4IW9A

Crystal structure of glutathione s-transferase mha_0454 (target efi-507015) from mannheimia haemolytica, gsh complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
210
structure length
210
Chain Sequence
SMKLYGLTGACSFVPHVALEWVKLRANQDYAFQAVSREFIKSAEYLALNPRGNVPLLVDGDLALTQNQAIVHYLDELYPEAKLFGSKTARDKAKAARWLAFFNSDVHKSFVPLFRLPSYAEGNETLTKTIRQQSAEQILEQLAFANAHLENHIFFGEEISVADAYLYIMLNWCRLLGLDFSHLSQLSAFMQRVEADQGVDNVREQEGLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Probable Glutathione S-Transferase Mha_0454 (Target Efi-507015) from Mannheimia Haemolytica
rcsb
molecule keywords Glutathione transferase
molecule tags Transferase
source organism Mannheimia haemolytica phl213
total genus 76
structure length 210
sequence length 210
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4iw9A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4iw9A01
3L9UA 4F03A 4EL1A 5C00A 3UL3A 4E8EA 2DJ0A 3PGTA 4KNDA 3BBYA 1XVQA 5ECPB 1SENA 5ECNB 4NPBA 5AISA 4TR1B 2IMEA 2WZ9A 3KCMA 1FW1A 2C0DA 1PL2A 3F3RA 3KJYA 3H93A 2XPDA 3O3TA 1BX9A 11GSA 3C1RA 1SL0B 4D73A 1Z5YE 2FA8A 1S3CA 5E59A 2FA4A 4F82A 3IK9A 2M46A 2C8UA 2PERA 1DE1A 4OMVA 1HNAA 1X9WB 2YWOA 4K7OA 2CVBA 1TDIA 4BVYA 2H1GA 2VOCA 4I8BA 1SK1A 2R3XA 3N9JA 4IGJA 2JACA 3Q18A 3F6FA 4KCEA 2GTUA 4RI7A 3FY7A 4EUYA 5G1KA 4GF0A 1JFUA 3CSIA 1DBYA 2G0FA 3GH6A 3IC4A 1R26A 3E0UA 4G19A 3FRCA 3ZIJA 2VL3A 1OYJA 13GSA 5IM9A 1GTUA 3F4TA 4XS4B 1GSSA 1JHBA 5J9CA 1EWXA 2PN8A 2HXKA 2CX4A 2R6KA 2XBQA 1ZGNA 1XWAA 4N11A 3KTLA 3M3MA 1YDKA 4TR1A 14GSA 1K0NA 2ALBA 6GSSA 4EC0A 3HKRA 2GSRA 2MMAA 4WETA 4JBBA 1XCCA 4P3YB 4FO5A 3Q19A 1YEPA 4PQHA 3TKRA 2AJQB 1B48A 1B8XA 3LYKA 3MAKA 4X0XA 3BOAA 3TKSC 1X9MB 5GZZB 1SU9A 3SWLA 3FYGA 2P31A 3FZ5A 3PINA 1R5AA 2B1LA 4G0KA 3IOSA 3TRPA 4OO5A 1NW2A 1G7OA 5ECOB 2CAIA 4KAEA 2LRTA 4EDYA 5D96A 5HR0A 4K7NA 5FHIA 5DAKB 4I5QA 4ZBBA 2M80A 1KNGA 4G9HA 4V1Ap 3IV4A 1PX7A 5IO2A 2PUKC 3IPZA 1SK0A 3VURA 3ZVJD 1TRUA 2L4QA 4FIWA 3TDGA 3WYWA 4MJEA 2P5QA 4FYCA 3GTUA 4F9ZA 4IJ3A 5KN0A 1I5GA 6GSTA 5ELGA 4N10A 4TVEA 4JR4A 2VAFA 4MABA 1SJIA 1R5PA 1OKTA 1FB6A 3FW2A 5HR2A 4ISDA 2C80A 1THOA 4AF2A 2LQOA 1A8LA 3ED3A 2PBJA 5EY6A 1OKDA 2MMOA 2GGTA 1HYUA 2L57A 1TRSA 4GSSA 2KP2A 3CRUA 3ZRDA 3Q74A 10GSA 3IC8A 1M9AA 1XWBA 5ECSA 4MZWA 3ZFBA 2EIQA 4LL1B 3TJGA 4EE0A 1YEXA 3RPNA 2FWGA 1OC9B 6GSYA 2KOKA 4BPYA 2B3SA 1O73A 2VCXA 3EINA 2NBSA 1GNEA 1JLVA 2B5XA 4ZBAA 5LD0A 5J4UA 2MYGA 1N8JA 5G31A 1K3YA 3LG6A 1T4YA 1F37A 4HJ2A 8GSSA 1G7EA 1OE8A 5C04A 2B7JA 1U3IA 1Q4JA 1T4ZA 4NHZA 3HD5A 5F07A 3TJFA 4HJMA 3RPPA 1DUGA 3HVXA 3RBTA 2YCDA 3MSZA 1TU8A 5J3RA 1GWCA 1ERUA 3FR3A 1NHOA 2YV7A 1Z3EA 4ULXA 3D4MA 4PUAA 2DIYA 3HXSA 5ECQB 2REMA 5ECIB 1ABAA 2NDOA 2XHFA 2DC5A 3BCIA 4KE3A 1XZOA 2GZPA 3O6TA 2FY6A 1JZDA 5D93A 4GSNA 1XOBA 1GLPA 1BJXA 1XIYA 2VIMA 3EYTA 4BL7B 3KD0A 3FKFA 4IP1A 3L0HA 3UIWA 1EP7A 1Z7RA 2V1MA 1QK8A 5KN3A 2HSYA 4I6XA 3VWUA 4WBJA 4HOJA 4HDEA 3CYNA 2K9FA 5DALB 2OE0A 3GX8A 2F8AA 2H73A 4DSSA 3Q6OA 2XPEA 1GSQA 2IMKA 4TW5A 3TCOA 4MJCA 3IR4A 2VLVA 3VWVA 1MDIA 2LJRA 1G6YA 1J9BA 3C71A 5DCGA 3QAVA 3VPTA 1NHYA 3M8NA 6GSXA 1YF1A 3F6DA 3A5WA 4MZCA 2DLXA 2L6DA 4PUFC 3EU3A 4GWRA 4QL9A 1OC8A 2GVPA 3US3A 5CO3A 2KUCA 3UMAA 1W4VA 3J7Yb 4DEJA 5G30A 1MD4A 2B6MA 1A2MA 1T8EB 2E2MA 2K6VA 2YZHA 1HNCA 1K0MA 5DDLA 4WEYA 1E6BA 1O85A 3F4SA 3NIVA 9GSSA 5F8BA 4EF0A 4EKZA 1NM3A 3LWAA 3GFKA 3ZL5A 2HZEA 5H5SA 4KCAA 2LTKA 2O85A 1FB0A 4MA9A 5G2ZA 1LU4A 5DALA 4TXVA 1T1VA 1GSYA 2D2ZA 3VWXA 2IMDA 1WWJA 2L5OA 5ECLB 2L6CA 2L5LA 4AGSA 1ZYEA 4TR0A 4POKA 3RAZA 1FO5A 1ST9A 4F2IA 4JEDA 2A2SA 4IQAA 4LL4B 5CP1A 2CAQA 4J56E 2DBCA 1TI1A 1YF0A 2WCIA 3TJKA 4JRRA 2HZFA 3WD6A 4POBA 2A4VA 1UC7A 4MF6A 5LNKe 2H1AA 5COHA 5A5KA 1GTBA 3MDKA 4O5RA 4TR4A 1AXDA 4PNGA 3VFIA 3QFBC 2LRCA 1J0FA 3RDWA 4NV5A 4F0BA 3MNGA 4JU5A 1Y6EA 3G7YA 3HVSA 5HFKA 3F9UA 1MEKA 1H75A 4BVXB 1U6TA 1ZMAA 2VLTA 1A0FA 2H72A 2VCZA 4HUAA 3QPMA 4HU7A 3R2QA 4D73B 1TKDB 4EO3A 2DMMA 1F2EA 4USSA 3L78A 1JLWA 2OJLA 2IFQA 2VL2C 2GT6A 3CSHA 4ECIA 5ABRA 1K3LA 2I4AA 3KP9A 2JADA 4BVYB 3WT1A 2K8SA 2H0HA 2WJUA 4MP4A 4MCUA 2LEGA 1OVNA 4K1FA 3IA1A 4HI7A 1UA5A 3G9BA 4X43A 4MJAA 2YPMA 3A2VA 4K9ZA 4POMA 12GSA 4ZB8A 3LORA 4WBRD 2CVDA 3U6VA 2GQMA 4ECCA 2GZYA 4NWYA 3GX0A 2LRNA 4WF5A 3DGQA 1KEBA 19GSA 5HQPA 4YQVA 6GSUA 5GAPD 5IO0A 2P0GA 4ZB9A 3QCPA 2HI7A 1X5EA 4BVXA 1TK0B 1M2AA 1SJ6A 3PH9A 3J7Yk 1XWGA 4QL7A 4QQ7A 2NTOA 5IOXA 2LSTA 2R2JA 2YWIA 1F3AA 1TK5B 5IQYA 2KLXA 3IBHA 1TOFA 1A24A 5ENUA 2H6YA 3A2XA 3APSA 2I1UA 1PRXA 3LFLA 5D9XA 1TRWA 2O87A 1M9BA 3ZVJA 3IK7A 3HJOA 4MH2A 1GSDA 1MD3A 4TR3A 2IMFA 2HNLA 2HRNA 3KTBA 3M9JA 4KGIA 5CYYA 3DD3A 3VPQA 4MK3A 5A4UA 2PU9C 1DSBA 1SJZA 1TI3A 2AYTA 4XS1A 2AV4A 3EMPA 5CNWA 3TRQA 3CMIA 2MBSA 3HDCA 4BA7A 3FZ4A 2O89A 2MZCA 2XC2A 1SYRA 2WDUA 1GUHA 4J57E 3BJ5A 1S3AA 3GTUB 4ZB6A 4OO4A 4ZL7A 4MMMA 3JCML 1XBSA 5CRWA 2FHEA 2V6OA 4HQSA 3F0IA 3QOUA 2FLSA 2C3TA 2DJ3A 2AAWA 3F4RA 1VF4A 2GQKA 2EIOA 22GSA 2FGXA 2VO4A 2GZZA 2TRCP 4G2EA 2GQLA 2HFDA 4JR6A 4ID0A 2MMNA 1T7PB 3ME7A 4WR4A 2PVOC 2LUSA 3QAGA 1UVZA 3EMXA 2QSIA 2CQ9A 1V9WA 1O8XA 5FT3A 1ERWA 2FCHA 2PWJA 2VL9A 1ILOA 3HZ4A 2HSNB 2I81A 3BCKA 5IMCA 1X5DA 2YP6A 3C7MA 2EIRA 1A2JA 3TKSA 18GSA 1M2BA 1MDKA 1E2YA 1BEDA 3EVIA 2RUFA 1HQOA 3D22A 2IJYA 2YJHA 2JSZA 3D4TA 3PPUA 4KW6A 3FZAA 1VRSD 1SD8A 3IE3A 4XS6A 1M99A 2ZCTA 5JCUA 1F9MA 1QQ2A 1Y25A 4K0NA 3LSZA 4CDOA 4O7HA 1A2LA 4ECJA 4DVCA 4IKHA 4POLA 4IW9A 1EEJA 2MMZA 4WR5A 2OE3A 4KSOA 2FWHA 1U87A 2GT5A 3GKNA 1Z9HA 3KIJA 2DJJA 5A4VA 4GQCA 3UBLA 2HRFA 2CX3A 4ZBDA 2JZSA 17GSA 3GHAA 3D21A 2GLRA 4WKWA 2VM2A 2WGRA 2WB9A 1I9DA 2VUPA 2X8HA 2WULA 2VD0A 2H1BA 4H86A 4DSSB 2I3YA 2YZUA 4K2DA 3KGKA 5H5RA 3NOFA 3GL5A 4IELA 2HSHA 1FVKA 16GSA 3F63A 5D9WA 2R37A 1JZOA 1GNWA 2ZUPA 3D5JA 2E0QA 2JZTA 2O8VB 2X99A 3A2WA 2NVLA 2CVKA 3P90A 2F9SA 1B4QA 3H4KA 1ZL9A 4KA0A 1WP0A 2GSSA 3P8WA 3W8JA 5ID2B 5DCHA 1XVWA 1NSWA 1X9SB 3UBKA 4HZ4A 3DVWA 4J2FA 2C3QA 2WS2A 4V1Ag 3K8NA 4L5OA 3HVVA 2DMLA 4YQMA 3H8QA 5JWQB 5J9BA 2VCWA 1FVJA 1GLQA 3IAS2 1J08A 3FK8A 3GIXA 2YWNA 3EWLA 3M0FA 2YOIA 3DEXA 3VLNA 1QFNA 2E2GA 1RW1A 3GSSA 1KTEA 2P5RA 3DYRA 4KDXA 1HNBA 3DIEA 4OFTA 5DBQA 5HFIA 3CSJA 2TIRA 3GKXA 1AIUA 2HZEB 1U3AA 2LS5A 4KB3A 3R3EA 1B4PA 2CZ3A 1EEMA 2LNSA 3DRNA 5IOWA 1PD21 3H1NA 4MZBA 1SKRB 1WMJA 1V98A 2NPBA 5IIZA 2H6XA 1A8YA 1SKSB 3APQA 4MPGA 2VCQA 4ZXGA 2J23A 2L4CA 2FNOA 4AJ6A 3CTFA 4YQUA 3UOMA 2LNTA 4GSTA 5GSSA 4N0ZA 4LLRA 1LJRA 4I97A 2X8GA 3VK9A 2JU5A 5ID2A 3GNJA 5HR1A 3KMNA 3L9SA 4Z7XA 1T00A 1BYEA 2H76A 5J41A 4K0GA 4MF7A 1G6WA 3ZMKA 2XBIA 3QD9A 1JZWA 1H4OA 3ZTLA 3UEMA 5B6NA 3FHKA 3HYPA 2K18A 1USBA 3CTGA 1RQMA 3HCZA 1GUMA 3ZIVA 3QFAC 3N5OA 2K8VA 2ON7A 3W8SA 4AJ8A 3EE2A 2HYXA 3GRXA 3LQ7A 2H75A 2GS3A 1YY7A 2IFQB 4HU9A 2OKAA 2GSTA 1A23A 1GP1A 3E3EA 4PNFA 2OBKA 1ON4A 2H66A 2OADA 4RQRA 1EV4A 1JZRA 4G0IA 2F51A 4KUNA 1X0RA 2HSMB 2E7PA 5IMFA 1EGOA 5AN1A 5LCZA 3I69A 1RK4A 1IYIA 1Z6NA 4IP6A 1GUKA 4GTUA 1WJKA 1B9XC 4TN8A 3G7IA 2PPTA 3KP8A 3UJ1A 3TKSE 2J9HA 1ZYQB 1V40A 4EVMA 1WRYA 4K8MA 5KN2A 4PTSA 3ZZXA 1TXXA 4WF4A 1K3OA 2VD1A 1GSEA 2GSQA 3GV1A 3L4NA 1EV9A 2H71A 3HJMA 3GSTA 2MBTA 1FAAA 5AIVA 3V1WA 4PQ1A 1FG4A 1WIKA 1LBKA 4TKYA 5G1LA 1V57A 3DVXA 1ERVA 1FHEA 1B9YC 4V2LA 2VCVA 1WE0A 3WT2A 4O32A 4O92A 2HRKB 2PGTA 4KDYA 1PQNA 3IHQA 3I6AA 1PN9A 2OBIA 2OE1A 4ML6A 1SYXA 2VLUA 1DE2A 2IIYA 4NAXA 5GAND 2HSMA 1EZKA 4IJIA 1XWCA 2RM6A 2H0GA 1S3DA 3TJBA 1AQWA 4NMUA 2JSYA 3NZNA 5H5QA 1Q98A 1XW5A 2N5BA 2ON5A 1PA3A 2C4JA 5G5EA 2C0EA 2PMTA 2YJ7A 5IMDA 1ACVA 1YKCA 3QDNA 1K0BA 2VL2A 4XCSA 4PURA 4GRFA 2HRAA 3QMXA 1EOGA 2V2GA 1YZXA 2RLIA 4MH3A 2R4VA 2JZRA 4YH2A 1QGVA 2RUEA 4PX1A 1SD9A 3GYKA 2F8FA 5CRGA 1PKWA 4NV2A 1HD2A 2HRKA 4ZIJA 4CW9A 1GTAA 2CT6A 2YWMA 5DJLA 1PX6A 4L0UA 1XXUA 2YANA 2AUVA 1URMA 1AQVA 2L59A 2C0GA 4RUVA 5L71A 1YQ1A 2YV9A 1TK8B 3LXTA 3ISOA 4I2UA 3LEFA 2HQTA 2IMIA 2QKEA 3HY2A 5HR3A 3HZ8A 2GDRA 2H0IA 4TRXA 5CAXA 4IVFA 4N30A 4L8EA 5IMVA 4K7IA 3DXBA 1WPIA 1TW9A 1U88A 4KH7A 1MTCA 3M1GA 1TRVA 1OAZA 2PVQA 7GSSA 2LJKA 3TKQA 2V32A 4ACSA 2R5GA 3IDVA 1QXHA 1G0TA 5AGYA 2FD3A 2N5FA 1X5CA 3C8EA 3PR8A 2IN3A 1QMVA 5DQYA 2YNXA 4TOPA 2A2RA 2B1KA 3OR5A 3IXRA 3TGZA 5FWGA 20GSA 3ERWA 1KBNA 3EURA 3KXOA 5KN1A 2BMXA 2IL3A 1BG5A 4MPFA 1ML6A 4HEA2 5IPGA 2FWFA 1W89A 1SL2B 3CXGA 4BWQA 3HA9A 1XFLA 3GURA 3GL3A 4GQFA 1EGRA 1CQGA 1CQHA 2ZNMA 2O7KA 2CA8A 2KP1A 1R7HA 4IQ1A 3C73A 3GA4A 2LQQA 4TXOB 2RM5A 1EOHA 4HZ2A 3EC3A 5CRHA 2OACA 4MDCA 3GKKA 2G2QA 3CBUA 5DJMA 3APOA 4XS4A 2H1DA 4EXJA 1N2AA 1GL8A 4CHSA 4FYBA 4G10A 2OA7A 2HT9A 2H6ZA 4G0LA 3C1SA 4DSRA 1O6JA 2UZ8A 1PSQA 3RHBA 1EP8A 1O7UA 1XOAA 2I9HA 1O8WA 4PQIA 1SL1B 3IRAA 3HJPA 2H19A 5DVBA 3QR6A 3A3TA 4ECBA 2FWEA 1A0RP 3VWWA 3KMOA 1V58A 1WOUA 2M72A 1VF2A 3UAPA 3TJJA 3FZ9A 2ES7A 3FR6A 5IPHA 5EVOA 3UVTA 2RIIA 5B7CA 3S9FA 4FH8A 1OC3A 5ECMB 2V41A 2YN1A 4GXZA 3VI7A 1VF1A 3LXZA 5DAKA 3TUEA 1BAYA 1Z6MA 4TXOA 3KM6A 5JCWA 1O81A 3ZLPA 5F05A 2KHPA 1AW9A 5GSTA 4YAPA 4Q5NA 4NHWA 3P2AA 1GH2A 3W6GA 3ERGA 4Q5QA 4L0WA 4PXOA 3FEUA 4IBPA 3E9JB 1GSUA 4AJ7A 5B6MA 3CRTA 1AUCA 3G7JA 4HQZA 1ZCPA 4LA1A 2C0FA 4MLYA 3IAM2 4LMWA 3KEBA 5INYA 5ELAA 3TKPA 2F3MA 2H8LA 3GN3A 4NXIA 1MDJA 2X64A 4KF9A 4DSQA 1YKAA 5G5FA 4HS1A 4GCIA 4KDUA 4XHMA 3GMFA 3M9KA 2VM1A 2N5AA 3UARA 1PKZA 3TOUA 4ILFA 2DSAA 1AAZA 3HHVA 2DJ2A 4OWYA 4FQUA 3LJRA 2B5EA 1K0OA 1OC9A 3FR9A 2DJ1A 4E8HA 3GKMA 3LYPA 5A4WA 1TJDA 1GTIA 1QUWA 4RI6A 4ZL9A 3L9VA 3DKSA 3F8UA 3WGDA 3BD2A 5ECKB 1PMTA 4N0VA 4MF5A 3KH9A 4X1UA 1F3BA 3TRXA 3O76A 2C1YA 3RHCA 4ZILA 5KEJA 1UN2A 4XIHA 3I43A 5B8BA 4Q5FA 1XWKA 3ME8A 3D0ZA 1IYHA 2FUG2 5IMZA 2TRXA 4LMVA 3P7XA 2IWTA 3QAWA 5ECRB 1PGTA 5B8AA 1XW9A 4FYUA 2LJAA 5CREA 3KZQA 2HLSA 1K0AA 4ML1A 5E4WA 2H70A 4OD7A 3ZREA 2BTOT 1GRXA 4XRDA 5D9VA 4K6XA 3ERFA 4EDZA 1ZZYA 2H30A 4GLTA 5F0GA 6GSWA 4OFNA 1FOVA 3TOTA 4MJBA 2Z9SA 2EC4A 2AHEA 4L5LA 5D9TA 4BL7A 1SKWB 3ZITA 4JE1A 1GULA 5BMUA 1ERTA 2VCTA 1VF3A 3AY8A 1ZOFA 5ECHB 4PGTA 4IS0A 2H74A 4JZQA 2JL4A 3U5RE 2CZ2A 3MWHA 5D8IA 3H79A 2HE3A 3D6IA 4XTSA 3GH9A 1SK2A 2QC7A 1GSFA 4OFMA 5AIXA 4IN0A 1BQ7A 4I2TA 1F6MC 4IHUA 4XRAA 3ZMLA 1TP9A 1XW6A 1M0UA 2B7KA 2C3NA 6GSVA 1TTZA 3VI5A 1R4WA 1M7TA 5DQSA 3LGCA 1AQXA 3I9V2 3WGXA 1AC1A 4OCEA 3KH7A 4Q5RA 3ZFLA 3F3QA 2BJXA 2LV3A 3DMLA 4YAVA 1K0CA 2LKUA 1K0DA 2B5YA 3EU4A 2WRTA 2CV4A 1YJ6A 4RQXA 2QGVA 5CRDA 5IMAA 1M2DA 4ZL8A 4WXTA 5HFGA 2AB6A 1C72A 1TU7A 5JWRB 1OE7A 4F0CA 3WGEA 5JCGA 1V2AA 5JWOB 2V6KA 5J5NA 1VGLA 3SBCA 2H01A 2IPAA 1Z7PA 4KX4A 3ZYWA 4V2MA 3DWVA 3GUSA 4KSMA 1T3BA 5EL8A 3TB2A 3UVHA 1THXA 2X8CA 5EPFA 4OCFA 2DIZA 1PL1A 1XPVA 2WFCA 4V2NA 4BWSA 5F06A 5D73A 2DJKA
