4IX4A

Crystal structure of a stt7 homolog from micromonas algae in complex with adp
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
346
structure length
346
Chain Sequence
b'LKARGGPKTLRRTPGVEPKDIRVLPGPLGSGNFGTVFRGVFKGDQDVVLKNAKADVMAAEELLECEMDVNYHVHANAKGTCARFMGCIELGAKDGGEIYNGTLTEGLWLMWANEGENTVEALMRRGTAPLATAMACADATELGVTKKAMRELLGSLARLHECGVVHRDVKPANLIAAEKDGGVLKLIDLGAAALCLPLPETLNYYPGDGPADPRYAKADELYLLPPGSPRPTKDNAAKLWEAHKPDRFDSWSAGCVMLQLAVVGLRTDAGLERFLADYKAVGYDVNAFRGEKSGEYGTMDFAALDANGGAGWDLCQRLMEAERDARASCEAALSHAFFDAAALEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MsStt7d protein
publication title Structure of the catalytic domain of a state transition kinase homolog from Micromonas algae
pubmed doi rcsb
source organism Micromonas
molecule tags Transferase
total genus 105
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ix4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ix4A01
2PMIA 3UZTA 3VWAA 2VTRA 3THBA 4X3FA 2XIZA 3P7BA 4NK9A 2IPXA 1CKJA 4KKEA 4XHKB 4E6AA 1OIQA 3ERKA 3ZU7A 4XLIA 1W82A 5HIBA 4ANNA 4J8MA 3R7VA 4CRLA 4FG8A 5CAPA 3OCBA 3HYHA 2XNBA 5GINE 3VBWA 1PXJA 3OUKA 2XK3A 2ETKA 5ANGA 5C4LA 2VAGA 4U7ZA 4OT5A 4AZTA 4WNPA 1MRUA 4NJDA 5C1QB 3ZUVA 3V8WA 3DZOA 4CVAA 2YITA 3CIKA 4AZWA 3SX9A 2B9FA 1UNLA 3DDQA 4E6QA 3UOJA 5DT0A 2IZTA 5AP1A 2C6DA 3E8DA 3D2IA 3O51A 4DEGA 1E1XA 2HW6A 4I5CA 4X0MA 4YNOA 2VU3A 3F6XA 4D2TA 3UP7A 4DFLA 2QOQA 2ZJWA 3HRFA 4WD5A 1H07A 4QYFA 4QPAA 3VF8A 2X8IA 3R6XA 4F7SA 4FSNA 4RIWA 3W32A 3JUHA 3HAMA 1XJDA 1I09A 3MIYA 4QMTA 2YWPA 3EKKA 3O50A 2AC5A 5IA4A 3ZRMA 4MXOA 2UVXA 4QP2A 1BL6A 2AYPA 3QX2A 4CYJA 1UWJA 4USDA 3VVHA 4FTCA 4I4EA 4IZAA 5DE2A 5EW3A 1OB3A 5EH0A 3OCTA 1FMKA 4O0TA 5TKDA 1NVSA 1W83A 3HAVA 4LFIA 5JGAA 4TWCA 4LGDA 2C30A 2YM5A 3FZTA 3I60A 3QRTA 5E8SA 3WZDA 4ASEA 1KV1A 3VUMA 3KFAA 1Y8GA 3F2RA 3MPTA 3ELJA 1K9AA 4U0IA 2BAKA 5DR9A 3U9CA 4EOLA 2GHLA 1YKRA 2XIKA 4IADA 5CTPA 5FTOA 3BWJA 5T68A 4F1MA 3BHUA 4BCNA 3C4CA 4DITA 5HLPA 3GCVA 4B8MA 1F0QA 3VW8A 3EQFA 4HCVA 2BRBA 3GT8A 3CQWA 3OT3A 2RKUA 3FWQA 5HG8A 2QO2A 2PE0A 4G16A 1CM8A 1YDTE 3PP1A 5DFPA 1WBSA 1M17A 2DYLA 1ZLTA 4U3YA 3BHHA 4O2PA 5LMBA 4MF0A 4XOZA 1PKGA 3AMYA 3I81A 1YOLA 3DAKA 4FICA 2CDZA 4FV7A 4QP6A 3HA6A 4EQUA 1J7LA 2F57A 3PJ1A 1KOAA 4O1PA 4XV3A 2WMQA 3TEIA 4JT3A 1KUTA 2R3KA 2OU7A 2X4FA 4B7TA 5CEPA 3AGLA 4LQMA 2IG7A 2BAQA 3LXLA 4GH2A 2VO7A 2XK7A 2VWIA 4FV4A 3IG7A 4FK6A 2QKWB 4CD0A 3UQGA 3WF8A 3D94A 3NAXA 4M13A 4AOIA 2C6MA 2QQ7A 1LEZA 3W10A 2R2PA 3WZKA 3ZYAA 4EL9A 1Z5MA 4QMUA 3C50A 3BU5A 3ZXZA 5EQPA 2XNPA 2UW5A 3DV3A 3L9NA 1H0VA 2Y4PA 4QTEA 4GFOA 1IASA 3DOGA 2X4ZA 2YACA 3PSBA 4C3PA 1XKKA 3FC1X 4HNIA 4RIYB 4JOAA 4BDCA 2C68A 4FI1A 4N70A 5IQEA 3ORNA 3TUBA 4WNMA 4AT3A 3QKLA 3DK6A 4OBQA 4YJVA 5EFQA 2WMBA 1SNXA 5IQDA 3QCXA 3QWJA 3BKBA 2ITVA 4GYIA 4K33A 4AU8A 5I4NA 2PWLA 5ITAA 3IK3A 4CV8A 4CFNA 3LVPA 5FM3A 1PXLA 1XH9A 1YOMA 1NXKA 2VO0A 3A7JA 4EQCA 3RCDA 4DFBA 3QUEA 2EUFB 4PMSA 4DH3A 4MQ1A 2B4SB 4WHZA 5LCKA 4YZMA 4PWNA 2W1EA 3QD2B 2GTMA 3V5PA 4ACGA 2BCJA 3DAJA 3OY1A 2C5NA 3RGFA 4K77A 5FLFA 3MH2A 3G0FA 2R3GA 5HE1A 2R0IA 4EH2A 3UG1A 3PWYA 4PPBA 2A4LA 1Q8YA 1H00A 1NVRA 3MDYA 2QKRA 4Q5EA 3VBYA 4ACCA 5DGZA 4BDFA 4QMVA 1GZNA 4V04A 5JEBA 4FYOA 5HICA 4HGLA 3KRXA 4XBUA 4C59A 2ZV2A 4EK5A 2Y4IC 3ETAA 4QNYA 3AD4A 4IM2A 3ZEPA 4QP3A 1J1CA 3FL5A 2QG7A 1OBGA 1FBNA 3P86A 4YSJA 2R3LA 3FLYA 5D7VA 1PMEA 4EH3A 4G9CA 4XLVA 4W8EA 2JGZA 4RX5A 4PTGA 1YWRA 2CCIA 2IJMA 4EZ7A 1M52A 3OOGA 4YC6A 5GJGA 2GU8A 5CU0A 3KQ7A 5IH5A 4RGJA 5I9ZA 3FEGA 5CLPA 4FV6A 5CNOA 3NW5A 4IC8A 2UZEA 2VTHA 3HP5A 4PPCA 2ITXA 1YI3A 1Q3DA 5HQ0A 3NEWA 4PDOA 2BZKB 2PVNA 2UUEA 5DVRA 5BQ0A 3FMJA 4DCAA 3PLSA 4BFMA 1HCLA 2OJIA 4E73A 2PVKA 4LL5A 3P4KA 4CT1A 3L8XA 4GJ3A 5J1WA 5TT7A 5KMJA 1U4DA 1Q8WA 4OTFA 3KF4A 3LCDA 4AA4A 3GENA 4ZJIA 4F63A 5HLWA 2YM7A 2YZLA 3NVMB 2P3GX 4QP9A 2R9SA 2B9JA 5BPYA 5M06A 3C5IA 4EH6A 4L8MA 3ZUTA 3F82A 3ZBFA 4BWKA 4X3JA 4MCVA 4XG8A 5A6NA 4L00A 4C4EA 1YW2A 4D2PA 4QQCA 4QTBA 4BHZA 2QOKA 2OKRA 5L6PA 3N4VA 3PXZA 3VJNA 4M68A 4AQCA 4Z7HA 3LOKA 4M67A 2XCHA 1OMWA 3DTCA 4FZ6A 3ZOSA 4HVDA 2WMUA 3KK8A 2PZYA 5F20A 2UW7A 3NZ0A 4AT5A 4MBJA 3H30A 4R6VA 4KRDA 1IR3A 5HCZA 2PUUA 4WSQA 4WT6A 2CGWA 4CQGA 1AD5A 4USFA 3SG9A 3FSFA 4OLIA 2C1AA 3GXLA 1L3RE 4IB5A 4U5JA 4UYNA 5CVFA 1UWHA 1PMUA 4FMQA 4H1MA 3VBTA 4BCGA 4O86A 4PNKA 5B7VA 4J1RA 5AV4A 3M1SA 5EHOA 3T8OA 4BKZA 3PIXA 4CXAA 5IA2A 3R8PA 3NPCA 3KXHA 4ZJJA 3ZC6A 4UWBA 3LMGA 3RHXA 2W1FA 5CAVA 3MTFA 4FV0A 1KE8A 3QD4A 5BNJA 3BE9A 3F61A 1UU7A 2H9VA 2PVHA 3QZFA 5AX9A 5CF6A 4FKLA 4AW2A 3MJ1A 4E6DA 3ATTA 5FTGA 3NUAA 5B2KA 3ZCLA 3W55A 2IVVA 2WELA 3ORXA 1W84A 3OFMA 4FKOA 4TRLA 4CNHA 5BUEA 1X8BA 5JMSA 4DGNA 5M44A 1URWA 3HV3A 3QHRA 5IMXA 4KINA 3SW7A 1UU8A 3FXXA 4FIGA 4HGSA 5HTBA 3UO5A 4DG0E 3ZSHA 3NUSA 3TWJA 3CXWA 3M2WA 2OZAB 4ANMA 3WZEA 4DLJA 2BIKB 3EFKA 5J87A 2I7QA 1PRYA 3DJ5A 5DNRA 3RWQA 5HBEA 3JVSA 2QC6A 2W06A 3CBLA 2YDKA 3P79A 5HX8A 3U87A 2V7AA 4F6WA 2EXEA 3EH9A 3DU8A 3LIJA 5EG3A 1WBVA 3C4FA 2VTPA 3UGCA 4BVUA 2JBOA 1P4OA 2F4JA 4FTIA 4NW6A 4MBLA 5I9XA 2Y6OA 4UBAA 2C69A 3W2QA 4ZZOA 5LQFA 4HOKA 2YIXA 