4IWJA

Crystal structure of iron soaked (45 min) ferritin from pseudo-nitzschia multiseries
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
159
structure length
158
Chain Sequence
SEELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAESAEEREHGLGFVDFANKRNIPIELQAVPAPVSAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHDFAVMAFLNPFHLQQVNEEDKIGSILAKVTDENRTPGLLRSLDVVSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin
publication title Mechanism of ferrous iron binding and oxidation by ferritin from a pennate diatom.
pubmed doi rcsb
source organism Pseudo-nitzschia multiseries
molecule tags Transport protein
total genus 69
structure length 158
sequence length 159
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4iwjA00
1YV1A 5HQOA 3ERZA 2CHIA 2XKQA 2FL0A 5I4JA 3ES3A 3QHBA 4PG0A 2FKZA 4PGKA 3WVUA 1UVHA 3GHQA 5C6FA 3TA8A 5FEJA 5GU0X 4TOEA 4ITTA 1RCGA 5HJFA 1DPSA 3KXUA 4ISPA 5D8QA 5GU1X 4M34A 5J9VA 1RCEA 4KVSA 2XJOA 3Q4RA 1R03A 1NNQA 2JD60 4TOBA 1RYTA 3O7SA 3NP0X 4U3GA 1JGCA 2XGWA 3HIUA 3GVYA 1VJXA 2PYBA 5D8YA 4IWKA 4XKSA 2HR5A 2C6RA 2BKCA 4ZLWA 3T9JA 3A68A 3QZ3A 3ISFA 1S30A 2UX1A 3UNOA 1TJOA 3MPSA 2QF9A 3E6RA 4TODA 1IERA 1SOFA 2VZBA 4MN9A 2CF7A 3QHCA 4ZTTA 1TKOA 3F34A 4QUWA 2QQYA 2XJMA 5GOUA 5IX6A 1JKUA 2F7NA 4AM2A 3U90A 3H7GA 4A25A 5LG8A 1F30A 4ERUA 3KX9A 1LKMA 2CEIA 5GU3X 1EUMA 4ZL5A 1DVBA 5JKLG 2JD70 3E1QA 4ZJKA 5D8XA 3RE7A 5FFBA 3UOIA 2ZA7A 2HTNA 5HJHA 1LKOA 1MFRA 4AM4A 3E2CA 3PW8A 3GE4A 5FFCA 1RCCA 5ERJA 1H96A 1NF6A 4LPNA 3A9QA 4TOFA 2Z6MA 3O7RA 2FFXJ 2BK6A 5JKMG 2Z5PA 3KA6A 4M33A 4ML5A 4DASA 3F38A 4KVQA 4PG1A 4LQNA 3RGDA 2V2IA 3VNXA 3EZUA 3SIDA 3F39A 4CVPA 1IESA 5AXSA 4EVCA 1JYBA 3PVYA 4TOAA 4REUA 4ZKHA 2V2LA 3AK9A 1S2ZA 1JTSA 4KVRA 4MUDA 3QB9A 5CMRA 1J30A 2ZG9X 1ZUJA 1TK6A 4CVTA 4ETRA 3F37A 1BCFA 1HRSA 3E1MA 4Y08A 2VXIA 3R2HA 3RAVA 3BT5A 5J8SA 4LQHA 3PWQC 2V2PA 5LBHA 3R2MA 1TKPA 2OH3A 1L8IA 1L8HA 2FHAA 3ISEA 4ZL6A 1N1QA 3KWOA 3R2SA 4RC6A 4EVDA 3SHXA 3FI6A 1VEQA 5J93A 2CN6A 4IXKA 4CVRA 2WLUA 3E1NA 3SE1A 2GYDA 4DYZA 2FG8A 4CY9A 3WVVA 4ZKWA 1JI4A 2C2JA 2XJNA 5LS9A 3PVRA 3PVYB 5D8SA 4OYNA 1JI5A 2ZA6A 2ZURX 3AF9X 1JIGA 5GN8A 3NOZX 1OTKA 3IS8A 3R2OA 4RC8A 2Z5RA 1XZ3A 2FG4A 3FSEA 2IB0A 2YW6A 1Z6OA 2Z90A 4DYXA 2ZG7X 1QYBA 4EVEA 1KRQA 3KA8A 5GU2X 1NFVA 2GYQA 5K52A 5K53A 4DYUA 1YUXA 3AF8X 2V2MA 3E6SA 3KA9A 4CMYA 1Z6OM 4XGSA 5FFDA 2V2JA 1B71A 3BVFA 4XKUA 1YUZA 3R2LA 4LYUA 1FHAA 1XZ1A 5CZUA 3PW8C 4CYAA 4MJYA 3E1OA 3BVEA 3WVWA 4CYBA 3E1LA 4RC7A 2IU2A 1JKVA 4DE6A 1GWGA 3UOFA 2C2UA 3HL1A 3PVRB 3Q4QA 2BJYA 4PGIA 5GN8B 1ZS3A 4XKTA 2V2SA 3IQ1A 4Z5SA 3AJOA 3OGHA 3BVIA 5D8OA 4ITWA 3EGMA 3KA3A 4AM5A 2VXXA 2FJCA 3AJQA 5E1UA 3RBCA 3PZAA 4DZ0A 2G4HA 4RC5A 1VEIA 3Q4OA 4P18A 3PVTA 3BKNA 3F35A 1SQ3A 2V2RA 2ITBA 2D5KA 3PW1A 1LKPA 2X170 1MOJA 4DI0A 3F33A 2CIHA 2RBDA 2YJJA 5JACA 1VLGA 1O9IA 1BG7A 3R2RA 4MY7A 2V2NA 2ZG8X 5ERKA 4E6KA 2WTLA 