  5IMA A;  4Q5Q A;  1XFL A;  1USB A;  5H5R A;  3J7Y k;  2R5G A;  1JFU A;  2VCZ A;  1JHB A;  3RHB A;  1K0O A;  1FAA A;  4MMM A;  2H75 A;  3F6D A;  13GS A;  3ED3 A;  2DMM A;  1ERT A;  1PA3 A;  1X9S B;  1KBN A;  4AF2 A;  2K8V A;  3GRX A;  1WJK A;  3VWW A;  3GA4 A;  1TP9 A;  4JE1 A;  3ZIT A;  2E2M A;  2VCV A;  3R2Q A;  2XPE A;  1K3L A;  3F3R A;  4IP6 A;  2NPB A;  1SD8 A;  4JZQ A;  2QSI A;  2ZNM A;  5J9C A;  1V58 A;  1GUL A;  1A0F A;  4ZL7 A;  5A4V A;  4HZ4 A;  2B5X A;  2GDR A;  5JWQ B;  2IME A;  4J57 E;  4TVE A;  1X0R A;  1F9M A;  4KSO A;  1X5E A;  3GKM A;  3APQ A;  2VCX A;  3ZFB A;  4L0U A;  4KCA A;  4WXT A;  2H1G A;  4AGS A;  4FO5 A;  2IIY A;  3C71 A;  5ECS A;  3Q74 A;  1HNA A;  4KDU A;  2I81 A;  4NHZ A;  5G5E A;  2M72 A;  1SD9 A;  1JZW A;  4IGJ A;  2FY6 A;  4IW9 A;  2CA8 A;  5J3R A;  1TDI A;  3F4R A;  2N5B A;  2WJU A;  4MPF A;  4ZB9 A;  1GRX A;  1PQN A;  2WFC A;  2ZCT A;  5A1N B;  1WMJ A;  1K0M A;  3L78 A;  4A5P A;  2WUL A;  5HR1 A;  1W89 A;  1YZX A;  1WRY A;  4GLT A;  5HFI A;  1TJD A;  1A24 A;  2IN3 A;  3EC3 A;  2TRX A;  5ECM B;  5IQY A;  3ZML A;  2FWG A;  2DIZ A;  5A5K A;  4O5U A;  2OAD A;  2FUG 2;  3EUR A;  3FRC A;  3UOM A;  19GS A;  2VL2 C;  2X49 A;  4I2U A;  3I9V 2;  2BTO T;  2B1K A;  2WVX B;  1KEB A;  1GWC A;  2O7K A;  1SJZ A;  2IMD A;  1B48 A;  1F6M C;  1Z6N A;  2CVD A;  4IVF A;  3WGX A;  5BMU B;  4K0G A;  2GZY A;  1YEP A;  2EIR A;  2VLT A;  4JU5 A;  1ST9 A;  3TOT A;  1OC8 A;  3DEX A;  4NPB A;  2DBC A;  2LUS A;  3TGZ A;  2WVZ A;  4MJC A;  3PR8 A;  2LNT A;  4HDE A;  3ERF A;  3Q18 A;  1TXX A;  5B8A A;  3MDK A;  3LWA A;  2AJQ B;  4JBB A;  4K5R A;  1X5D A;  4X0X A;  1VF4 A;  1G0T A;  4HQS A;  2EIQ A;  4TR1 A;  3UL3 A;  5A4U A;  2B1L A;  2XBQ A;  2CX3 A;  2RM6 A;  2JAD A;  3O6T A;  4G9H A;  2GZZ A;  1M2B A;  3FZ9 A;  1UA5 A;  3IV4 A;  1OKD A;  4KF9 A;  4ECJ A;  5EPF A;  2IPA A;  3GFK A;  2QGV A;  2L5L A;  2PWJ A;  1YQ1 A;  2AB6 A;  5H5Q A;  3WGE A;  3H8Q A;  5HFG A;  6GSX A;  3G7J A;  5AN1 A;  2CZ3 A;  5ECL B;  5ECH B;  3WT1 A;  2VM2 A;  4PUF C;  4PTS A;  6GSV A;  4EIP A;  1F3A A;  4ILF A;  2I4A A;  3QDN A;  2FD3 A;  1R5A A;  2A2P A;  4AKH A;  6GSU A;  1VGL A;  5CO3 A;  3TKS E;  3HJM A;  1GUM A;  4HS1 A;  1LU4 A;  1JZR A;  2HLS A;  3BD2 A;  2X8H A;  3KIJ A;  4KA0 A;  2EFE A;  2HRN A;  4POK A;  2VCQ A;  3L0H