chains in the Genus database with same CATH superfamily
3L9UA 4F03A 4EL1A 5C00A 3UL3A 4E8EA 2DJ0A 3PGTA 4KNDA 3BBYA 1XVQA 5ECPB 1SENA 5ECNB 4NPBA 5AISA 2H1LA 4TR1B 2IMEA 2WZ9A 3KCMA 4E68A 1FW1A 2C0DA 1PL2A 3F3RA 3KJYA 3H93A 2XPDA 3O3TA 1BX9A 11GSA 3C1RA 4AKIA 1TXUA 2OT3A 1SL0B 4D73A 1Z5YE 2FA8A 1S3CA 5E59A 2FA4A 4F82A 3IK9A 2M46A 2C8UA 2PERA 1DE1A 2X49A 4OMVA 1HNAA 1X9WB 2YWOA 4K7OA 2CVBA 1TDIA 4BVYA 2H1GA 2VOCA 4I8BA 1S4BP 1SK1A 2R3XA 3N9JA 4IGJA 2JACA 3Q18A 3F6FA 4KCEA 2GTUA 4RI7A 5J4YA 3FY7A 4EUYA 5G1KA 4GF0A 1JFUA 3CSIA 1DBYA 2G0FA 3GH6A 1Y1UA 3IC4A 1R26A 3E0UA 4G19A 3FRCA 3ZIJA 2VL3A 1OYJA 13GSA 5IM9A 1GTUA 3F4TA 4XS4B 4QMKA 1GSSA 1JHBA 2R0CA 5J9CA 1EWXA 2PN8A 2HXKA 2A4HA 2CX4A 2R6KA 2XBQA 1ZGNA 1XWAA 4N11A 4O5QA 3KTLA 3M3MA 1YDKA 4TR1A 2EFCA 14GSA 1K0NA 2ALBA 6GSSA 4EC0A 3HKRA 2GSRA 2MMAA 4WETA 4JBBA 1XCCA 4P3YB 4FO5A 3Q19A 3CHXC 1YEPA 4PQHA 3TKRA 2AJQB 1B48A 1B8XA 3LYKA 3MAKA 4X0XA 3BOAA 3TKSC 1X9MB 5GZZB 1SU9A 3SWLA 3FYGA 2P31A 3FZ5A 3PINA 1R5AA 2B1LA 4G0KA 3IOSA 3TRPA 4OO5A 1NW2A 1G7OA 5ECOB 2CAIA 4KAEA 2LRTA 4EDYA 5D96A 5HR0A 2DKIA 4K7NA 5FHIA 5DAKB 4I5QA 4ZBBA 2M80A 1KNGA 4G9HA 4V1Ap 3IV4A 1PX7A 5IO2A 2VKZG 2PUKC 3IPZA 1SK0A 3VURA 3ZVJD 1TRUA 2L4QA 4FIWA 3TDGA 3WYWA 2WW2A 4MJEA 2P5QA 4FYCA 3GTUA 4F9ZA 4IJ3A 5KN0A 1YEWC 1I5GA 6GSTA 5ELGA 4N10A 4TVEA 4JR4A 2VAFA 4MABA 1SJIA 1R5PA 1OKTA 1FB6A 3FW2A 5HR2A 4ISDA 2C80A 1THOA 4AF2A 2LQOA 1A8LA 3ED3A 2PBJA 5EY6A 1OKDA 2MMOA 2GGTA 1HYUA 2L57A 1TRSA 4GSSA 2KP2A 3CRUA 3ZRDA 3Q74A 10GSA 3IC8A 1M9AA 1XWBA 5ECSA 5A5HA 4BIKA 4MZWA 3ZFBA 2EIQA 4LL1B 3TJGA 4EE0A 1YEXA 3RPNA 2FWGA 1OC9B 6GSYA 2KOKA 4BPYA 2B3SA 1O73A 2VCXA 3EINA 2NBSA 1GNEA 1JLVA 2B5XA 1N25A 4ZBAA 5LD0A 5J4UA 2MYGA 1N8JA 5G31A 1K3YA 3LG6A 1T4YA 1F37A 4HJ2A 8GSSA 1G7EA 1OE8A 5C04A 2HSNA 2B7JA 1PFOA 1U3IA 1Q4JA 1T4ZA 4NHZA 3HD5A 5F07A 3TJFA 4HJMA 3RPPA 1DUGA 3HVXA 3RBTA 2YCDA 3MSZA 1TU8A 5J3RA 1GWCA 1ERUA 3FR3A 1NHOA 1SVOA 2YV7A 1Z3EA 4ULXA 3D4MA 4AI6A 4PUAA 2DIYA 3HXSA 5ECQB 2REMA 5ECIB 1ABAA 2NDOA 2XHFA 2DC5A 3BCIA 4KE3A 1XZOA 2GZPA 3O6TA 2FY6A 1JZDA 5D93A 4GSNA 1XOBA 1GLPA 1BJXA 1XIYA 2VIMA 3EYTA 4BL7B 2O5VA 3KD0A 3FKFA 4IP1A 3L0HA 3UIWA 1EP7A 1Z7RA 2V1MA 1QK8A 5KN3A 2HSYA 4I6XA 3VWUA 4WBJA 4HOJA 3CYNA 2K9FA 4HDEA 5DALB 5BMUB 2OE0A 3GX8A 2F8AA 2H73A 4DSSA 2O36A 3Q6OA 2XPEA 2UV8G 1GSQA 2IMKA 4TW5A 3TCOA 4MJCA 3IR4A 2VLVA 3VWVA 1YVLA 1MDIA 2LJRA 1G6YA 1J9BA 3C71A 5DCGA 2WVYA 3QAVA 3VPTA 1NHYA 3M8NA 6GSXA 1YF1A 3F6DA 3A5WA 1BF5A 4MZCA 2DLXA 2L6DA 4PUFC 3EU3A 1ZYPA 4GWRA 4QL9A 1OC8A 2GVPA 3US3A 5CO3A 2KUCA 3UMAA 3HVNA 1W4VA 3J7Yb 4DEJA 5G30A 1MD4A 2B6MA 1A2MA 1T8EB 2E2MA 2K6VA 2YZHA 1HNCA 1K0MA 5DDLA 4WEYA 1E6BA 1O85A 3F4SA 3NIVA 9GSSA 5F8BA 4EF0A 4EKZA 1NM3A 3LWAA 3GFKA 3ZL5A 2R0PA 2HZEA 5H5SA 4KCAA 2LTKA 2O85A 1FB0A 4MA9A 5G2ZA 1LU4A 5DALA 4TXVA 1T1VA 1GSYA 2D2ZA 3VWXA 2IMDA 4MNNA 1WWJA 2L5OA 5ECLB 2L6CA 2L5LA 4AGSA 5J40A 1ZYEA 4TR0A 4POKA 3RAZA 1FO5A 1ST9A 4F2IA 4JEDA 2A2SA 4IQAA 4LL4B 5CP1A 2CAQA 4J56E 2DBCA 1TI1A 1YF0A 2WCIA 3TJKA 4JRRA 2HZFA 3WD6A 4POBA 2A4VA 1UC7A 4MF6A 5LNKe 2H1AA 5COHA 5A5KA 1GTBA 3MDKA 4O5RA 4TR4A 1AXDA 4PNGA 2WZSA 3VFIA 3QFBC 2LRCA 1J0FA 3RDWA 4NV5A 4F0BA 3MNGA 4JU5A 1Y6EA 3G7YA 3HVSA 5HFKA 3F9UA 1MEKA 1H75A 4BVXB 4O5UA 1U6TA 1ZMAA 2VLTA 1A0FA 2H72A 4YKGA 2VCZA 4HUAA 3QPMA 4HU7A 3R2QA 4D73B 1TKDB 4EO3A 2DMMA 1F2EA 4USSA 4K5SA 3L78A 1JLWA 4Z2UA 2OJLA 2IFQA 2VL2C 2GT6A 3CSHA 4ECIA 5ABRA 1K3LA 2I4AA 3KP9A 2JADA 4BVYB 4AKGA 3WT1A 2K8SA 2H0HA 2WJUA 4MP4A 4MCUA 2LEGA 1OVNA 4K1FA 3IA1A 4HI7A 1UA5A 3G9BA 4X43A 4MJAA 2YPMA 3A2VA 4K9ZA 4POMA 12GSA 4ZB8A 3LORA 4CY8A 4WBRD 2CVDA 3U6VA 2GQMA 4ECCA 2GZYA 4CY6A 4NWYA 3GX0A 2LRNA 4WF5A 3DGQA 1KEBA 19GSA 5HQPA 2QA1A 4YQVA 6GSUA 5GAPD 5IO0A 2P0GA 4ZB9A 3QCPA 2HI7A 1X5EA 4K5RA 4BVXA 1TK0B 1M2AA 1SJ6A 3PH9A 3J7Yk 1XWGA 4QL7A 4QQ7A 4EIQA 2NTOA 5IOXA 2LSTA 2R2JA 2YWIA 1F3AA 1TK5B 5IQYA 2KLXA 3IBHA 1TOFA 1A24A 5ENUA 2H6YA 3A2XA 3APSA 2I1UA 1PRXA 3LFLA 5D9XA 1TRWA 2O87A 1M9BA 3ZVJA 3IK7A 3HJOA 4MH2A 1GSDA 1MD3A 4TR3A 2IMFA 2HNLA 2HRNA 3KTBA 3M9JA 4KGIA 5CYYA 3DD3A 3VPQA 4MK3A 5A4UA 2PU9C 1DSBA 1SJZA 1TI3A 2AYTA 4XS1A 2AV4A 3EMPA 5CNWA 3TRQA 3CMIA 2MBSA 3HDCA 4BA7A 3FZ4A 2O89A 2MZCA 2XC2A 1SYRA 2WDUA 4YKFA 1GUHA 4J57E 3BJ5A 1S3AA 1XG8A 3GTUB 4ZB6A 1ZYNA 4OO4A 4ZL7A 4MMMA 3JCML 1XBSA 5CRWA 2FHEA 2V6OA 4HQSA 3F0IA 3QOUA 2FLSA 2C3TA 2DJ3A 2AAWA 3F4RA 1VF4A 2WVXA 2GQKA 2EIOA 5A5HB 22GSA 2FGXA 2EFHA 2VO4A 2GZZA 2TRCP 4G2EA 2GQLA 2HFDA 4JR6A 4ID0A 1PN0A 2MMNA 1T7PB 3ME7A 4WR4A 2PVOC 2LUSA 3QAGA 1UVZA 3EMXA 2QSIA 2CQ9A 1V9WA 1O8XA 5FT3A 3RGBC 2WW0A 1ERWA 2FCHA 2PWJA 2VL9A 1ILOA 3HZ4A 2HSNB 2I81A 3BCKA 5IMCA 1X5DA 2YP6A 3C7MA 2EIRA 1A2JA 3TKSA 18GSA 1M2BA 1MDKA 1E2YA 1BEDA 3EVIA 2RUFA 1HQOA 3D22A 2IJYA 2YJHA 2JSZA 3D4TA 3PPUA 2WW3A 4KW6A 3FZAA 1VRSD 1SD8A 3IE3A 4XS6A 1M99A 2ZCTA 5JCUA 1F9MA 1QQ2A 1Y25A 4K0NA 3LSZA 5A34A 4CDOA 4O7HA 1A2LA 4ECJA 4DVCA 4IKHA 2DKHA 4POLA 4IW9A 1EEJA 2MMZA 4WR5A 2OE3A 4KSOA 2FWHA 1U87A 3IHGA 2GT5A 5BRTA 4AKXB 3GKNA 1Z9HA 3KIJA 2DJJA 5A4VA 4GQCA 3UBLA 2HRFA 2CX3A 4ZBDA 2JZSA 17GSA 3GHAA 3D21A 2GLRA 4WKWA 4FXYP 2VM2A 2WGRA 1BG1A 2WB9A 1I9DA 2VUPA 2X8HA 2WULA 3A5IA 2VD0A 2H1BA 4H86A 3RFRC 4DSSB 2I3YA 2YZUA 4K2DA 3KGKA 5H5RA 3NOFA 3GL5A 4IELA 2HSHA 1FVKA 16GSA 3F63A 5D9WA 2R37A 1JZOA 1GNWA 2ZUPA 3D5JA 2E0QA 2JZTA 2O8VB 2X99A 3A2WA 2NVLA 2CVKA 3P90A 2F9SA 1B4QA 3H4KA 1ZL9A 4KA0A 1WP0A 2GSSA 3P8WA 3W8JA 5ID2B 5DCHA 1XVWA 1NSWA 1X9SB 3UBKA 4HZ4A 3DVWA 4J2FA 2C3QA 2WS2A 4V1Ag 3K8NA 4L5OA 3HVVA 2DMLA 4YQMA 3H8QA 5JWQB 5J9BA 2VCWA 1FVJA 1GLQA 4PI0C 3IAS2 1J08A 3FK8A 3GIXA 2YWNA 3EWLA 3M0FA 2YOIA 3DEXA 3VLNA 1QFNA 2E2GA 1RW1A 3GSSA 1KTEA 2P5RA 3DYRA 4KDXA 5J4VA 1HNBA 3DIEA 4OFTA 5DBQA 5HFIA 3CSJA 2TIRA 3GKXA 1AIUA 2HZEB 1U3AA 4G01A 2LS5A 4HSCX 4X4JA 4KB3A 3R3EA 1B4PA 2CZ3A 1EEMA 2LNSA 3DRNA 5IOWA 1PD21 3H1NA 4MZBA 1SKRB 1WMJA 1V98A 2NPBA 5IIZA 2H6XA 1A8YA 1SKSB 3APQA 4MPGA 2VCQA 4ZXGA 2J23A 3TU3B 2L4CA 2FNOA 4AJ6A 3CTFA 4YQUA 3UOMA 2R0GA 2LNTA 4GSTA 5GSSA 4N0ZA 4LLRA 4EIPA 4N3ZA 1LJRA 4I97A 2X8GA 3VK9A 2JU5A 5ID2A 3GNJA 5HR1A 3KMNA 3L9SA 4Z7XA 1T00A 1BYEA 2H76A 5J41A 4K0GA 4MF7A 1G6WA 3ZMKA 2XBIA 3QD9A 1JZWA 1H4OA 1SVLA 3ZTLA 3UEMA 5B6NA 3FHKA 3HYPA 2K18A 1USBA 3CTGA 1RQMA 3HCZA 1GUMA 3ZIVA 3QFAC 3N5OA 2K8VA 2ON7A 3W8SA 4AJ8A 3EE2A 2HYXA 3GRXA 3LQ7A 2H75A 2GS3A 4A5PA 1YY7A 2IFQB 4HU9A 2OKAA 3FMWA 2GSTA 1A23A 1GP1A 5A1NB 3E3EA 4PNFA 2OBKA 1ON4A 2H66A 2OADA 4RQRA 1EV4A 1JZRA 4G0IA 2F51A 4KUNA 1X0RA 2HSMB 2E7PA 5IMFA 1EGOA 5AN1A 5LCZA 3I69A 1RK4A 1IYIA 1Z6NA 4ZB7A 4IP6A 1GUKA 4GTUA 1WJKA 1B9XC 4TN8A 3G7IA 2PPTA 2QA2A 3KP8A 3UJ1A 3TKSE 2J9HA 1ZYQB 1V40A 4EVMA 1WRYA 4K8MA 5KN2A 4PTSA 3ZZXA 1TXXA 4K2XA 4WF4A 1K3OA 2VD1A 1GSEA 2GSQA 3GV1A 3L4NA 1EV9A 2H71A 3HJMA 3GSTA 2MBTA 1FAAA 5AIVA 3V1WA 4PQ1A 1FG4A 1WIKA 1LBKA 4TKYA 5G1LA 1V57A 3DVXA 1ERVA 1FHEA 1B9YC 2A2PA 4V2LA 2VCVA 1WE0A 3WT2A 4O32A 4O92A 2HRKB 2PGTA 4KDYA 5A1NA 1PQNA 3IHQA 3I6AA 1PN9A 2OBIA 2OE1A 4ML6A 1SYXA 2VLUA 1DE2A 2IIYA 4NAXA 5GAND 2HSMA 1EZKA 4IJIA 1XWCA 4GDFA 2RM6A 2H0GA 1S3DA 3TJBA 1AQWA 4NMUA 2JSYA 3NZNA 5H5QA 1Q98A 1XW5A 2N5BA 2ON5A 1PA3A 2EFEA 2C4JA 5G5EA 2C0EA 2PMTA 2YJ7A 5IMDA 1ACVA 1YKCA 3QDNA 1K0BA 2VL2A 4XCSA 4PURA 4GRFA 2HRAA 3QMXA 1EOGA 2V2GA 1YZXA 2RLIA 4MH3A 2WW1A 2R4VA 2JZRA 4YH2A 1QGVA 2RUEA 4PX1A 1SD9A 3GYKA 2F8FA 5CRGA 1PKWA 4NV2A 1HD2A 2WVXB 2HRKA 4ZIJA 4CW9A 1GTAA 2CT6A 2YWMA 5DJLA 1PX6A 4L0UA 1XXUA 2YANA 2AUVA 1URMA 1AQVA 2L59A 2C0GA 4RUVA 5L71A 1YQ1A 2YV9A 1TK8B 3LXTA 3ISOA 4I2UA 3LEFA 2HQTA 2IMIA 2QKEA 3HY2A 3MYDA 5HR3A 3HZ8A 2GDRA 2H0IA 4TRXA 5CAXA 4IVFA 4N30A 4L8EA 5IMVA 4K7IA 4AKHA 3DXBA 1WPIA 1TW9A 1U88A 4KH7A 1MTCA 3M1GA 1TRVA 1OAZA 2PVQA 7GSSA 2LJKA 3TKQA 5A34B 2V32A 4ACSA 2R5GA 3IDVA 1QXHA 1G0TA 5AGYA 2FD3A 2N5FA 1X5CA 3C8EA 3PR8A 2IN3A 2X4AA 1QMVA 1S3RA 5DQYA 4PI2C 2YNXA 4TOPA 2A2RA 2B1KA 3OR5A 3IXRA 3TGZA 5FWGA 20GSA 3ERWA 1KBNA 3EURA 3KXOA 5KN1A 2BMXA 4Z2TA 2IL3A 1BG5A 4MPFA 1ML6A 4HEA2 5IPGA 2FWFA 1W89A 1SL2B 3CXGA 4BWQA 4W66A 3HA9A 1XFLA 3GURA 3GL3A 4GQFA 1EGRA 1CQGA 1CQHA 2ZNMA 2O7KA 2CA8A 2KP1A 1R7HA 4IQ1A 3C73A 3GA4A 2LQQA 4TXOB 2RM5A 1EOHA 4HZ2A 3EC3A 5CRHA 2OACA 4MDCA 3GKKA 2G2QA 3CBUA 5DJMA 3APOA 4XS4A 2H1DA 4EXJA 1N2AA 1GL8A 4CHSA 4FYBA 4G10A 2OA7A 2HT9A 2H6ZA 4G0LA 3C1SA 4DSRA 1O6JA 3CWGA 2UZ8A 1PSQA 3RHBA 1EP8A 1O7UA 1XOAA 2I9HA 1O8WA 4PQIA 1SL1B 3IRAA 3HJPA 2H19A 5DVBA 3QR6A 3A3TA 4ECBA 2FWEA 1FOHA 1A0RP 3VWWA 3KMOA 1V58A 1WOUA 2M72A 1VF2A 3UAPA 3TJJA 3FZ9A 2ES7A 3FR6A 5IPHA 5EVOA 3UVTA 2RIIA 2WVZA 5B7CA 3S9FA 4FH8A 1OC3A 5ECMB 2V41A 2YN1A 4GXZA 3VI7A 1VF1A 3LXZA 5DAKA 3TUEA 1BAYA 1Z6MA 4TXOA 3KM6A 5JCWA 1O81A 