5JKLA 2YW7A 5J8WA 4RC7B 4ZMCA 3E1PA 1VELA 2ZA8A 2CN7A 3KA4A 4MKUA 4II4A 5CMQA 4CMYV 4LQJA 4DYYA 4LQVA 1AEWA 4LPJA 3SH6A 3AJPA 4ISMA 5FFEA 3WNWA 2FZFA 2Y3QA 4ZKXA 4TOGA 4TW3A 4Z3BA 4TO9A 3BVLA 1LB3A 4LPMA 4R42A 3AF7X 2GS4A 5D8RA 1DATA 2YJKA 3F36A 1S3QA 3R2KA 2C2FA 3QVDA 4RC5B 5JKMA 4EVBA 3PWFA 5D8PA 3PVTB 1RCIA 3F32A 1O9RA 4TOHA 4YKHA 3RD0A 3PW1B 2IY4A 4RC6B 5FFAA 2BW1A 2CLBA 2CHPA 5LG2A 4IWJA 4LYXA 3NP2X 2OC5A 1F33A 5E2DA 1QGHA 2Z5QA 2W0OA 2JD80 1UMNA 1JREA 2WLAA 3OJ5A 2V15A 1RCDA 3IS7A 4II4B 3EZ0A 2CLUA 1BFRA 3BVKA 1NF4A 2C41A 4M35A 4M32A 3AK8A 2V2OA 3E1JA 4CVSA 3QD8A 1Z4AA 4TOCA 3Q4NA 3FVBA 3PWQA
chains in the Genus database with same CATH superfamily
1YV1A 3M6JA 5HQOA 3ERZA 2CHIA 2XKQA 2FL0A 5I4JA 3ES3A 3QHBA 4PG0A 2FKZA 4PGKA 3WVUA 1UVHA 3GHQA 4YXJA 5C6FA 3TA8A 5FEJA 5GU0X 4TOEA 4ITTA 1RCGA 5HJFA 1DPSA 3KXUA 4ISPA 5D8QA 5GU1X 4M34A 5J9VA 1RCEA 4KVSA 2XJOA 3Q4RA 1R03A 1NNQA 2JD60 4TOBA 1RYTA 3O7SA 3NP0X 4U3GA 1JGCA 2XGWA 3HIUA 3GVYA 1VJXA 2PYBA 5D8YA 4IWKA 4XKSA 2HR5A 2C6RA 2BKCA 4ZLWA 3T9JA 3A68A 3QZ3A 3ISFA 1S30A 2UX1A 3UNOA 1TJOA 3MPSA 2QF9A 3E6RA 3L0MA 4TODA 1IERA 1SOFA 2VZBA 4MN9A 2CF7A 3QHCA 4ZTTA 1TKOA 3F34A 4QUWA 2QQYA 2XJMA 4W4KB 5GOUA 5IX6A 1JKUA 2F7NA 4AM2A 3U90A 3H7GA 4A25A 5LG8A 1F30A 4ERUA 3KX9A 1LKMA 2CEIA 5GU3X 1EUMA 4ZL5A 1DVBA 5JKLG 2JD70 3E1QA 4ZJKA 5D8XA 3RE7A 5FFBA 3UOIA 2ZA7A 2HTNA 5HJHA 1LKOA 1MFRA 4AM4A 3E2CA 3PW8A 3GE4A 5FFCA 1RCCA 5ERJA 1H96A 1NF6A 4LPNA 3A9QA 4TOFA 2Z6MA 3O7RA 2FFXJ 4YVZA 2BK6A 5JKMG 2Z5PA 3KA6A 5JDOA 4M33A 4ML5A 3FRSA 3F38A 4KVQA 4DASA 4PG1A 4LQNA 3RGDA 2V2IA 3VNXA 3EZUA 3SIDA 3F39A 4CVPA 1IESA 5AXSA 4EVCA 4MXPA 1JYBA 3PVYA 4TOAA 4REUA 4ZKHA 2V2LA 3AK9A 2N02A 1S2ZA 1JTSA 4KVRA 4KXRB 4MUDA 3QB9A 5CMRA 1J30A 2ZG9X 1ZUJA 3FRRA 1TK6A 4CVTA 4ETRA 3F37A 1BCFA 1HRSA 3JZ9A 3E1MA 4Y08A 2VXIA 3R2HA 3RAVA 3BT5A 3UFBA 5J8SA 4LQHA 3PWQC 2V2PA 5LBHA 3R2MA 3GGYA 1TKPA 2OH3A 1L8IA 1L8HA 2FHAA 3ISEA 4ZL6A 1N1QA 3KWOA 3R2SA 4RC6A 4EVDA 3SHXA 3FI6A 1VEQA 5J93A 2CN6A 4IXKA 5JDOB 4CVRA 2WLUA 3E1NA 3SE1A 2GYDA 4DYZA 2FG8A 4CY9A 5HU6D 3WVVA 4ZKWA 4YXMA 1JI4A 2C2JA 3C21A 2XJNA 5LS9A 3PVRA 3PVYB 5D8SA 4OYNA 1JI5A 2ZA6A 2ZURX 3AF9X 1JIGA 3D19A 5GN8A 4X0JA 3NOZX 1OTKA 3IS8A 3R2OA 4RC8A 2Z5RA 1XZ3A 2FG4A 3FSEA 2IB0A 2YW6A 1Z6OA 2Z90A 4DYXA 2ZG7X 3C1ZA 1QYBA 4EVEA 1KRQA 3KA8A 5GU2X 1NFVA 2GYQA 5K52A 5K53A 4DYUA 1YUXA 3AF8X 2V2MA 3E6SA 3KA9A 4CMYA 1Z6OM 4XGSA 5FFDA 2V2JA 1B71A 3BVFA 4XKUA 1YUZA 2MGYA 3R2LA 4LYUA 1FHAA 1XZ1A 5CZUA 3PW8C 4CYAA 4MJYA 3E1OA 3BVEA 2AR0A 3WVWA 4CYBA 2WWXB 3E1LA 4RC7A 2IU2A 1JKVA 4DE6A 2G38B 1GWGA 3UOFA 2C2UA 3GGZA 3HL1A 3PVRB 3Q4QA 2V8UA 3DBYA 2BJYA 4PGIA 5GN8B 1ZS3A 4XKTA 2V2SA 3IQ1A 4WJG4 4Z5SA 3AJOA 3OGHA 3BVIA 5D8OA 4ITWA 3EGMA 3KA3A 4AM5A 2VXXA 2FJCA 3AJQA 4W4LB 5E1UA 3RBCA 3PZAA 4DZ0A 2G4HA 4RC5A 1VEIA 3Q4OA 2Y44A 4P18A 3PVTA 2OKCA 3BKNA 1SQ3A 3F35A 2V2RA 2ITBA 2D5KA 3PW1A 1LKPA 