3A60A 1KOBA 2R7IA 1Q4LA 3NIZA 3QZGA 4FZ7A 4HGTA 3VIDA 4AZVA 2YWVA 1Q8ZA 3WF9A 2O2UA 2XK4A 4IW0A 2IZRA 3QBNA 5DHJA 1TKIA 1XH4A 4FKVA 4JQ8A 1AQ1A 3EQIA 3KL8A 3UVQA 5AUZA 1G3NA 3RVGA 5JFVA 3R9DA 3NUXA 4IZYA 3EIDA 4DFUA 4KB8A 2WB8A 5J9LA 3QU0A 5ANOA 4AX8A 3VS6A 5C01A 3O8PA 4MXZA 3FHRA 1ZAOA 2V22A 2E9NA 3FXWA 4E6CA 3DBEA 4I0SA 2E2BA 1XBCA 1G5SA 2X39A 2CN8A 4WO5A 4F08A 2PHKA 2ITTA 1ZXEA 2UZVA 3KN5A 3KU2A 4E20A 5EDRA 4YO4A 4ZS4A 3FDNA 4JRNA 2GHGA 4MWHA 4FKGA 4JG7A 4IB1A 3UC4A 3WZUA 5KHWA 3ZM9A 1V0PA 2GCDA 1SVGA 5AUVA 4F09A 4F4PA 4EQMA 4HVHA 3EJ1A 1JNKA 5FG8A 2IVTA 4H36A 4BDJA 4HGEA 4Q5HA 3F69A 3FI2A 1XHAA 4MYGA 5AR8A 4C4FA 1XBBA 1PXMA 5FM2A 3FV8A 4BDIA 5KMKA 4DTBA 3Q6UA 4IAZA 4IM0A 3R01A 2J9MA 2GNLA 4UALA 4F9BA 5AAEA 3NYOA 4QQJA 4BIBA 2XUUA 3LFAA 4WRSA 3QQFA 5AA8A 1OPKA 2X1NA 3UQCA 4CV9A 4IAIA 3R7OA 3HV5A 3F3UA 3HP2A 3D15A 3EYGA 2Y8OA 1R0EA 2HYYA 2WTKC 1M7QA 2Z7QA 3TIZA 4IACA 3HECA 4S31A 5KHXA 1FVTA 2YHVA 4H05A 4I5MA 4V05A 3OZ6A 3R7UA 3TKHA 1DS5A 4YNEA 1PXOA 3IONA 2KTYA 5AIRA 3VBQA 3HDMA 4C35A 4EEVA 4EOQA 1WBWA 3PXYA 4ALVA 5HE2A 3NLBA 4EBVA 4IJ9A 3G5DA 5F95A 3C5UA 4LRKA 4IFCA 4EHVA 2I40A 3W16A 4EJ7A 3SRVB 2IN6A 4ENXA 1ZMUA 3UTOA 4GU9A 3M42A 2O8YA 2IWIA 3E8CA 4EORA 4O82A 4GJ2A 3BEAA 5LMKA 2WZJA 5LVLA 2C3IB 3QA0A 2XJ1A 3ET7A 4YTIA 5HEZA 3ULIA 2EXCX 4KAOA 4P5QA 2PMLX 3FKOA 2JDSA 2DUVA 5K3YA 1E1VA 4EJNA 4C02A 2X2MA 3ZDIA 4FVQA 2BVAA 3OTUA 4GUBA 5HVJA 4XUFA 4JDJA 4LRJA 3GFEA 3R8LA 1CKPA 3PWDA 4CRSA 5ICPA 5HORA 4DGMA 4LGGA 3COHA 2QU6A 3EYHA 5A46A 5KCVA 5A4CA 3KK9A 4FG9A 4RQVA 4O7YA 5BVFA 5CALA 4TYJA 4OAUC 3LZBA 4O2ZA 2YABA 4ERWA 3QXPA 1LP4A 3EQHA 4J99A 3SC1A 3VRYA 3TNPC 2OSCA 2Z2WA 3PJ3A 3Q96A 1K2PA 4FKWA 4QMSA 5DR2A 5AWMA 5HO6A 1UKIA 5G6VA 4M0ZA 3FAAA 2O0UA 2QODA 3CTJA 3HZTA 2GNHA 3UNZA 4BGHA 3S1HA 3UVRA 4MNEA 4LOQA 3UPXA 4XJ0A 4HCTA 4NFMA 3EFWA 4Y8DA 5HNBA 4FK3A 2J0IA 4E5WA 5HD4A 4O0VA 4L46A 4UXQA 4M69B 3QTZA 1V0BA 2XRUA 2ESMA 2VTIA 4IWDA 3V6SA 4DFNA 5FDXA 2XKFA 4XP0A 3KN6A 5J9ZA 4KIKA 4XEYA 1MP8A 3A8WA 4ANOA 1M14A 5CANA 5CF8A 3Q9XA 4I6QA 3KRLA 3RALA 3CSVA 2XS0A 4AG8A 2WXVA 2X8EA 3R7EA 5AUYA 4R5SA 1GY3A 1PKDA 3IPHA 3LFEA 3VS7A 2QG5A 3SAYA 4EHGA 3FI8A 2Y6MA 3FE3A 3NYVA 2JIIA 2VNWA 3Q3BA 2VNYA 3UMXA 1IG1A 4KIKB 3C4XA 4U45A 3BRBA 5CU4A 4XG9A 4X7QA 2W96B 4D9UA 5BX0A 3MESA 1JKKA 3O8UA 3OBGA 4JNWA 3BQCA 1UU3A 2B53A 4GL9A 4RRVA 4DLIA 1QPJA 3RK7A 1V1KA 5L2IA 4EYJA 1RJBA 3V5TA 1J7IA 1YWNA 3Q4ZA 3ENMA 4G34A 4C62A 4PNIA 2W1ZA 4LMUA 5LVMA 5E4HA 3ORLA 4QMPA 2HZIA 3Q60A 4MEDA 4RWIA 1QPDA 4DEBA 5AIKA 4YJUA 2YLFA 4QYEA 4GT5A 4J98A 4S34A 4BZNA 2VTOA 2W4OA 2BMCA 5CU3A 5EM5A 5H8EA 3UYTA 5HG9A 2G2HA 5K9IA 4BKYA 4L45A 4PDSA 1A06A 1O9UA 4U41A 2ITUA 3IW5A 5GJFA 2CNQA 4ZEGA 3OWJA 3MYGA 3E8NA 4Y73A 3D4QA 4CT2A 2WU7A 3C1XA 4LYNA 3EMGA 4UYAA 3TACA 3ACJA 3MVMA 1OM1A 1WBOA 5IA5A 5I5ZA 1P5EA 1ZMWA 2ZV8A 3HX4A 5CZIA 4FA2A 1B6CB 4LOOA 3QQKA 3E5AA 3IECA 4OR5A 5BYZA 3EHAA 2JKMA 3HMPA 3CP9A 4C36A 4ZAUA 1H24A 4MK0A 2JD5A 2YM8A 4ZMEA 5AR4A 4D0XA 2CKOA 2HWPA 4BTMA 2YM4A 3Q5IA 4C0TA 4DTKA 3ZONA 2ERKA 2RGPA 4JX7A 3LJ2A 4DGOA 2GQRA 5TE0A 4OTDA 2VWYA 4G3EA 4GK4A 3MY5A 2B9HA 4BTKA 3HMIA 3RAKA 4UZDA 5ETFA 4F7NA 1APME 5L8LA 2QOHA 4R77A 5AV1A 4JXFA 3C4WA 2YDIA 4PP9A 4EOMA 3ORKA 4YLLA 2W1HA 4IAFA 4IQ6A 1UNHA 3L8PA 4XG7A 1YXSA 4M66A 5LMAA 3TNWA 3O0GA 4IX6A 3UZRA 3FMLA 3D83A 4EHZA 2C5OA 4PX6A 3V5JA 4ARKA 4D9TA 3POZA 3RHKA 1REKA 2IW6A 2PY3A 4KWPA 5IA3A 3DCVA 4FKUA 3UZPA 5CU6A 3RM7A 3ZO2A 2RL5A 2R3RA 2XKCA 3B2TA 5J8IA 1NY3A 3L8VA 4HZRA 4NM3A 4W4YA 3PA5A 2AC3A 4N6ZA 4DEDA 4C37A 3LPBA 4O6EA 5DLSA 3U6JA 4YHJA 4L44A 5K0KA 4MX9A 3ULZA 4CFFA 2J5EA 4AOTA 4UN0C 3QZHA 3UIUA 4R5YA 2XB7A 5KNJA 5ACKA 2NNWB 2UVZA 5BMSA 3O96A 3DB8A 2Z7RA 4PDPA 1R3CA 3S4QA 1JQHA 5ANEA 1J3HA 3PSCA 3ANQA 3EN7A 5HNIX 4ANQA 3KVWA 2YERA 4FTLA 1GIIA 2PE2A 4OTHA 3NNUA 4AP7A 5M4IA 4LL0A 1PMNA 4FKSA 4JVGA 4L3PA 3RAHA 4AAAA 2BRGA 4HNFA 4CMOA 3H3CA 4HVGA 2DQ7X 4DGGA 2GSFA 3QRUA 4AN9A 4X2JA 4AN2A 4BCPA 3V01A 3OVVA 4YJPA 1CSNA 3JS2A 3NUYA 4YJOA 4JR3A 4D5HA 5GZAA 4R7IA 5C03A 3ID6C 3D5XA 1U59A 4FKRA 4O7RA 4I4FA 5A4QA 4RSSA 4X6RA 1OZ1A 4CTCA 1E9HA 3AT3A 3KRRA 3COMA 2WIPA 3K5UA 1SVEA 3MVLA 5BMMA 5LARA 2BPMA 4S32A 3LQ3A 2ZM1A 4A07A 3HA8A 3NR9A 4C3FA 4CLIA 1WVXA 2G01A 1OBDA 4X2GA 1W8CA 3PPZA 3LFNA 3S3IA 3MBLA 3VHKA 2WQNA 1PJKA 3Q52A 4BYJA 4D28A 3FQSA 3BE2A 1DAYA 4G2FA 4RJ4A 2Z7LA 4Y85A 4BGQA 2FSMX 2J5FA 2VO6A 2GQGA 4L7FA 4ANLA 3GC8A 2HZ4A 3PIZA 4QTDA 3R1QA 4LRMA 4B9DA 2G9XA 5AMNA 3DLZA 4B6LA 4CKJA 5M4CA 3PSDA 4M12A 5EYDA 3NYNA 5AR2A 1R1WA 2HCKA 2CLQA 4GEOA 2W99B 4TPTA 4ACMA 2P0CA 3WZJA 4IVDA 3P7CA 4U3ZA 3BGZA 4P90A 4I6FA 3F5PA 1WFCA 1OPJA 1Y6AA 4TWPA 2BDJA 3ORMA 5L8JA 4ZTRA 4WG4A 3ZO1A 4KKGA 2BDWA 4JDIA 3BELA 4LGHA 5GHVA 4M8TA 3TTJA 5M4UA 5JGBA 1BUHA 1O6YA 5HU3A 3IKAA 3E87A 2PVRA 2VTQA 5CF4A 2X81A 4AGDA 5KBQA 4PP7A 4F9WA 3KCFA 4CSVA 2XEYA 4E26A 3UJGA 3F3ZA 1U5QA 2I0VA 2C0TA 2YCFA 3RK5A 2R3JA 5IUGA 3FL4A 5E91A 4CMTA 5K4IA 4W8DA 4X2NA 2RFDA 2FYSA 4ONAA 5BVWA 2ITQA 1YI4A 4QYYA 1JAMA 5D10A 4ZSJA 4XV2A 2P55A 3R28A 2GDOA 3A7GA 3HMOA 2C5VA 4NSTA 3PG1A 2XK9A 3EN6A 3VHEA 3KULB 3ZC5A 4E93A 