A;  3D22 A;  2JZS A;  4XCS A;  4EXJ A;  1ZYE A;  2L4Q A;  5CRW A;  4MLY A;  5AIX A;  4CY8 A;  5CYY A;  4V2M A;  2DJ0 A;  1Z7P A;  4G2E A;  3IK9 A;  2BJX A;  4IJ3 A;  1NHY A;  1S3R A;  5AGY A;  5KN1 A;  11GS A;  1HNC A;  2CT6 A;  2L57 A;  2C0F A;  1M2A A;  4USS A;  2H1D A;  1PD2 1;  2MMO A;  1H75 A;  3FHK A;  4Z7X A;  2VD1 A;  2JSZ A;  2HQT A;  4MCU A;  2PVO C;  1PKW A;  1Y6E A;  2HSN B;  4L5O A;  5D93 A;  3PPU A;  4YKF A;  1GLQ A;  1THX A;  4I5Q A;  1GSY A;  5ENU A;  5G5F A;  1TI1 A;  4PX1 A;  1JZO A;  1YF0 A;  2R3X A;  22GS A;  4IN0 A;  2WB9 A;  1VF3 A;  2WW3 A;  3D0Z A;  4DSS A;  1EGO A;  3EIN A;  4YKG A;  4HEA 2;  1W4V A;  3KTL A;  4ZL9 A;  3A2X A;  2K9F A;  4N0V A;  1SKS B;  2D2Z A;  5IMZ A;  2O89 A;  2YZH A;  3IHG A;  1GL8 A;  4GQF A;  5DAL B;  3KCM A;  17GS A;  1X5C A;  3HJO A;  1XW9 A;  2V6O A;  4HU7 A;  4Z2T A;  1LJR A;  2P5R A;  2LQQ A;  2MMZ A;  2HRK A;  5D9T A;  2VIM A;  4N0Z A;  3GYK A;  3QFA C;  1FB0 A;  1EV9 A;  2H70 A;  4YH2 A;  3F4S A;  1MDJ A;  2KUC A;  5B8B A;  5CAX A;  1SYR A;  3QD9 A;  4PXO A;  5D9X A;  3A3T A;  1FVJ A;  4IQ1 A; 
#chains in the Genus database with same CATH homology
 4K0N A;  2B5E A;  2GLR A;  3M1G A;  1A2J A;  3EMX A;  3GTU B;  2IFQ A;  1AQV A;  5F06 A;  1XOA A;  1EWX A;  2P0G A;  3S9F A;  4D73 B;  3BCK A;  2X8C A;  3UVH A;  4IS0 A;  14GS A;  3N5O A;  2MBT A;  1WOU A;  2O85 A;  4TXO B;  5E59 A;  5HR3 A;  2IMK A;  4WKW A;  2H1B A;  3GL5 A;  5DCG A;  1R5P A;  1B9Y C;  4OCE A;  2PUK C;  2H01 A;  3GH6 A;  2B5Y A;  3KZQ A;  2F3M A;  4O5R A;  3UJ1 A;  3WT2 A;  2GSQ A;  1MEK A;  5D9W A;  3CTG A;  3LXZ A;  1FOH A;  2EFC A;  2O87 A;  1ZYQ B;  1Z6M A;  4KX4 A;  2C8U A;  5A34 B;  2H6Y A;  1G7O A;  2L5O A;  4NAX A;  2HRF A;  3F63 A;  5HR0 A;  2MMN A;  5ID2 A;  2TRC P;  1M0U A;  5ECN B;  2TIR A;  1WPI A;  3IR4 A;  4IQA A;  3DXB A;  4FIW A;  1RW1 A;  1BAY A;  1GSD A;  4LMV A;  1QFN A;  1AW9 A;  5DJM A;  3H79 A;  2H0H A;  2YV9 A;  3GMF A;  4HU9 A;  1V98 A;  3DML A;  1EV4 A;  1K0D A;  4RI6 A;  2FA8 A;  4V1A g;  2ES7 A;  5B6N A;  3MAK A;  1TW9 A;  2CQ9 A;  4G0K A;  2PVQ A;  1WP0 A;  3RPN A;  4KUN A;  1BG1 A;  5EVO A;  4ECI A;  3APO A;  2EIO A;  4P3Y B;  2H73 A;  4Z2U A;  3FR6 A;  1SVL A;  1DBY A;  3IC8 A;  4V1A p;  3F3Q A;  4BVX B;  2LJR A;  4MP4 A;  2N5F A;  4F82 A;  2DKI A;  2V32 A;  