2X170 1MOJA 4DI0A 3F33A 2CIHA 2RBDA 2YJJA 3W54A 3VV9A 5JACA 1VLGA 1O9IA 1BG7A 3R2RA 4MY7A 2V2NA 2ZG8X 3KHKA 5ERKA 4E6KA 2WTLA 5JKLA 2YW7A 5J8WA 4RC7B 4ZMCA 3E1PA 1VELA 2ZA8A 3C1YA 2CN7A 2V8TA 3KA4A 4MKUA 4II4A 5CMQA 4CMYV 4LQJA 4DYYA 4LQVA 1AEWA 4LPJA 3SH6A 3AJPA 4ISMA 5FFEA 3WNWA 2FZFA 2Y3QA 4ZKXA 4TOGA 4TW3A 4Z3BA 4TO9A 3BVLA 1LB3A 4LPMA 4R42A 3AF7X 2GS4A 5D8RA 1DATA 2YJKA 3F36A 1S3QA 3R2KA 2C2FA 3VVAA 3QVDA 4RC5B 5JKMA 4EVBA 3JZAB 3PWFA 5D8PA 3PVTB 1RCIA 3F32A 1O9RA 4TOHA 4YKHA 3RD0A 3PW1B 2IY4A 3C23A 4RC6B 5FFAA 2BW1A 2CLBA 2CHPA 5LG2A 4IWJA 4LYXA 3NP2X 2OC5A 1F33A 5E2DA 1QGHA 2Z5QA 2W0OA 3KDQA 2JD80 1UMNA 3LKDA 1JREA 2WLAA 3N6OA 3OJ5A 2V15A 2CWLA 1RCDA 3IS7A 4II4B 3EZ0A 2CLUA 1BFRA 3BVKA 1NF4A 2C41A 4M35A 4M32A 3AK8A 2V2OA 3E1JA 3V3KB 4CVSA 4E40A 3QD8A 1Z4AA 4TOCA 3Q4NA 3FVBA 3PWQA
chains in the Genus database with same CATH topology
1YV1A 3M6JA 5HQOA 3ERZA 2CHIA 2XKQA 2FL0A 5I4JA 3ES3A 3QHBA 4PG0A 2FKZA 4PGKA 3WVUA 1UVHA 3GHQA 4YXJA 5C6FA 3TA8A 5FEJA 5GU0X 4TOEA 4ITTA 1RCGA 5HJFA 1DPSA 3KXUA 4ISPA 5D8QA 5GU1X 4M34A 5J9VA 1RCEA 4KVSA 2XJOA 3Q4RA 1R03A 1NNQA 2JD60 4TOBA 1RYTA 3O7SA 3NP0X 4U3GA 1JGCA 2XGWA 3HIUA 3GVYA 1VJXA 2PYBA 5D8YA 4IWKA 4XKSA 2HR5A 2C6RA 2BKCA 4ZLWA 3T9JA 3A68A 3QZ3A 3ISFA 1S30A 2UX1A 3UNOA 1TJOA 3MPSA 2QF9A 3E6RA 3L0MA 4TODA 1IERA 1SOFA 2VZBA 4MN9A 2CF7A 3QHCA 4ZTTA 1TKOA 3F34A 4QUWA 2QQYA 2XJMA 4W4KB 5GOUA 5IX6A 1JKUA 2F7NA 4AM2A 3U90A 3H7GA 4A25A 5LG8A 1F30A 4ERUA 3KX9A 1LKMA 2CEIA 5GU3X 1EUMA 4ZL5A 1DVBA 5JKLG 2JD70 3E1QA 4ZJKA 5D8XA 3RE7A 5FFBA 3UOIA 2ZA7A 2HTNA 5HJHA 1LKOA 1MFRA 4AM4A 3E2CA 3PW8A 3GE4A 5FFCA 1RCCA 5ERJA 1H96A 1NF6A 4LPNA 3A9QA 4TOFA 2Z6MA 3O7RA 2FFXJ 4YVZA 2BK6A 5JKMG 2Z5PA 3KA6A 5JDOA 4M33A 4ML5A 3FRSA 3F38A 4KVQA 4DASA 4PG1A 4LQNA 3RGDA 2V2IA 3VNXA 3EZUA 3SIDA 3F39A 4CVPA 1IESA 5AXSA 4EVCA 4MXPA 1JYBA 3PVYA 4TOAA 4REUA 4ZKHA 2V2LA 3AK9A 2N02A 1S2ZA 1JTSA 4KVRA 4KXRB 4MUDA 3QB9A 5CMRA 1J30A 2ZG9X 1ZUJA 3FRRA 1TK6A 4CVTA 4ETRA 3F37A 1BCFA 1HRSA 3JZ9A 3E1MA 4Y08A 2VXIA 3R2HA 3RAVA 3BT5A 3UFBA 5J8SA 4LQHA 3PWQC 2V2PA 5LBHA 3R2MA 3GGYA 1TKPA 2OH3A 1L8IA 1L8HA 2FHAA 3ISEA 4ZL6A 1N1QA 3KWOA 3R2SA 4RC6A 4EVDA 3SHXA 3FI6A 1VEQA 5J93A 2CN6A 4IXKA 5JDOB 4CVRA 2WLUA 3E1NA 3SE1A 2GYDA 4DYZA 2FG8A 4CY9A 5HU6D 3WVVA 4ZKWA 4YXMA 1JI4A 2C2JA 3C21A 2XJNA 5LS9A 3PVRA 3PVYB 5D8SA 4OYNA 1JI5A 2ZA6A 2ZURX 3AF9X 1JIGA 3D19A 5GN8A 4X0JA 3NOZX 1OTKA 3IS8A 3R2OA 4RC8A 2Z5RA 1XZ3A 2FG4A 3FSEA 2IB0A 2YW6A 1Z6OA 2Z90A 4DYXA 2ZG7X 3C1ZA 1QYBA 4EVEA 1KRQA 3KA8A 5GU2X 1NFVA 2GYQA 5K52A 5K53A 4DYUA 1YUXA 3AF8X 2V2MA 3E6SA 3KA9A 4CMYA 1Z6OM 4XGSA 5FFDA 2V2JA 1B71A 3BVFA 4XKUA 1YUZA 2MGYA 3R2LA 4LYUA 1FHAA 1XZ1A 5CZUA 3PW8C 4CYAA 4MJYA 3E1OA 3BVEA 2AR0A 3WVWA 4CYBA 2WWXB 3E1LA 4RC7A 2IU2A 1JKVA 4DE6A 2G38B 1GWGA 3UOFA 2C2UA 3GGZA 3HL1A 3PVRB 3Q4QA 2V8UA 3DBYA 2BJYA 4PGIA 5GN8B 1ZS3A 4XKTA 2V2SA 3IQ1A 4WJG4 4Z5SA 3AJOA 