2PVMA 3QC9A 3HDNA 5EQYA 4JAJA 4KIOA 1LEWA 4CZUA 3KCKA 5CEQA 3CJFA 2YAKA 4FKIA 5L6WL 4G6OA 4IE9A 4QMQA 3MFRA 1GIJA 4H3QA 4FR4A 5I9VA 1JWHA 3DK3A 4MWIA 5CX9A 4TYHB 2XCKA 2YCSA 3DKFA 1YWVA 1BKXA 3QUPA 4K1BA 4LV8A 4XYFA 2QONA 5AR7A 3ZUUA 2X7OA 1W7HA 3HNGA 3DS6A 3OWLA 2F2UA 4BI2A 4O27B 4IWQA 4WOVA 5EHYA 5K5NA 2J7TA 5FUTA 5ANDA 5CASA 3CQEA 4KS7A 5CAOA 2XK8A 3OEZA 1VYZA 1IRKA 4KD1A 5IQCA 4PQNA 2CGVA 2HW7A 4MKCA 4MD9E 4ASZA 5CAUA 4YTHA 3R83A 5I3RA 4OBPA 3CD8A 4AW0A 4UXLA 4IZ5A 3KB7A 2EWAA 3F7ZA 3R1SA 5HG7A 2O65A 2G2FA 2VTSA 4WG5A 2UW4A 1KSWA 2GS7A 2PTKA 3VNTA 3FPQA 3CGOA 4O7WA 3GC0A 5EW9A 3P0MA 5HO7A 5JKGA 4QTCA 4RPVA 5IZFA 5LJJA 3GVUA 3RJCA 4HYIA 3QQGA 5HE0A 4GFMA 3TV7A 4ZSLA 4JDKA 2ZVAA 4QTAA 4RLKA 4RJ8A 4YPSA 3F2AA 4EWHA 3FMDA 4JQEA 3OCGA 5HX6A 1PW2A 4FUYA 3RK9A 1WVYA 2QURA 2VWUA 4K0YA 3UYSA 1WAKA 3D5WA 4GVAA 4JBPA 2ITZA 4F9AA 2O63A 2QR8A 5IEVA 4NUSA 5EYKA 4DBXA 4A9RA 4UWCA 4G3FA 3KY2A 2BIYA 1CKIA 4F0GA 3QYWA 2ZV7A 4RIYA 3MVJA 5HLNA 3R8MA 2WGJA 4DH7A 3F3VA 3JVRA 1XH8A 2W5BA 3V3VA 5E8YA 3BYVA 2IW9A 2NRUA 4DYMA 5EM7A 3MN3A 4XG3A 3UE4A 2I6LA 4U80A 2EB2A 2VTMA 2OIBA 4O0SA 2BKKA 4J97A 2XF0A 4F0FA 4U8ZA 2WTIA 4GT4A 3EFJA 1WVWA 2RG5A 3W8LA 4C3RA 3IW6A 3PTGA 4ITHA 2E9UA 1ZRZA 4YJTA 5IISA 3CC6A 2J4ZA 3U4UA 4XBRA 4E4MA 1OECA 3I6UA 5IG1A 4IVBA 3TI1A 5AP6A 5CEKA 2XEZA 4ZIMA 5CYIA 4XNEA 4D2WA 5HU9A 5HD7A 4HYHA 4I41A 5IUIA 1ZYDA 4KSQA 4AZFA 1HOWA 3LJ1A 1NW1A 4C4IA 4QRCA 2F2CB 4RVMA 2H34A 2OF2A 3LM0A 1H01A 5LMKC 1STCE 2WO6A 4RG0A 5IQAA 2C3KA 4C2WA 1V0OA 3OW4A 5ETCA 2GS6A 3BBTB 3CY2A 3GFWA 4M15A 3E93A 4O1OA 4OGRA 1L8TA 4BI1A 4ZSAA 2X9FA 2RFEA 3F7WA 5HIDA 3C4EA 2X8DA 5E8ZA 4RC3A 2W7XA 2FB8A 4RVTA 2E9OA 1YHVA 5ETAA 5DBXA 3U8WA 3FXZA 3IDCA 3Q5ZA 4W4WA 3W33A 3C9WA 3ANRA 5IH6A 3HVCA 5JT2A 3S0OA 3AC2A 4FBXA 3B8QA 1OUKA 4YHTA 5H2UA 5HBJA 4U79A 4YHFA 5J9YA 5CWZA 3IGOA 4GV1A 4O81A 2GTNA 2A1AB 2IZUA 4QMLA 4A4LA 4LV5A 5HZNA 3L9PA 5IU2A 4EC8A 4Q9ZA 3E62A 1Q5KA 2IO6A 2FVDA 2H8HA 5JGDA 5M4FA 2FO0A 3BCEA 1H28A 2GPHA 4NFNA 4F65A 3HRCA 3U6IA 2BHHA 3NS9A 3PVGA 2FSTX 2OBJA 5HCXA 2CJMA 2VX0A 3FKNA 3FZOA 4FKQA 2VTAA 2GNFA 4DEEA 3PDTA 4U44A 3TNIA 4PPAA 3KMWA 2WTDA 2REIA 3U55A 3V5LA 3G9LX 3BQRA 2OXYA 4ZZMA 3IOPA 4BF2A 3PG3A 4G3GA 5LOHA 3NNXA 1IA8A 1VEBA 3F3TA 1AGWA 4O38A 4F7JA 5ACBC 5DPVA 2OWBA 3Q9WA 3UIBA 4E7WA 2JKKA 3Q4CA 4FTUA 1JVPP 4IX3A 4EH7A 3ZO3A 3I6WA 3KXXA 3R2YA 4HCUA 2HZNA 2WMAA 3DZQA 4ZTLA 3E3PA 3FLWA 5AP5A 5F1ZA 1H4LA 3MH1A 1QCFA 4L3JA 2ZAZA 4RQKA 3UOHA 5AP7A 5L3AA 3PVWA 3R04A 3D14A 4ITJA 4DGLC 1UNGA 4UEUA 3OF0A 2C3LA 1PY5A 2W5AA 3EQPA 2UZDA 5CQUA 2WD1A 5AUTA 3JPVA 1KV2A 2JITA 3CTHA 2JFMA 4JAIA 4ZY6A 3R21A 3R8ZA 2W1IA 4JL9A 5E8WA 5A14A 5H8GA 1FGKA 2NP8A 3DFAA 4A9SA 2FUMA 3F3WA 4QP4A 2F49A 1J7UA 4X6QC 2P2HA 4RX7A 4E1ZA 1QMZA 4TTHB 5FBNC 4K9YA 4TT7A 4CKRA 3DNDA 1OL6A 2QOFA 4UMPA 2A0CX 4NCTA 4AXAA 4FIHA 1M2RA 4QMNA 4TWNA 4NL0A 2OGVA 4C4HA 3SG8A 3PRFA 3UBDA 2PUIA 4ZS0A 2HELA 2PZIA 3UMWA 3E8EA 3HV4A 3OXIA 4JS8A 2OJ9A 5E1SA 3SA0A 3KMMA 3OROA 5KE0A 4O0UA 3GCSA 3V5QA 3TNQB 2QOOA 3G6GA 5JZNA 4DG3E 3E7VA 3NSZA 1SZMA 2J0LA 3BEGA 3BWFA 2R7BA 3L9LA 4B0GA 2OZAA 3P9JA 5IF1A 3MY1A 5FEDA 4G6LA 4OUCA 5BVNA 4N57A 5LVNA 1OIYA 4WKQA 5E90A 5B2LA 1YXUA 3ZBXA 4P7EA 4I93A 3DKGA 3BV3A 3EQCA 3DTWA 1XWSA 4FL3A 3Q6WA 4FKTA 2P33A 2CLXA 1J91A 5D11A 5FWKK 3T3UA 3EQDA 2HXLA 3QRIA 4IMYA 4AGWA 4QQTA 4D2RA 4YU2A 3PE1A 3ALOA 2HOGA 5AV3A 3GNIB 4RIOA 4YJNA 4G17A 4QD6A 4C61A 4MD7E 4CMUA 4FEQA 5EM6A 4EC9A 4M97A 4RIXB 5E8XA 2V62A 2BALA 1Q24A 4GRBA 2PUPA 4C38A 4UMRA 4B8LA 1REJA 3I0QA 2WQOA 3LCTA 3LXPA 5K0XA 3NW7A 2DS1A 4DF3A 1K3AA 4UY9A 4EBWA 2BILB 4I92A 3H4JA 2VTTA 2PVJA 4MXXA 1KE6A 1R0PA 5I9YA 1WZYA 5CZHA 5C27A 3O7LB 3F5GA 2YCRA 3VULA 4Z3VA 3MFSA 3A4PA 4MHAA 3RINA 3T9IA 4ASDA 4C33A 4D4SA 3DY7A 1JSVA 3HL7A 4ZY4A 2BTRA 3GUBA 5CT0A 3PPJA 5CI6A 5D1JA 4BICA 4DFYA 2J2IB 4LMNA 5AR3A 4ACHA 1P4FA 4FIIA 2B52A 2ZDTA 4AE6A 2VTLA 3MTLA 3VO3A 4MBIA 4O22A 5AM7A 4DC2A 5KKRB 3RZFA 1Z9XA 3TXOA 1PF8A 1YXVA 4HZSA 5KO1A 2CKQA 4PY1A 2C4GA 4JQ7A 1DI8A 4EONA 1YHSA 4O7SA 5IEXA 4JG6A 3W1FA 4PF4A 1S9IA 4K18A 3C0GA 3NUNA 3VS5A 2EVAA 4CFXA 2RFSA 3IQ7A 4Q9SA 3T3VA 3ATSA 4FIJA 4GK2A 3DQWA 3V8SA 1Q8UA 3R9RA 4GSBA 2OIQA 1MQ4A 2BHEA 1XBAA 3R02A 3L1SA 4BBEA 4CG9A 3FZRA 2PVYA 1TQMA 2F7ZE 1GIHA 4JI9A 3R2BA 1HCKA 4F9CA 5EQEA 3GU6A 3WF5A 2Z02A 1YVJA 3R71A 1OL5A 3KF7A 1P2AA 3VUDA 4JBQA 2WMSA 1A9UA 3QQUA 3SW4A 4D5KA 4F99A 3I5ZA 4IFGA 4CTBA 2OH0E 2C5YA 1YDSE 2RSVA 4GS6A 2PE1A 4I5PA 5CF5A 1M7NA 3GB2A 4RWKA 5IH4A 5EW8A 2QOCA 2VN9A 2PL0A 4EOJA 2B7AA 4ZMFA 3PRIA 5AUUA 1KE9A 2UZLA 3FMNA 2JIUA 2W1DA 2HK5A 4NIFB 5D41A 4AZSA 4E4XA 2X2KA 4F70A 4Z16A 3SRVA 4C34A 4PL4A 3EL7A 4R7HA 5EKOA 4CLJA 4I24A 1Y91A 2I0HA 3DFCB 4GUEA 3FBVA 4AZEA 2XYUA 4NEUA 4YBKA 2WQBA 4L67A 4BCHA 5DH3A 3AMAA 4FNZA 1FMOE 1OKVA 3LXKA 1ZYLA 4ZSGA 4G5PA 3HLLA 3QX4A 1UA2A 4O7ZA 4M14A 4Y83A 3A7FA 1URCA 3QCQA 4WSYA 4FKJA 2I0YA 3F5UA 5A54A 4FZDB 5JQ5A 4BC6A 3BIZA 1Q99A 4AFEA 4YC3A 3UOLA 2F7XE 3UQFA 1ZYJA 4EI4A 2WTWA 4G31A 4LM5A 4BCKA 2J0KA 4TXCA 5AJQA 4L42A 3WYXA 4C7TA 3SV0A 4L6QA 2YAAA 2R3FA 4GIIA 2NRYA 3SD0A 3AXWA 3WYYA 3QLGA 