4WF4 A;  4WF5 A;  4NXI A;  3QAW A;  3C7M A;  2IMI A;  4MF6 A;  2UZ8 A;  3O76 A;  4LMW A;  3PIN A;  3QR6 A;  5J9B A;  2EFH A;  2E7P A;  2G2Q A;  4N30 A;  2E0Q A;  2H71 A;  2JZT A;  4ULX A;  4GCI A;  5DQY A;  3FR3 A;  2HYX A;  1J9B A;  2YJH A;  2LTK A;  4NV2 A;  3UMA A;  1T1V A;  3LSZ A;  3GX0 A;  1A8Y A;  1ZGN A;  1IYI A;  3D4M A;  3L9S A;  1Z9H A;  2O8V B;  7GSS A;  4KGI A;  1PSQ A;  3NOF A;  5F05 A;  2B7J A;  5KN0 A;  2XPD A;  5GZZ B;  4GTU A;  4IKH A;  3GV1 A;  3TU3 B;  3KEB A;  4G0I A;  1EOG A;  4G01 A;  1X9W B;  3HA9 A;  2WGR A;  5E4W A;  1DSB A;  4O5Q A;  3GHA A;  4GDF A;  1EOH A;  2VL9 A;  2P5Q A;  4WET A;  1OKT A;  4L8E A;  3HHV A;  4WEY A;  1G6W A;  3TRQ A;  1PGT A;  4XS4 A;  1GTI A;  1XWC A;  1SK1 A;  1IYH A;  3G7Y A;  2O5V A;  2HSY A;  3OR5 A;  4GSN A;  3D4T A;  4BL7 B;  1B9X C;  3BBY A;  1QK8 A;  4K8M A;  4GWR A;  5IPG A;  4G0L A;  3MSZ A;  1YDK A;  3DYR A;  4F0C A;  1O8X A;  1YVL A;  3NIV A;  2CVK A;  2JZR A;  1A0R P;  3H4K A;  2YV7 A;  3HYP A;  3IE3 A;  4MNN A;  4POL A;  5IMF A;  1JLV A;  2H74 A;  2YN1 A;  3HZ4 A;  4QL7 A;  4OMV A;  4F03 A;  1HYU A;  1FG4 A;  1ZZY A;  3RAZ A;  3P90 A;  3L9U A;  2DC5 A;  3TKR A;  5L71 A;  4ZB8 A;  3GST A;  5ECO B;  2FWF A;  4OO4 A;  1GSE A;  3UEM A;  3ZIV A;  4DVC A;  3MWH A;  3CSJ A;  3HKR A;  2CX4 A;  4GSS A;  2AHE A;  3WYW A;  2V2G A;  2LV3 A;  1KNG A;  4O7H A;  4N10 A;  2DML A;  5ELA A;  1U3A A;  3HXS A;  4I2T A;  4I8B A;  4KE3 A;  1EP7 A;  4OD7 A;  3TCO A;  5IOW A;  5IPH A;  2PN8 A;  3ZIJ A;  4I97 A;  4ZBB A;  4EDZ A;  2ALB A;  5J41 A;  1A23 A;  2LST A;  4JED A;  1ZOF A;  4PNF A;  3TJJ A;  3HDC A;  2LJA A;  1SJ6 A;  4FYB A;  4CY6 A;  4JR6 A;  3AY8 A;  3ZZX A;  1GSF A;  2VCT A;  3LXT A;  1GTB A;  1ERW A;  4TRX A;  1NSW A;  4X43 A;  4POB A;  4L0W A;  5FT3 A;  2DKH A;  5B7C A;  1EEJ A;  5DBQ A;  3M0F A;  2OT3 A;  2WCI A;  4LLR A;  4H86 A;  2QC7 A;  4I6X A;  2RLI A;  4PNG A;  4ISD A;  3QMX A;  3LG6 A;  1K0C A;  1R26 A;  5C00 A;  4JR4 A;  2H19 A;  3SWL A;  3L4N A;  4AKX B;  4AJ8 A;  5KOX A;  4K7I A;  3DRN A;  2HSM A;  3KJY A;  5GST A;  4TOP A;  1OC3 A;  3H1N A;  4OFN A;  5J47 A;  3GL3 A;  3F6F A;  4ZBA A;  5JWO B;  3ERW A;  2L4C A;  3FEU A;  4EL1 A;  3P8W A;  3HVS A;  3TB2 A;  4GXZ A;  3A2W A;  4K2X A;  2FGX A;  4F9Z A;  1TU7 A;  1OE7 A;  4YAP A;  4AJ6 A;  2C3N A;  