3ZLPA 5F05A 2KHPA 1AW9A 5KOWA 5GSTA 2O3EA 4YAPA 3CQFA 4Q5NA 4NHWA 3P2AA 1GH2A 3EPTA 3W6GA 3ERGA 4Q5QA 4L0WA 4PXOA 3FEUA 3LW9A 4IBPA 3E9JB 1GSUA 4AJ7A 5B6MA 3CRTA 1AUCA 3G7JA 4HQZA 1ZCPA 4LA1A 2C0FA 4MLYA 3IAM2 4LMWA 3KEBA 1M3IA 5INYA 5ELAA 3TKPA 2F3MA 2H8LA 3GN3A 4NXIA 1MDJA 2X64A 4KF9A 4DSQA 1YKAA 5G5FA 4HS1A 4GCIA 4KDUA 4XHMA 3GMFA 3M9KA 2VM1A 2N5AA 3UARA 1PKZA 3TOUA 4ILFA 2DSAA 1AAZA 3HMJG 3HHVA 2DJ2A 4OWYA 4FQUA 3LJRA 2B5EA 1I1IP 1K0OA 3FR9A 1OC9A 2DJ1A 4E8HA 3GKMA 3LYPA 5A4WA 1TJDA 1GTIA 1QUWA 4RI6A 4ZL9A 3L9VA 3DKSA 3F8UA 3WGDA 3BD2A 5ECKB 1PMTA 4N0VA 4MF5A 3KH9A 4X1UA 1F3BA 3TRXA 3O76A 2C1YA 3RHCA 4ZILA 5KEJA 4PHZC 1UN2A 4XIHA 3I43A 5B8BA 4Q5FA 1XWKA 3ME8A 3D0ZA 1IYHA 2FUG2 5IMZA 5KOXA 2TRXA 4LMVA 3P7XA 2IWTA 3QAWA 5ECRB 1PGTA 5B8AA 1XW9A 4FYUA 2LJAA 5CREA 3KZQA 2HLSA 1K0AA 4ML1A 5E4WA 2H70A 4OD7A 3ZREA 2BTOT 1GRXA 4XRDA 5D9VA 4K6XA 3ERFA 1M3JA 5J47A 4EDZA 1ZZYA 2H30A 4GLTA 5F0GA 6GSWA 4OFNA 1FOVA 3TOTA 4MJBA 2Z9SA 2EC4A 2AHEA 4L5LA 5D9TA 4BL7A 1SKWB 3ZITA 4JE1A 4Z2RA 1GULA 5BMUA 1ERTA 2VCTA 1VF3A 3AY8A 1ZOFA 5ECHB 4PGTA 4IS0A 2H74A 4JZQA 2JL4A 3U5RE 2CZ2A 3MWHA 5D8IA 3H79A 2HE3A 3D6IA 4XTSA 3GH9A 1SK2A 2QC7A 1GSFA 4OFMA 5AIXA 4IN0A 1BQ7A 4I2TA 1F6MC 4IHUA 4XRAA 3ZMLA 1TP9A 3MIXA 1XW6A 1M0UA 2B7KA 2C3NA 6GSVA 1TTZA 3VI5A 1R4WA 1M7TA 5DQSA 3LGCA 1AQXA 3I9V2 3WGXA 4ICYA 1AC1A 4OCEA 3KH7A 4Q5RA 3ZFLA 3F3QA 2BJXA 2LV3A 3DMLA 4YAVA 1K0CA 2LKUA 1K0DA 2B5YA 3EU4A 2WRTA 2CV4A 1YJ6A 4RQXA 2QGVA 5CRDA 5IMAA 1M2DA 4ZL8A 4WXTA 5HFGA 2AB6A 1C72A 1TU7A 5JWRB 1OE7A 4F0CA 3WGEA 5JCGA 1V2AA 5JWOB 2EFDA 2V6KA 5J5NA 1VGLA 3SBCA 1SVMA 2H01A 2IPAA 1Z7PA 4KX4A 3ZYWA 4V2MA 3DWVA 3GUSA 4KSMA 1T3BA 5EL8A 3TB2A 3UVHA 1THXA 2X8CA 5EPFA 4OCFA 2DIZA 1PL1A 1XPVA 2WFCA 4V2NA 4BWSA 5F06A 5D73A 2DJKA
chains in the Genus database with same CATH topology
3L9UA 4F03A 4EL1A 5C00A 3UL3A 4E8EA 2DJ0A 3PGTA 4KNDA 3BBYA 1XVQA 5ECPB 1SENA 5ECNB 4NPBA 5AISA 2H1LA 4TR1B 2IMEA 2WZ9A 3KCMA 4E68A 1FW1A 2C0DA 1PL2A 3F3RA 3KJYA 3H93A 2XPDA 3O3TA 1BX9A 11GSA 3C1RA 4AKIA 1TXUA 2OT3A 1SL0B 4D73A 1Z5YE 2FA8A 1S3CA 5E59A 2FA4A 4F82A 3IK9A 2M46A 2C8UA 2PERA 1DE1A 2X49A 4OMVA 1HNAA 1X9WB 2YWOA 4K7OA 2CVBA 1TDIA 4BVYA 2H1GA 2VOCA 4I8BA 1SK1A 2R3XA 3N9JA 4IGJA 2JACA 3Q18A 3F6FA 4KCEA 2GTUA 4RI7A 5J4YA 3FY7A 4EUYA 5G1KA 4GF0A 1JFUA 3CSIA 1DBYA 2G0FA 3GH6A 1Y1UA 3IC4A 1R26A 3E0UA 4G19A 3FRCA 3ZIJA 2VL3A 1OYJA 13GSA 5IM9A 1GTUA 3F4TA 4XS4B 4QMKA 1GSSA 1JHBA 2R0CA 5J9CA 1EWXA 2PN8A 2HXKA 2A4HA 2CX4A 2R6KA 2XBQA 1ZGNA 1XWAA 4N11A 4O5QA 3KTLA 3M3MA 1YDKA 4TR1A 2EFCA 14GSA 1K0NA 2ALBA 6GSSA 4EC0A 3HKRA 2GSRA 2MMAA 4WETA 4JBBA 1XCCA 4P3YB 4FO5A 3Q19A 1YEPA 4PQHA 3TKRA 2AJQB 1B48A 1B8XA 3LYKA 3MAKA 4X0XA 3BOAA 3TKSC 1X9MB 5GZZB 1SU9A 3SWLA 3FYGA 2P31A 3FZ5A 3PINA 1R5AA 2B1LA 4G0KA 3IOSA 3TRPA 4OO5A 1NW2A 1G7OA 5ECOB 2CAIA 4KAEA 2LRTA 4EDYA 5D96A 5HR0A 2DKIA 4K7NA 5FHIA 5DAKB 4I5QA 4ZBBA 2M80A 1KNGA 4G9HA 4V1Ap 3IV4A 1PX7A 5IO2A 2VKZG 2PUKC 3IPZA 1SK0A 3VURA 3ZVJD 1TRUA 2L4QA 4FIWA 3TDGA 3WYWA 4MJEA 2P5QA 4FYCA 3GTUA 4F9ZA 4IJ3A 5KN0A 1I5GA 6GSTA 5ELGA 4N10A 4TVEA 4JR4A 2VAFA 4MABA 1SJIA 1R5PA 1OKTA 1FB6A 3FW2A 5HR2A 4ISDA 2C80A 1THOA 4AF2A 2LQOA 1A8LA 3ED3A 2PBJA 5EY6A 1OKDA 2MMOA 2GGTA 1HYUA 2L57A 1TRSA 4GSSA 2KP2A 3CRUA 3ZRDA 3Q74A 10GSA 3IC8A 1M9AA 1XWBA 5ECSA 5A5HA 4MZWA 3ZFBA 2EIQA 4LL1B 3TJGA 4EE0A 1YEXA 3RPNA 2FWGA 1OC9B 6GSYA 2KOKA 4BPYA 2B3SA 1O73A 2VCXA 3EINA 2NBSA 1GNEA 1JLVA 2B5XA 1N25A 4ZBAA 5LD0A 5J4UA 2MYGA 1N8JA 5G31A 1K3YA 3LG6A 1T4YA 1F37A 4HJ2A 8GSSA 1G7EA 1OE8A 5C04A 2HSNA 2B7JA 1U3IA 1Q4JA 1T4ZA 4NHZA 3HD5A 5F07A 3TJFA 4HJMA 3RPPA 1DUGA 3HVXA 3RBTA 2YCDA 3MSZA 1TU8A 5J3RA 1GWCA 1ERUA 3FR3A 1NHOA 1SVOA 2YV7A 1Z3EA 4ULXA 3D4MA 4AI6A 4PUAA 2DIYA 3HXSA 5ECQB 2REMA 5ECIB 1ABAA 2NDOA 2XHFA 2DC5A 3BCIA 4KE3A 1XZOA 2GZPA 3O6TA 2FY6A 1JZDA 5D93A 4GSNA 1XOBA 1GLPA 1BJXA 1XIYA 2VIMA 3EYTA 4BL7B 2O5VA 3KD0A 3FKFA 4IP1A 3L0HA 3UIWA 1EP7A 1Z7RA 2V1MA 1QK8A 5KN3A 2HSYA 4I6XA 3VWUA 4WBJA 4HOJA 3CYNA 2K9FA 4HDEA 5DALB 5BMUB 2OE0A 3GX8A 2F8AA 2H73A 4DSSA 3Q6OA 2XPEA 2UV8G 1GSQA 2IMKA 4TW5A 3TCOA 4MJCA 3IR4A 2VLVA 3VWVA 1YVLA 1MDIA 2LJRA 1G6YA 1J9BA 3C71A 5DCGA 3QAVA 3VPTA 1NHYA 3M8NA 6GSXA 1YF1A 3F6DA 3A5WA 1BF5A 4MZCA 2DLXA 2L6DA 4PUFC 3EU3A 1ZYPA 4GWRA 4QL9A 1OC8A 2GVPA 3US3A 5CO3A 2KUCA 3UMAA 1W4VA 3J7Yb 4DEJA 5G30A 1MD4A 2B6MA 1A2MA 1T8EB 2E2MA 2K6VA 2YZHA 1HNCA 1K0MA 5DDLA 4WEYA 1E6BA 1O85A 3F4SA 3NIVA 9GSSA 5F8BA 4EF0A 4EKZA 1NM3A 3LWAA 3GFKA 3ZL5A 2R0PA 2HZEA 5H5SA 4KCAA 2LTKA 2O85A 1FB0A 4MA9A 5G2ZA 1LU4A 5DALA 4TXVA 1T1VA 1GSYA 2D2ZA 3VWXA 2IMDA 4MNNA 1WWJA 2L5OA 5ECLB 2L6CA 2L5LA 4AGSA 5J40A 1ZYEA 4TR0A 4POKA 3RAZA 1FO5A 1ST9A 4F2IA 4JEDA 2A2SA 4IQAA 4LL4B 5CP1A 2CAQA 4J56E 2DBCA 1TI1A 1YF0A 2WCIA 3TJKA 4JRRA 2HZFA 3WD6A 4POBA 2A4VA 1UC7A 4MF6A 5LNKe 2H1AA 5COHA 5A5KA 1GTBA 3MDKA 4O5RA 4TR4A 1AXDA 4PNGA 3VFIA 3QFBC 2LRCA 1J0FA 3RDWA 4NV5A 4F0BA 3MNGA 4JU5A 1Y6EA 3G7YA 3HVSA 5HFKA 3F9UA 1MEKA 1H75A 4BVXB 4O5UA 1U6TA 1ZMAA 2VLTA 1A0FA 2H72A 4YKGA 2VCZA 4HUAA 3QPMA 4HU7A 3R2QA 4D73B 1TKDB 4EO3A 2DMMA 1F2EA 4USSA 4K5SA 3L78A 1JLWA 4Z2UA 2OJLA 2IFQA 2VL2C 2GT6A 3CSHA 4ECIA 5ABRA 1K3LA 2I4AA 3KP9A 2JADA 4BVYB 4AKGA 3WT1A 2K8SA 2H0HA 2WJUA 4MP4A 4MCUA 2LEGA 1OVNA 4K1FA 3IA1A 4HI7A 1UA5A 3G9BA 4X43A 4MJAA 2YPMA 3A2VA 4K9ZA 4POMA 12GSA 4ZB8A 3LORA 4CY8A 4WBRD 2CVDA 3U6VA 2GQMA 4ECCA 2GZYA 4CY6A 4NWYA 3GX0A 2LRNA 4WF5A 3DGQA 1KEBA 19GSA 5HQPA 2QA1A 4YQVA 6GSUA 5GAPD 5IO0A 2P0GA 4ZB9A 3QCPA 2HI7A 1X5EA 4K5RA 4BVXA 1TK0B 1M2AA 1SJ6A 3PH9A 3J7Yk 1XWGA 4QL7A 4QQ7A 4EIQA 2NTOA 5IOXA 2LSTA 2R2JA 2YWIA 1F3AA 1TK5B 5IQYA 2KLXA 3IBHA 1TOFA 1A24A 5ENUA 2H6YA 3A2XA 3APSA 2I1UA 1PRXA 3LFLA 5D9XA 1TRWA 2O87A 1M9BA 3ZVJA 3IK7A 3HJOA 4MH2A 1GSDA 1MD3A 4TR3A 2IMFA 2HNLA 2HRNA 3KTBA 3M9JA 4KGIA 5CYYA 3DD3A 3VPQA 4MK3A 5A4UA 2PU9C 1DSBA 1SJZA 1TI3A 2AYTA 4XS1A 2AV4A 3EMPA 5CNWA 3TRQA 3CMIA 2MBSA 3HDCA 4BA7A 3FZ4A 2O89A 2MZCA 2XC2A 1SYRA 2WDUA 4YKFA 1GUHA 4J57E 3BJ5A 1S3AA 3GTUB 4ZB6A 1ZYNA 4OO4A 4ZL7A 4MMMA 3JCML 1XBSA 5CRWA 2FHEA 2V6OA 4HQSA 3F0IA 3QOUA 2FLSA 2C3TA 2DJ3A 2AAWA 3F4RA 1VF4A 2GQKA 2EIOA 5A5HB 22GSA 2FGXA 2EFHA 2VO4A 2GZZA 2TRCP 4G2EA 2GQLA 2HFDA 4JR6A 4ID0A 1PN0A 2MMNA 1T7PB 3ME7A 4WR4A 2PVOC 2LUSA 3QAGA 1UVZA 3EMXA 2QSIA 2CQ9A 1V9WA 1O8XA 5FT3A 1ERWA 2FCHA 2PWJA 2VL9A 1ILOA 3HZ4A 2HSNB 2I81A 3BCKA 5IMCA 1X5DA 2YP6A 3C7MA 2EIRA 1A2JA 3TKSA 18GSA 1M2BA 1MDKA 1E2YA 1BEDA 3EVIA 2RUFA 1HQOA 3D22A 2IJYA 2YJHA 2JSZA 3D4TA 3PPUA 4KW6A 3FZAA 1VRSD 1SD8A 3IE3A 4XS6A 1M99A 2ZCTA 5JCUA 1F9MA 1QQ2A 1Y25A 4K0NA 3LSZA 5A34A 4CDOA 4O7HA 1A2LA 4ECJA 4DVCA 4IKHA 2DKHA 4POLA 4IW9A 1EEJA 2MMZA 4WR5A 2OE3A 4KSOA 2FWHA 1U87A 3IHGA 2GT5A 5BRTA 4AKXB 3GKNA 1Z9HA 3KIJA 2DJJA 5A4VA 4GQCA 3UBLA 2HRFA 2CX3A 4ZBDA 2JZSA 17GSA 3GHAA 3D21A 2GLRA 4WKWA 2VM2A 2WGRA 1BG1A 2WB9A 1I9DA 2VUPA 2X8HA 2WULA 3A5IA 2VD0A 2H1BA 4H86A 4DSSB 2I3YA 2YZUA 4K2DA 3KGKA 5H5RA 3NOFA 3GL5A 4IELA 2HSHA 1FVKA 16GSA 3F63A 5D9WA 2R37A 1JZOA 1GNWA 2ZUPA 3D5JA 2E0QA 2JZTA 2O8VB 2X99A 3A2WA 2NVLA 2CVKA 3P90A 2F9SA 1B4QA 3H4KA 1ZL9A 4KA0A 1WP0A 2GSSA 3P8WA 3W8JA 5ID2B 5DCHA 1XVWA 1NSWA 1X9SB 3UBKA 4HZ4A 3DVWA 4J2FA 2C3QA 2WS2A 4V1Ag 3K8NA 4L5OA 3HVVA 2DMLA 4YQMA 3H8QA 5JWQB 5J9BA 2VCWA 1FVJA 1GLQA 3IAS2 1J08A 3FK8A 3GIXA 2YWNA 3EWLA 3M0FA 2YOIA 3DEXA 3VLNA 1QFNA 2E2GA 1RW1A 3GSSA 1KTEA 2P5RA 3DYRA 4KDXA 5J4VA 1HNBA 3DIEA 4OFTA 5DBQA 5HFIA 3CSJA 2TIRA 3GKXA 1AIUA 2HZEB 1U3AA 4G01A 2LS5A 4X4JA 4KB3A 3R3EA 1B4PA 2CZ3A 1EEMA 2LNSA 3DRNA 5IOWA 1PD21 3H1NA 4MZBA 1SKRB 1WMJA 1V98A 2NPBA 5IIZA 2H6XA 1A8YA 1SKSB 3APQA 4MPGA 2VCQA 4ZXGA 2J23A 3TU3B 2L4CA 2FNOA 4AJ6A 3CTFA 4YQUA 3UOMA 2R0GA 2LNTA 4GSTA 5GSSA 4N0ZA 4LLRA 4EIPA 4N3ZA 1LJRA 4I97A 2X8GA 3VK9A 2JU5A 5ID2A 3GNJA 5HR1A 3KMNA 3L9SA 4Z7XA 1T00A 1BYEA 2H76A 5J41A 4K0GA 4MF7A 1G6WA 3ZMKA 2XBIA 3QD9A 1JZWA 1H4OA 1SVLA 3ZTLA 3UEMA 5B6NA 3FHKA 3HYPA 2K18A 1USBA 3CTGA 1RQMA 3HCZA 1GUMA 3ZIVA 3QFAC 3N5OA 2K8VA 2ON7A 3W8SA 4AJ8A 3EE2A 2HYXA 3GRXA 3LQ7A 2H75A 2GS3A 4A5PA 1YY7A 2IFQB 4HU9A 2OKAA 3FMWA 2GSTA 1A23A 1GP1A 5A1NB 3E3EA 4PNFA 2OBKA 1ON4A 2H66A 2OADA 4RQRA 1EV4A 1JZRA 4G0IA 2F51A 4KUNA 1X0RA 2HSMB 2E7PA 5IMFA 1EGOA 5AN1A 5LCZA 3I69A 1RK4A 1IYIA 1Z6NA 4ZB7A 4IP6A 1GUKA 4GTUA 1WJKA 1B9XC 4TN8A 3G7IA 2PPTA 2QA2A 3KP8A 3UJ1A 3TKSE 2J9HA 1ZYQB 1V40A 4EVMA 1WRYA 4K8MA 5KN2A 4PTSA 3ZZXA 1TXXA 4K2XA 4WF4A 1K3OA 2VD1A 1GSEA 2GSQA 3GV1A 3L4NA 1EV9A 2H71A 3HJMA 3GSTA 2MBTA 1FAAA 5AIVA 3V1WA 4PQ1A 1FG4A 1WIKA 1LBKA 4TKYA 5G1LA 1V57A 3DVXA 1ERVA 1FHEA 1B9YC 2A2PA 4V2LA 2VCVA 1WE0A 3WT2A 4O32A 4O92A 2HRKB 2PGTA 4KDYA 5A1NA 1PQNA 3IHQA 3I6AA 1PN9A 2OBIA 2OE1A 4ML6A 1SYXA 2VLUA 1DE2A 2IIYA 4NAXA 5GAND 2HSMA 1EZKA 4IJIA 1XWCA 4GDFA 2RM6A 2H0GA 1S3DA 3TJBA 1AQWA 4NMUA 2JSYA 3NZNA 5H5QA 1Q98A 1XW5A 2N5BA 2ON5A 1PA3A 2EFEA 2C4JA 5G5EA 2C0EA 2PMTA 2YJ7A 5IMDA 1ACVA 1YKCA 3QDNA 1K0BA 2VL2A 4XCSA 4PURA 4GRFA 2HRAA 3QMXA 1EOGA 2V2GA 1YZXA 2RLIA 4MH3A 2R4VA 2JZRA 4YH2A 1QGVA 2RUEA 4PX1A 1SD9A 3GYKA 2F8FA 5CRGA 1PKWA 4NV2A 1HD2A 2HRKA 4ZIJA 4CW9A 1GTAA 2CT6A 2YWMA 5DJLA 1PX6A 4L0UA 1XXUA 2YANA 2AUVA 1URMA 1AQVA 2L59A 2C0GA 4RUVA 5L71A 1YQ1A 2YV9A 1TK8B 3LXTA 3ISOA 4I2UA 3LEFA 2HQTA 2IMIA 2QKEA 3HY2A 3MYDA 5HR3A 3HZ8A 2GDRA 2H0IA 4TRXA 5CAXA 4IVFA 4N30A 4L8EA 5IMVA 4K7IA 4AKHA 3DXBA 1WPIA 1TW9A 1U88A 4KH7A 1MTCA 3M1GA 1TRVA 1OAZA 2PVQA 7GSSA 2LJKA 3TKQA 5A34B 2V32A 4ACSA 2R5GA 3IDVA 1QXHA 1G0TA 5AGYA 2FD3A 2N5FA 1X5CA 3C8EA 3PR8A 2IN3A 2X4AA 1QMVA 5DQYA 2YNXA 4TOPA 2A2RA 2B1KA 3OR5A 3IXRA 3TGZA 5FWGA 20GSA 3ERWA 1KBNA 3EURA 3KXOA 5KN1A 2BMXA 4Z2TA 2IL3A 1BG5A 