1BLXA 3ZSIA 1UVRA 3GU5A 3SQQA 1FGIA 3Q53A 3PXQA 3EOCA 5E1EA 4TNBA 4KBAA 5FP5A 3TIYA 4JJRA 4BCIA 3BYOA 4IBMA 4QPMA 1WCCA 2BDFA 3RWPA 3LJ0A 2W5HA 3FSKA 1BI7A 3ALNA 4OBOA 2R64A 2A2AA 3KRJA 1DM2A 4YZDA 4D1XA 4TNDA 5H9BA 3RCJA 4M69A 3FZ1A 3E92A 3PA3A 3UO4A 3MFUA 4AGUA 3ZZWA 2R0UA 2WOTA 3AC3A 4CFWA 3TNHA 3LHJA 4DE4A 1W98A 3F5XA 1YHWA 4BDEA 3ZZEA 4KIQA 3WE8A 5BVDA 3AD6A 3AMBA 3QD3A 4JIAA 2XK6A 4L01A 5E7RA 4DN5A 1MUOA 4OTQA 1UV5A 3EB0A 3SHEA 2W1CA 5AUWA 2QCSA 3UP2A 3TZ7A 3GCPA 4QMYA 4K8AA 3VW6A 3MWUA 1OL2A 4ANSA 3A7HA 2JKOA 1QL6A 4XG2A 4AT4A 1IAHA 4FVPA 4EZ5A 3BI6A 3H0YA 1NVQA 1M2QA 4PV0A 5EOBA 2Q0BA 2QNJA 4YTCA 3A4OX 4BCJA 5EM8A 4AE9A 4NWMA 4RX8A 5IMEA 3AT4A 4U43A 1T45A 2PZRA 5K5XA 5L2SA 4FV1A 3VS2A 2J90A 3PY0A 4RWLA 2F7EE 2Y4IB 1CMKE 5HOAA 4X2KA 4I94A 4M0YA 3HMMA 2JLDA 3DBDA 3QTSA 3QKMA 4ERKA 3CKWA 3AT2A 4I0TA 4P5ZA 4ALUA 1ZOGA 3GC7A 4GKIA 4H1JA 3C7QA 3UC3A 1VYWA 3CR0A 1DI9A 3PJCA 2WOUA 3VJOA 2BROA 3CD3A 5A9UA 4FTRA 3CPBA 3OWKA 4UZHA 5DOSA 3LM5A 3IDPA 4BDHA 2UZTA 2WMXA 2XIXA 4KA3A 4FNXA 4QMMA 2V0DA 2O64A 3K3IA 2W0JA 2Q83A 4UMTA 5JRQA 4HYSA 3DK7A 5GIPE 2XKDA 2JIVA 2VO3A 3DLSA 5AP3A 3MB7A 3QTIA 5DG5A 2QU5A 4YZBA 3WILA 3L9MA 4YURA 5E92A 1XH6A 5EI2A 4R3PA 5AA9A 2X2LA 3EN5A 4R8QA 3QQLA 5C8MA 2JEDA 2SRCA 3PE2A 4KSPA 4O83A 3KXGA 4M3QA 4I6BA 3FKLA 4RZWA 4NT4A 2XP2A 4F64A 5CVGA 4U97A 2XM8A 2ZOQA 4FG7A 3RZBA 2ITOA 3MH3A 4BZOA 4FX3A 2ZMDA 4EKLA 1SVHA 3NCGA 1ZOEA 2BZIB 3NWWA 5CI7A 3ZTXA 4GK3A 3FZPA 3Q2MA 3P1AA 4G5JA 3FLNC 5BVEA 2CCHA 4KUJA 2LGCA 3PJ2A 4QMXA 4W9WA 1Z57A 2J6MA 2C6EA 4HPUE 4FKPA 2XMYA 4X2FA 4FC0A 2YN8A 4EK3A 3GOPA 3ODZX 1U54B 2QO7A 2W1GA 2JBPA 3D7TB 3F66A 4MF1A 4OTPA 3SKCA 3VAPA 2OIDA 4ITIA 2HENA 4L3LA 4FEWA 1ATPE 2VGOA 4HVSA 3R7IA 2OZOA 4FTOA 4NM0A 5KMLA 5AEPA 3EQBA 4RLLA 3SXFA 4YC8A 3RNIA 4I21A 4UMUA 3ORPA 4F7LA 4BY9E 2WNTA 3BGQA 5D7AA 4CCUA 1ZWSA 3U6HA 1XO2B 2FH9A 3JR1A 4ASXA 5KZIA 3FJQE 1Q61A 3LAUA 2W17A 4RJ3A 3JY0A 2IVSA 3FQEA 3KXMA 5L2QA 3FY2A 4LUEA 4J8NA 4YLJA 3MA3A 1H26A 2PVLA 5HKMA 4KBKA 4TYIA 4YMJA 2HWOA 3VUHA 1ZARA 3ORIA 2UW3A 2OFVA 2PYWA 4QYGA 1RE8A 3CKXA 2BFYA 4F0IA 1OVEA 2ITWA 4FSWA 3RP9A 2YIWA 4N6YA 3FUPA 3CPCA 2C5XA 1FVRA 5KBRA 3EL8A 1H1QA 2DWBA 4IX5A 4BDBA 5J7HA 3ZFXA 4B99A 2GNIA 3UDBA 4GMYA 4D58A 4IAKA 3EWHA 4WUAA 2X7GA 3MPAA 3NDMA 5L4QA 3LMIA 4BRXA 2R3QA 1JSUA 1H1WA 3UNKA 3R1YA 2C0OA 5BVOA 1H1SA 2VRXA 5DN3A 3HV7A 3K5VA 2H96A 3JY9A 2OF4A 4TWOA 4IIRA 4QNAA 1F3MC 1YOJA 5LWMA 3HUCA 4HPTE 4O91A 3VQHA 4MNFA 3DXNA 3IO7A 1U46A 3GCQA 3NIEA 4LG4A 4WUNA 4RZVA 5HI2A 4JBVA 2ITNA 2YIYA 2GHMA 3LQ5A 5AP4A 4YUQA 4QO9A 5AV2A 4RJ7A 1VZOA 5HNGA 4F9YA 2EXMA 1EH4A 4BZDA 3R73A 4YZCA 3QF9A 2A27A 4YZ9A 4YO6A 2PUNA 2PPQA 5DEWA 2X6EA 3D2KA 4EUUA 2RG6A 2XVDA 2VD5A 3VUGA 1M2PA 3LFSA 3I7CA 4RC4A 5DT3A 5HCYA 4B4LA 2HXQA 3G2FA 1PYEA 4XH6A 5EDPA 4F6SA 3WARA 4WNOA 3WE4A 2CNUA 1O6LA 5FXSA 4FZAB 3V04A 2VX3A 3BHYA 4W9XA 5EYMA 3VBXA 2R3IA 2ACXA 3TDWA 2WEIA 4A4OA 3LFQA 2VTNA 5JRSA 3C13A 2ONLA 3JXWA 4P4CA 2WKMA 2FSLX 3EZRA 4IB3A 5T6KA 4FEXA 3DDPA 4OTIA 1XR1A 3TL8A 4EOIA 2ZB0A 4D2VA 3E7OA 1H0WA 5GZ8A 4ID7A 5BUIA 2IZSA 5IPJA 3GP0A 3QTUA 2XNNA 5ETIA 2LAVA 1GZKA 3HKOA 1PMVA 2YJSA 4QOXA 4DAWA 4KRCA 4NJ3A 2YIQA 2NPQA 3DA6A 3H9FA 2Y0AA 4E5AX 5JH6A 4EOOA 1H25A 2JC6A 2W9FB 1ZYCA 4XOYA 3EFLA 4NCTC 3SLSA 4EOPA 5DWRA 5EYCA 5A4EA 1KE7A 1FQ1B 3MV5A 2BRNA 4U40A 1LPUA 2J50A 3G6HA 1I44A 4FE2A 5CVHA 4PMPA 3NVKI 2PZPA 3PJ8A 5AP0A 3FI3A 3CE3A 1KE5A 2WTCA 3IW4A 2C0IA 3KXZA 4CZTA 4IC7A 3FI4A 2R3HA 2J51A 2Z8CA 4AACA 4DG2E 3IS5A 3KULA 1FPUA 3AC1A 2B0QA 2X9EA 3Q4TA 3DT1A 1R78A 2JDRA 3DJ7A 4Y5HA 2WTKB 3ZH8A 2R3NA 5KUPA 4XP3A 2OH4A 2OXXA 4IDVA 4M84A 5H8BA 1U5RA 4FIFA 2C1BA 4EK8A 3O2MA 5IDPA 2R5TA 3ZLWA 3QL8A 3OC1A 3QLFA 4H3BA 2XA4A 4QP8A 4TYHA 3RBWA 1GNGA 3GU7A 4UX9A 2QOBA 4UB7A 3FMMA 4CFUA 4I20A 4I6HA 5CQWA 5HO8A 5LWNA 3BYSA 4XS2A 2CSNA 5F4NA 2OJJA 4BBMA 4X3FB 1Y57A 3MY0A 3R8VA 3OTVA 4FSUA 3W2PA 3VN9A 4DBNA 2RF9A 5C8NA 2JDTA 4NU1A 3QALE 2G15A 5I3OA 4JIKA 3A62A 4EUTA 1ZOHA 4OTRA 4Z7GA 3EQGA 3REPA 3TUDA 1RW8A 4EH5A 3BU3A 4RA4A 3V51A 3H9OA 3R0TA 3CY3A 1BX6A 4U6RA 3D5UA 3I4BA 5HESA 5HGIA 4D1SA 5L2TA 1IAJA 4D2SA 3IGGA 2PU8A 4BIEA 4L7SA 4O0WA 2UVYA 2BFXA 4C57A 5KKRC 4RMZA 2IW8A 2YZAA 4W4VA 3NGAA 3FC2A 3LFBA 2BRHA 2HY0A 3BPRA 4FF8A 4V01A 1JLUE 3BX5A 3OEFX 1B39A 1XH7A 4F6UA 4WA9A 4A4XA 4K2RA 5IQHA 2GQSA 2YFXA 4IAYA 2AUHA 3EN4A 4YR8A 2OICA 4YSMA 4KS8A 3G33A 4DCEA 4S30A 2C6TA 3TJCA 4BTFA 3BLRA 5AP2A 4R1VA 3D7ZA 4RIWB 3RM6A 3R00A 5HE3A 1W0XC 3LQ8A 5CAQA 5K4JA 2UZOA 1TVOA 2GNGA 2QI8A 4FL2A 4RBLA 4XMOA 4BR3A 2R3MA 2HZ0A 4ZSEA 4ZLOA 3LLTA 4E4LA 4NM5A 4MAOA 5ANIA 4OAVB 3RNYA 2I1MA 3S00A 3FYKX 4R78A 4O0XA 3TM0A 2UW6A 4EHEA 4C58A 3KRWA 5L8KA 2XRWA 5E8UA 4A9YA 4NYEA 4CZYB 3BLQA 3F9NA 2CNVA 4GT3A 2W4KA 5DR6A 4K6ZA 1Q3WA 1H8FA 3VC4A 5LVOA 4CFMA 3MSSA 5JZJA 5FRIA 4UMQA 2V7OA 4CG8A 4FOBA 3QHWA 5EDQA 3G90X 4IB0A 4DEIA 5JSMA 3ZLXA 1OL7A 4JRVA 2XKEA 2PULA 4K11A 3BZ3A 4ZLYA 2QVSE 3LFCA 4L43A 4EOKA 5JN2A 5CSWA 1G8SA 4FGRA 4L52A 3DAEA 4KBCA 2UW9A 3DXQA 3O23A 2WFYA 4BCOA 3PVBA 1OIRA 5CU2A 1R39A 3MIAA 2CHLA 1NA7A 1YDRE 2PMOX 5DYJA 4A9UA 2CPKE 3PPKA 