3OGHA 3BVIA 5D8OA 4ITWA 3EGMA 3KA3A 4AM5A 2VXXA 2FJCA 3AJQA 4W4LB 5E1UA 3RBCA 3PZAA 4DZ0A 2G4HA 4RC5A 1VEIA 3Q4OA 2Y44A 4P18A 3PVTA 2OKCA 3BKNA 1SQ3A 3F35A 2V2RA 2ITBA 2D5KA 3PW1A 1LKPA 2X170 1MOJA 4DI0A 3F33A 2CIHA 2RBDA 2YJJA 3W54A 3VV9A 5JACA 1VLGA 1O9IA 1BG7A 3R2RA 4MY7A 2V2NA 2ZG8X 3KHKA 5ERKA 4E6KA 2WTLA 5JKLA 2YW7A 5J8WA 4RC7B 4ZMCA 3E1PA 1VELA 2ZA8A 3C1YA 2CN7A 2V8TA 3KA4A 4MKUA 4II4A 5CMQA 4CMYV 4LQJA 4DYYA 4LQVA 1AEWA 4LPJA 3SH6A 3AJPA 4ISMA 5FFEA 3WNWA 2FZFA 2Y3QA 4ZKXA 4TOGA 4TW3A 4Z3BA 4TO9A 3BVLA 1LB3A 4LPMA 4R42A 3AF7X 2GS4A 5D8RA 1DATA 2YJKA 3F36A 1S3QA 3R2KA 2C2FA 3VVAA 3QVDA 4RC5B 5JKMA 4EVBA 3JZAB 3PWFA 5D8PA 3PVTB 1RCIA 3F32A 1O9RA 4TOHA 4YKHA 3RD0A 3PW1B 2IY4A 3C23A 4RC6B 5FFAA 2BW1A 2CLBA 2CHPA 5LG2A 4IWJA 4LYXA 3NP2X 2OC5A 1F33A 5E2DA 1QGHA 2Z5QA 2W0OA 3KDQA 2JD80 1UMNA 3LKDA 1JREA 2WLAA 3N6OA 3OJ5A 2V15A 2CWLA 1RCDA 3IS7A 4II4B 3EZ0A 2CLUA 1BFRA 3BVKA 1NF4A 2C41A 4M35A 4M32A 3AK8A 2V2OA 3E1JA 3V3KB 4CVSA 4E40A 3QD8A 1Z4AA 4TOCA 3Q4NA 3FVBA 3PWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YV1 A;  5HQO A;  3ERZ A;  2CHI A;  2XKQ A;  2FL0 A;  5I4J A;  3ES3 A;  3QHB A;  4PG0 A;  2FKZ A;  4PGK A;  3WVU A;  1UVH A;  3GHQ A;  5C6F A;  3TA8 A;  5FEJ A;  5GU0 X;  4TOE A;  4ITT A;  1RCG A;  5HJF A;  1DPS A;  3KXU A;  4ISP A;  5D8Q A;  5GU1 X;  4M34 A;  5J9V A;  1RCE A;  4KVS A;  2XJO A;  3Q4R A;  1R03 A;  1NNQ A;  2JD6 0;  4TOB A;  1RYT A;  3O7S A;  3NP0 X;  4U3G A;  1JGC A;  2XGW A;  3HIU A;  3GVY A;  1VJX A;  2PYB A;  5D8Y A;  4IWK A;  4XKS A;  2HR5 A;  2C6R A;  2BKC A;  4ZLW A;  3T9J A;  3A68 A;  3QZ3 A;  3ISF A;  1S30 A;  2UX1 A;  3UNO A;  1TJO A;  3MPS A;  2QF9 A;  3E6R A;  4TOD A;  1IER A;  1SOF A;  2VZB A;  4MN9 A;  2CF7 A;  3QHC A;  4ZTT A;  1TKO A;  3F34 A;  4QUW A;  2QQY A;  2XJM A;  5GOU A;  5IX6 A;  1JKU A;  2F7N A;  4AM2 A;  3U90 A;  3H7G A;  4A25 A;  5LG8 A;  1F30 A;  4ERU A;  3KX9 A;  1LKM A;  2CEI A;  5GU3 X;  1EUM A;  4ZL5 A;  1DVB A;  5JKL G;  2JD7 0;  3E1Q A;  4ZJK A;  5D8X A;  3RE7 A;  5FFB A;  3UOI A;  2ZA7 A;  2HTN A;  5HJH A;  1LKO A;  1MFR A;  4AM4 A;  3E2C A;  3PW8 A;  3GE4 A;  5FFC A;  1RCC A;  5ERJ A;  1H96 A;  1NF6 A;  4LPN A;  3A9Q A;  4TOF A;  2Z6M A;  3O7R A;  2FFX J;  2BK6 A;  5JKM G;  2Z5P A;  3KA6 A;  4M33 A;  4ML5 A;  4DAS A;  3F38 A;  4KVQ A;  4PG1 A;  4LQN A;  3RGD A;  2V2I A;  3VNX A;  3EZU A;  3SID A;  3F39 A;  4CVP A;  1IES A;  5AXS A;  4EVC A;  1JYB A;  3PVY A;  4TOA A;  4REU A;  4ZKH A;  2V2L A;  3AK9 A;  1S2Z A;  1JTS A;  4KVR A;  4MUD A;  3QB9 A;  5CMR A;  1J30 A;  2ZG9 X;  1ZUJ A;  1TK6 A;  4CVT A;  4ETR A;  3F37 A;  1BCF A;  1HRS A;  3E1M A;  4Y08 A;  2VXI A;  3R2H A;  3RAV A;  3BT5 A;  5J8S A;  4LQH A;  3PWQ C;  2V2P A;  5LBH A;  3R2M A;  1TKP A;  2OH3 A;  1L8I A;  1L8H A;  2FHA A;  3ISE A;  4ZL6 A;  1N1Q A;  3KWO A;  3R2S A;  4RC6 A;  4EVD A;  3SHX A;  3FI6 A;  