4MPFA 1ML6A 4HEA2 5IPGA 2FWFA 1W89A 1SL2B 3CXGA 4BWQA 4W66A 3HA9A 1XFLA 3GURA 3GL3A 4GQFA 1EGRA 1CQGA 1CQHA 2ZNMA 2O7KA 2CA8A 2KP1A 1R7HA 4IQ1A 3C73A 3GA4A 2LQQA 4TXOB 2RM5A 1EOHA 4HZ2A 3EC3A 5CRHA 2OACA 4MDCA 3GKKA 2G2QA 3CBUA 5DJMA 3APOA 4XS4A 2H1DA 4EXJA 1N2AA 1GL8A 4CHSA 4FYBA 4G10A 2OA7A 2HT9A 2H6ZA 4G0LA 3C1SA 4DSRA 1O6JA 3CWGA 2UZ8A 1PSQA 3RHBA 1EP8A 1O7UA 1XOAA 2I9HA 1O8WA 4PQIA 1SL1B 3IRAA 3HJPA 2H19A 5DVBA 3QR6A 3A3TA 4ECBA 2FWEA 1FOHA 1A0RP 3VWWA 3KMOA 1V58A 1WOUA 2M72A 1VF2A 3UAPA 3TJJA 3FZ9A 2ES7A 3FR6A 5IPHA 5EVOA 3UVTA 2RIIA 5B7CA 3S9FA 4FH8A 1OC3A 5ECMB 2V41A 2YN1A 4GXZA 3VI7A 1VF1A 3LXZA 5DAKA 3TUEA 1BAYA 1Z6MA 4TXOA 3KM6A 5JCWA 1O81A 3ZLPA 5F05A 2KHPA 1AW9A 5KOWA 5GSTA 4YAPA 4Q5NA 4NHWA 3P2AA 1GH2A 3EPTA 3W6GA 3ERGA 4Q5QA 4L0WA 4PXOA 3FEUA 3LW9A 4IBPA 3E9JB 1GSUA 4AJ7A 5B6MA 3CRTA 1AUCA 3G7JA 4HQZA 1ZCPA 4LA1A 2C0FA 4MLYA 3IAM2 4LMWA 3KEBA 5INYA 5ELAA 3TKPA 2F3MA 2H8LA 3GN3A 4NXIA 1MDJA 2X64A 4KF9A 4DSQA 1YKAA 5G5FA 4HS1A 4GCIA 4KDUA 4XHMA 3GMFA 3M9KA 2VM1A 2N5AA 3UARA 1PKZA 3TOUA 4ILFA 2DSAA 1AAZA 3HMJG 3HHVA 2DJ2A 4OWYA 4FQUA 3LJRA 2B5EA 1K0OA 1OC9A 3FR9A 2DJ1A 4E8HA 3GKMA 3LYPA 5A4WA 1TJDA 1GTIA 1QUWA 4RI6A 4ZL9A 3L9VA 3DKSA 3F8UA 3WGDA 3BD2A 5ECKB 1PMTA 4N0VA 4MF5A 3KH9A 4X1UA 1F3BA 3TRXA 3O76A 2C1YA 3RHCA 4ZILA 5KEJA 1UN2A 4XIHA 3I43A 5B8BA 4Q5FA 1XWKA 3ME8A 3D0ZA 1IYHA 2FUG2 5IMZA 5KOXA 2TRXA 4LMVA 3P7XA 2IWTA 3QAWA 5ECRB 1PGTA 5B8AA 1XW9A 4FYUA 2LJAA 5CREA 3KZQA 2HLSA 1K0AA 4ML1A 5E4WA 2H70A 4OD7A 3ZREA 2BTOT 1GRXA 4XRDA 5D9VA 4K6XA 3ERFA 5J47A 4EDZA 1ZZYA 2H30A 4GLTA 5F0GA 6GSWA 4OFNA 1FOVA 3TOTA 4MJBA 2Z9SA 2EC4A 2AHEA 4L5LA 5D9TA 4BL7A 1SKWB 3ZITA 4JE1A 4Z2RA 1GULA 5BMUA 1ERTA 2VCTA 1VF3A 3AY8A 1ZOFA 5ECHB 4PGTA 4IS0A 2H74A 4JZQA 2JL4A 3U5RE 2CZ2A 3MWHA 5D8IA 3H79A 2HE3A 3D6IA 4XTSA 3GH9A 1SK2A 2QC7A 1GSFA 4OFMA 5AIXA 4IN0A 1BQ7A 4I2TA 1F6MC 4IHUA 4XRAA 3ZMLA 1TP9A 3MIXA 1XW6A 1M0UA 2B7KA 2C3NA 6GSVA 1TTZA 3VI5A 1R4WA 1M7TA 5DQSA 3LGCA 1AQXA 3I9V2 3WGXA 4ICYA 1AC1A 4OCEA 3KH7A 4Q5RA 3ZFLA 3F3QA 2BJXA 2LV3A 3DMLA 4YAVA 1K0CA 2LKUA 1K0DA 2B5YA 3EU4A 2WRTA 2CV4A 1YJ6A 4RQXA 2QGVA 5CRDA 5IMAA 1M2DA 4ZL8A 4WXTA 5HFGA 2AB6A 1C72A 1TU7A 5JWRB 1OE7A 4F0CA 3WGEA 5JCGA 1V2AA 5JWOB 2EFDA 2V6KA 5J5NA 1VGLA 3SBCA 1SVMA 2H01A 2IPAA 1Z7PA 4KX4A 3ZYWA 4V2MA 3DWVA 3GUSA 4KSMA 1T3BA 5EL8A 3TB2A 3UVHA 1THXA 2X8CA 5EPFA 4OCFA 2DIZA 1PL1A 1XPVA 2WFCA 4V2NA 4BWSA 5F06A 5D73A 2DJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L9U A;  4F03 A;  4EL1 A;  5C00 A;  3UL3 A;  4E8E A;  2DJ0 A;  3PGT A;  4KND A;  3BBY A;  1XVQ A;  5ECP B;  1SEN A;  5ECN B;  4NPB A;  5AIS A;  4TR1 B;  2IME A;  2WZ9 A;  3KCM A;  1FW1 A;  2C0D A;  1PL2 A;  3F3R A;  3KJY A;  3H93 A;  2XPD A;  3O3T A;  1BX9 A;  11GS A;  3C1R A;  1SL0 B;  4D73 A;  1Z5Y E;  2FA8 A;  1S3C A;  5E59 A;  2FA4 A;  4F82 A;  3IK9 A;  2M46 A;  2C8U A;  2PER A;  1DE1 A;  4OMV A;  1HNA A;  1X9W B;  2YWO A;  4K7O A;  2CVB A;  1TDI A;  4BVY A;  2H1G A;  2VOC A;  4I8B A;  1SK1 A;  2R3X A;  3N9J A;  4IGJ A;  2JAC A;  3Q18 A;  3F6F A;  4KCE A;  2GTU A;  4RI7 A;  3FY7 A;  4EUY A;  5G1K A;  4GF0 A;  1JFU A;  3CSI A;  1DBY A;  2G0F A;  3GH6 A;  3IC4 A;  1R26 A;  3E0U A;  4G19 A;  3FRC A;  3ZIJ A;  2VL3 A;  1OYJ A;  13GS A;  5IM9 A;  1GTU A;  3F4T A;  4XS4 B;  1GSS A;  1JHB A;  5J9C A;  1EWX A;  2PN8 A;  2HXK A;  2CX4 A;  2R6K A;  2XBQ A;  1ZGN A;  1XWA A;  4N11 A;  3KTL A;  3M3M A;  1YDK A;  4TR1 A;  14GS A;  1K0N A;  2ALB A;  6GSS A;  4EC0 A;  3HKR A;  2GSR A;  2MMA A;  4WET A;  4JBB A;  1XCC A;  4P3Y B;  4FO5 A;  3Q19 A;  1YEP A;  4PQH A;  3TKR A;  2AJQ B;  1B48 A;  1B8X A;  3LYK A;  3MAK A;  4X0X A;  3BOA A;  3TKS C;  1X9M B;  5GZZ B;  1SU9 A;  3SWL A;  3FYG A;  2P31 A;  3FZ5 A;  3PIN A;  1R5A A;  2B1L A;  4G0K A;  3IOS A;  3TRP A;  4OO5 A;  1NW2 A;  1G7O A;  5ECO B;  2CAI A;  4KAE A;  2LRT A;  4EDY A;  5D96 A;  5HR0 A;  4K7N A;  5FHI A;  5DAK B;  4I5Q A;  4ZBB A;  2M80 A;  1KNG A;  4G9H A;  4V1A p;  3IV4 A;  1PX7 A;  5IO2 A;  2PUK C;  3IPZ A;  1SK0 A;  3VUR A;  3ZVJ D;  1TRU A;  2L4Q A;  4FIW A;  3TDG A;  3WYW A;  4MJE A;  2P5Q A;  4FYC A;  3GTU A;  4F9Z A;  4IJ3 A;  5KN0 A;  1I5G A;  6GST A;  5ELG A;  4N10 A;  4TVE A;  4JR4 A;  2VAF A;  4MAB A;  1SJI A;  1R5P A;  1OKT A;  1FB6 A;  3FW2 A;  5HR2 A;  4ISD A;  2C80 A;  1THO A;  4AF2 A;  2LQO A;  1A8L A;  3ED3 A;  2PBJ A;  5EY6 A;  1OKD A;  2MMO A;  2GGT A;  1HYU A;  2L57 A;  1TRS A;  4GSS A;  2KP2 A;  3CRU A;  3ZRD A;  3Q74 A;  10GS A;  3IC8 A;  1M9A A;  1XWB A;  5ECS A;  4MZW A;  3ZFB A;  2EIQ A;  4LL1 B;  3TJG A;  4EE0 A;  1YEX A;  3RPN A;  2FWG A;  1OC9 B;  6GSY A;  2KOK A;  4BPY A;  2B3S A;  1O73 A;  2VCX A;  3EIN A;  2NBS A;  1GNE A;  1JLV A;  2B5X A;  4ZBA A;  5LD0 A;  5J4U A;  2MYG A;  1N8J A;  5G31 A;  1K3Y A;  3LG6 A;  1T4Y A;  1F37 A;  4HJ2 A;  8GSS A;  1G7E A;  1OE8 A;  5C04 A;  2B7J A;  1U3I A;  1Q4J A;  1T4Z A;  4NHZ A;  3HD5 A;  5F07 A;  3TJF A;  4HJM A;  3RPP A;  1DUG A;  3HVX A;  3RBT A;  2YCD A;  3MSZ A;  1TU8 A;  5J3R A;  1GWC A;  1ERU A;  3FR3 A;  1NHO A;  2YV7 A;  1Z3E A;  4ULX A;  3D4M A;  4PUA A;  2DIY A;  3HXS A;  5ECQ B;  2REM A;  5ECI B;  1ABA A;  2NDO A;  2XHF A;  2DC5 A;  3BCI A;  4KE3 A;  1XZO A;  2GZP A;  3O6T A;  2FY6 A;  1JZD A;  5D93 A;  4GSN A;  1XOB A;  1GLP A;  1BJX A;  1XIY A;  2VIM A;  3EYT A;  4BL7 B;  3KD0 A;  3FKF A;  4IP1 A;  3L0H A;  3UIW A;  1EP7 A;  1Z7R A;  2V1M A;  1QK8 A;  5KN3 A;  2HSY A;  4I6X A;  3VWU A;  4WBJ A;  4HOJ A;  4HDE A;  3CYN A;  2K9F A;  5DAL B;  2OE0 A;  3GX8 A;  2F8A A;  2H73 A;  4DSS A;  3Q6O A;  2XPE A;  1GSQ A;  2IMK A;  4TW5 A;  3TCO A;  4MJC A;  3IR4 A;  2VLV A;  3VWV A;  1MDI A;  2LJR A;  1G6Y A;  1J9B A;  3C71 A;  5DCG A;  3QAV A;  3VPT A;  1NHY A;  3M8N A;  6GSX A;  1YF1 A;  3F6D A;  3A5W A;  4MZC A;  2DLX A;  2L6D A;  4PUF C;  3EU3 A;  4GWR A;  4QL9 A;  1OC8 A;  2GVP A;  3US3 A;  5CO3 A;  2KUC A;  3UMA A;  1W4V A;  3J7Y b;  4DEJ A;  5G30 A;  1MD4 A;  2B6M A;  1A2M A;  1T8E B;  2E2M A;  2K6V A;  2YZH A;  1HNC A;  1K0M A;  5DDL A;  4WEY A;  1E6B A;  1O85 A;  3F4S A;  3NIV A;  9GSS A;  5F8B A;  4EF0 A;  4EKZ A;  1NM3 A;  3LWA A;  3GFK A;  3ZL5 A;  2HZE A;  5H5S A;  4KCA A;  2LTK A;  2O85 A;  1FB0 A;  4MA9 A;  5G2Z A;  1LU4 A;  5DAL A;  4TXV A;  1T1V A;  1GSY A;  2D2Z A;  3VWX A;  2IMD A;  1WWJ A;  2L5O A;  5ECL B;  2L6C A;  2L5L A;  4AGS A;  1ZYE A;  4TR0 A;  4POK A;  3RAZ A;  1FO5 A;  1ST9 A;  4F2I A;  4JED A;  2A2S A;  4IQA A;  4LL4 B;  5CP1 A;  2CAQ A;  4J56 E;  2DBC A;  1TI1 A;  1YF0 A;  2WCI A;  3TJK A;  4JRR A;  2HZF A;  3WD6 A;  4POB A;  2A4V A;  1UC7 A;  4MF6 A;  5LNK e;  2H1A A;  5COH A;  5A5K A;  1GTB A;  3MDK A;  4O5R A;  4TR4 A;  1AXD A;  4PNG A;  3VFI A;  3QFB C;  2LRC A;  1J0F A;  3RDW A;  4NV5 A;  4F0B A;  3MNG A;  4JU5 A;  1Y6E A;  3G7Y A;  3HVS A;  5HFK A;  3F9U A;  1MEK A;  1H75 A;  4BVX B;  1U6T A;  1ZMA A;  2VLT A;  1A0F A;  2H72 A;  2VCZ A;  4HUA A;  3QPM A;  4HU7 A;  3R2Q A;  4D73 B;  1TKD B;  4EO3 A;  2DMM A;  1F2E A;  4USS A;  3L78 A;  1JLW A;  2OJL A;  2IFQ A;  2VL2 C;  2GT6 A;  3CSH A;  4ECI A;  5ABR A;  1K3L A;  2I4A A;  3KP9 A;  2JAD A;  4BVY B;  3WT1 A;  2K8S A;  2H0H A;  2WJU A;  4MP4 A;  4MCU A;  2LEG A;  1OVN A;  4K1F A;  3IA1 A;  4HI7 A;  1UA5 A;  3G9B A;  4X43 A;  4MJA A;  2YPM A;  3A2V A;  4K9Z A;  4POM A;  12GS A;  4ZB8 A;  3LOR A;  4WBR D;  2CVD A;  3U6V A;  2GQM A;  4ECC A;  2GZY A;  4NWY A;  3GX0 A;  2LRN A;  4WF5 A;  3DGQ A;  1KEB A;  19GS A;  5HQP A;  4YQV A;  6GSU A;  5GAP D;  5IO0 A;  2P0G A;  4ZB9 A;  3QCP A;  2HI7 A;  1X5E A;  4BVX A;  1TK0 B;  1M2A A;  1SJ6 A;  3PH9 A;  3J7Y k;  1XWG A;  4QL7 A;  4QQ7 A;  2NTO A;  5IOX A;  2LST A;  2R2J A;  2YWI A;  1F3A A;  1TK5 B;  5IQY A;  2KLX A;  3IBH A;  1TOF A;  1A24 A;  5ENU A;  2H6Y A;  3A2X A;  3APS A;  2I1U A;  1PRX A;  3LFL A;  5D9X A;  1TRW A;  2O87 A;  1M9B A;  3ZVJ A;  3IK7 A;  3HJO A;  4MH2 A;  1GSD A;  1MD3 A;  4TR3 A;  2IMF A;  2HNL A;  2HRN A;  3KTB A;  3M9J A;  4KGI A;  5CYY A;  3DD3 A;  3VPQ A;  4MK3 A;  5A4U A;  2PU9 C;  1DSB A;  1SJZ A;  1TI3 A;  2AYT A;  4XS1 A;  2AV4 A;  3EMP A;  5CNW A;  3TRQ A;  3CMI A;  2MBS A;  3HDC A;  4BA7 A;  3FZ4 A;  2O89 A;  2MZC A;  2XC2 A;  1SYR A;  2WDU A;  1GUH A;  4J57 E;  3BJ5 A;  1S3A A;  3GTU B;  4ZB6 A;  4OO4 A;  4ZL7 A;  4MMM A;  3JCM L;  1XBS A;  5CRW A;  2FHE A;  2V6O A;  4HQS A;  3F0I A;  3QOU A;  2FLS A;  2C3T A;  2DJ3 A;  2AAW A;  3F4R A;  1VF4 A;  2GQK A;  2EIO A;  22GS A;  2FGX A;  2VO4 A;  2GZZ A;  2TRC P;  4G2E A;  2GQL A;  2HFD A;  4JR6 A;  4ID0 A;  2MMN A;  1T7P B;  3ME7 A;  4WR4 A;  2PVO C;  2LUS A;  3QAG A;  1UVZ A;  3EMX A;  2QSI A;  2CQ9 A;  1V9W A;  1O8X A;  5FT3 A;  1ERW A;  2FCH A;  2PWJ A;  2VL9 A;  1ILO A;  3HZ4 A;  2HSN B;  2I81 A;  3BCK A;  5IMC A;  1X5D A;  2YP6 A;  3C7M A;  2EIR A;  1A2J A;  3TKS A;  18GS A;  1M2B A;  1MDK A;  1E2Y A;  1BED A;  3EVI A;  2RUF A;  1HQO A;  3D22 A;  2IJY A;  2YJH A;  2JSZ A;  3D4T A;  3PPU A;  4KW6 A;  3FZA A;  1VRS D;  1SD8 A;  3IE3 A;  4XS6 A;  1M99 A;  2ZCT A;  5JCU A;  1F9M A;  1QQ2 A;  1Y25 A;  4K0N A;  3LSZ A;  4CDO A;  4O7H A;  1A2L A;  4ECJ A;  4DVC A;  4IKH A;  4POL A;  4IW9 A;  1EEJ A;  2MMZ A;  4WR5 A;  2OE3 A;  4KSO A;  2FWH A;  1U87 A;  2GT5 A;  3GKN A;  1Z9H A;  3KIJ A;  2DJJ A;  5A4V A;  4GQC A;  3UBL A;  2HRF A;  2CX3 A;  4ZBD A;  2JZS A;  17GS A;  3GHA A;  3D21 A;  2GLR A;  4WKW A;  2VM2 A;  2WGR A;  2WB9 A;  1I9D A;  2VUP A;  2X8H A;  2WUL A;  2VD0 A;  2H1B A;  4H86 A;  4DSS B;  2I3Y A;  2YZU