3AQVA 3VUIA 3IW7A 4A9TA 5AUXA 5L2WA 3HRBA 3GU8A 2IVUA 1GJOA 4XX9A 4MQ2A 1MQBA 3Q04A 4KKHA 5FGKA 4FTNA 2XJ0A 2JAMA 4EKKA 5JFXA 1WBPA 3E88A 2EU9A 3QUDA 4DINA 3ZS5A 5TR6A 4D4YA 5KX8A 3LCOA 4TKSA 3LFFA 3R7GA 3KVXA 4U81A 3FQHA 2UW8A 2XJ2A 3OCSA 3ZDUA 5B2MA 2JFLA 2P2IA 4N4SA 4WRGA 2CGUA 3COIA 4AGCA 3GI3A 3VRZA 3DB6A 3I1AA 3GBZA 4I1ZA 1JBPE 3QD0A 4PTEA 3L8SA 4FT0A 4MXYA 3IDBA 3QWKA 3VS0A 4NH1A 4O21A 3II5A 2GFCA 3T9TA 4DH8A 4FL1A 2ZM3A 3EQRA 5AM6A 4ZTHA 3UIXA 3SVVA 3Q9ZA 3QCYA 3TZ8A 4UV0A 3OG7A 4BB4A 3N4TA 4YGAA 3TTIA 3CLYA 4AOJA 5ANJA 2GS2A 3WIKA 3PYYA 3PZEA 4FSYA 5TF9A 1PXKA 4DH5A 3Q2JA 3HMNA 1G8AA 4QPSA 5CEOA 3KC3A 3ZFMA 4RFZA 3QC4A 1BMKA 4NM7A 3U9NA 2OO8X 4N0SA 2OXDA 2UW0A 5FXRA 4BYIA 5J5TA 4PDYA 4FSZA 4USEA 2X7FA 3ENHA 5J95A 4AA0A 4P2KA 4AW1A 4H58A 4IVCA 1VJYA 1PXPA 4C4GA 5FEQA 4IX4A 4OTGA 3PLAE 5LVPA 2WMTA 3EZVA 3TV4A 3NAYA 3MH0A 3WBLA 2R4BA 3QQHA 1JOWB 2Z7SA 4G6NA 3WF7A 4TN6A 3DGKA 4FEUA 4ZTNA 2O5KA 4Y5QA 5HG5A 5EI8A 3WOWA 4FV3A 3G15A 3ACKA 3PY1A 4G9RA 3O8TA 2CN5A 3U54A 3ZM4A 4ZLZA 1Q41A 4GKHA 2O3PA 5DT4A 2YJRA 2BAJA 4QP1A 3SDJA 1OL1A 3PXFA 5JFSA 3BYUA 3GQIA 4E4NA 5IKWA 2WTJA 2ERZE 3MB6A 5CEMA 3M11A 4IZ7A 3V6RA 5CY3A 4IWOA 4ZOGA 1ZZ2A 1B38A 3BHTA 5BYLA 4FT5A 5KMMA 4D1ZA 2QHNA 4CKIA 5FDPA 2WHBA 4R3RA 1A48A 1H27A 4AUAA 4RX9A 4NW5A 2ITYA 4FNWA 1BYGA 4XRLA 3RMFA 2XNGA 4GVJA 5TO8A 4S2ZA 3RAWA 5BUJA 3CGFA 3MFTA 1OUYA 2J0MB 1H1RA 2QO9A 4L68A 5AR5A 3ORZA 3BV2A 1JKLA 1NT2A 5BVKA 4QMOA 4C4JA 3FMEA 3H0ZA 4D55A 2QLUA 3QTWA 4I23A 3UNJA 4YJSA 3ZEWA 3KREA 3S2PA 2WQEA 4ALWA 5IQGA 3RTPA 2C6OA 1QPEA 1H1PA 2R3PA 4HJOA 3LKMA 4R7BA 3FLZA 4DFXE 4ORKA 3LLAA 3ZSGA 3W8QA 2YM6A 1IEPA 5CSPA 3ITZA 3C0IA 3N51A 5ANKA 3TZMA 1OITA 1FINA 4F1TA 2VGPA 3WIGA 2XM9A 3C4ZA 3O7LD 3Q32A 2C47A 4NTTA 3H10A 3UVPA 4G3CA 4JX3A 3KEXA 4DH1A 2PK9A 4RIXA 1VR2A 5M08A 4MD8E 4A7CA 5CSVA 3OT8A 3ZLSA 4MXCA 3FHIA 3CJGA 2QHMA 2QR7A 3BYMA 3NW6A 4AF3A 4R3CA 2WQMA 5CS6A 3PXRA 3VBVA 4FV9A 3K3JA 5J5SA 2B54A 4ANBA 1UU9A 1OGUA 5JQ8A 1ZYSA 5A4LA 4DT9A 1YRPA 4IH8A 4RA5A 1ZMVA 4DA5A 5A3XA 4YZNA 4H39A 1ZZLA 3AGMA 3SXRA 2JKQA 4IXPA 5M53A 3ZRLA 4APCA 4MXAA 3VS1A 3D0EA 4EH4A 4TL0A 2W9ZB 2YDJA 2YA9A 4BIDA 1Q62A 2VUWA 4CQEA 3G51A 1XH5A 4PTCA 3EN9A 2ZMCA 3POOA 4U42A 5FD2A 1KWPA 3TKIA 5CSHA 4ACDA 4CYIA 3OUNB 1YI6A 4AN3A 4BHNA 3R9OA 4FZFB 3NUPA 3SGCA 2VWXA 4QMWA 2FA2A 4FNYA 3AG9A 3UOKA 1LUFA 4LUDA 2PVFA 3GEQA 4O0RA 5IQBA 2C6IA 4RVLA 1Q97A 5KZ0A 5CXZA 5F94A 3TG1A 3DKCA 4OW8A 5M51A 2E9PA 5DEYA 4FTJA 2V5QA 2WTVA 4QMZA 3W2SA 5DI1A 4V0GA 2CMWA 4PUZA 3ZHPC 4X21A 3DNEA 3I5NA 3W2CA 2WAJA 4O7LA 3R9HA 4G1WA 5AV0A 5M57A 3TUCA 1ND4A 3BBWA 1OIUA 3K54A 4EYMA 2QD9A 4WBBB 2ZV9A 4J53A 3O17A 5I9UA 3QTQA 4NIFA 1TQIA 1WBTA 4PRJA 1UKHA 4DEHA 3ZRKA 4EH8A 5EK7A 4MH7A 4RFYA 2YCQA 3MPMA 2BUJA 5LXMA 3A7IA 5C8KA 3PP0A 4V0GB 4WNKA 3WF6A 2YEXA 5AAGA 1CDKA 3LCKA 3IOKA 4ZTSA 3OS3A 3I0OA 4BWPA 3EKNA 4E5BA 4ENYA 1JKSA 5JK3A 3LMHA 3TZ9A 1FVVA 3OHTA 4BDKA 4J96A 1SNUA 2X0GA 3OP5A 3ZMMA 5L6OA 3DPKA 3R30A 5EHLA 4QP7A 4QQ5A 4GG5A 2ONLC 2XNMA 4WIHA 1H08A 3W18A 3OOMA 2VZ6A 3LXNA 5E9EA 2C6LA 3MS9A 4FSMA 4YTFA 4MTAA 1SM2A 3VF9A 4BDGA 5A4TA 4JLCA 5M55A 2PMNX 3AC8A 2VWBA 2XZSA 5FBOA 3Q9YA 4C2VA 3PXKA 4GYGA 3K2LA 4W4XA 3BLHA 4FTQA 4YBJA 5CSXA 2B9IA 3PUPA 5M56A 2B1PA 3E64A 2YIRA 2WMRA 4IJPA 2ZM4A 5T3QA 4EK4A 1WMKA 2OLCA 4ZZNA 4WG3A 1OPLA 3NNVA 4FTMA 5C26A 3TDVA 3KKVA 3RPRA 4EOSA 3DBQA 2OW3A 3KA0A 4KNBA 4FUXA 2XBAA 5J7BA 3OW3A 2X6DA 4RC2A 4UWYA 4CCBA 5M07A 3OD6X 1S9JA 3PZHA 3QTRA 3TJDA 5AADA 5IQIA 4I22A 4O6LA 5GZ9A 2BTSA 5CT7A 4X3FC 4XP2A 5GIOE 2P4IA 4A06A 1WBNA 2RFNA 3AD5A 3CS9A 5B0XA 3QGWA 3O71A 3QXOA 3TKUA 2GMXA 1JPAA 3NRMA 3KXNA 2CKPA 1J1BA 3OXZA 4J7BA 1GZ8A 2UZNA 3MA6A 4GG7A 3HV6A 4ZJVA 3QRKA 2XIYA 3GCUA 3SXSA 5H3QA 3R7YA 4DTAA 3QCSA 1PXIA 2VWVA 3AC5A 2FSOX 2CKEA 4OT6A 4FODA 4PL5A 4O7NA 3ZO4A 4RJ6A 4DFZE 4TW9A 1IA9A 4FSRA 2WU6A 4KABA 3GGFA 4U9AA 4O7VA 4D0WA 3I79A 3DKOA 4TYGA 2OK1A 4EK6A 4CFVA 5DIAA 1LR4A 1MRVA 3E63A 5DRDA 4IAAA 2GFSA 4JR7A 4IVAA 3PY3A 2Q0NA 4GW8A 5DMZA 2XNOA 3OBJA 2Y9QA 2XYNA 2BZJA 2BZHB 4YJQA 1GAGA 4LOPA 2EB3A 4APPA 3R63A 4FTTA 4I5HA 4LI5A 4NKAA 4BWXA 1GOLA 4O96A 2HY81 1TQPA 2NO3A 5A6OA 3BU6A 5JFWA 4GCJA 2OFUA 2YM3A 3KMUA 3F2NA 3PVUA 3R9NA 2FGIA 5FP6A 1O6KA 3DBFA 4JG8A 3FYJX 5HIEA 3AC4A 3H9RA 3MGYA 3P23A 4AA5A 2VTJA 4BDDA 5CENA 5HVYA 2ZYBA 1Y6BA 4PMTA 1T46A 1RDQE 2OG8A 4MNEB 3P7AA 4XCUA 4XV1A 3QA8A 3V8TA 4IEBA 4RVKA 3Q4UA 4FV8A 1Y8YA 4E8AA 1JKTA 5DRBA 2HAKA 3FMKA 3GU4A 4RJ5A 5DA3A 4Z9LA 4CEGA 2ETRA 3LCSA 5AFVA 1ZY4A 1F5QA 3NNWA 2V55A 4G3DA 4YJRA 5EOLA 3RKBA 3UPZA 4FT3A 3A61A 2BRMA 3BHVA 3QRJA 3PA4A 4M7IA 4XRJA 2OJGA 4OTWA 2VWZA 3RPSA 3E3BX 2JAVA 4PL3A 4J95A 1MRYA 4D4VA 5C9CA 2CGXA 4ZTMA 4QYHA 4WBOA 1YXTA 5D9HA 5FXQA 3P08A 2ZB1A 4II5A 2ITPA 3RI1A 1U54A 3D7TA 4NZWB 5E8VA 1YQJA 4AFJA 4TZRA 4FV5A 4ZXTA 4EZ3A 3RPOA 3WI6A 1YXXA 4L53A 4Y95A 3COKA 3NYXA 2C3JA 5M09A 3VUTA 4FV2A 3GQLA 3CCNA 4BKJA 2H6DA 5FEEA 3SOAA 5LCJA 4FIEA 4RT7A 3KGAA 4JBOA 3UG2A 4HW7A 3R22A 4ZTQA 4BL1A 1ZY5A 2VWWA 3VUKA 4D4RA 4XG6A 4E3CA 3C51A 5HVKA 3AOXA 2YLEA 4FTAA 3W2RA 4EH9A 4J52A 1DAWA 3B8RA 4RWJA 5CXHA 