1VEQ A;  5J93 A;  2CN6 A;  4IXK A;  4CVR A;  2WLU A;  3E1N A;  3SE1 A;  2GYD A;  4DYZ A;  2FG8 A;  4CY9 A;  3WVV A;  4ZKW A;  1JI4 A;  2C2J A;  2XJN A;  5LS9 A;  3PVR A;  3PVY B;  5D8S A;  4OYN A;  1JI5 A;  2ZA6 A;  2ZUR X;  3AF9 X;  1JIG A;  5GN8 A;  3NOZ X;  1OTK A;  3IS8 A;  3R2O A;  4RC8 A;  2Z5R A;  1XZ3 A;  2FG4 A;  3FSE A;  2IB0 A;  2YW6 A;  1Z6O A;  2Z90 A;  4DYX A;  2ZG7 X;  1QYB A;  4EVE A;  1KRQ A;  3KA8 A;  5GU2 X;  1NFV A;  2GYQ A;  5K52 A;  5K53 A;  4DYU A;  1YUX A;  3AF8 X;  2V2M A;  3E6S A;  3KA9 A;  4CMY A;  1Z6O M;  4XGS A;  5FFD A;  2V2J A;  1B71 A;  3BVF A;  4XKU A;  1YUZ A;  3R2L A;  4LYU A;  1FHA A;  1XZ1 A;  5CZU A;  3PW8 C;  4CYA A;  4MJY A;  3E1O A;  3BVE A;  3WVW A;  4CYB A;  3E1L A;  4RC7 A;  2IU2 A;  1JKV A;  4DE6 A;  1GWG A;  3UOF A;  2C2U A;  3HL1 A;  3PVR B;  3Q4Q A;  2BJY A;  4PGI A;  5GN8 B;  1ZS3 A;  4XKT A;  2V2S A;  3IQ1 A;  4Z5S A;  3AJO A;  3OGH A;  3BVI A;  5D8O A;  4ITW A;  3EGM A;  3KA3 A;  4AM5 A;  2VXX A;  2FJC A;  3AJQ A;  5E1U A;  3RBC A;  3PZA A;  4DZ0 A;  2G4H A;  4RC5 A;  1VEI A;  3Q4O A;  4P18 A;  3PVT A;  3BKN A;  3F35 A;  1SQ3 A;  2V2R A;  2ITB A;  2D5K A;  3PW1 A;  1LKP A;  2X17 0;  1MOJ A;  4DI0 A;  3F33 A;  2CIH A;  2RBD A;  2YJJ A;  5JAC A;  1VLG A;  1O9I A;  1BG7 A;  3R2R A;  4MY7 A;  2V2N A;  2ZG8 X;  5ERK A;  4E6K A;  2WTL A;  5JKL A;  2YW7 A;  5J8W A;  4RC7 B;  4ZMC A;  3E1P A;  1VEL A;  2ZA8 A;  2CN7 A;  3KA4 A;  4MKU A;  4II4 A;  5CMQ A;  4CMY V;  4LQJ A;  4DYY A;  4LQV A;  1AEW A;  4LPJ A;  3SH6 A;  3AJP A;  4ISM A;  5FFE A;  3WNW A;  2FZF A;  2Y3Q A;  4ZKX A;  4TOG A;  4TW3 A;  4Z3B A;  4TO9 A;  3BVL A;  1LB3 A;  4LPM A;  4R42 A;  3AF7 X;  2GS4 A;  5D8R A;  1DAT A;  2YJK A;  3F36 A;  1S3Q A;  3R2K A;  2C2F A;  3QVD A;  4RC5 B;  5JKM A;  4EVB A;  3PWF A;  5D8P A;  3PVT B;  1RCI A;  3F32 A;  1O9R A;  4TOH A;  4YKH A;  3RD0 A;  3PW1 B;  2IY4 A;  4RC6 B;  5FFA A;  2BW1 A;  2CLB A;  2CHP A;  5LG2 A;  4IWJ A;  4LYX A;  3NP2 X;  2OC5 A;  1F33 A;  5E2D A;  1QGH A;  2Z5Q A;  2W0O A;  2JD8 0;  1UMN A;  1JRE A;  2WLA A;  3OJ5 A;  2V15 A;  1RCD A;  3IS7 A;  4II4 B;  3EZ0 A;  2CLU A;  1BFR A;  3BVK A;  1NF4 A;  2C41 A;  4M35 A;  4M32 A;  3AK8 A;  2V2O A;  3E1J A;  4CVS A;  3QD8 A;  1Z4A A;  4TOC A;  3Q4N A;  3FVB A;  3PWQ A; 
#chains in the Genus database with same CATH topology
 1YV1 A;  3M6J A;  5HQO A;  3ERZ A;  2CHI A;  2XKQ A;  2FL0 A;  5I4J A;  3ES3 A;  3QHB A;  4PG0 A;  2FKZ A;  4PGK A;  3WVU A;  1UVH A;  3GHQ A;  4YXJ A;  5C6F A;  3TA8 A;  5FEJ A;  5GU0 X;  4TOE A;  4ITT A;  1RCG A;  5HJF A;  1DPS A;  3KXU A;  4ISP A;  5D8Q A;  5GU1 X;  4M34 A;  5J9V A;  1RCE A;  4KVS A;  2XJO A;  3Q4R A;  1R03 A;  1NNQ A;  2JD6 0;  4TOB A;  1RYT A;  3O7S A;  3NP0 X;  4U3G A;  1JGC A;  2XGW A;  3HIU A;  3GVY A;  1VJX A;  2PYB A;  5D8Y A;  4IWK A;  4XKS A;  2HR5 A;  2C6R A;  2BKC A;  4ZLW A;  