A;  4K2D A;  3KGK A;  5H5R A;  3NOF A;  3GL5 A;  4IEL A;  2HSH A;  1FVK A;  16GS A;  3F63 A;  5D9W A;  2R37 A;  1JZO A;  1GNW A;  2ZUP A;  3D5J A;  2E0Q A;  2JZT A;  2O8V B;  2X99 A;  3A2W A;  2NVL A;  2CVK A;  3P90 A;  2F9S A;  1B4Q A;  3H4K A;  1ZL9 A;  4KA0 A;  1WP0 A;  2GSS A;  3P8W A;  3W8J A;  5ID2 B;  5DCH A;  1XVW A;  1NSW A;  1X9S B;  3UBK A;  4HZ4 A;  3DVW A;  4J2F A;  2C3Q A;  2WS2 A;  4V1A g;  3K8N A;  4L5O A;  3HVV A;  2DML A;  4YQM A;  3H8Q A;  5JWQ B;  5J9B A;  2VCW A;  1FVJ A;  1GLQ A;  3IAS 2;  1J08 A;  3FK8 A;  3GIX A;  2YWN A;  3EWL A;  3M0F A;  2YOI A;  3DEX A;  3VLN A;  1QFN A;  2E2G A;  1RW1 A;  3GSS A;  1KTE A;  2P5R A;  3DYR A;  4KDX A;  1HNB A;  3DIE A;  4OFT A;  5DBQ A;  5HFI A;  3CSJ A;  2TIR A;  3GKX A;  1AIU A;  2HZE B;  1U3A A;  2LS5 A;  4KB3 A;  3R3E A;  1B4P A;  2CZ3 A;  1EEM A;  2LNS A;  3DRN A;  5IOW A;  1PD2 1;  3H1N A;  4MZB A;  1SKR B;  1WMJ A;  1V98 A;  2NPB A;  5IIZ A;  2H6X A;  1A8Y A;  1SKS B;  3APQ A;  4MPG A;  2VCQ A;  4ZXG A;  2J23 A;  2L4C A;  2FNO A;  4AJ6 A;  3CTF A;  4YQU A;  3UOM A;  2LNT A;  4GST A;  5GSS A;  4N0Z A;  4LLR A;  1LJR A;  4I97 A;  2X8G A;  3VK9 A;  2JU5 A;  5ID2 A;  3GNJ A;  5HR1 A;  3KMN A;  3L9S A;  4Z7X A;  1T00 A;  1BYE A;  2H76 A;  5J41 A;  4K0G A;  4MF7 A;  1G6W A;  3ZMK A;  2XBI A;  3QD9 A;  1JZW A;  1H4O A;  3ZTL A;  3UEM A;  5B6N A;  3FHK A;  3HYP A;  2K18 A;  1USB A;  3CTG A;  1RQM A;  3HCZ A;  1GUM A;  3ZIV A;  3QFA C;  3N5O A;  2K8V A;  2ON7 A;  3W8S A;  4AJ8 A;  3EE2 A;  2HYX A;  3GRX A;  3LQ7 A;  2H75 A;  2GS3 A;  1YY7 A;  2IFQ B;  4HU9 A;  2OKA A;  2GST A;  1A23 A;  1GP1 A;  3E3E A;  4PNF A;  2OBK A;  1ON4 A;  2H66 A;  2OAD A;  4RQR A;  1EV4 A;  1JZR A;  4G0I A;  2F51 A;  4KUN A;  1X0R A;  2HSM B;  2E7P A;  5IMF A;  1EGO A;  5AN1 A;  5LCZ A;  3I69 A;  1RK4 A;  1IYI A;  1Z6N A;  4IP6 A;  1GUK A;  4GTU A;  1WJK A;  1B9X C;  4TN8 A;  3G7I A;  2PPT A;  3KP8 A;  3UJ1 A;  3TKS E;  2J9H A;  1ZYQ B;  1V40 A;  4EVM A;  1WRY A;  4K8M A;  5KN2 A;  4PTS A;  3ZZX A;  1TXX A;  4WF4 A;  1K3O A;  2VD1 A;  1GSE A;  2GSQ A;  3GV1 A;  3L4N A;  1EV9 A;  2H71 A;  3HJM A;  3GST A;  2MBT A;  1FAA A;  5AIV A;  3V1W A;  4PQ1 A;  1FG4 A;  1WIK A;  1LBK A;  4TKY A;  5G1L A;  1V57 A;  3DVX A;  1ERV A;  1FHE A;  1B9Y C;  4V2L A;  2VCV A;  1WE0 A;  3WT2 A;  4O32 A;  4O92 A;  2HRK B;  2PGT A;  4KDY A;  1PQN A;  3IHQ A;  3I6A A;  1PN9 A;  2OBI A;  2OE1 A;  4ML6 A;  1SYX A;  2VLU A;  1DE2 A;  2IIY A;  4NAX A;  5GAN D;  2HSM A;  1EZK A;  4IJI A;  1XWC A;  2RM6 A;  2H0G A;  1S3D A;  3TJB A;  1AQW A;  4NMU A;  2JSY A;  3NZN A;  5H5Q A;  1Q98 A;  1XW5 A;  2N5B A;  2ON5 A;  1PA3 A;  2C4J A;  5G5E A;  2C0E A;  2PMT A;  2YJ7 A;  5IMD A;  1ACV A;  1YKC A;  3QDN A;  1K0B A;  2VL2 A;  4XCS A;  4PUR A;  4GRF A;  2HRA A;  3QMX A;  1EOG A;  2V2G A;  1YZX A;  2RLI A;  4MH3 A;  2R4V A;  2JZR A;  4YH2 A;  1QGV A;  2RUE A;  4PX1 A;  1SD9 A;  3GYK A;  2F8F A;  5CRG A;  1PKW A;  4NV2 A;  1HD2 A;  2HRK A;  4ZIJ A;  4CW9 A;  1GTA A;  2CT6 A;  2YWM A;  5DJL A;  1PX6 A;  4L0U A;  1XXU A;  2YAN A;  2AUV A;  1URM A;  1AQV A;  2L59 A;  2C0G A;  4RUV A;  5L71 A;  1YQ1 A;  2YV9 A;  1TK8 B;  3LXT A;  3ISO A;  4I2U A;  3LEF A;  2HQT A;  2IMI A;  2QKE A;  3HY2 A;  5HR3 A;  3HZ8 A;  2GDR A;  2H0I A;  4TRX A;  5CAX A;  4IVF A;  4N30 A;  4L8E A;  5IMV A;  4K7I A;  3DXB A;  1WPI A;  1TW9 A;  1U88 A;  4KH7 A;  1MTC A;  3M1G A;  1TRV A;  1OAZ A;  2PVQ A;  7GSS A;  2LJK A;  3TKQ A;  2V32 A;  4ACS A;  2R5G A;  3IDV A;  1QXH A;  1G0T A;  5AGY A;  2FD3 A;  2N5F A;  1X5C A;  3C8E A;  3PR8 A;  2IN3 A;  1QMV A;  5DQY A;  2YNX A;  4TOP A;  2A2R A;  2B1K A;  3OR5 A;  3IXR A;  3TGZ A;  5FWG A;  20GS A;  3ERW A;  1KBN A;  3EUR A;  3KXO A;  5KN1 A;  2BMX A;  2IL3 A;  1BG5 A;  4MPF A;  1ML6 A;  4HEA 2;  5IPG A;  2FWF A;  1W89 A;  1SL2 B;  3CXG A;  4BWQ A;  3HA9 A;  1XFL A;  3GUR A;  3GL3 A;  4GQF A;  1EGR A;  1CQG A;  1CQH A;  2ZNM A;  2O7K A;  2CA8 A;  2KP1 A;  1R7H A;  4IQ1 A;  3C73 A;  3GA4 A;  2LQQ A;  4TXO B;  2RM5 A;  1EOH A;  4HZ2 A;  3EC3 A;  5CRH A;  2OAC A;  4MDC A;  3GKK A;  2G2Q A;  3CBU A;  5DJM A;  3APO A;  4XS4 A;  2H1D A;  4EXJ A;  1N2A A;  1GL8 A;  4CHS A;  4FYB A;  4G10 A;  2OA7 A;  2HT9 A;  2H6Z A;  4G0L A;  3C1S A;  4DSR A;  1O6J A;  2UZ8 A;  1PSQ A;  3RHB A;  1EP8 A;  1O7U A;  1XOA A;  2I9H A;  1O8W A;  4PQI A;  1SL1 B;  3IRA A;  3HJP A;  2H19 A;  5DVB A;  3QR6 A;  3A3T A;  4ECB A;  2FWE A;  1A0R P;  3VWW A;  3KMO A;  1V58 A;  1WOU A;  2M72 A;  1VF2 A;  3UAP A;  3TJJ A;  3FZ9 A;  2ES7 A;  3FR6 A;  5IPH A;  5EVO A;  3UVT A;  2RII A;  5B7C A;  3S9F A;  4FH8 A;  1OC3 A;  5ECM B;  2V41 A;  2YN1 A;  4GXZ A;  3VI7 A;  1VF1 A;  3LXZ A;  5DAK A;  3TUE A;  1BAY A;  1Z6M A;  4TXO A;  3KM6 A;  5JCW A;  1O81 A;  3ZLP A;  5F05 A;  2KHP A;  1AW9 A;  5GST A;  4YAP A;  4Q5N A;  4NHW A;  3P2A A;  1GH2 A;  3W6G A;  3ERG A;  4Q5Q A;  4L0W A;  4PXO A;  3FEU A;  4IBP A;  3E9J B;  1GSU A;  4AJ7 A;  5B6M A;  3CRT A;  1AUC A;  3G7J A;  4HQZ A;  1ZCP A;  4LA1 A;  2C0F A;  4MLY A;  3IAM 2;  4LMW A;  3KEB A;  5INY A;  5ELA A;  3TKP A;  2F3M A;  2H8L A;  3GN3 A;  4NXI A;  1MDJ A;  2X64 A;  4KF9 A;  4DSQ A;  1YKA A;  5G5F A;  4HS1 A;  4GCI A;  4KDU A;  4XHM A;  3GMF A;  3M9K A;  2VM1 A;  2N5A A;  3UAR A;  1PKZ A;  3TOU A;  4ILF A;  2DSA A;  1AAZ A;  3HHV A;  2DJ2 A;  4OWY A;  4FQU A;  3LJR A;  2B5E A;  1K0O A;  1OC9 A;  3FR9 A;  2DJ1 A;  4E8H A;  3GKM A;  3LYP A;  5A4W A;  1TJD A;  1GTI A;  1QUW A;  4RI6 A;  4ZL9 A;  3L9V A;  3DKS A;  3F8U A;  3WGD A;  3BD2 A;  5ECK B;  1PMT A;  4N0V A;  4MF5 A;  3KH9 A;  4X1U A;  1F3B A;  3TRX A;  3O76 A;  2C1Y A;  3RHC A;  4ZIL A;  5KEJ A;  1UN2 A;  4XIH A;  3I43 A;  5B8B A;  4Q5F A;  1XWK A;  3ME8 A;  3D0Z A;  1IYH A;  2FUG 2;  5IMZ A;  2TRX A;  4LMV A;  3P7X A;  2IWT A;  3QAW A;  5ECR B;  1PGT A;  5B8A A;  1XW9 A;  4FYU A;  2LJA A;  5CRE A;  3KZQ A;  2HLS A;  1K0A A;  4ML1 A;  5E4W A;  2H70 A;  4OD7 A;  3ZRE A;  2BTO T;  1GRX A;  4XRD A;  5D9V A;  4K6X A;  3ERF A;  4EDZ A;  1ZZY A;  2H30 A;  4GLT A;  5F0G A;  6GSW A;  4OFN A;  1FOV A;  3TOT A;  4MJB A;  2Z9S A;  2EC4 A;  2AHE A;  4L5L A;  5D9T A;  4BL7 A;  1SKW B;  3ZIT A;  4JE1 A;  1GUL A;  5BMU A;  1ERT A;  2VCT A;  1VF3 A;  3AY8 A;  1ZOF A;  5ECH B;  4PGT A;  4IS0 A;  2H74 A;  4JZQ A;  2JL4 A;  3U5R E;  2CZ2 A;  3MWH A;  5D8I A;  3H79 A;  2HE3 A;  3D6I A;  4XTS A;  3GH9 A;  1SK2 A;  2QC7 A;  1GSF A;  4OFM A;  5AIX A;  4IN0 A;  1BQ7 A;  4I2T A;  1F6M C;  4IHU A;  4XRA A;  3ZML A;  1TP9 A;  1XW6 A;  1M0U A;  2B7K A;  2C3N A;  6GSV A;  1TTZ A;  3VI5 A;  1R4W A;  1M7T A;  5DQS A;  3LGC A;  1AQX A;  3I9V 2;  3WGX A;  1AC1 A;  4OCE A;  3KH7 A;  4Q5R A;  3ZFL A;  3F3Q A;  2BJX A;  2LV3 A;  3DML A;  4YAV A;  1K0C A;  2LKU A;  1K0D A;  2B5Y A;  3EU4 A;  2WRT A;  2CV4 A;  1YJ6 A;  4RQX A;  2QGV A;  5CRD A;  5IMA A;  1M2D A;  4ZL8 A;  4WXT A;  5HFG A;  2AB6 A;  1C72 A;  1TU7 A;  5JWR B;  1OE7 A;  4F0C A;  3WGE A;  5JCG A;  1V2A A;  5JWO B;  2V6K A;  5J5N A;  1VGL A;  3SBC A;  2H01 A;  2IPA A;  1Z7P A;  4KX4 A;  3ZYW A;  4V2M A;  3DWV A;  3GUS A;  4KSM A;  1T3B A;  5EL8 A;  3TB2 A;  3UVH A;  1THX A;  2X8C A;  5EPF A;  4OCF A;  2DIZ A;  1PL1 A;  1XPV A;  2WFC A;  4V2N A;  4BWS A;  5F06 A;  5D73 A;  2DJK A; 
#chains in the Genus database with same CATH topology
 3L9U A;  4F03 A;  4EL1 A;  5C00 A;  3UL3 A;  4E8E A;  2DJ0 A;  3PGT A;  4KND A;  3BBY A;  1XVQ A;  5ECP B;  1SEN A;  5ECN B;  4NPB A;  5AIS A;  2H1L A;  4TR1 B;  2IME A;  2WZ9 A;  3KCM A;  4E68 A;  1FW1 A;  2C0D A;  1PL2 A;  3F3R A;  3KJY A;  3H93 A;  2XPD A;  3O3T A;  1BX9 A;  11GS A;  3C1R A;  4AKI A;  1TXU A;  2OT3 A;  1SL0 B;  4D73 A;  1Z5Y E;  2FA8 A;  1S3C A;  5E59 A;  2FA4 A;  4F82 A;  3IK9 A;  2M46 A;  2C8U A;  2PER A;  1DE1 A;  2X49 A;  4OMV A;  1HNA A;  1X9W B;  2YWO A;  4K7O A;  2CVB A;  1TDI A;  4BVY A;  2H1G A;  2VOC A;  4I8B A;  1S4B P;  1SK1 A;  2R3X A;  3N9J A;  4IGJ A;  2JAC A;  3Q18 A;  3F6F A;  4KCE A;  2GTU A;  4RI7 A;  5J4Y A;  3FY7 A;  4EUY A;  5G1K A;  4GF0 A;  1JFU A;  3CSI A;  1DBY A;  2G0F A;  3GH6 A;  1Y1U A;  3IC4 A;  1R26 A;  3E0U A;  4G19 A;  3FRC A;  3ZIJ A;  2VL3 A;  1OYJ A;  13GS A;  5IM9 A;  1GTU A;  3F4T A;  4XS4 B;  4QMK A;  1GSS A;  1JHB A;  2R0C A;  5J9C A;  1EWX A;  2PN8 A;  2HXK A;  2A4H A;  2CX4 A;  2R6K A;  2XBQ A;  1ZGN A;  1XWA A;  4N11 A;  4O5Q A;  3KTL A;  3M3M A;  1YDK A;  4TR1 A;  2EFC A;  14GS A;  1K0N A;  2ALB A;  6GSS A;  4EC0 A;  3HKR A;  2GSR A;  2MMA A;  4WET A;  4JBB A;  1XCC A;  4P3Y B;  4FO5 A;  3Q19 A;  3CHX C;  1YEP A;  4PQH A;  3TKR A;  2AJQ B;  1B48 A;  1B8X A;  3LYK A;  3MAK A;  4X0X A;  3BOA A;  3TKS C;  1X9M B;  5GZZ B;  1SU9 A;  3SWL A;  3FYG A;  2P31 A;  3FZ5 A;  3PIN A;  1R5A A;  2B1L A;  4G0K A;  3IOS A;  3TRP A;  4OO5 A;  1NW2 A;  1G7O A;  5ECO B;  2CAI A;  4KAE A;  2LRT A;  4EDY A;  5D96 A;  5HR0 A;  2DKI A;  4K7N A;  5FHI A;  5DAK B;  4I5Q A;  4ZBB A;  2M80 A;  1KNG A;  4G9H A;  4V1A p;  3IV4 A;  1PX7 A;  5IO2 A;  2VKZ G;  2PUK C;  3IPZ A;  1SK0 A;  3VUR A;  3ZVJ D;  1TRU A;  2L4Q A;  4FIW A;  3TDG A;  3WYW A;  2WW2 A;  4MJE A;  2P5Q A;  4FYC A;  3GTU A;  4F9Z A;  4IJ3 A;  5KN0 A;  1YEW C;  1I5G A;  6GST A;  5ELG A;  4N10 A;  4TVE A;  4JR4 A;  2VAF A;  4MAB A;  1SJI A;  1R5P A;  1OKT A;  1FB6 A;  3FW2 A;  5HR2 A;  4ISD A;  2C80 A;  1THO A;  4AF2 A;  2LQO A;  1A8L A;  3ED3 A;  2PBJ A;  5EY6 A;  1OKD A;  2MMO A;  2GGT A;  1HYU A;  2L57 A;  1TRS A;  4GSS A;  2KP2 A;  3CRU A;  