3VS3A 3PIYA 4HVIA 3FMHA 3TN8A 3UODA 5F9EA 2XIRA 3G9NA 3C0HA 4FT7A 2PSQA 4FVRA 4JDHA 4FEVA 3GC9A 3FZSA 4YPDA 4Z55A 4BN1A 3CTQA 2WPAA 5KMOA 1OKZA 3NX8A 3ORTA 3TCPA 4GIHA 4FT9A 5CEIA 2W05A 5TOZA 4BCQA 3QZIA 1PXNA 4XG4A 5AX3A 2G1TA 1BI8A 3TV6A 1FOTA 4C8BA 5IDNA 2UV2A 3IW8A 1SYKA 1Q8TA 3LFDA 4DEAA 1JSTA 3R8UA 4DT8A 3HEGA 5HTCA 2R3OA 3ZLYA 3VQUA 4ZK5A 5CNNA 3RPYA 3DXPA 4I0RA 4PMMA 2I0EA 2VX1A 4ZY5A 5I0BA 3D9VA 4EWQA 3ROYA 3UO6A 3F88A 3N9XA 2BR1A 4HYUA 2J0JA 5C4KA 1OI9A 4BTJA 3R1NA 5IA0A 2RIOA 1BL7A 3QKKA 2OI4X 2OJFE 2G2IA 2UZWE 2WMVA 4BDAA 4BI0A 3OXTA 2XBJA 1OKWA 2UZUE 2XH5A 3MI9A 5KMIA 4FTKA 3CQUA 3G0EA 4AWIA 1P14A 3B2WA 2XNEA 3FLSA 3U51A 5IA1A 2WEVA 1PYXA 3LW0A 3QFVA 3SOCA 3NMUF 3UIMA 2Y7JA 2QOLA 5J1VA 3DJ6A 3ZXTA 5HHWA 3QGYA 3U4WA 1RQQA 4YP8A 4FSQA 5GNKA 3D5VA 3MW1A 2WMWA 1CTPE 2ETMA 4IANA 4DHFA 1ERKA 1PHKA 3ODYX 4Y46A 4O7TA 3OWPA 2E9VA 4BCMA 3HGKA 4QT1A 3W2OA 5EKNA 3QYZA 4RFMA 3N4UA 3GOKA 2F9GA 5J79A 2ZDUA 3P5KA 2WIHA 3FPMA 3JYAA 3MJ2A 2Z60A 4IDTA 4S33A 4Y72A 2GNJA 3S95A 3LE6A 4IWPA 3ZFYA 4AS0A 4AW5A 3BGPA 5E8TA 5FTQA 3P78A 4J71A 3VS4A 4H3PA 4NKSA 2QOIA 1OKYA 2W4JA 5EI6A 5IEYA 3DQXA 4BGGA 2JDVA 2YISA 4O84A 1XQZA 3PFQA 4MVFA 2QLQA 3A2CA 3FY0A 5AAFA 4L9IA 4Q2AA 3NCZA 4ZP5A 4FGBA 4XV9A 4TYEA 5G1XA 2UZBA 5D12A 5BYYA 4O0YA 3ROCA 5IUHA 3I7BA 5GJDA 4GU6A 4TY1A 3A8XA 4I3ZA 3MVHA 2B55A 4NTSA 4IM3A 1QPCA 4FYNA 2KULA 4GFGA 4BCFA 2JDOA 3RPVA 1GZOA 3NUUA 5KMNA 3A99A 5FQDC 5IQFA 3QAME 3TT0A 4BBFA 5HTIA 4CGAA 2HIWA 2C6KA 3QTXA 4YLKA 3CEKA 3OMVA 3HUBA 1SMHA 3QQJA 5I9WA 5HBHA 2PZ5A 2A19B 4KIPA 4FOCA 3RAIA 2BKZA 3FLQA 4R1YA 3DBCA 4F1OA 4IHPA 4FSTA 3V5WA 2VV9A 3OY3A
chains in the Genus database with same CATH superfamily
2PMIA 3UZTA 3VWAA 2VTRA 3THBA 4X3FA 2XIZA 3P7BA 4NK9A 2IPXA 1CKJA 4KKEA 4XHKB 4E6AA 1OIQA 3ERKA 3ZU7A 4XLIA 1W82A 5HIBA 4ANNA 4J8MA 3R7VA 4CRLA 4FG8A 5CAPA 3OCBA 3HYHA 2XNBA 5GINE 3VBWA 1PXJA 3OUKA 2XK3A 2ETKA 5ANGA 5C4LA 2VAGA 4U7ZA 4OT5A 4AZTA 4WNPA 1MRUA 4NJDA 5C1QB 3ZUVA 3V8WA 3DZOA 4CVAA 2YITA 3CIKA 4AZWA 3SX9A 2B9FA 1UNLA 3DDQA 4E6QA 3UOJA 5DT0A 2IZTA 5AP1A 2C6DA 3E8DA 3D2IA 3O51A 4DEGA 1E1XA 2HW6A 4I5CA 4X0MA 4YNOA 2VU3A 3F6XA 4D2TA 3UP7A 4DFLA 2QOQA 2ZJWA 3HRFA 4WD5A 1H07A 4QYFA 4QPAA 3VF8A 2X8IA 3R6XA 4F7SA 4FSNA 4RIWA 3W32A 3JUHA 3HAMA 1XJDA 1I09A 3MIYA 4QMTA 2YWPA 3EKKA 3O50A 2AC5A 5IA4A 3ZRMA 4MXOA 2UVXA 4QP2A 1BL6A 2AYPA 3QX2A 4CYJA 1UWJA 4USDA 3VVHA 4FTCA 4I4EA 4IZAA 5DE2A 5EW3A 1OB3A 5EH0A 3OCTA 1FMKA 4O0TA 5TKDA 1NVSA 1W83A 3HAVA 4LFIA 5JGAA 4TWCA 4LGDA 2C30A 2YM5A 2XANA 3FZTA 3I60A 3QRTA 5E8SA 3WZDA 4ASEA 1KV1A 3VUMA 3KFAA 1Y8GA 3F2RA 3MPTA 3ELJA 1K9AA 4U0IA 2BAKA 5DR9A 3U9CA 4EOLA 2GHLA 1YKRA 2XIKA 4IADA 5CTPA 5FTOA 3BWJA 5T68A 4F1MA 3BHUA 4BCNA 3C4CA 4DITA 5HLPA 3GCVA 4B8MA 1F0QA 3VW8A 3EQFA 4HCVA 2BRBA 3GT8A 3CQWA 3OT3A 2RKUA 3FWQA 5HG8A 2QO2A 2PE0A 4G16A 1CM8A 1YDTE 3PP1A 5DFPA 1WBSA 1M17A 2DYLA 1ZLTA 4U3YA 3BHHA 4O2PA 5LMBA 4MF0A 4XOZA 1PKGA 3AMYA 3I81A 1YOLA 3DAKA 4FICA 2CDZA 4FV7A 4QP6A 3HA6A 4EQUA 1J7LA 2F57A 3PJ1A 1KOAA 4O1PA 4XV3A 2WMQA 3TEIA 4JT3A 1KUTA 2R3KA 2OU7A 2X4FA 4B7TA 5CEPA 3AGLA 4LQMA 2IG7A 2BAQA 1W2CA 3LXLA 4GH2A 2VO7A 2XK7A 2VWIA 4FV4A 3IG7A 4FK6A 2QKWB 4CD0A 3UQGA 3WF8A 3D94A 3NAXA 4M13A 4AOIA 2C6MA 2QQ7A 1LEZA 3W10A 2R2PA 3WZKA 3ZYAA 4EL9A 1Z5MA 4QMUA 3C50A 3BU5A 3ZXZA 5EQPA 2XNPA 2UW5A 3DV3A 3L9NA 1H0VA 2Y4PA 4QTEA 4GFOA 1IASA 3DOGA 2X4ZA 2YACA 3PSBA 4C3PA 1XKKA 3FC1X 4HNIA 4RIYB 4JOAA 4BDCA 2C68A 4FI1A 4N70A 5IQEA 3ORNA 3TUBA 4WNMA 4AT3A 1ST0A 4AXEA 3QKLA 3DK6A 4OBQA 4YJVA 5EFQA 2WMBA 1SNXA 5IQDA 3QCXA 3QWJA 3BKBA 2ITVA 4GYIA 4K33A 4AU8A 5I4NA 2PWLA 5ITAA 3IK3A 4CV8A 4CFNA 3LVPA 5FM3A 1PXLA 1XH9A 1YOMA 1NXKA 2VO0A 3A7JA 4EQCA 3RCDA 4DFBA 3QUEA 2EUFB 4PMSA 4DH3A 4MQ1A 2B4SB 4WHZA 5LCKA 4YZMA 4PWNA 2W1EA 3QD2B 2GTMA 3V5PA 4ACGA 2BCJA 3DAJA 3OY1A 2C5NA 3RGFA 4K77A 5FLFA 3W0RA 3MH2A 3G0FA 2R3GA 5HE1A 2R0IA 4EH2A 3UG1A 3PWYA 3W0PA 4PPBA 2A4LA 1Q8YA 1H00A 1NVRA 3MDYA 2QKRA 4Q5EA 3VBYA 4ACCA 5DGZA 4BDFA 4QMVA 1GZNA 4V04A 5JEBA 4FYOA 5HICA 4HGLA 3KRXA 4XBUA 4C59A 2ZV2A 4EK5A 2Y4IC 3ETAA 4QNYA 3AD4A 4IM2A 3ZEPA 4QP3A 1J1CA 3FL5A 2QG7A 1OBGA 1FBNA 3P86A 4YSJA 2R3LA 3FLYA 5D7VA 1PMEA 4EH3A 4G9CA 4XLVA 4W8EA 2JGZA 4RX5A 4PTGA 1YWRA 2CCIA 2IJMA 4EZ7A 1M52A 3OOGA 4YC6A 5GJGA 2GU8A 5CU0A 3KQ7A 5IH5A 4RGJA 5I9ZA 3FEGA 5CLPA 4FV6A 5CNOA 3NW5A 4IC8A 2UZEA 2VTHA 3HP5A 4PPCA 2ITXA 1YI3A 1Q3DA 5HQ0A 3NEWA 4PDOA 2BZKB 2PVNA 2UUEA 5DVRA 5BQ0A 3FMJA 4DCAA 3PLSA 4BFMA 1HCLA 2OJIA 4E73A 2PVKA 4LL5A 3P4KA 4CT1A 3L8XA 4GJ3A 5J1WA 5TT7A 5KMJA 1U4DA 1Q8WA 4OTFA 3KF4A 3LCDA 4AA4A 3GENA 4ZJIA 4F63A 5HLWA 2YM7A 2YZLA 3NVMB 4I6LA 2P3GX 4QP9A 2R9SA 2B9JA 5BPYA 5M06A 3C5IA 4EH6A 4L8MA 3ZUTA 3F82A 3ZBFA 4BWKA 4X3JA 4O4CA 4MCVA 4XG8A 5A6NA 4L00A 4C4EA 1YW2A 4D2PA 4QQCA 4QTBA 4BHZA 2QOKA 2OKRA 5L6PA 3N4VA 3PXZA 3VJNA 4M68A 4AQCA 4Z7HA 3LOKA 4M67A 2XCHA 1OMWA 3DTCA 4FZ6A 3ZOSA 4HVDA 2WMUA 3KK8A 2PZYA 5F20A 2UW7A 3NZ0A 4AT5A 4MBJA 3H30A 4R6VA 4KRDA 1IR3A 5HCZA 2PUUA 4WSQA 4WT6A 2CGWA 4CQGA 1AD5A 4USFA 3SG9A 3FSFA 4OLIA 2C1AA 3GXLA 1L3RE 4IB5A 4U5JA 4UYNA 5CVFA 1UWHA 1PMUA 