3T9J A;  3A68 A;  3QZ3 A;  3ISF A;  1S30 A;  2UX1 A;  3UNO A;  1TJO A;  3MPS A;  2QF9 A;  3E6R A;  3L0M A;  4TOD A;  1IER A;  1SOF A;  2VZB A;  4MN9 A;  2CF7 A;  3QHC A;  4ZTT A;  1TKO A;  3F34 A;  4QUW A;  2QQY A;  2XJM A;  4W4K B;  5GOU A;  5IX6 A;  1JKU A;  2F7N A;  4AM2 A;  3U90 A;  3H7G A;  4A25 A;  5LG8 A;  1F30 A;  4ERU A;  3KX9 A;  1LKM A;  2CEI A;  5GU3 X;  1EUM A;  4ZL5 A;  1DVB A;  5JKL G;  2JD7 0;  3E1Q A;  4ZJK A;  5D8X A;  3RE7 A;  5FFB A;  3UOI A;  2ZA7 A;  2HTN A;  5HJH A;  1LKO A;  1MFR A;  4AM4 A;  3E2C A;  3PW8 A;  3GE4 A;  5FFC A;  1RCC A;  5ERJ A;  1H96 A;  1NF6 A;  4LPN A;  3A9Q A;  4TOF A;  2Z6M A;  3O7R A;  2FFX J;  4YVZ A;  2BK6 A;  5JKM G;  2Z5P A;  3KA6 A;  5JDO A;  4M33 A;  4ML5 A;  3FRS A;  3F38 A;  4KVQ A;  4DAS A;  4PG1 A;  4LQN A;  3RGD A;  2V2I A;  3VNX A;  3EZU A;  3SID A;  3F39 A;  4CVP A;  1IES A;  5AXS A;  4EVC A;  4MXP A;  1JYB A;  3PVY A;  4TOA A;  4REU A;  4ZKH A;  2V2L A;  3AK9 A;  2N02 A;  1S2Z A;  1JTS A;  4KVR A;  4KXR B;  4MUD A;  3QB9 A;  5CMR A;  1J30 A;  2ZG9 X;  1ZUJ A;  3FRR A;  1TK6 A;  4CVT A;  4ETR A;  3F37 A;  1BCF A;  1HRS A;  3JZ9 A;  3E1M A;  4Y08 A;  2VXI A;  3R2H A;  3RAV A;  3BT5 A;  3UFB A;  5J8S A;  4LQH A;  3PWQ C;  2V2P A;  5LBH A;  3R2M A;  3GGY A;  1TKP A;  2OH3 A;  1L8I A;  1L8H A;  2FHA A;  3ISE A;  4ZL6 A;  1N1Q A;  3KWO A;  3R2S A;  4RC6 A;  4EVD A;  3SHX A;  3FI6 A;  1VEQ A;  5J93 A;  2CN6 A;  4IXK A;  5JDO B;  4CVR A;  2WLU A;  3E1N A;  3SE1 A;  2GYD A;  4DYZ A;  2FG8 A;  4CY9 A;  5HU6 D;  3WVV A;  4ZKW A;  4YXM A;  1JI4 A;  2C2J A;  3C21 A;  2XJN A;  5LS9 A;  3PVR A;  3PVY B;  5D8S A;  4OYN A;  1JI5 A;  2ZA6 A;  2ZUR X;  3AF9 X;  1JIG A;  3D19 A;  5GN8 A;  4X0J A;  3NOZ X;  1OTK A;  3IS8 A;  3R2O A;  4RC8 A;  2Z5R A;  1XZ3 A;  2FG4 A;  3FSE A;  2IB0 A;  2YW6 A;  1Z6O A;  2Z90 A;  4DYX A;  2ZG7 X;  3C1Z A;  1QYB A;  4EVE A;  1KRQ A;  3KA8 A;  5GU2 X;  1NFV A;  2GYQ A;  5K52 A;  5K53 A;  4DYU A;  1YUX A;  3AF8 X;  2V2M A;  3E6S A;  3KA9 A;  4CMY A;  1Z6O M;  4XGS A;  5FFD A;  2V2J A;  1B71 A;  3BVF A;  4XKU A;  1YUZ A;  2MGY A;  3R2L A;  4LYU A;  1FHA A;  1XZ1 A;  5CZU A;  3PW8 C;  4CYA A;  4MJY A;  3E1O A;  3BVE A;  2AR0 A;  3WVW A;  4CYB A;  2WWX B;  3E1L A;  4RC7 A;  2IU2 A;  1JKV A;  4DE6 A;  2G38 B;  1GWG A;  3UOF A;  2C2U A;  3GGZ A;  3HL1 A;  3PVR B;  3Q4Q A;  2V8U A;  3DBY A;  2BJY A;  4PGI A;  5GN8 B;  1ZS3 A;  4XKT A;  2V2S A;  3IQ1 A;  4WJG 4;  4Z5S A;  3AJO A;  3OGH A;  3BVI A;  5D8O A;  4ITW A;  3EGM A;  3KA3 A;  4AM5 A;  2VXX A;  2FJC A;  3AJQ A;  4W4L B;  5E1U A;  3RBC A;  3PZA A;  4DZ0 A;  2G4H A;  4RC5 A;  1VEI A;  3Q4O A;  2Y44 A;  4P18 A;  3PVT A;  2OKC A;  3BKN A;  1SQ3 A;  3F35 A;  2V2R A;  2ITB A;  2D5K A;  3PW1 A;  1LKP A;  2X17 0;  1MOJ A;  4DI0 A;  3F33 A;  2CIH A;  2RBD A;  2YJJ A;  3W54 A;  3VV9 A;  5JAC A;  1VLG A;  1O9I A;  1BG7 A;  