3ZRD A;  3Q74 A;  10GS A;  3IC8 A;  1M9A A;  1XWB A;  5ECS A;  5A5H A;  4BIK A;  4MZW A;  3ZFB A;  2EIQ A;  4LL1 B;  3TJG A;  4EE0 A;  1YEX A;  3RPN A;  2FWG A;  1OC9 B;  6GSY A;  2KOK A;  4BPY A;  2B3S A;  1O73 A;  2VCX A;  3EIN A;  2NBS A;  1GNE A;  1JLV A;  2B5X A;  1N25 A;  4ZBA A;  5LD0 A;  5J4U A;  2MYG A;  1N8J A;  5G31 A;  1K3Y A;  3LG6 A;  1T4Y A;  1F37 A;  4HJ2 A;  8GSS A;  1G7E A;  1OE8 A;  5C04 A;  2HSN A;  2B7J A;  1PFO A;  1U3I A;  1Q4J A;  1T4Z A;  4NHZ A;  3HD5 A;  5F07 A;  3TJF A;  4HJM A;  3RPP A;  1DUG A;  3HVX A;  3RBT A;  2YCD A;  3MSZ A;  1TU8 A;  5J3R A;  1GWC A;  1ERU A;  3FR3 A;  1NHO A;  1SVO A;  2YV7 A;  1Z3E A;  4ULX A;  3D4M A;  4AI6 A;  4PUA A;  2DIY A;  3HXS A;  5ECQ B;  2REM A;  5ECI B;  1ABA A;  2NDO A;  2XHF A;  2DC5 A;  3BCI A;  4KE3 A;  1XZO A;  2GZP A;  3O6T A;  2FY6 A;  1JZD A;  5D93 A;  4GSN A;  1XOB A;  1GLP A;  1BJX A;  1XIY A;  2VIM A;  3EYT A;  4BL7 B;  2O5V A;  3KD0 A;  3FKF A;  4IP1 A;  3L0H A;  3UIW A;  1EP7 A;  1Z7R A;  2V1M A;  1QK8 A;  5KN3 A;  2HSY A;  4I6X A;  3VWU A;  4WBJ A;  4HOJ A;  3CYN A;  2K9F A;  4HDE A;  5DAL B;  5BMU B;  2OE0 A;  3GX8 A;  2F8A A;  2H73 A;  4DSS A;  2O36 A;  3Q6O A;  2XPE A;  2UV8 G;  1GSQ A;  2IMK A;  4TW5 A;  3TCO A;  4MJC A;  3IR4 A;  2VLV A;  3VWV A;  1YVL A;  1MDI A;  2LJR A;  1G6Y A;  1J9B A;  3C71 A;  5DCG A;  2WVY A;  3QAV A;  3VPT A;  1NHY A;  3M8N A;  6GSX A;  1YF1 A;  3F6D A;  3A5W A;  1BF5 A;  4MZC A;  2DLX A;  2L6D A;  4PUF C;  3EU3 A;  1ZYP A;  4GWR A;  4QL9 A;  1OC8 A;  2GVP A;  3US3 A;  5CO3 A;  2KUC A;  3UMA A;  3HVN A;  1W4V A;  3J7Y b;  4DEJ A;  5G30 A;  1MD4 A;  2B6M A;  1A2M A;  1T8E B;  2E2M A;  2K6V A;  2YZH A;  1HNC A;  1K0M A;  5DDL A;  4WEY A;  1E6B A;  1O85 A;  3F4S A;  3NIV A;  9GSS A;  5F8B A;  4EF0 A;  4EKZ A;  1NM3 A;  3LWA A;  3GFK A;  3ZL5 A;  2R0P A;  2HZE A;  5H5S A;  4KCA A;  2LTK A;  2O85 A;  1FB0 A;  4MA9 A;  5G2Z A;  1LU4 A;  5DAL A;  4TXV A;  1T1V A;  1GSY A;  2D2Z A;  3VWX A;  2IMD A;  4MNN A;  1WWJ A;  2L5O A;  5ECL B;  2L6C A;  2L5L A;  4AGS A;  5J40 A;  1ZYE A;  4TR0 A;  4POK A;  3RAZ A;  1FO5 A;  1ST9 A;  4F2I A;  4JED A;  2A2S A;  4IQA A;  4LL4 B;  5CP1 A;  2CAQ A;  4J56 E;  2DBC A;  1TI1 A;  1YF0 A;  2WCI A;  3TJK A;  4JRR A;  2HZF A;  3WD6 A;  4POB A;  2A4V A;  1UC7 A;  4MF6 A;  5LNK e;  2H1A A;  5COH A;  5A5K A;  1GTB A;  3MDK A;  4O5R A;  4TR4 A;  1AXD A;  4PNG A;  2WZS A;  3VFI A;  3QFB C;  2LRC A;  1J0F A;  3RDW A;  4NV5 A;  4F0B A;  3MNG A;  4JU5 A;  1Y6E A;  3G7Y A;  3HVS A;  5HFK A;  3F9U A;  1MEK A;  1H75 A;  4BVX B;  4O5U A;  1U6T A;  1ZMA A;  2VLT A;  1A0F A;  2H72 A;  4YKG A;  2VCZ A;  4HUA A;  3QPM A;  4HU7 A;  3R2Q A;  4D73 B;  1TKD B;  4EO3 A;  2DMM A;  1F2E A;  4USS A;  4K5S A;  3L78 A;  1JLW A;  4Z2U A;  2OJL A;  2IFQ A;  2VL2 C;  2GT6 A;  3CSH A;  4ECI A;  5ABR A;  1K3L A;  2I4A A;  3KP9 A;  2JAD A;  4BVY B;  4AKG A;  3WT1 A;  2K8S A;  2H0H A;  2WJU A;  4MP4 A;  4MCU A;  2LEG A;  1OVN A;  4K1F A;  3IA1 A;  4HI7 A;  1UA5 A;  3G9B A;  4X43 A;  4MJA A;  2YPM A;  3A2V A;  4K9Z A;  4POM A;  12GS A;  4ZB8 A;  3LOR A;  4CY8 A;  4WBR D;  2CVD A;  3U6V A;  2GQM A;  4ECC A;  2GZY A;  4CY6 A;  4NWY A;  3GX0 A;  2LRN A;  4WF5 A;  3DGQ A;  1KEB A;  19GS A;  5HQP A;  2QA1 A;  4YQV A;  6GSU A;  5GAP D;  5IO0 A;  2P0G A;  4ZB9 A;  3QCP A;  2HI7 A;  1X5E A;  4K5R A;  4BVX A;  1TK0 B;  1M2A A;  1SJ6 A;  3PH9 A;  3J7Y k;  1XWG A;  4QL7 A;  4QQ7 A;  4EIQ A;  2NTO A;  5IOX A;  2LST A;  2R2J A;  2YWI A;  1F3A A;  1TK5 B;  5IQY A;  2KLX A;  3IBH A;  1TOF A;  1A24 A;  5ENU A;  2H6Y A;  3A2X A;  3APS A;  2I1U A;  1PRX A;  3LFL A;  5D9X A;  1TRW A;  2O87 A;  1M9B A;  3ZVJ A;  3IK7 A;  3HJO A;  4MH2 A;  1GSD A;  1MD3 A;  4TR3 A;  2IMF A;  2HNL A;  2HRN A;  3KTB A;  3M9J A;  4KGI A;  5CYY A;  3DD3 A;  3VPQ A;  4MK3 A;  5A4U A;  2PU9 C;  1DSB A;  1SJZ A;  1TI3 A;  2AYT A;  4XS1 A;  2AV4 A;  3EMP A;  5CNW A;  3TRQ A;  3CMI A;  2MBS A;  3HDC A;  4BA7 A;  3FZ4 A;  2O89 A;  2MZC A;  2XC2 A;  1SYR A;  2WDU A;  4YKF A;  1GUH A;  4J57 E;  3BJ5 A;  1S3A A;  1XG8 A;  3GTU B;  4ZB6 A;  1ZYN A;  4OO4 A;  4ZL7 A;  4MMM A;  3JCM L;  1XBS A;  5CRW A;  2FHE A;  2V6O A;  4HQS A;  3F0I A;  3QOU A;  2FLS A;  2C3T A;  2DJ3 A;  2AAW A;  3F4R A;  1VF4 A;  2WVX A;  2GQK A;  2EIO A;  5A5H B;  22GS A;  2FGX A;  2EFH A;  2VO4 A;  2GZZ A;  2TRC P;  4G2E A;  2GQL A;  2HFD A;  4JR6 A;  4ID0 A;  1PN0 A;  2MMN A;  1T7P B;  3ME7 A;  4WR4 A;  2PVO C;  2LUS A;  3QAG A;  1UVZ A;  3EMX A;  2QSI A;  2CQ9 A;  1V9W A;  1O8X A;  5FT3 A;  3RGB C;  2WW0 A;  1ERW A;  2FCH A;  2PWJ A;  2VL9 A;  1ILO A;  3HZ4 A;  2HSN B;  2I81 A;  3BCK A;  5IMC A;  1X5D A;  2YP6 A;  3C7M A;  2EIR A;  1A2J A;  3TKS A;  18GS A;  1M2B A;  1MDK A;  1E2Y A;  1BED A;  3EVI A;  2RUF A;  1HQO A;  3D22 A;  2IJY A;  2YJH A;  2JSZ A;  3D4T A;  3PPU A;  2WW3 A;  4KW6 A;  3FZA A;  1VRS D;  1SD8 A;  3IE3 A;  4XS6 A;  1M99 A;  2ZCT A;  5JCU A;  1F9M A;  1QQ2 A;  1Y25 A;  4K0N A;  3LSZ A;  5A34 A;  4CDO A;  4O7H A;  1A2L A;  4ECJ A;  4DVC A;  4IKH A;  2DKH A;  4POL A;  4IW9 A;  1EEJ A;  2MMZ A;  4WR5 A;  2OE3 A;  4KSO A;  2FWH A;  1U87 A;  3IHG A;  2GT5 A;  5BRT A;  4AKX B;  3GKN A;  1Z9H A;  3KIJ A;  2DJJ A;  5A4V A;  4GQC A;  3UBL A;  2HRF A;  2CX3 A;  4ZBD A;  2JZS A;  17GS A;  3GHA A;  3D21 A;  2GLR A;  4WKW A;  4FXY P;  2VM2 A;  2WGR A;  1BG1 A;  2WB9 A;  1I9D A;  2VUP A;  2X8H A;  2WUL A;  3A5I A;  2VD0 A;  2H1B A;  4H86 A;  3RFR C;  4DSS B;  2I3Y A;  2YZU A;  4K2D A;  3KGK A;  5H5R A;  3NOF A;  3GL5 A;  4IEL A;  2HSH A;  1FVK A;  16GS A;  3F63 A;  5D9W A;  2R37 A;  1JZO A;  1GNW A;  2ZUP A;  3D5J A;  2E0Q A;  2JZT A;  2O8V B;  2X99 A;  3A2W A;  2NVL A;  2CVK A;  3P90 A;  2F9S A;  1B4Q A;  3H4K A;  1ZL9 A;  4KA0 A;  1WP0 A;  2GSS A;  3P8W A;  3W8J A;  5ID2 B;  5DCH A;  1XVW A;  1NSW A;  1X9S B;  3UBK A;  4HZ4 A;  3DVW A;  4J2F A;  2C3Q A;  2WS2 A;  4V1A g;  3K8N A;  4L5O A;  3HVV A;  2DML A;  4YQM A;  3H8Q A;  5JWQ B;  5J9B A;  2VCW A;  1FVJ A;  1GLQ A;  4PI0 C;  3IAS 2;  1J08 A;  3FK8 A;  3GIX A;  2YWN A;  3EWL A;  3M0F A;  2YOI A;  3DEX A;  3VLN A;  1QFN A;  2E2G A;  1RW1 A;  3GSS A;  1KTE A;  2P5R A;  3DYR A;  4KDX A;  5J4V A;  1HNB A;  3DIE A;  4OFT A;  5DBQ A;  5HFI A;  3CSJ A;  2TIR A;  3GKX A;  1AIU A;  2HZE B;  1U3A A;  4G01 A;  2LS5 A;  4HSC X;  4X4J A;  4KB3 A;  3R3E A;  1B4P A;  2CZ3 A;  1EEM A;  2LNS A;  3DRN A;  5IOW A;  1PD2 1;  3H1N A;  4MZB A;  1SKR B;  1WMJ A;  1V98 A;  2NPB A;  5IIZ A;  2H6X A;  1A8Y A;  1SKS B;  3APQ A;  4MPG A;  2VCQ A;  4ZXG A;  2J23 A;  3TU3 B;  2L4C A;  2FNO A;  4AJ6 A;  3CTF A;  4YQU A;  3UOM A;  2R0G A;  2LNT A;  4GST A;  5GSS A;  4N0Z A;  4LLR A;  4EIP A;  4N3Z A;  1LJR A;  4I97 A;  2X8G A;  3VK9 A;  2JU5 A;  5ID2 A;  3GNJ A;  5HR1 A;  3KMN A;  3L9S A;  4Z7X A;  1T00 A;  1BYE A;  2H76 A;  5J41 A;  4K0G A;  4MF7 A;  1G6W A;  3ZMK A;  2XBI A;  3QD9 A;  1JZW A;  1H4O A;  1SVL A;  3ZTL A;  3UEM A;  5B6N A;  3FHK A;  3HYP A;  2K18 A;  1USB A;  3CTG A;  1RQM A;  3HCZ A;  1GUM A;  3ZIV A;  3QFA C;  3N5O A;  2K8V A;  2ON7 A;  3W8S A;  4AJ8 A;  3EE2 A;  2HYX A;  3GRX A;  3LQ7 A;  2H75 A;  2GS3 A;  4A5P A;  1YY7 A;  2IFQ B;  4HU9 A;  2OKA A;  3FMW A;  2GST A;  1A23 A;  1GP1 A;  5A1N B;  3E3E A;  4PNF A;  2OBK A;  1ON4 A;  2H66 A;  2OAD A;  4RQR A;  1EV4 A;  1JZR A;  4G0I A;  2F51 A;  4KUN A;  1X0R A;  2HSM B;  2E7P A;  5IMF A;  1EGO A;  5AN1 A;  5LCZ A;  3I69 A;  1RK4 A;  1IYI A;  1Z6N A;  4ZB7 A;  4IP6 A;  1GUK A;  4GTU A;  1WJK A;  1B9X C;  4TN8 A;  3G7I A;  2PPT A;  2QA2 A;  3KP8 A;  3UJ1 A;  3TKS E;  2J9H A;  1ZYQ B;  1V40 A;  4EVM A;  1WRY A;  4K8M A;  5KN2 A;  4PTS A;  3ZZX A;  1TXX A;  4K2X A;  4WF4 A;  1K3O A;  2VD1 A;  1GSE A;  2GSQ A;  3GV1 A;  3L4N A;  1EV9 A;  2H71 A;  3HJM A;  3GST A;  2MBT A;  1FAA A;  5AIV A;  3V1W A;  4PQ1 A;  1FG4 A;  1WIK A;  1LBK A;  4TKY A;  5G1L A;  1V57 A;  3DVX A;  1ERV A;  1FHE A;  1B9Y C;  2A2P A;  4V2L A;  2VCV A;  1WE0 A;  3WT2 A;  4O32 A;  4O92 A;  2HRK B;  2PGT A;  4KDY A;  5A1N A;  1PQN A;  3IHQ A;  3I6A A;  1PN9 A;  2OBI A;  2OE1 A;  4ML6 A;  1SYX A;  2VLU A;  1DE2 A;  2IIY A;  4NAX A;  5GAN D;  2HSM A;  1EZK A;  4IJI A;  1XWC A;  4GDF A;  2RM6 A;  2H0G A;  1S3D A;  3TJB A;  1AQW A;  4NMU A;  2JSY A;  3NZN A;  5H5Q A;  1Q98 A;  1XW5 A;  2N5B A;  2ON5 A;  1PA3 A;  2EFE A;  2C4J A;  5G5E A;  2C0E A;  2PMT A;  2YJ7 A;  5IMD A;  1ACV A;  1YKC A;  3QDN A;  1K0B A;  2VL2 A;  4XCS A;  4PUR A;  4GRF A;  2HRA A;  3QMX A;  1EOG A;  2V2G A;  1YZX A;  2RLI A;  4MH3 A;  2WW1 A;  2R4V A;  2JZR A;  4YH2 A;  1QGV A;  2RUE A;  4PX1 A;  1SD9 A;  3GYK A;  2F8F A;  5CRG A;  1PKW A;  4NV2 A;  1HD2 A;  2WVX B;  2HRK A;  4ZIJ A;  4CW9 A;  1GTA A;  2CT6 A;  2YWM A;  5DJL A;  1PX6 A;  4L0U A;  1XXU A;  2YAN A;  2AUV A;  1URM A;  1AQV A;  2L59 A;  2C0G A;  4RUV A;  5L71 A;  1YQ1 A;  2YV9 A;  1TK8 B;  3LXT A;  3ISO A;  4I2U A;  3LEF A;  2HQT A;  2IMI A;  2QKE A;  3HY2 A;  3MYD A;  5HR3 A;  3HZ8 A;  2GDR A;  2H0I A;  4TRX A;  5CAX A;  4IVF A;  4N30 A;  4L8E A;  5IMV A;  4K7I A;  4AKH A;  3DXB A;  1WPI A;  1TW9 A;  1U88 A;  4KH7 A;  1MTC A;  3M1G A;  1TRV A;  1OAZ A;  2PVQ A;  7GSS A;  2LJK A;  3TKQ A;  5A34 B;  2V32 A;  4ACS A;  2R5G A;  3IDV A;  1QXH A;  1G0T A;  5AGY A;  2FD3 A;  2N5F A;  1X5C A;  3C8E A;  3PR8 A;  2IN3 A;  2X4A A;  1QMV A;  1S3R A;  5DQY A;  4PI2 C;  2YNX A;  4TOP A;  2A2R A;  2B1K A;  3OR5 A;  3IXR A;  3TGZ A;  5FWG A;  20GS A;  3ERW A;  1KBN A;  3EUR