4IWMA

Crystal structure of the conserved hypothetical protein mj0927 from methanocaldococcus jannaschii (in p21 form)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
244
structure length
244
Chain Sequence
MKAKEIIEFIETFAPKDLAIEGDNIGLQVGDNLDKEIKKLGIALDPSLSVIKKAEKEGVDFLFTHHPLLKDPIRNFTGVIYKKLKILMENDIILYSAHTNLDICKNGLNDALAELYNLENPKPLYDNGLGRVGIFKGSFEEFLEITKKYIHKNPIVVKSKEVDDNFKLAVLSGYGLSQSSIKYVAEKADVYLSGDLTHHSKILAEELGLVVVDATHYSTEVFGLKKFKEFLSSNLDLEIISLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0135 protein MJ0927
publication title Crystal Structure of the Conserved Hypothetical Protein MJ0927 from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Unknown function
total genus 86
structure length 244
sequence length 244
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01784 NIF3 NIF3 (NGG1p interacting factor 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 4iwmA01
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 4iwmA02
4IWMA 1NMPA 2YYBA 4IWGA 3WSHA 1NMOA 2FYWA 3WSGA 3WSFA 3WSIA 3WSEA 3WSDA
chains in the Genus database with same CATH superfamily
1NMPA 2YYBA 3EEQA 4QF5A 4BUBA 1NMOA 1KNXA 3L31A 4C13A 4CVLA 2IOJA 4IHFA 3WSDA 3WSIA 3ZL8A 3WSHA 4E75A 2AM1A 3ZM6A 4C12A 2XJAA 3WSFA 2IU8A 4IWMA 4ZIYA 2IUAA 2FYWA 4IHGA 3WSEA 1GG4A 3EH0A 1KO7A 3L2BA 4IWGA 2AM2A 3PMOA 4CVMA 4E79A 1E8CA 4IHHA 4CVKA 3ZM5A 3WSGA 4QDIA 2IU9A 2WTZA
chains in the Genus database with same CATH topology
4IWMA 1NMPA 2YYBA 4IWGA 3WSHA 1NMOA 2FYWA 3WSGA 3WSFA 3WSIA 3WSEA 3WSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IWM A;  1NMP A;  2YYB A;  4IWG A;  3WSH A;  1NMO A;  2FYW A;  3WSG A;  3WSF A;  3WSI A;  3WSE A;  3WSD A; 
#chains in the Genus database with same CATH topology
 1NMP A;  2YYB A;  3EEQ A;  4QF5 A;  4BUB A;  1NMO A;  1KNX A;  3L31 A;  4C13 A;  4CVL A;  2IOJ A;  4IHF A;  3WSD A;  3WSI A;  3ZL8 A;  3WSH A;  4E75 A;  2AM1 A;  3ZM6 A;  4C12 A;  2XJA A;  3WSF A;  2IU8 A;  4IWM A;  4ZIY A;  2IUA A;  2FYW A;  4IHG A;  3WSE A;  1GG4 A;  3EH0 A;  1KO7 A;  3L2B A;  4IWG A;  2AM2 A;  3PMO A;  4CVM A;  4E79 A;  1E8C A;  4IHH A;  4CVK A;  3ZM5 A;  3WSG A;  4QDI A;  2IU9 A;  2WTZ A; 
#chains in the Genus database with same CATH homology
 4IWM A;  1NMP A;  2YYB A;  4IWG A;  3WSH A;  1NMO A;  2FYW A;  3WSG A;  3WSF A;  3WSI A;  3WSE A;  3WSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...