1F3B A;  2GQM A;  3KD0 A;  1Y25 A;  3F8U A;  3JCM L;  2MMA A;  2JAC A;  1BYE A;  2VKZ G;  3VK9 A;  1G6Y A;  4OFT A;  2IL3 A;  4PQ1 A;  2F9S A;  5J4V A;  4TR1 B;  2PU9 C;  2OE3 A;  3E3E A;  2A4V A;  2HT9 A;  2RII A;  2OE0 A;  5ECK B;  4ID0 A;  3FKF A;  4TN8 A;  3C1S A;  5G1L A;  5ECP B;  1QQ2 A;  4MH3 A;  1YY7 A;  5J40 A;  2IJY A;  1R7H A;  2X64 A;  1XPV A;  4MA9 A;  2DLX A;  3M9K A;  4MH2 A;  1N25 A;  5LCZ A;  4HZ2 A;  2YPM A;  5CRH A;  1U87 A;  1SVM A;  2EFD A;  3EMP A;  1XW5 A;  4RUV A;  2OJL A;  3UBL A;  3DD3 A;  3CXG A;  2DJ2 A;  1O7U A;  2H66 A;  4TW5 A;  1TXU A;  5D8I A;  3IAS 2;  4DSR A;  5DAK A;  3VLN A;  4G10 A;  2NVL A;  5HFK A;  3D21 A;  1TK8 B;  1AQW A;  1M9A A;  2LRN A;  3PGT A;  3CBU A;  4ML6 A;  3TJB A;  2F51 A;  5J4U A;  4Q5F A;  1XZO A;  2YNX A;  3C8E A;  4GF0 A;  4WBR D;  1DUG A;  4FYC A;  6GSW A;  1YKA A;  4ZB6 A;  4JRR A;  5CRE A;  4PUA A;  4DEJ A;  1MD4 A;  3RDW A;  3KTB A;  3LFL A;  2XHF A;  3TRX A;  1ML6 A;  1CQG A;  3KM6 A;  4EF0 A;  4E8E A;  2B3S A;  3ZRD A;  5JCW A;  3KH7 A;  1SU9 A;  5IMV A;  3EE2 A;  2LEG A;  1B4P A;  5G30 A;  5INY A;  2V41 A;  1AUC A;  1AC1 A;  4EE0 A;  2LS5 A;  4OFM A;  3GKK A;  2RUE A;  4OWY A;  1XWG A;  3GIX A;  2J23 A;  2LJK A;  3W8S A;  3DKS A;  2DSA A;  3I69 A;  4Z2R A;  1PX7 A;  2PGT A;  4NWY A;  3J7Y b;  1QUW A;  4MPG A;  1GUH A;  4DSS B;  1MTC A;  2PMT A;  1UN2 A;  3N9J A;  2Z9S A;  1GTA A;  3GKX A;  5CNW A;  2DIY A;  3V1W A;  4XS1 A;  5KN3 A;  2HRA A;  3M3M A;  3KH9 A;  4HUA A;  3VFI A;  5KN2 A;  3DGQ A;  4OCF A;  4K7O A;  3HVX A;  1TK0 B;  1UC7 A;  1WE0 A;  1EZK A;  1F37 A;  1VF1 A;  5G2Z A;  3TUE A;  3WGD A;  5CP1 A;  2H0I A;  4GST A;  1PKZ A;  2VLV A;  2DJJ A;  4MAB A;  3M9J A;  2G0F A;  1GTU A;  5F07 A;  2H6X A;  4QMK A;  3IPZ A;  2OA7 A;  1O6J A;  4EC0 A;  3TKS C;  2QKE A;  2YWO A;  3M8N A;  4PGT A;  4BVY A;  3UAR A;  3LEF A;  3EU3 A;  3GUR A;  3IRA A;  5COH A;  2CAQ A;  2AYT A;  3EU4 A;  1ZCP A;  1A8L A;  1Z5Y E;  1YJ6 A;  1K3Y A;  4ZIL A;  2CZ2 A;  3FMW A;  4RQX A;  3QAG A;  4XRD A;  2IFQ B;  2VD0 A;  1E2Y A;  1QGV A;  4LA1 A;  2H1L A;  4IBP A;  4AJ7 A;  1FB6 A;  1DE1 A;  2GST A;  2YWI A;  1HD2 A;  2JU5 A;  3DVW A;  3HJP A;  3LGC A;  1SK2 A;  4KDY A;  3C73 A;  2VUP A;  1LBK A;  3EWL A;  2K18 A;  3U6V A;  2OAC A;  6GSY A;  2YAN A;  3F4T A;  2YWM