A;  3KXO A;  5KN1 A;  2BMX A;  4Z2T A;  2IL3 A;  1BG5 A;  4MPF A;  1ML6 A;  4HEA 2;  5IPG A;  2FWF A;  1W89 A;  1SL2 B;  3CXG A;  4BWQ A;  4W66 A;  3HA9 A;  1XFL A;  3GUR A;  3GL3 A;  4GQF A;  1EGR A;  1CQG A;  1CQH A;  2ZNM A;  2O7K A;  2CA8 A;  2KP1 A;  1R7H A;  4IQ1 A;  3C73 A;  3GA4 A;  2LQQ A;  4TXO B;  2RM5 A;  1EOH A;  4HZ2 A;  3EC3 A;  5CRH A;  2OAC A;  4MDC A;  3GKK A;  2G2Q A;  3CBU A;  5DJM A;  3APO A;  4XS4 A;  2H1D A;  4EXJ A;  1N2A A;  1GL8 A;  4CHS A;  4FYB A;  4G10 A;  2OA7 A;  2HT9 A;  2H6Z A;  4G0L A;  3C1S A;  4DSR A;  1O6J A;  3CWG A;  2UZ8 A;  1PSQ A;  3RHB A;  1EP8 A;  1O7U A;  1XOA A;  2I9H A;  1O8W A;  4PQI A;  1SL1 B;  3IRA A;  3HJP A;  2H19 A;  5DVB A;  3QR6 A;  3A3T A;  4ECB A;  2FWE A;  1FOH A;  1A0R P;  3VWW A;  3KMO A;  1V58 A;  1WOU A;  2M72 A;  1VF2 A;  3UAP A;  3TJJ A;  3FZ9 A;  2ES7 A;  3FR6 A;  5IPH A;  5EVO A;  3UVT A;  2RII A;  2WVZ A;  5B7C A;  3S9F A;  4FH8 A;  1OC3 A;  5ECM B;  2V41 A;  2YN1 A;  4GXZ A;  3VI7 A;  1VF1 A;  3LXZ A;  5DAK A;  3TUE A;  1BAY A;  1Z6M A;  4TXO A;  3KM6 A;  5JCW A;  1O81 A;  3ZLP A;  5F05 A;  2KHP A;  1AW9 A;  5KOW A;  5GST A;  2O3E A;  4YAP A;  3CQF A;  4Q5N A;  4NHW A;  3P2A A;  1GH2 A;  3EPT A;  3W6G A;  3ERG A;  4Q5Q A;  4L0W A;  4PXO A;  3FEU A;  3LW9 A;  4IBP A;  3E9J B;  1GSU A;  4AJ7 A;  5B6M A;  3CRT A;  1AUC A;  3G7J A;  4HQZ A;  1ZCP A;  4LA1 A;  2C0F A;  4MLY A;  3IAM 2;  4LMW A;  3KEB A;  1M3I A;  5INY A;  5ELA A;  3TKP A;  2F3M A;  2H8L A;  3GN3 A;  4NXI A;  1MDJ A;  2X64 A;  4KF9 A;  4DSQ A;  1YKA A;  5G5F A;  4HS1 A;  4GCI A;  4KDU A;  4XHM A;  3GMF A;  3M9K A;  2VM1 A;  2N5A A;  3UAR A;  1PKZ A;  3TOU A;  4ILF A;  2DSA A;  1AAZ A;  3HMJ G;  3HHV A;  2DJ2 A;  4OWY A;  4FQU A;  3LJR A;  2B5E A;  1I1I P;  1K0O A;  3FR9 A;  1OC9 A;  2DJ1 A;  4E8H A;  3GKM A;  3LYP A;  5A4W A;  1TJD A;  1GTI A;  1QUW A;  4RI6 A;  4ZL9 A;  3L9V A;  3DKS A;  3F8U A;  3WGD A;  3BD2 A;  5ECK B;  1PMT A;  4N0V A;  4MF5 A;  3KH9 A;  4X1U A;  1F3B A;  3TRX A;  3O76 A;  2C1Y A;  3RHC A;  4ZIL A;  5KEJ A;  4PHZ C;  1UN2 A;  4XIH A;  3I43 A;  5B8B A;  4Q5F A;  1XWK A;  3ME8 A;  3D0Z A;  1IYH A;  2FUG 2;  5IMZ A;  5KOX A;  2TRX A;  4LMV A;  3P7X A;  2IWT A;  3QAW A;  5ECR B;  1PGT A;  5B8A A;  1XW9 A;  4FYU A;  2LJA A;  5CRE A;  3KZQ A;  2HLS A;  1K0A A;  4ML1 A;  5E4W A;  2H70 A;  4OD7 A;  3ZRE A;  2BTO T;  1GRX A;  4XRD A;  5D9V A;  4K6X A;  3ERF A;  1M3J A;  5J47 A;  4EDZ A;  1ZZY A;  2H30 A;  4GLT A;  5F0G A;  6GSW A;  4OFN A;  1FOV A;  3TOT A;  4MJB A;  2Z9S A;  2EC4 A;  2AHE A;  4L5L A;  5D9T A;  4BL7 A;  1SKW B;  3ZIT A;  4JE1 A;  4Z2R A;  1GUL A;  5BMU A;  1ERT A;  2VCT A;  1VF3 A;  3AY8 A;  1ZOF A;  5ECH B;  4PGT A;  4IS0 A;  2H74 A;  4JZQ A;  2JL4 A;  3U5R E;  2CZ2 A;  3MWH A;  5D8I A;  3H79 A;  2HE3 A;  3D6I A;  4XTS A;  3GH9 A;  1SK2 A;  2QC7 A;  1GSF A;  4OFM A;  5AIX A;  4IN0 A;  1BQ7 A;  4I2T A;  1F6M C;  4IHU A;  4XRA A;  3ZML A;  1TP9 A;  3MIX A;  1XW6 A;  1M0U A;  2B7K A;  2C3N A;  6GSV A;  1TTZ A;  3VI5 A;  1R4W A;  1M7T A;  5DQS A;  3LGC A;  1AQX A;  3I9V 2;  3WGX A;  4ICY A;  1AC1 A;  4OCE A;  3KH7 A;  4Q5R A;  3ZFL A;  3F3Q A;  2BJX A;  2LV3 A;  3DML A;  4YAV A;  1K0C A;  2LKU A;  1K0D A;  2B5Y A;  3EU4 A;  2WRT A;  2CV4 A;  1YJ6 A;  4RQX A;  2QGV A;  5CRD A;  5IMA A;  1M2D A;  4ZL8 A;  4WXT A;  5HFG A;  2AB6 A;  1C72 A;  1TU7 A;  5JWR B;  1OE7 A;  4F0C A;  3WGE A;  5JCG A;  1V2A A;  5JWO B;  2EFD A;  2V6K A;  5J5N A;  1VGL A;  3SBC A;  1SVM A;  2H01 A;  2IPA A;  1Z7P A;  4KX4 A;  3ZYW A;  4V2M A;  3DWV A;  3GUS A;  4KSM A;  1T3B A;  5EL8 A;  3TB2 A;  3UVH A;  1THX A;  2X8C A;  5EPF A;  4OCF A;  2DIZ A;  1PL1 A;  1XPV A;  2WFC A;  4V2N A;  4BWS A;  5F06 A;  5D73 A;  2DJK A; 
#chains in the Genus database with same CATH homology
 3L9U A;  4F03 A;  4EL1 A;  5C00 A;  3UL3 A;  4E8E A;  2DJ0 A;  3PGT A;  4KND A;  3BBY A;  1XVQ A;  5ECP B;  1SEN A;  5ECN B;  4NPB A;  5AIS A;  2H1L A;  4TR1 B;  2IME A;  2WZ9 A;  3KCM A;  4E68 A;  1FW1 A;  2C0D A;  1PL2 A;  3F3R A;  3KJY A;  3H93 A;  2XPD A;  3O3T A;  1BX9 A;  11GS A;  3C1R A;  4AKI A;  1TXU A;  2OT3 A;  1SL0 B;  4D73 A;  1Z5Y E;  2FA8 A;  1S3C A;  5E59 A;  2FA4 A;  4F82 A;  3IK9 A;  2M46 A;  2C8U A;  2PER A;  1DE1 A;  2X49 A;  4OMV A;  1HNA A;  1X9W B;  2YWO A;  4K7O A;  2CVB A;  1TDI A;  4BVY A;  2H1G A;  2VOC A;  4I8B A;  1SK1 A;  2R3X A;  3N9J A;  4IGJ A;  2JAC A;  3Q18 A;  3F6F A;  4KCE A;  2GTU A;  4RI7 A;  5J4Y A;  3FY7 A;  4EUY A;  5G1K A;  4GF0 A;  1JFU A;  3CSI A;  1DBY A;  2G0F A;  3GH6 A;  1Y1U A;  3IC4 A;  1R26 A;  3E0U A;  4G19 A;  3FRC A;  3ZIJ A;  2VL3 A;  1OYJ A;  13GS A;  5IM9 A;  1GTU A;  3F4T A;  4XS4 B;  4QMK A;  1GSS A;  1JHB A;  2R0C A;  5J9C A;  1EWX A;  2PN8 A;  2HXK A;  2A4H A;  2CX4 A;  2R6K A;  2XBQ A;  1ZGN A;  1XWA A;  4N11 A;  4O5Q A;  3KTL A;  3M3M A;  1YDK A;  4TR1 A;  2EFC A;  14GS A;  1K0N A;  2ALB A;  6GSS A;  4EC0 A;  3HKR A;  2GSR A;  2MMA A;  4WET A;  4JBB A;  1XCC A;  4P3Y B;  4FO5 A;  3Q19 A;  1YEP A;  4PQH A;  3TKR A;  2AJQ B;  1B48 A;  1B8X A;  3LYK A;  3MAK A;  4X0X A;  3BOA A;  3TKS C;  1X9M B;  5GZZ B;  1SU9 A;  3SWL A;  3FYG A;  2P31 A;  3FZ5 A;  3PIN A;  1R5A A;  2B1L A;  4G0K A;  3IOS A;  3TRP A;  4OO5 A;  1NW2 A;  1G7O A;  5ECO B;  2CAI A;  4KAE A;  2LRT A;  4EDY A;  5D96 A;  5HR0 A;  2DKI A;  4K7N A;  5FHI A;  5DAK B;  4I5Q A;  4ZBB A;  2M80 A;  1KNG A;  4G9H A;  4V1A p;  3IV4 A;  1PX7 A;  5IO2 A;  2VKZ G;  2PUK C;  3IPZ A;  1SK0 A;  3VUR A;  3ZVJ D;  1TRU A;  2L4Q A;  4FIW A;  3TDG A;  3WYW A;  4MJE A;  2P5Q A;  4FYC A;  3GTU A;  4F9Z A;  4IJ3 A;  5KN0 A;  1I5G A;  6GST A;  5ELG A;  4N10 A;  4TVE A;  4JR4 A;  2VAF A;  4MAB A;  1SJI A;  1R5P A;  1OKT A;  1FB6 A;  3FW2 A;  5HR2 A;  4ISD A;  2C80 A;  1THO A;  4AF2 A;  2LQO A;  1A8L A;  3ED3 A;  2PBJ A;  5EY6 A;  1OKD A;  2MMO A;  2GGT A;  1HYU A;  2L57 A;  1TRS A;  4GSS A;  2KP2 A;  3CRU A;  3ZRD A;  3Q74 A;  10GS A;  3IC8 A;  1M9A A;  1XWB A;  5ECS A;  5A5H A;  4MZW A;  3ZFB A;  2EIQ A;  4LL1 B;  3TJG A;  4EE0 A;  1YEX A;  3RPN A;  2FWG A;  1OC9 B;  6GSY A;  2KOK A;  4BPY A;  2B3S A;  1O73 A;  2VCX A;  3EIN A;  2NBS A;  1GNE A;  1JLV A;  2B5X A;  1N25 A;  4ZBA A;  5LD0 A;  5J4U A;  2MYG A;  1N8J A;  5G31 A;  1K3Y A;  3LG6 A;  1T4Y A;  1F37 A;  4HJ2 A;  8GSS A;  1G7E A;  1OE8 A;  5C04 A;  2HSN A;  2B7J A;  1U3I A;  1Q4J A;  1T4Z A;  4NHZ A;  3HD5 A;  5F07 A;  3TJF A;  4HJM A;  3RPP A;  1DUG A;  3HVX A;  3RBT A;  2YCD A;  3MSZ A;  1TU8 A;  5J3R A;  1GWC A;  1ERU A;  3FR3 A;  1NHO A;  1SVO A;  2YV7 A;  1Z3E A;  4ULX A;  3D4M A;  4AI6 A;  4PUA A;  2DIY A;  3HXS A;  5ECQ B;  2REM A;  5ECI B;  1ABA A;  2NDO A;  2XHF A;  2DC5 A;  3BCI A;  4KE3 A;  1XZO A;  2GZP A;  3O6T A;  2FY6 A;  1JZD A;  5D93 A;  4GSN A;  1XOB A;  1GLP A;  1BJX A;  1XIY A;  2VIM A;  3EYT A;  4BL7 B;  2O5V A;  3KD0 A;  3FKF A;  4IP1 A;  3L0H A;  3UIW A;  1EP7 A;  1Z7R A;  2V1M A;  1QK8 A;  5KN3 A;  2HSY A;  4I6X A;  3VWU A;  4WBJ A;  4HOJ A;  3CYN A;  2K9F A;  4HDE A;  5DAL B;  5BMU B;  2OE0 A;  3GX8 A;  2F8A A;  2H73 A;  4DSS A;  3Q6O A;  2XPE A;  2UV8 G;  1GSQ A;  2IMK A;  4TW5 A;  3TCO A;  4MJC A;  3IR4 A;  2VLV A;  3VWV A;  1YVL A;  1MDI A;  2LJR A;  1G6Y A;  1J9B A;  3C71 A;  5DCG A;  3QAV A;  3VPT A;  1NHY A;  3M8N A;  6GSX A;  1YF1 A;  3F6D A;  3A5W A;  1BF5 A;  4MZC A;  2DLX A;  2L6D A;  4PUF C;  3EU3 A;  1ZYP A;  4GWR A;  4QL9 A;  1OC8 A;  2GVP A;  3US3 A;  5CO3 A;  2KUC A;  3UMA A;  1W4V A;  3J7Y b;  4DEJ A;  5G30 A;  1MD4 A;  2B6M A;  1A2M A;  1T8E B;  2E2M A;  2K6V A;  2YZH A;  1HNC A;  1K0M A;  5DDL A;  4WEY A;  1E6B A;  1O85 A;  3F4S A;  3NIV A;  9GSS A;  5F8B A;  4EF0 A;  4EKZ A;  1NM3 A;  3LWA A;  3GFK A;  3ZL5 A;  2R0P A;  2HZE A;  5H5S A;  4KCA A;  2LTK A;  2O85 A;  1FB0 A;  4MA9 A;  5G2Z A;  1LU4 A;  5DAL A;  4TXV A;  1T1V A;  1GSY A;  2D2Z A;  3VWX A;  2IMD A;  4MNN A;  1WWJ A;  2L5O A;  5ECL B;  2L6C A;  2L5L A;  4AGS A;  5J40 A;  1ZYE A;  4TR0 A;  4POK A;  3RAZ A;  1FO5 A;  1ST9 A;  4F2I A;  4JED A;  2A2S A;  4IQA A;  4LL4 B;  5CP1 A;  2CAQ A;  4J56 E;  2DBC A;  1TI1 A;  1YF0 A;  2WCI A;  3TJK A;  4JRR A;  2HZF A;  3WD6 A;  4POB A;  2A4V A;  1UC7 A;  4MF6 A;  5LNK e;  2H1A A;  5COH A;  5A5K A;  1GTB A;  3MDK A;  4O5R A;  4TR4 A;  1AXD A;  4PNG A;  3VFI A;  3QFB C;  2LRC A;  1J0F A;  3RDW A;  4NV5 A;  4F0B A;  3MNG A;  4JU5 A;  1Y6E A;  3G7Y A;  3HVS A;  5HFK A;  3F9U A;  1MEK A;  1H75 A;  4BVX B;  4O5U A;  1U6T A;  1ZMA A;  2VLT A;  1A0F A;  2H72 A;  4YKG A;  2VCZ A;  4HUA A;  3QPM A;  4HU7 A;  3R2Q A;  4D73 B;  1TKD B;  4EO3 A;  2DMM A;  1F2E A;  4USS A;  4K5S A;  3L78 A;  1JLW A;  4Z2U A;  2OJL A;  2IFQ A;  2VL2 C;  2GT6 A;  3CSH A;  4ECI A;  5ABR A;  1K3L A;  2I4A A;  3KP9 A;  2JAD A;  4BVY B;  4AKG A;  3WT1 A;  2K8S A;  2H0H A;  2WJU A;  4MP4 A;  4MCU A;  2LEG A;  1OVN A;  4K1F A;  3IA1 A;  4HI7 A;  1UA5 A;  3G9B A;  4X43 A;  4MJA A;  2YPM A;  3A2V A;  4K9Z A;  4POM A;  12GS A;  4ZB8 A;  3LOR A;  4CY8 A;  4WBR D;  2CVD A;  3U6V A;  2GQM A;  4ECC A;  2GZY A;  4CY6 A;  4NWY A;  3GX0 A;  2LRN A;  4WF5 A;  3DGQ A;  1KEB A;  19GS A;  5HQP A;  2QA1 A;  4YQV A;  6GSU A;  5GAP D;  5IO0 A;  2P0G A;  4ZB9 A;  3QCP A;  2HI7 A;  1X5E A;  4K5R A;  4BVX A;  1TK0 B;  1M2A A;  1SJ6 A;  3PH9 A;  3J7Y k;  1XWG A;  4QL7 A;  4QQ7 A;  4EIQ A;  2NTO A;  5IOX A;  2LST A;  2R2J A;  2YWI A;  1F3A A;  1TK5 B;  5IQY A;  2KLX A;  3IBH A;  1TOF A;  1A24 A;  5ENU A;  2H6Y A;  3A2X A;  3APS A;  