4FMQA 4H1MA 3VBTA 4BCGA 4O86A 4PNKA 5B7VA 4J1RA 3W0SA 5AV4A 3M1SA 5EHOA 3T8OA 4BKZA 3PIXA 4CXAA 5IA2A 3R8PA 3NPCA 3KXHA 4ZJJA 3ZC6A 4UWBA 3LMGA 3RHXA 2W1FA 5CAVA 3MTFA 4FV0A 1KE8A 3QD4A 5BNJA 3BE9A 3F61A 1UU7A 2H9VA 2PVHA 3QZFA 5AX9A 5CF6A 4FKLA 4AW2A 3MJ1A 4E6DA 3ATTA 5FTGA 3NUAA 5B2KA 3ZCLA 3W55A 2IVVA 2WELA 3BL9A 3ORXA 1W84A 3OFMA 4FKOA 4TRLA 4CNHA 5BUEA 1X8BA 5JMSA 4DGNA 5M44A 1URWA 3HV3A 3QHRA 5IMXA 4KINA 3SW7A 1UU8A 3FXXA 4FIGA 4HGSA 5HTBA 3UO5A 4DG0E 3ZSHA 3NUSA 3TWJA 1VLRA 3CXWA 3M2WA 2OZAB 4ANMA 3WZEA 4DLJA 2BIKB 3UDSA 3EFKA 5J87A 2I7QA 1PRYA 3DJ5A 5DNRA 3RWQA 5HBEA 3JVSA 2QC6A 2W06A 3CBLA 2YDKA 3P79A 5HX8A 3U87A 2V7AA 4F6WA 2EXEA 3EH9A 3DU8A 3LIJA 5EG3A 1WBVA 3C4FA 2VTPA 3UGCA 4BVUA 2JBOA 1P4OA 2F4JA 4FTIA 4NW6A 4MBLA 5I9XA 2Y6OA 4UBAA 2C69A 3W2QA 4ZZOA 5LQFA 4HOKA 2YIXA 3A60A 1KOBA 2R7IA 1Q4LA 3NIZA 3QZGA 4FZ7A 4HGTA 3VIDA 4AZVA 2YWVA 3W0QA 1Q8ZA 3WF9A 2O2UA 2XK4A 4IW0A 2IZRA 3QBNA 5DHJA 1TKIA 1XH4A 4FKVA 4JQ8A 1AQ1A 3EQIA 3KL8A 3UVQA 5AUZA 1G3NA 3RVGA 5JFVA 3R9DA 3NUXA 4IZYA 3EIDA 4DFUA 4KB8A 2WB8A 5J9LA 3QU0A 5ANOA 4AX8A 3VS6A 5C01A 3O8PA 4MXZA 3FHRA 1ZAOA 2V22A 2E9NA 3FXWA 4E6CA 3DBEA 4I0SA 2E2BA 1XBCA 1G5SA 2X39A 2CN8A 4WO5A 4F08A 2PHKA 2ITTA 1ZXEA 2UZVA 3KN5A 3KU2A 4E20A 5EDRA 4YO4A 4ZS4A 3FDNA 4JRNA 2GHGA 4MWHA 4FKGA 4JG7A 4IB1A 3UC4A 3WZUA 5KHWA 3ZM9A 1V0PA 2GCDA 1SVGA 5AUVA 4F09A 4F4PA 4EQMA 4HVHA 3EJ1A 1JNKA 5FG8A 2IVTA 4H36A 4BDJA 4HGEA 4Q5HA 3F69A 3FI2A 1XHAA 4MYGA 5AR8A 4C4FA 4MUQA 1XBBA 1PXMA 5FM2A 3FV8A 4BDIA 5KMKA 4DTBA 3Q6UA 4IAZA 4IM0A 3R01A 2J9MA 2GNLA 4UALA 4F9BA 5AAEA 3NYOA 4QQJA 4BIBA 2XUUA 3LFAA 4WRSA 3QQFA 5AA8A 1OPKA 2X1NA 3UQCA 4CV9A 4IAIA 4O4EA 3R7OA 3HV5A 3F3UA 3HP2A 3D15A 3EYGA 2Y8OA 1R0EA 2HYYA 2WTKC 1M7QA 2Z7QA 3TIZA 3AKJA 4IACA 3HECA 4S31A 5KHXA 1FVTA 2YHVA 4H05A 4I5MA 4V05A 3OZ6A 3R7UA 3TKHA 1DS5A 4YNEA 1PXOA 3IONA 2KTYA 5AIRA 3VBQA 3HDMA 4C35A 4EEVA 4EOQA 1WBWA 3PXYA 4ALVA 5HE2A 3NLBA 4EBVA 4IJ9A 3G5DA 5F95A 3C5UA 4LRKA 4IFCA 4EHVA 2I40A 3W16A 4EJ7A 3SRVB 2IN6A 4ENXA 1ZMUA 3UTOA 4GU9A 3M42A 2O8YA 2IWIA 3E8CA 4EORA 4O82A 4GJ2A 3BEAA 5LMKA 2WZJA 5LVLA 2C3IB 3QA0A 2XJ1A 3ET7A 4YTIA 5HEZA 3ULIA 2EXCX 4KAOA 4P5QA 2PMLX 3FKOA 2JDSA 2DUVA 5K3YA 1E1VA 4EJNA 4C02A 2X2MA 3ZDIA 4FVQA 2BVAA 3OTUA 4GUBA 5HVJA 4XUFA 4JDJA 4LRJA 3GFEA 3R8LA 1CKPA 3PWDA 4CRSA 5ICPA 5HORA 4DGMA 4LGGA 3COHA 2QU6A 3EYHA 5A46A 5KCVA 5A4CA 3KK9A 4FG9A 4RQVA 4O7YA 5BVFA 5CALA 4TYJA 4OAUC 3LZBA 4O2ZA 2YABA 4ERWA 3QXPA 1LP4A 3EQHA 4J99A 3SC1A 3VRYA 4AXFA 3TNPC 2OSCA 2Z2WA 3PJ3A 3Q96A 1K2PA 4FKWA 4QMSA 5DR2A 5AWMA 5HO6A 1UKIA 5G6VA 4M0ZA 3FAAA 2O0UA 2QODA 3CTJA 3HZTA 2GNHA 3UNZA 4BGHA 3S1HA 3UVRA 4MNEA 4LOQA 3UPXA 4XJ0A 4HCTA 4NFMA 3EFWA 4Y8DA 5HNBA 4FK3A 2J0IA 4E5WA 5HD4A 4O0VA 4L46A 4UXQA 4M69B 3QTZA 1V0BA 2XRUA 2ESMA 2VTIA 4IWDA 3V6SA 4DFNA 5FDXA 2XKFA 4XP0A 3KN6A 5J9ZA 4KIKA 4XEYA 1MP8A 3A8WA 4ANOA 1M14A 5CANA 5CF8A 3Q9XA 4I6QA 3KRLA 3RALA 3CSVA 2XS0A 4AG8A 2WXVA 2X8EA 1XMMA 3R7EA 5AUYA 4R5SA 1GY3A 1PKDA 3IPHA 3LFEA 3VS7A 2QG5A 3SAYA 4EHGA 3FI8A 2Y6MA 3FE3A 3NYVA 1XMLA 2JIIA 2VNWA 3Q3BA 2VNYA 3UDZA 3UMXA 1IG1A 4KIKB 3C4XA 4U45A 3BRBA 5CU4A 4XG9A 4X7QA 2W96B 4D9UA 5BX0A 3MESA 1JKKA 3O8UA 3OBGA 4JNWA 3BQCA 1UU3A 2B53A 4GL9A 4RRVA 4DLIA 1QPJA 3RK7A 1V1KA 5L2IA 4EYJA 1RJBA 3V5TA 1J7IA 1YWNA 3Q4ZA 3ENMA 4G34A 4C62A 4PNIA 2W1ZA 4LMUA 5LVMA 5E4HA 3ORLA 4QMPA 2HZIA 3Q60A 4MEDA 4RWIA 1QPDA 4DEBA 5AIKA 4YJUA 2YLFA 4QYEA 4GT5A 4J98A 4S34A 4BZNA 2VTOA 2W4OA 2BMCA 5CU3A 5EM5A 5H8EA 3UYTA 5HG9A 2G2HA 5K9IA 4BKYA 4L45A 4PDSA 1A06A 1O9UA 4U41A 2ITUA 3IW5A 5GJFA 2CNQA 4ZEGA 3OWJA 3MYGA 3E8NA 4Y73A 3D4QA 4CT2A 2WU7A 3C1XA 4LYNA 3EMGA 4UYAA 3TACA 3ACJA 3MVMA 1OM1A 1WBOA 5IA5A 5I5ZA 1P5EA 1ZMWA 2ZV8A 3HX4A 5CZIA 4FA2A 1B6CB 4LOOA 3QQKA 3E5AA 3IECA 4OR5A 5BYZA 3EHAA 2JKMA 3HMPA 3CP9A 4C36A 4ZAUA 1H24A 4MK0A 2JD5A 2YM8A 4ZMEA 5AR4A 4D0XA 2CKOA 2HWPA 4BTMA 2YM4A 3Q5IA 4C0TA 4DTKA 3ZONA 2ERKA 2RGPA 4JX7A 3LJ2A 4DGOA 2GQRA 5TE0A 4OTDA 2VWYA 4G3EA 4GK4A 3MY5A 2B9HA 4BTKA 3HMIA 3RAKA 4UZDA 5ETFA 4F7NA 1APME 5L8LA 2QOHA 4R77A 5AV1A 4JXFA 3C4WA 2YDIA 4PP9A 4EOMA 3ORKA 4YLLA 4DDIA 2W1HA 4IAFA 4IQ6A 1UNHA 3L8PA 4XG7A 1YXSA 4M66A 5LMAA 3TNWA 3O0GA 4IX6A 3UZRA 3FMLA 3D83A 4EHZA 2C5OA 4PX6A 3V5JA 4ARKA 4D9TA 3POZA 3RHKA 4DHJA 1REKA 2IW6A 2PY3A 4KWPA 5IA3A 3DCVA 4FKUA 3UZPA 5CU6A 3RM7A 3ZO2A 2RL5A 2R3RA 2XKCA 3B2TA 5J8IA 1NY3A 3L8VA 4HZRA 4NM3A 4W4YA 3PA5A 2AC3A 4N6ZA 4DEDA 4C37A 3LPBA 4O6EA 5DLSA 3U6JA 4YHJA 4L44A 5K0KA 4MX9A 3ULZA 4CFFA 2J5EA 4AOTA 4UN0C 3QZHA 3UIUA 4R5YA 2XB7A 5KNJA 5ACKA 2NNWB 2UVZA 5BMSA 3O96A 3DB8A 2Z7RA 4PDPA 1R3CA 3S4QA 1JQHA 5ANEA 1J3HA 3PSCA 3ANQA 3EN7A 5HNIX 4ANQA 3KVWA 2YERA 4FTLA 1GIIA 2PE2A 4OTHA 3NNUA 4AP7A 5M4IA 4LL0A 1PMNA 4FKSA 4JVGA 4L3PA 3RAHA 4AAAA 2BRGA 4HNFA 4CMOA 3H3CA 4HVGA 2DQ7X 4DGGA 2GSFA 3QRUA 4AN9A 4X2JA 4AN2A 4BCPA 3V01A 3OVVA 4YJPA 1CSNA 3JS2A 3NUYA 4YJOA 4JR3A 4D5HA 5GZAA 4R7IA 5C03A 3ID6C 3D5XA 1U59A 4FKRA 4O7RA 4I4FA 5A4QA 4RSSA 4X6RA 1OZ1A 4CTCA 1E9HA 3AT3A 3KRRA 3COMA 2WIPA 3K5UA 1SVEA 3MVLA 5BMMA 5LARA 2BPMA 4S32A 3LQ3A 2ZM1A 4A07A 3HA8A 3NR9A 