A;  2HZF A;  1OC9 A;  5A5H A;  4MZW A;  2KOK A;  6GSS A;  1TOF A;  1B4Q A;  4KB3 A;  3ZL5 A;  3EVI A;  1MDK A;  1THO A;  5IMD A;  1U3I A;  3FK8 A;  4IJI A;  5DVB A;  1PN0 A;  2M80 A;  1SL0 B;  5ID2 B;  2K6V A;  3EPT A;  3W6G A;  4L5L A;  2REM A;  2VO4 A;  2YZU A;  3FW2 A;  2C4J A;  4CHS A;  1XVW A;  1M9B A;  2WRT A;  2H8L A;  2WS2 A;  5J4Y A;  5AIV A;  4ZB7 A;  4J2F A;  3P7X A;  3KMO A;  4E8H A;  2GSR A;  2V1M A;  3BJ5 A;  1A2L A;  1H4O A;  3VWX A;  3HCZ A;  3SBC A;  3TKQ A;  4RI7 A;  2R0G A;  1WIK A;  2LNS A;  5GAN D;  4XS6 A;  2C3T A;  2NTO A;  4WR4 A;  3CRU A;  4ZIJ A;  2C0G A;  3UBK A;  1TK5 B;  1G7E A;  4KCE A;  3Q6O A;  3O3T A;  10GS A;  4Q5R A;  4ECB A;  1Q4J A;  2VCW A;  4XHM A;  1V2A A;  1J08 A;  4MJE A;  3FR9 A;  1TRW A;  3LJR A;  2PER A;  1Q98 A;  2H76 A;  3CRT A;  4LL4 B;  20GS A;  1HNB A;  4MJB A;  3VPQ A;  4NHW A;  1XW6 A;  2QA1 A;  3DIE A;  4KSM A;  4MZC A;  1E6B A;  1XXU A;  2MZC A;  3K8N A;  4CW9 A;  4V2L A;  4PQI A;  2R4V A;  1O73 A;  1T8E B;  1PL1 A;  1AQX A;  1U6T A;  5BRT A;  3FZ4 A;  3US3 A;  2IMF A;  4K6X A;  2HZE B;  3TRP A;  2VL3 A;  2L6C A;  3HVV A;  1O81 A;  4EIQ A;  1Y1U A;  3UAP A;  2WDU A;  5IO0 A;  1Z3E A;  4HJ2 A;  3ERG A;  5AIS A;  3CSH A;  1ILO A;  4ICY A;  4DSQ A;  3FYG A;  1BED A;  3L9V A;  5A1N A;  5D96 A;  1K0N A;  1JLW A;  1ZYP A;  2GT5 A;  4NV5 A;  3BCI A;  4TR4 A;  1SK0 A;  1OE8 A;  5ECQ B;  4YAV A;  1S3C A;  5GAP D;  2YJ7 A;  6GST A;  1OAZ A;  2NDO A;  1N2A A;  4EKZ A;  4QL9 A;  4PUR A;  5EY6 A;  2KLX A;  2YWN A;  3GX8 A;  4XS4 B;  4N3Z A;  2X99 A;  5BMU A;  4X4J A;  2A2S A;  3TJG A;  2GZP A;  1I5G A;  1YEX A;  4Q5N A;  2HXK A;  3CTF A;  3RPP A;  4ML1 A;  2KP1 A;  1SKW B;  5DQS A;  4BPY A;  2CV4 A;  3A2V A;  1M99 A;  1OVN A;  3CMI A;  2KP2 A;  3RBT A;  1ZL9 A;  2GQL A;  4EVM A;  3G7I A;  3QFB C;  1PN9 A;  3ISO A;  3KP9 A;  3EYT A;  3D5J A;  3UIW A;  3GUS A;  5HQP A;  2KHP A;  3TDG A;  3ZLP A;  1ERV A;  1J0F A;  2R37 A;  1C72 A;  4AI6 A;  1S3A A;  4POM A;  1V40 A;  3IHQ A;  4FQU A;  1FVK A;  1GSS A;  1SYX A;  4K7N A;  1AIU A;  4ECC A;  2EC4 A;  2PBJ A;  5J5N A;  2J9H A;  4KAE A;  2LQO A;  5IM9 A;  1SEN A;  4ZXG A;  2M46 A;  3LQ7 A;  4BWQ A;  2NBS A;  2JSY A;  2C0D A;  2MBS A;  4MDC A;  2FLS A;  1T00 A;  1TI3 A;  1ACV A;  1WWJ A;  2IWT A;  5IOX A;  1ON4 A;  1GP1 A;  2UV8 