3R2R A;  4MY7 A;  2V2N A;  2ZG8 X;  3KHK A;  5ERK A;  4E6K A;  2WTL A;  5JKL A;  2YW7 A;  5J8W A;  4RC7 B;  4ZMC A;  3E1P A;  1VEL A;  2ZA8 A;  3C1Y A;  2CN7 A;  2V8T A;  3KA4 A;  4MKU A;  4II4 A;  5CMQ A;  4CMY V;  4LQJ A;  4DYY A;  4LQV A;  1AEW A;  4LPJ A;  3SH6 A;  3AJP A;  4ISM A;  5FFE A;  3WNW A;  2FZF A;  2Y3Q A;  4ZKX A;  4TOG A;  4TW3 A;  4Z3B A;  4TO9 A;  3BVL A;  1LB3 A;  4LPM A;  4R42 A;  3AF7 X;  2GS4 A;  5D8R A;  1DAT A;  2YJK A;  3F36 A;  1S3Q A;  3R2K A;  2C2F A;  3VVA A;  3QVD A;  4RC5 B;  5JKM A;  4EVB A;  3JZA B;  3PWF A;  5D8P A;  3PVT B;  1RCI A;  3F32 A;  1O9R A;  4TOH A;  4YKH A;  3RD0 A;  3PW1 B;  2IY4 A;  3C23 A;  4RC6 B;  5FFA A;  2BW1 A;  2CLB A;  2CHP A;  5LG2 A;  4IWJ A;  4LYX A;  3NP2 X;  2OC5 A;  1F33 A;  5E2D A;  1QGH A;  2Z5Q A;  2W0O A;  3KDQ A;  2JD8 0;  1UMN A;  3LKD A;  1JRE A;  2WLA A;  3N6O A;  3OJ5 A;  2V15 A;  2CWL A;  1RCD A;  3IS7 A;  4II4 B;  3EZ0 A;  2CLU A;  1BFR A;  3BVK A;  1NF4 A;  2C41 A;  4M35 A;  4M32 A;  3AK8 A;  2V2O A;  3E1J A;  3V3K B;  4CVS A;  4E40 A;  3QD8 A;  1Z4A A;  4TOC A;  3Q4N A;  3FVB A;  3PWQ A; 
#chains in the Genus database with same CATH homology
 1YV1 A;  3M6J A;  5HQO A;  3ERZ A;  2CHI A;  2XKQ A;  2FL0 A;  5I4J A;  3ES3 A;  3QHB A;  4PG0 A;  2FKZ A;  4PGK A;  3WVU A;  1UVH A;  3GHQ A;  4YXJ A;  5C6F A;  3TA8 A;  5FEJ A;  5GU0 X;  4TOE A;  4ITT A;  1RCG A;  5HJF A;  1DPS A;  3KXU A;  4ISP A;  5D8Q A;  5GU1 X;  4M34 A;  5J9V A;  1RCE A;  4KVS A;  2XJO A;  3Q4R A;  1R03 A;  1NNQ A;  2JD6 0;  4TOB A;  1RYT A;  3O7S A;  3NP0 X;  4U3G A;  1JGC A;  2XGW A;  3HIU A;  3GVY A;  1VJX A;  2PYB A;  5D8Y A;  4IWK A;  4XKS A;  2HR5 A;  2C6R A;  2BKC A;  4ZLW A;  3T9J A;  3A68 A;  3QZ3 A;  3ISF A;  1S30 A;  2UX1 A;  3UNO A;  1TJO A;  3MPS A;  2QF9 A;  3E6R A;  3L0M A;  4TOD A;  1IER A;  1SOF A;  2VZB A;  4MN9 A;  2CF7 A;  3QHC A;  4ZTT A;  1TKO A;  3F34 A;  4QUW A;  2QQY A;  2XJM A;  4W4K B;  5GOU A;  5IX6 A;  1JKU A;  2F7N A;  4AM2 A;  3U90 A;  3H7G A;  4A25 A;  5LG8 A;  1F30 A;  4ERU A;  3KX9 A;  1LKM A;  2CEI A;  5GU3 X;  1EUM A;  4ZL5 A;  1DVB A;  5JKL G;  2JD7 0;  3E1Q A;  4ZJK A;  5D8X A;  3RE7 A;  5FFB A;  3UOI A;  2ZA7 A;  2HTN A;  5HJH A;  1LKO A;  1MFR A;  4AM4 A;  3E2C A;  3PW8 A;  3GE4 A;  5FFC A;  1RCC A;  5ERJ A;  1H96 A;  1NF6 A;  4LPN A;  3A9Q A;  4TOF A;  2Z6M A;  3O7R A;  2FFX J;  4YVZ A;  2BK6 A;  5JKM G;  2Z5P A;  3KA6 A;  5JDO A;  4M33 A;  4ML5 A;  3FRS A;  3F38 A;  4KVQ A;  4DAS A;  4PG1 A;  4LQN A;  3RGD A;  2V2I A;  3VNX A;  3EZU A;  3SID A;  3F39 A;  4CVP A;  1IES A;  5AXS A;  4EVC A;  4MXP A;  1JYB A;  3PVY A;  4TOA A;  4REU A;  4ZKH A;  2V2L A;  3AK9 A;  2N02 A;  1S2Z A;  1JTS A;  4KVR A;  4KXR B;  4MUD A;  3QB9 A;  5CMR A;  1J30 A;  2ZG9 X;  1ZUJ A;  3FRR A;  1TK6 A;  4CVT A;  4ETR A;  3F37 A;  1BCF A;  1HRS A;  3JZ9 A;  3E1M A;  4Y08 A;  2VXI