2I1U A;  1PRX A;  3LFL A;  5D9X A;  1TRW A;  2O87 A;  1M9B A;  3ZVJ A;  3IK7 A;  3HJO A;  4MH2 A;  1GSD A;  1MD3 A;  4TR3 A;  2IMF A;  2HNL A;  2HRN A;  3KTB A;  3M9J A;  4KGI A;  5CYY A;  3DD3 A;  3VPQ A;  4MK3 A;  5A4U A;  2PU9 C;  1DSB A;  1SJZ A;  1TI3 A;  2AYT A;  4XS1 A;  2AV4 A;  3EMP A;  5CNW A;  3TRQ A;  3CMI A;  2MBS A;  3HDC A;  4BA7 A;  3FZ4 A;  2O89 A;  2MZC A;  2XC2 A;  1SYR A;  2WDU A;  4YKF A;  1GUH A;  4J57 E;  3BJ5 A;  1S3A A;  3GTU B;  4ZB6 A;  1ZYN A;  4OO4 A;  4ZL7 A;  4MMM A;  3JCM L;  1XBS A;  5CRW A;  2FHE A;  2V6O A;  4HQS A;  3F0I A;  3QOU A;  2FLS A;  2C3T A;  2DJ3 A;  2AAW A;  3F4R A;  1VF4 A;  2GQK A;  2EIO A;  5A5H B;  22GS A;  2FGX A;  2EFH A;  2VO4 A;  2GZZ A;  2TRC P;  4G2E A;  2GQL A;  2HFD A;  4JR6 A;  4ID0 A;  1PN0 A;  2MMN A;  1T7P B;  3ME7 A;  4WR4 A;  2PVO C;  2LUS A;  3QAG A;  1UVZ A;  3EMX A;  2QSI A;  2CQ9 A;  1V9W A;  1O8X A;  5FT3 A;  1ERW A;  2FCH A;  2PWJ A;  2VL9 A;  1ILO A;  3HZ4 A;  2HSN B;  2I81 A;  3BCK A;  5IMC A;  1X5D A;  2YP6 A;  3C7M A;  2EIR A;  1A2J A;  3TKS A;  18GS A;  1M2B A;  1MDK A;  1E2Y A;  1BED A;  3EVI A;  2RUF A;  1HQO A;  3D22 A;  2IJY A;  2YJH A;  2JSZ A;  3D4T A;  3PPU A;  4KW6 A;  3FZA A;  1VRS D;  1SD8 A;  3IE3 A;  4XS6 A;  1M99 A;  2ZCT A;  5JCU A;  1F9M A;  1QQ2 A;  1Y25 A;  4K0N A;  3LSZ A;  5A34 A;  4CDO A;  4O7H A;  1A2L A;  4ECJ A;  4DVC A;  4IKH A;  2DKH A;  4POL A;  4IW9 A;  1EEJ A;  2MMZ A;  4WR5 A;  2OE3 A;  4KSO A;  2FWH A;  1U87 A;  3IHG A;  2GT5 A;  5BRT A;  4AKX B;  3GKN A;  1Z9H A;  3KIJ A;  2DJJ A;  5A4V A;  4GQC A;  3UBL A;  2HRF A;  2CX3 A;  4ZBD A;  2JZS A;  17GS A;  3GHA A;  3D21 A;  2GLR A;  4WKW A;  2VM2 A;  2WGR A;  1BG1 A;  2WB9 A;  1I9D A;  2VUP A;  2X8H A;  2WUL A;  3A5I A;  2VD0 A;  2H1B A;  4H86 A;  4DSS B;  2I3Y A;  2YZU A;  4K2D A;  3KGK A;  5H5R A;  3NOF A;  3GL5 A;  4IEL A;  2HSH A;  1FVK A;  16GS A;  3F63 A;  5D9W A;  2R37 A;  1JZO A;  1GNW A;  2ZUP A;  3D5J A;  2E0Q A;  2JZT A;  2O8V B;  2X99 A;  3A2W A;  2NVL A;  2CVK A;  3P90 A;  2F9S A;  1B4Q A;  3H4K A;  1ZL9 A;  4KA0 A;  1WP0 A;  2GSS A;  3P8W A;  3W8J A;  5ID2 B;  5DCH A;  1XVW A;  1NSW A;  1X9S B;  3UBK A;  4HZ4 A;  3DVW A;  4J2F A;  2C3Q A;  2WS2 A;  4V1A g;  3K8N A;  4L5O A;  3HVV A;  2DML A;  4YQM A;  3H8Q A;  5JWQ B;  5J9B A;  2VCW A;  1FVJ A;  1GLQ A;  3IAS 2;  1J08 A;  3FK8 A;  3GIX A;  2YWN A;  3EWL A;  3M0F A;  2YOI A;  3DEX A;  3VLN A;  1QFN A;  2E2G A;  1RW1 A;  3GSS A;  1KTE A;  2P5R A;  3DYR A;  4KDX A;  5J4V A;  1HNB A;  3DIE A;  4OFT A;  5DBQ A;  5HFI A;  3CSJ A;  2TIR A;  3GKX A;  1AIU A;  2HZE B;  1U3A A;  4G01 A;  2LS5 A;  4X4J A;  4KB3 A;  3R3E A;  1B4P A;  2CZ3 A;  1EEM A;  2LNS A;  3DRN A;  5IOW A;  1PD2 1;  3H1N A;  4MZB A;  1SKR B;  1WMJ A;  1V98 A;  2NPB A;  5IIZ A;  2H6X A;  1A8Y A;  1SKS B;  3APQ A;  4MPG A;  2VCQ A;  4ZXG A;  2J23 A;  3TU3 B;  2L4C A;  2FNO A;  4AJ6 A;  3CTF A;  4YQU A;  3UOM A;  2R0G A;  2LNT A;  4GST A;  5GSS A;  4N0Z A;  4LLR A;  4EIP A;  4N3Z A;  1LJR A;  4I97 A;  2X8G A;  3VK9 A;  2JU5 A;  5ID2 A;  3GNJ A;  5HR1 A;  3KMN A;  3L9S A;  4Z7X A;  1T00 A;  1BYE A;  2H76 A;  5J41 A;  4K0G A;  4MF7 A;  1G6W A;  3ZMK A;  2XBI A;  3QD9 A;  1JZW A;  1H4O A;  1SVL A;  3ZTL A;  3UEM A;  5B6N A;  3FHK A;  3HYP A;  2K18 A;  1USB A;  3CTG A;  1RQM A;  3HCZ A;  1GUM A;  3ZIV A;  3QFA C;  3N5O A;  2K8V A;  2ON7 A;  3W8S A;  4AJ8 A;  3EE2 A;  2HYX A;  3GRX A;  3LQ7 A;  2H75 A;  2GS3 A;  4A5P A;  1YY7 A;  2IFQ B;  4HU9 A;  2OKA A;  3FMW A;  2GST A;  1A23 A;  1GP1 A;  5A1N B;  3E3E A;  4PNF A;  2OBK A;  1ON4 A;  2H66 A;  2OAD A;  4RQR A;  1EV4 A;  1JZR A;  4G0I A;  2F51 A;  4KUN A;  1X0R A;  2HSM B;  2E7P A;  5IMF A;  1EGO A;  5AN1 A;  5LCZ A;  3I69 A;  1RK4 A;  1IYI A;  1Z6N A;  4ZB7 A;  4IP6 A;  1GUK A;  4GTU A;  1WJK A;  1B9X C;  4TN8 A;  3G7I A;  2PPT A;  2QA2 A;  3KP8 A;  3UJ1 A;  3TKS E;  2J9H A;  1ZYQ B;  1V40 A;  4EVM A;  1WRY A;  4K8M A;  5KN2 A;  4PTS A;  3ZZX A;  1TXX A;  4K2X A;  4WF4 A;  1K3O A;  2VD1 A;  1GSE A;  2GSQ A;  3GV1 A;  3L4N A;  1EV9 A;  2H71 A;  3HJM A;  3GST A;  2MBT A;  1FAA A;  5AIV A;  3V1W A;  4PQ1 A;  1FG4 A;  1WIK A;  1LBK A;  4TKY A;  5G1L A;  1V57 A;  3DVX A;  1ERV A;  1FHE A;  1B9Y C;  2A2P A;  4V2L A;  2VCV A;  1WE0 A;  3WT2 A;  4O32 A;  4O92 A;  2HRK B;  2PGT A;  4KDY A;  5A1N A;  1PQN A;  3IHQ A;  3I6A A;  1PN9 A;  2OBI A;  2OE1 A;  4ML6 A;  1SYX A;  2VLU A;  1DE2 A;  2IIY A;  4NAX A;  5GAN D;  2HSM A;  1EZK A;  4IJI A;  1XWC A;  4GDF A;  2RM6 A;  2H0G A;  1S3D A;  3TJB A;  1AQW A;  4NMU A;  2JSY A;  3NZN A;  5H5Q A;  1Q98 A;  1XW5 A;  2N5B A;  2ON5 A;  1PA3 A;  2EFE A;  2C4J A;  5G5E A;  2C0E A;  2PMT A;  2YJ7 A;  5IMD A;  1ACV A;  1YKC A;  3QDN A;  1K0B A;  2VL2 A;  4XCS A;  4PUR A;  4GRF A;  2HRA A;  3QMX A;  1EOG A;  2V2G A;  1YZX A;  2RLI A;  4MH3 A;  2R4V A;  2JZR A;  4YH2 A;  1QGV A;  2RUE A;  4PX1 A;  1SD9 A;  3GYK A;  2F8F A;  5CRG A;  1PKW A;  4NV2 A;  1HD2 A;  2HRK A;  4ZIJ A;  4CW9 A;  1GTA A;  2CT6 A;  2YWM A;  5DJL A;  1PX6 A;  4L0U A;  1XXU A;  2YAN A;  2AUV A;  1URM A;  1AQV A;  2L59 A;  2C0G A;  4RUV A;  5L71 A;  1YQ1 A;  2YV9 A;  1TK8 B;  3LXT A;  3ISO A;  4I2U A;  3LEF A;  2HQT A;  2IMI A;  2QKE A;  3HY2 A;  3MYD A;  5HR3 A;  3HZ8 A;  2GDR A;  2H0I A;  4TRX A;  5CAX A;  4IVF A;  4N30 A;  4L8E A;  5IMV A;  4K7I A;  4AKH A;  3DXB A;  1WPI A;  1TW9 A;  1U88 A;  4KH7 A;  1MTC A;  3M1G A;  1TRV A;  1OAZ A;  2PVQ A;  7GSS A;  2LJK A;  3TKQ A;  5A34 B;  2V32 A;  4ACS A;  2R5G A;  3IDV A;  1QXH A;  1G0T A;  5AGY A;  2FD3 A;  2N5F A;  1X5C A;  3C8E A;  3PR8 A;  2IN3 A;  2X4A A;  1QMV A;  5DQY A;  2YNX A;  4TOP A;  2A2R A;  2B1K A;  3OR5 A;  3IXR A;  3TGZ A;  5FWG A;  20GS A;  3ERW A;  1KBN A;  3EUR A;  3KXO A;  5KN1 A;  2BMX A;  4Z2T A;  2IL3 A;  1BG5 A;  4MPF A;  1ML6 A;  4HEA 2;  5IPG A;  2FWF A;  1W89 A;  1SL2 B;  3CXG A;  4BWQ A;  4W66 A;  3HA9 A;  1XFL A;  3GUR A;  3GL3 A;  4GQF A;  1EGR A;  1CQG A;  1CQH A;  2ZNM A;  2O7K A;  2CA8 A;  2KP1 A;  1R7H A;  4IQ1 A;  3C73 A;  3GA4 A;  2LQQ A;  4TXO B;  2RM5 A;  1EOH A;  4HZ2 A;  3EC3 A;  5CRH A;  2OAC A;  4MDC A;  3GKK A;  2G2Q A;  3CBU A;  5DJM A;  3APO A;  4XS4 A;  2H1D A;  4EXJ A;  1N2A A;  1GL8 A;  4CHS A;  4FYB A;  4G10 A;  2OA7 A;  2HT9 A;  2H6Z A;  4G0L A;  3C1S A;  4DSR A;  1O6J A;  3CWG A;  2UZ8 A;  1PSQ A;  3RHB A;  1EP8 A;  1O7U A;  1XOA A;  2I9H A;  1O8W A;  4PQI A;  1SL1 B;  3IRA A;  3HJP A;  2H19 A;  5DVB A;  3QR6 A;  3A3T A;  4ECB A;  2FWE A;  1FOH A;  1A0R P;  3VWW A;  3KMO A;  1V58 A;  1WOU A;  2M72 A;  1VF2 A;  3UAP A;  3TJJ A;  3FZ9 A;  2ES7 A;  3FR6 A;  5IPH A;  5EVO A;  3UVT A;  2RII A;  5B7C A;  3S9F A;  4FH8 A;  1OC3 A;  5ECM B;  2V41 A;  2YN1 A;  4GXZ A;  3VI7 A;  1VF1 A;  3LXZ A;  5DAK A;  3TUE A;  1BAY A;  1Z6M A;  4TXO A;  3KM6 A;  5JCW A;  1O81 A;  3ZLP A;  5F05 A;  2KHP A;  1AW9 A;  5KOW A;  5GST A;  4YAP A;  4Q5N A;  4NHW A;  3P2A A;  1GH2 A;  3EPT A;  3W6G A;  3ERG A;  4Q5Q A;  4L0W A;  4PXO A;  3FEU A;  3LW9 A;  4IBP A;  3E9J B;  1GSU A;  4AJ7 A;  5B6M A;  3CRT A;  1AUC A;  3G7J A;  4HQZ A;  1ZCP A;  4LA1 A;  2C0F A;  4MLY A;  3IAM 2;  4LMW A;  3KEB A;  5INY A;  5ELA A;  3TKP A;  2F3M A;  2H8L A;  3GN3 A;  4NXI A;  1MDJ A;  2X64 A;  4KF9 A;  4DSQ A;  1YKA A;  5G5F A;  4HS1 A;  4GCI A;  4KDU A;  4XHM A;  3GMF A;  3M9K A;  2VM1 A;  2N5A A;  3UAR A;  1PKZ A;  3TOU A;  4ILF A;  2DSA A;  1AAZ A;  3HMJ G;  3HHV A;  2DJ2 A;  4OWY A;  4FQU A;  3LJR A;  2B5E A;  1K0O A;  1OC9 A;  3FR9 A;  2DJ1 A;  4E8H A;  3GKM A;  3LYP A;  5A4W A;  1TJD A;  1GTI A;  1QUW A;  4RI6 A;  4ZL9 A;  3L9V A;  3DKS A;  3F8U A;  3WGD A;  3BD2 A;  5ECK B;  1PMT A;  4N0V A;  4MF5 A;  3KH9 A;  4X1U A;  1F3B A;  3TRX A;  3O76 A;  2C1Y A;  3RHC A;  4ZIL A;  5KEJ A;  1UN2 A;  4XIH A;  3I43 A;  5B8B A;  4Q5F A;  1XWK A;  3ME8 A;  3D0Z A;  1IYH A;  2FUG 2;  5IMZ A;  5KOX A;  2TRX A;  4LMV A;  3P7X A;  2IWT A;  3QAW A;  5ECR B;  1PGT A;  5B8A A;  1XW9 A;  4FYU A;  2LJA A;  5CRE A;  3KZQ A;  2HLS A;  1K0A A;  4ML1 A;  5E4W A;  2H70 A;  4OD7 A;  3ZRE A;  2BTO T;  1GRX A;  4XRD A;  5D9V A;  4K6X A;  3ERF A;  5J47 A;  4EDZ A;  1ZZY A;  2H30 A;  4GLT A;  5F0G A;  6GSW A;  4OFN A;  1FOV A;  3TOT A;  4MJB A;  2Z9S A;  2EC4 A;  2AHE A;  4L5L A;  5D9T A;  4BL7 A;  1SKW B;  3ZIT A;  4JE1 A;  4Z2R A;  1GUL A;  5BMU A;  1ERT A;  2VCT A;  1VF3 A;  3AY8 A;  1ZOF A;  5ECH B;  4PGT A;  4IS0 A;  2H74 A;  4JZQ A;  2JL4 A;  3U5R E;  2CZ2 A;  3MWH A;  5D8I A;  3H79 A;  2HE3 A;  3D6I A;  4XTS A;  3GH9 A;  1SK2 A;  2QC7 A;  1GSF A;  4OFM A;  5AIX A;  4IN0 A;  1BQ7 A;  4I2T A;  1F6M C;  4IHU A;  4XRA A;  3ZML A;  1TP9 A;  3MIX A;  1XW6 A;  1M0U A;  2B7K A;  2C3N A;  6GSV A;  1TTZ A;  3VI5 A;  1R4W A;  1M7T A;  5DQS A;  3LGC A;  1AQX A;  3I9V 2;  3WGX A;  4ICY A;  1AC1 A;  4OCE A;  3KH7 A;  4Q5R A;  3ZFL A;  3F3Q A;  2BJX A;  2LV3 A;  3DML A;  4YAV A;  1K0C A;  2LKU A;  1K0D A;  2B5Y A;  3EU4 A;  2WRT A;  2CV4 A;  1YJ6 A;  4RQX A;  2QGV A;  5CRD A;  5IMA A;  1M2D A;  4ZL8 A;  4WXT A;  5HFG A;  2AB6 A;  1C72 A;  1TU7 A;  5JWR B;  1OE7 A;  4F0C A;  3WGE A;  5JCG A;  1V2A A;  5JWO B;  2EFD A;  2V6K A;  5J5N A;  1VGL A;  3SBC A;  1SVM A;  2H01 A;  2IPA A;  1Z7P A;  4KX4 A;  3ZYW A;  4V2M A;  3DWV A;  3GUS A;  4KSM A;  1T3B A;  5EL8 A;  3TB2 A;  3UVH A;  1THX A;  2X8C A;  5EPF A;  4OCF A;  2DIZ A;  1PL1 A;  1XPV A;  2WFC A;  4V2N A;  4BWS A;  5F06 A;  5D73 A;  2DJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...