G;  1GUK A;  2RM5 A;  1ERU A;  4HJM A;  4PQH A;  3CSI A;  3IBH A;  1K0A A;  4K9Z A;  3TKS A;  3CWG A;  5CRD A;  3QOU A;  2A2R A;  2HFD A;  4J56 E;  2E2G A;  4V2N A;  2VOC A;  4K2D A;  1BX9 A;  2X4A A;  3LYK A;  1O8W A;  3F0I A;  1I9D A;  2VAF A;  3KXO A;  4WBJ A;  3LOR A;  2ON7 A;  1AXD A;  3ZTL A;  18GS A;  1T4Z A;  1RQM A;  3PH9 A;  2P31 A;  1DE2 A;  1MDI A;  2YP6 A;  1EGR A;  3IDV A;  3W8J A;  1SL2 B;  4MK3 A;  2R2J A;  4O92 A;  4YQM A;  4WR5 A;  2VM1 A;  1ZMA A;  1XVQ A;  3P2A A;  3MIX A;  2WZ9 A;  2HSN A;  3G9B A;  2I9H A;  1GNW A;  1A2M A;  3ZRE A;  1VF2 A;  2L59 A;  8GSS A;  9GSS A;  3IXR A;  2HSM B;  1ZYN A;  2HI7 A;  2RUF A;  4RQR A;  2R0P A;  2DJ1 A;  3D6I A;  4OO5 A;  1FW1 A;  1TRV A;  2FA4 A;  1XWA A;  2H1A A;  4ZBD A;  4XTS A;  2H0G A;  3DWV A;  3VUR A;  2FWH A;  2N5A A;  3GH9 A;  3GKN A;  4YQV A;  3C1R A;  5JCU A;  3NZN A;  5DAL A;  1EP8 A;  1F2E A;  1JZD A;  4HI7 A;  4FYU A;  4YQU A;  1PX6 A;  4K5S A;  5D73 A;  1GSU A;  2F8A A;  2LKU A;  4IEL A;  2GGT A;  2A4H A;  3QAV A;  1GSQ A;  1N8J A;  2YOI A;  5ECI B;  3DVX A;  5DDL A;  1M2D A;  2XBI A;  1KTE A;  3MNG A;  2DJK A;  3TJF A;  2ZUP A;  2ON5 A;  4EUY A;  3HY2 A;  2QA2 A;  3QPM A;  4TKY A;  2MYG A;  3Q19 A;  3GTU A;  3H93 A;  2XC2 A;  5DJL A;  3MYD A;  3ME8 A;  4D73 A;  3FZ5 A;  5H5S A;  1UVZ A;  1NW2 A;  2C3Q A;  2GT6 A;  3ZVJ D;  4K1F A;  4TXO A;  3A5I A;  1BQ7 A;  2K8S A;  5ELG A;  5F0G A;  1GLP A;  5DAK B;  5KEJ A;  1SVO A;  1SKR B;  3U5R E;  3HD5 A;  4HOJ A;  5LD0 A;  5B6M A;  2DJ3 A;  5F8B A;  1TKD B;  5IMC A;  2R6K A;  2OBI A;  4KDX A;  3I6A A;  5EL8 A;  2OBK A;  5C04 A;  5CRG A;  5A34 A;  2JL4 A;  3TJK A;  2LRC A;  4IHU A;  1GNE A;  1FHE A;  4HQZ A;  3IC4 A;  1V57 A;  3I43 A;  4F0B A;  1EEM A;  1NM3 A;  5GSS A;  3LW9 A;  5FHI A;  4KH7 A;  1XIY A;  3APS A;  4X1U A;  2HRK B;  3KMN A;  4AKG A;  5G1K A;  3KGK A;  2OE1 A;  4BA7 A;  1TU8 A;  3LYP A;  1S3D A;  3ME7 A;  4TR3 A;  5LNK e;  1T4Y A;  2B6M A;  2HSH A;  1M7T A;  1NHO A;  2V6K A;  2L6D A;  2AUV A;  2C0E A;  4NMU A;  4MZB A;  2OKA A;  3WD6 A;  3F9U A;  1U88 A;  2FCH A;  3ZMK A;  2I1U A;  1PRX A;  2CVB A;  1GH2 A;  3HZ8 A;  4XRA A;  1QXH A;  4ZL8 A;  5FWG A;  3GN3 A;  3E9J B;  1B8X A;  2HE3 A;  16GS A;  4E68 A;  1BJX A;  4BVX A;  4IP1 A;  3QCP A;  4N11 A;  2GTU A;  4AKI A;  3UVT A;  