A;  3R2H A;  3RAV A;  3BT5 A;  3UFB A;  5J8S A;  4LQH A;  3PWQ C;  2V2P A;  5LBH A;  3R2M A;  3GGY A;  1TKP A;  2OH3 A;  1L8I A;  1L8H A;  2FHA A;  3ISE A;  4ZL6 A;  1N1Q A;  3KWO A;  3R2S A;  4RC6 A;  4EVD A;  3SHX A;  3FI6 A;  1VEQ A;  5J93 A;  2CN6 A;  4IXK A;  5JDO B;  4CVR A;  2WLU A;  3E1N A;  3SE1 A;  2GYD A;  4DYZ A;  2FG8 A;  4CY9 A;  5HU6 D;  3WVV A;  4ZKW A;  4YXM A;  1JI4 A;  2C2J A;  3C21 A;  2XJN A;  5LS9 A;  3PVR A;  3PVY B;  5D8S A;  4OYN A;  1JI5 A;  2ZA6 A;  2ZUR X;  3AF9 X;  1JIG A;  3D19 A;  5GN8 A;  4X0J A;  3NOZ X;  1OTK A;  3IS8 A;  3R2O A;  4RC8 A;  2Z5R A;  1XZ3 A;  2FG4 A;  3FSE A;  2IB0 A;  2YW6 A;  1Z6O A;  2Z90 A;  4DYX A;  2ZG7 X;  3C1Z A;  1QYB A;  4EVE A;  1KRQ A;  3KA8 A;  5GU2 X;  1NFV A;  2GYQ A;  5K52 A;  5K53 A;  4DYU A;  1YUX A;  3AF8 X;  2V2M A;  3E6S A;  3KA9 A;  4CMY A;  1Z6O M;  4XGS A;  5FFD A;  2V2J A;  1B71 A;  3BVF A;  4XKU A;  1YUZ A;  2MGY A;  3R2L A;  4LYU A;  1FHA A;  1XZ1 A;  5CZU A;  3PW8 C;  4CYA A;  4MJY A;  3E1O A;  3BVE A;  2AR0 A;  3WVW A;  4CYB A;  2WWX B;  3E1L A;  4RC7 A;  2IU2 A;  1JKV A;  4DE6 A;  2G38 B;  1GWG A;  3UOF A;  2C2U A;  3GGZ A;  3HL1 A;  3PVR B;  3Q4Q A;  2V8U A;  3DBY A;  2BJY A;  4PGI A;  5GN8 B;  1ZS3 A;  4XKT A;  2V2S A;  3IQ1 A;  4WJG 4;  4Z5S A;  3AJO A;  3OGH A;  3BVI A;  5D8O A;  4ITW A;  3EGM A;  3KA3 A;  4AM5 A;  2VXX A;  2FJC A;  3AJQ A;  4W4L B;  5E1U A;  3RBC A;  3PZA A;  4DZ0 A;  2G4H A;  4RC5 A;  1VEI A;  3Q4O A;  2Y44 A;  4P18 A;  3PVT A;  2OKC A;  3BKN A;  1SQ3 A;  3F35 A;  2V2R A;  2ITB A;  2D5K A;  3PW1 A;  1LKP A;  2X17 0;  1MOJ A;  4DI0 A;  3F33 A;  2CIH A;  2RBD A;  2YJJ A;  3W54 A;  3VV9 A;  5JAC A;  1VLG A;  1O9I A;  1BG7 A;  3R2R A;  4MY7 A;  2V2N A;  2ZG8 X;  3KHK A;  5ERK A;  4E6K A;  2WTL A;  5JKL A;  2YW7 A;  5J8W A;  4RC7 B;  4ZMC A;  3E1P A;  1VEL A;  2ZA8 A;  3C1Y A;  2CN7 A;  2V8T A;  3KA4 A;  4MKU A;  4II4 A;  5CMQ A;  4CMY V;  4LQJ A;  4DYY A;  4LQV A;  1AEW A;  4LPJ A;  3SH6 A;  3AJP A;  4ISM A;  5FFE A;  3WNW A;  2FZF A;  2Y3Q A;  4ZKX A;  4TOG A;  4TW3 A;  4Z3B A;  4TO9 A;  3BVL A;  1LB3 A;  4LPM A;  4R42 A;  3AF7 X;  2GS4 A;  5D8R A;  1DAT A;  2YJK A;  3F36 A;  1S3Q A;  3R2K A;  2C2F A;  3VVA A;  3QVD A;  4RC5 B;  5JKM A;  4EVB A;  3JZA B;  3PWF A;  5D8P A;  3PVT B;  1RCI A;  3F32 A;  1O9R A;  4TOH A;  4YKH A;  3RD0 A;  3PW1 B;  2IY4 A;  3C23 A;  4RC6 B;  5FFA A;  2BW1 A;  2CLB A;  2CHP A;  5LG2 A;  4IWJ A;  4LYX A;  3NP2 X;  2OC5 A;  1F33 A;  5E2D A;  1QGH A;  2Z5Q A;  2W0O A;  3KDQ A;  2JD8 0;  1UMN A;  3LKD A;  1JRE A;  2WLA A;  3N6O A;  3OJ5 A;  2V15 A;  2CWL A;  1RCD A;  3IS7 A;  4II4 B;  3EZ0 A;  2CLU A;  1BFR A;  3BVK A;  1NF4 A;  2C41 A;  4M35 A;  4M32 A;  3AK8 A;  2V2O A;  3E1J A;  3V3K B;  4CVS A;  4E40 A;  3QD8 A;  1Z4A A;  4TOC A;  3Q4N A;  3FVB A;  3PWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...