4C3FA 4CLIA 1WVXA 2G01A 1OBDA 4X2GA 1W8CA 3PPZA 3LFNA 3S3IA 3MBLA 3VHKA 2WQNA 1PJKA 3Q52A 4BYJA 4D28A 3FQSA 3BE2A 1DAYA 4G2FA 4RJ4A 2Z7LA 4Y85A 4BGQA 2FSMX 2J5FA 2VO6A 2GQGA 4L7FA 4ANLA 3GC8A 4F78A 2HZ4A 3PIZA 4QTDA 3R1QA 4LRMA 4B9DA 2G9XA 5AMNA 3DLZA 4B6LA 4CKJA 5M4CA 3PSDA 4M12A 5EYDA 3NYNA 5AR2A 1R1WA 2HCKA 2CLQA 4GEOA 2W99B 4TPTA 4ACMA 2P0CA 3WZJA 4IVDA 3P7CA 4U3ZA 3BGZA 4P90A 4I6FA 3F5PA 1WFCA 1OPJA 1Y6AA 4TWPA 1W2DA 2BDJA 3ORMA 5L8JA 4ZTRA 4WG4A 3ZO1A 4KKGA 2BDWA 4JDIA 3BELA 4LGHA 5GHVA 4M8TA 3TTJA 5M4UA 5JGBA 1BUHA 1O6YA 5HU3A 3IKAA 3E87A 2PVRA 2VTQA 5CF4A 2X81A 4AGDA 5KBQA 4PP7A 4O4BB 4F9WA 3KCFA 4CSVA 2XEYA 4E26A 3UJGA 3F3ZA 1U5QA 2I0VA 2C0TA 2YCFA 3RK5A 2R3JA 5IUGA 3FL4A 5E91A 4CMTA 5K4IA 4W8DA 4X2NA 2RFDA 2FYSA 4ONAA 5BVWA 2ITQA 1YI4A 4QYYA 1JAMA 5D10A 4ZSJA 4XV2A 2P55A 3R28A 2GDOA 3AKLA 3A7GA 3HMOA 2C5VA 4NSTA 3PG1A 2XK9A 3EN6A 3VHEA 3KULB 3ZC5A 4E93A 2PVMA 3QC9A 3HDNA 5EQYA 4JAJA 4KIOA 1LEWA 4CZUA 3KCKA 5CEQA 3CJFA 2YAKA 4FKIA 5L6WL 4G6OA 4IE9A 4QMQA 3MFRA 1GIJA 4H3QA 3PFYA 4FR4A 5I9VA 1JWHA 3DK3A 4MWIA 5CX9A 4TYHB 2XCKA 2YCSA 3DKFA 1YWVA 1BKXA 3QUPA 4K1BA 4LV8A 4XYFA 2QONA 4O4DA 5AR7A 2X7OA 1W7HA 3HNGA 3ZUUA 3DS6A 3OWLA 2F2UA 4BI2A 4O27B 4IWQA 4WOVA 5EHYA 5K5NA 3ML1A 2J7TA 5FUTA 5ANDA 5CASA 3CQEA 4KS7A 5CAOA 2XK8A 2XALA 3OEZA 1VYZA 1IRKA 4KD1A 5IQCA 4PQNA 2CGVA 2HW7A 4MKCA 4MD9E 4ASZA 5CAUA 4YTHA 3R83A 5I3RA 4OBPA 3CD8A 4AW0A 4UXLA 4IZ5A 3KB7A 2EWAA 3F7ZA 3R1SA 5HG7A 2O65A 2G2FA 2VTSA 4WG5A 2UW4A 1KSWA 2GS7A 2PTKA 3VNTA 3FPQA 3CGOA 4O7WA 3GC0A 5EW9A 3P0MA 5HO7A 5JKGA 4QTCA 4RPVA 5IZFA 5LJJA 3GVUA 3RJCA 4HYIA 3QQGA 5HE0A 4GFMA 3TV7A 4ZSLA 4JDKA 2ZVAA 4QTAA 4RLKA 4RJ8A 4YPSA 3F2AA 4EWHA 3FMDA 4JQEA 3OCGA 5HX6A 1PW2A 4FUYA 3RK9A 1WVYA 2QURA 2VWUA 4K0YA 3UYSA 1WAKA 3D5WA 4GVAA 4JBPA 2ITZA 4F9AA 2O63A 2QR8A 5IEVA 4NUSA 5EYKA 4DBXA 4A9RA 4UWCA 4G3FA 3KY2A 2BIYA 1CKIA 2IEWA 3QYWA 4F0GA 2ZV7A 4RIYA 3MVJA 5HLNA 3R8MA 2WGJA 4DH7A 3F3VA 3JVRA 1XH8A 2W5BA 3V3VA 5E8YA 3BYVA 2IW9A 2NRUA 4DYMA 5EM7A 3MN3A 4XG3A 3UE4A 2I6LA 4U80A 2EB2A 2VTMA 2OIBA 4O0SA 2BKKA 4J97A 2XF0A 4F0FA 4U8ZA 2WTIA 4GT4A 3EFJA 1WVWA 2RG5A 3W8LA 4C3RA 3IW6A 3PTGA 4ITHA 2E9UA 1ZRZA 4YJTA 5IISA 3CC6A 2J4ZA 3U4UA 4XBRA 4E4MA 1OECA 3I6UA 5IG1A 4IVBA 3TI1A 5AP6A 5CEKA 2XEZA 4ZIMA 2X0PA 5CYIA 4XNEA 4D2WA 5HU9A 5HD7A 4HYHA 4I41A 5IUIA 1ZYDA 4KSQA 4AZFA 1HOWA 3LJ1A 1NW1A 4C4IA 4QRCA 2F2CB 4RVMA 2H34A 2OF2A 3LM0A 1H01A 5LMKC 1STCE 2WO6A 4RG0A 5IQAA 2C3KA 4C2WA 1V0OA 3OW4A 5ETCA 2GS6A 3BBTB 3CY2A 3GFWA 4M15A 3E93A 4O1OA 4OGRA 1L8TA 4BI1A 4ZSAA 2X9FA 2RFEA 3F7WA 5HIDA 3C4EA 2X8DA 5E8ZA 4RC3A 2W7XA 2FB8A 4RVTA 2E9OA 1YHVA 5ETAA 5DBXA 3U8WA 3FXZA 3IDCA 3Q5ZA 4W4WA 3W33A 3NFGB 3C9WA 3ANRA 5IH6A 3HVCA 5JT2A 3S0OA 3AC2A 4FBXA 3B8QA 1OUKA 4YHTA 5H2UA 5HBJA 4U79A 4YHFA 5J9YA 5CWZA 3IGOA 4GV1A 4O81A 2GTNA 2A1AB 2IZUA 4QMLA 4A4LA 4LV5A 5HZNA 3L9PA 5IU2A 4EC8A 4Q9ZA 3E62A 1Q5KA 2IO6A 2FVDA 2H8HA 5JGDA 4BJJB 5M4FA 2FO0A 3BCEA 1H28A 2GPHA 4NFNA 4F65A 3HRCA 3U6IA 2BHHA 3NS9A 3PVGA 2FSTX 2OBJA 5HCXA 4LDTA 2CJMA 2VX0A 3FKNA 3FZOA 4FKQA 2VTAA 2GNFA 4DEEA 3PDTA 4U44A 3TNIA 4PPAA 3KMWA 2WTDA 2REIA 3U55A 3V5LA 3G9LX 3BQRA 2OXYA 4ZZMA 3IOPA 4BF2A 3PG3A 4G3GA 5LOHA 3NNXA 1IA8A 1VEBA 3F3TA 1AGWA 4O38A 4F7JA 5ACBC 5DPVA 2OWBA 3Q9WA 3UIBA 4E7WA 2JKKA 3Q4CA 4FTUA 1JVPP 4IX3A 4EH7A 3ZO3A 3I6WA 3KXXA 3R2YA 4HCUA 2HZNA 2WMAA 3DZQA 4ZTLA 3E3PA 3FLWA 5AP5A 5F1ZA 1H4LA 3MH1A 1QCFA 4L3JA 2ZAZA 4RQKA 3UOHA 5AP7A 5L3AA 3PVWA 3R04A 3D14A 4ITJA 4DGLC 1UNGA 4UEUA 3OF0A 2C3LA 1PY5A 2W5AA 3EQPA 2UZDA 5CQUA 2WD1A 5AUTA 3JPVA 1KV2A 2JITA 3CTHA 2JFMA 4JAIA 4ZY6A 3R21A 3R8ZA 2W1IA 4JL9A 5E8WA 5A14A 5H8GA 1FGKA 2NP8A 3DFAA 4A9SA 2FUMA 3F3WA 4QP4A 2F49A 1J7UA 4X6QC 2P2HA 4RX7A 4E1ZA 1QMZA 4TTHB 5FBNC 4K9YA 4TT7A 4CKRA 3DNDA 1OL6A 2QOFA 4UMPA 2A0CX 4NCTA 4AXAA 4FIHA 1M2RA 4QMNA 4TWNA 4NL0A 2OGVA 4C4HA 3SG8A 3PRFA 3UBDA 2PUIA 4ZS0A 2HELA 2PZIA 3UMWA 3E8EA 3HV4A 3OXIA 4JS8A 2OJ9A 5E1SA 3SA0A 3KMMA 3OROA 5KE0A 4O0UA 3GCSA 3V5QA 3TNQB 2QOOA 3G6GA 5JZNA 4DG3E 3E7VA 3NSZA 1SZMA 2J0LA 3BEGA 3BWFA 2R7BA 3L9LA 4B0GA 2OZAA 3P9JA 5IF1A 3MY1A 5FEDA 4G6LA 4OUCA 5BVNA 4N57A 5LVNA 1OIYA 4WKQA 5E90A 5B2LA 1YXUA 3ZBXA 4P7EA 4I93A 3DKGA 3BV3A 3EQCA 3DTWA 1XWSA 4FL3A 3Q6WA 4FKTA 2P33A 2CLXA 1J91A 5D11A 5FWKK 3T3UA 3EQDA 2HXLA 3QRIA 4IMYA 4AGWA 4QQTA 4D2RA 4YU2A 3PE1A 3ALOA 2HOGA 5AV3A 3GNIB 4RIOA 4YJNA 4G17A 4QD6A 4C61A 4MD7E 4CMUA 2A98A 4FEQA 5EM6A 1TFFA 4EC9A 4M97A 4RIXB 5E8XA 2V62A 2BALA 1Q24A 4GRBA 2PUPA 4C38A 4UMRA 4B8LA 1REJA 3I0QA 2WQOA 3LCTA 3LXPA 5K0XA 3NW7A 2DS1A 4DF3A 1K3AA 4UY9A 4EBWA 2BILB 4I92A 3H4JA 2VTTA 2PVJA 4MXXA 1KE6A 1R0PA 5I9YA 1WZYA 5CZHA 5C27A 3O7LB 3F5GA 2YCRA 3VULA 4Z3VA 3MFSA 3A4PA 4MHAA 3RINA 3T9IA 4ASDA 4C33A 4D4SA 3DY7A 1JSVA 3HL7A 4ZY4A 2BTRA 3GUBA 5CT0A 3PPJA 5CI6A 5D1JA 4BICA 4DFYA 2J2IB 4LMNA 5AR3A 4ACHA 1P4FA 4FIIA 2B52A 2ZDTA 4AE6A 2VTLA 3MTLA 3VO3A 4MBIA 4O22A 5AM7A 4DC2A 5KKRB 3RZFA 1Z9XA 3TXOA 1PF8A 1YXVA 4HZSA 5KO1A 2CKQA 4PY1A 2C4GA 4JQ7A 1DI8A 4EONA 1YHSA 4O7SA 5IEXA 4JG6A 3W1FA 4PF4A 1S9IA 4K18A 3C0GA 3NUNA 3VS5A 2EVAA 4CFXA 2RF