1T7P B;  1YKC A;  3ZVJ A;  1OYJ A;  3VPT A;  1TRU A;  5D9V A;  2YCD A;  4FH8 A;  2F8F A;  1PL2 A;  1HQO A;  1XOB A;  4F2I A;  2GQK A;  2I3Y A;  3KP8 A;  1RK4 A;  5KOW A;  3RHC A;  4KND A;  4W66 A;  2AAW A;  3IA1 A;  1FO5 A;  5JWR B;  3ZYW A;  4BVY B;  5JCG A;  5A4W A;  1URM A;  1SJI A;  2FWE A;  3GSS A;  1YF1 A;  3TKP A;  2GS3 A;  4MJA A;  4O32 A;  3TOU A;  2H72 A;  2GVP A;  1FOV A;  4GQC A;  1BF5 A;  3R3E A;  1XWB A;  5HR2 A;  1XBS A;  5DCH A;  1XCC A;  4MF7 A;  5IIZ A;  1K0B A;  4ACS A;  4GRF A;  1Z7R A;  12GS A;  3E0U A;  1CQH A;  2C1Y A;  4BWS A;  2VL2 A;  1TRS A;  2H30 A;  1QMV A;  3VWU A;  3VI5 A;  1O85 A;  3IK7 A;  3CYN A;  2BMX A;  2H6Z A;  4MF5 A;  5ECR B;  3IOS A;  4LL1 B;  1ABA A;  5IO2 A;  2HNL A;  1BG5 A;  1T3B A;  4EO3 A;  4XIH A;  3FY7 A;  1R4W A;  1MD3 A;  4QQ7 A;  1V9W A;  1VRS D;  4TXV A;  4CDO A;  2CAI A;  2FHE A;  3ZFL A;  1PMT A;  4EDY A;  3BOA A;  3GNJ A;  4G19 A;  4KW6 A;  5ABR A;  2LRT A;  2R0C A;  5G31 A;  1OC9 B;  1AAZ A;  5A5H B;  2B7K A;  2GSS A;  2FNO A;  3HMJ G;  3IAM 2;  1SL1 B;  2VLU A;  3VI7 A;  4BL7 A;  2HZE A;  3A5W A;  1TTZ A;  2AV4 A;  2PPT A;  1XWK A;  2C80 A;  3VWV A;  3FZA A;  2X8G A;  4TR0 A;  1X9M B;  1K3O A;  5IMA A;  4Q5Q A;  1XFL A;  1USB A;  5H5R A;  3J7Y k;  2R5G A;  1JFU A;  2VCZ A;  1JHB A;  3RHB A;  1K0O A;  1FAA A;  4MMM A;  2H75 A;  3F6D A;  13GS A;  3ED3 A;  2DMM A;  1ERT A;  1PA3 A;  1X9S B;  1KBN A;  4AF2 A;  2K8V A;  3GRX A;  1WJK A;  3VWW A;  3GA4 A;  1TP9 A;  4JE1 A;  3ZIT A;  2E2M A;  2VCV A;  3R2Q A;  2XPE A;  1K3L A;  3F3R A;  4IP6 A;  2NPB A;  1SD8 A;  4JZQ A;  2QSI A;  2ZNM A;  5J9C A;  1V58 A;  1GUL A;  1A0F A;  4ZL7 A;  5A4V A;  4HZ4 A;  2B5X A;  2GDR A;  5JWQ B;  2IME A;  4J57 E;  4TVE A;  1X0R A;  1F9M A;  4KSO A;  1X5E A;  3GKM A;  3APQ A;  2VCX A;  3ZFB A;  4L0U A;  4KCA A;  4WXT A;  2H1G A;  4AGS A;  4FO5 A;  2IIY A;  3C71 A;  5ECS A;  3Q74 A;  1HNA A;  4KDU A;  2I81 A;  4NHZ A;  5G5E A;  2M72 A;  1SD9 A;  1JZW A;  4IGJ A;  2FY6 A;  4IW9 A;  2CA8 A;  5J3R A;  1TDI A;  3F4R A;  2N5B A;  2WJU A;  4MPF A;  4ZB9 A;  1GRX A;  1PQN A;  2WFC A;  2ZCT A;  5A1N B;  1WMJ A;  1K0M A;  3L78 A;  4A5P A;  2WUL A;  5HR1 A;  1W89 A;  1YZX A;  1WRY A;  4GLT A;  5HFI A;  1TJD A;  1A24 A;  2IN3 A;  3EC3 A;  2TRX A;  5ECM B;  5IQY A;  3ZML A;  2FWG A;  2DIZ A;  5A5K A;  4O5U A;  2OAD A;  2FUG 2;  3EUR A;  3FRC A;  3UOM A;  19GS A;  2VL2 C;  2X49 A;  4I2U A;  3I9V 2;  2BTO T;  2B1K A;  1KEB A;  1GWC A;  2O7K A;  1SJZ A;  2IMD A;  1B48 A;  1F6M C;  1Z6N A;  2CVD A;  4IVF A;  3WGX A;  5BMU B;  4K0G A;  2GZY A;  1YEP A;  2EIR A;  2VLT A;  4JU5 A;  1ST9 A;  3TOT A;  1OC8 A;  3DEX A;  4NPB A;  2DBC A;  2LUS A;  3TGZ A;  4MJC A;  3PR8 A;  2LNT A;  4HDE A;  3ERF A;  3Q18 A;  1TXX A;  5B8A A;  3MDK A;  3LWA A;  2AJQ B;  4JBB A;  4K5R A;  1X5D A;  4X0X A;  1VF4 A;  1G0T A;  4HQS A;  2EIQ A;  4TR1 A;  3UL3 A;  5A4U A;  2B1L A;  2XBQ A;  2CX3 A;  2RM6 A;  2JAD A;  3O6T A;  4G9H A;  2GZZ A;  1M2B A;  3FZ9 A;  1UA5 A;  3IV4 A;  1OKD A;  4KF9 A;  4ECJ A;  5EPF A;  2IPA A;  3GFK A;  2QGV A;  2L5L A;  2PWJ A;  1YQ1 A;  2AB6 A;  5H5Q A;  3WGE A;  3H8Q A;  5HFG A;  6GSX A;  3G7J A;  5AN1 A;  2CZ3 A;  5ECL B;  5ECH B;  3WT1 A;  2VM2 A;  4PUF C;  4PTS A;  6GSV A;  4EIP A;  1F3A A;  4ILF A;  2I4A A;  3QDN A;  2FD3 A;  1R5A A;  2A2P A;  4AKH A;  6GSU A;  1VGL A;  5CO3 A;  3TKS E;  3HJM A;  1GUM A;  4HS1 A;  1LU4 A;  1JZR A;  2HLS A;  3BD2 A;  2X8H A;  3KIJ A;  4KA0 A;  2EFE A;  2HRN A;  4POK A;  2VCQ A;  3L0H A;  3D22 A;  2JZS A;  4XCS A;  4EXJ A;  1ZYE A;  2L4Q A;  5CRW A;  4MLY A;  5AIX A;  4CY8 A;  5CYY A;  4V2M A;  2DJ0 A;  1Z7P A;  4G2E A;  3IK9 A;  2BJX A;  4IJ3 A;  1NHY A;  5AGY A;  5KN1 A;  11GS A;  1HNC A;  2CT6 A;  2L57 A;  2C0F A;  1M2A A;  4USS A;  2H1D A;  1PD2 1;  2MMO A;  1H75 A;  3FHK A;  4Z7X A;  2VD1 A;  2JSZ A;  2HQT A;  4MCU A;  2PVO C;  1PKW A;  1Y6E A;  2HSN B;  4L5O A;  5D93 A;  3PPU A;  4YKF A;  1GLQ A;  1THX A;  4I5Q A;  1GSY A;  5ENU A;  5G5F A;  1TI1 A;  4PX1 A;  1JZO A;  1YF0 A;  2R3X A;  22GS A;  4IN0 A;  2WB9 A;  1VF3 A;  3D0Z A;  4DSS A;  1EGO A;  3EIN A;  4YKG A;  4HEA 2;  1W4V A;  3KTL A;  4ZL9 A;  3A2X A;  2K9F A;  4N0V A;  1SKS B;  2D2Z A;  5IMZ A;  2O89 A;  2YZH A;  3IHG A;  1GL8 A;  4GQF A;  5DAL B;  3KCM A;  17GS A;  1X5C A;  3HJO A;  1XW9 A;  2V6O A;  4HU7 A;  4Z2T A;  1LJR A;  2P5R A;  2LQQ A;  2MMZ A;  2HRK A;  5D9T A;  2VIM A;  4N0Z A;  3GYK A;  3QFA C;  1FB0 A;  1EV9 A;  2H70 A;  4YH2 A;  3F4S A;  1MDJ A;  2KUC A;  5B8B A;  5CAX A;  1SYR A;  3QD9 A;  4PXO A;  5D9X A;  3A3T A;  1FVJ A;  4IQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...