4IX4A

Crystal structure of a stt7 homolog from micromonas algae in complex with adp
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
346
structure length
346
Chain Sequence
b'LKARGGPKTLRRTPGVEPKDIRVLPGPLGSGNFGTVFRGVFKGDQDVVLKNAKADVMAAEELLECEMDVNYHVHANAKGTCARFMGCIELGAKDGGEIYNGTLTEGLWLMWANEGENTVEALMRRGTAPLATAMACADATELGVTKKAMRELLGSLARLHECGVVHRDVKPANLIAAEKDGGVLKLIDLGAAALCLPLPETLNYYPGDGPADPRYAKADELYLLPPGSPRPTKDNAAKLWEAHKPDRFDSWSAGCVMLQLAVVGLRTDAGLERFLADYKAVGYDVNAFRGEKSGEYGTMDFAALDANGGAGWDLCQRLMEAERDARASCEAALSHAFFDAAALEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic domain of a state transition kinase homolog from Micromonas algae
pubmed doi rcsb
molecule keywords MsStt7d protein
source organism Micromonas
molecule tags Transferase
total genus 105
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ix4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ix4A01
2R2PA 3O71A 3EFJA 5E1EA 5EW8A 4CNHA 2VTOA 3DLZA 3MH2A 3KRRA 3I5NA 3Q4TA 2NO3A 2HZ4A 4X3FB 4X2KA 5JFVA 4DCEA 4F0FA 4MH7A 4JRNA 5IQHA 2UW5A 2XJ1A 2OI4X 2HYYA 3GC7A 3ZU7A 4E6CA 3U6JA 4IBMA 4OT6A 4W9WA 4X2GA 4QMYA 2CGWA 1ATPE 2J0IA 3HV6A 4DT8A 1V0OA 2XK3A 4WG3A 2WXVA 4CV9A 2BFXA 4JR7A 2HOGA 4F9WA 2PMNX 1NA7A 4L3JA 4EJNA 4PRJA 4UALA 5AA9A 5JSMA 4RJ8A 4CVAA 5AUTA 4BWXA 5ETCA 3QYWA 4ZMFA 3BE9A 3H4JA 3LVPA 3NYOA 3ODZX 2JC6A 4PL4A 2BROA 3UMWA 3UO4A 2QVSE 3FKNA 4AOTA 2QD9A 4F08A 4I22A 4ITJA 4NEUA 4XG7A 5AR3A 5FDPA 4DG2E 4XV9A 1P5EA 2W0JA 3R00A 1M2RA 3I0QA 3SRVA 2PMOX 4PY1A 3R7VA 5CQWA 5DVRA 5CXZA 2WQNA 2QOKA 2WELA 1Y6BA 3HECA 3MJ1A 5HKMA 2PVNA 2C1BA 1BI8A 1CTPE 4KBCA 4QMXA 5H8BA 3UQGA 4JBVA 3RALA 3DCVA 4BTKA 3AG9A 3QCXA 1QPEA 4RX5A 2YDJA 5J5SA 1GIHA 4FUXA 3MV5A 2YCFA 5EM5A 3EZVA 3QBNA 1OBGA 3PIXA 4PTCA 3R01A 4OTFA 4YJQA 3FHIA 4IB3A 3PSCA 2E9VA 4C4EA 4QMPA 2EU9A 1UA2A 2HW6A 3LMGA 1Y91A 3CPBA 1PXNA 3QKLA 5BUJA 3AT2A 5IUHA 3C4ZA 3OCSA 4WG4A 4CKIA 3G6HA 3KULA 3QTXA 1IR3A 1OI9A 3ITZA 1KE8A 3ZOSA 2BKZA 4DC2A 4FGRA 4BDEA 1B6CB 3R9DA 3R28A 3ZO1A 4E5BA 4E4MA 4FEVA 2EVAA 1J1CA 3DS6A 3QQKA 5D1JA 3CC6A 4FL3A 3DBQA 3AGLA 2V0DA 3K5UA 4MD9E 5IH5A 2DWBA 4PMTA 3SVVA 3HLLA 4IHPA 3KXXA 4IZAA 3DPKA 4NM7A 4NW5A 4ZTSA 2PUPA 2XNBA 4TY1A 5CEMA 5AAEA 5M4CA 5AFVA 3WZKA 4FV5A 2R7IA 4LV8A 3DBEA 4YO6A 2BAKA 2WIPA 2X8DA 3K3IA 3R0TA 4W4VA 1UVRA 3FQHA 1OIQA 3R8PA 1QPDA 3R8LA 4D4RA 5BVDA 5CX9A 4Z7HA 4O7VA 3D15A 2C0IA 5LMKC 4IX6A 4CFXA 3ELJA 4HVDA 4G3FA 4DGNA 2A0CX 1QL6A 4EQMA 2WD1A 5LJJA 3ATTA 4IM3A 4NIFA 3RCJA 4LM5A 2CLXA 4AOIA 3I81A 4B8LA 1ZY4A 3LAUA 3P86A 2XKCA 1M7NA 1YHSA 2VN9A 4N0SA 1XJDA 4IWOA 4NJ3A 4NUSA 3R8MA 4I20A 5CF6A 2B9HA 5DBXA 4O7NA 2XNEA 1APME 4LL0A 2VWVA 2OZOA 4ASXA 3LCOA 4FG7A 5EM8A 1RE8A 3WIKA 2WTDA 1O6LA 3PSDA 4E93A 5EHLA 3NS9A 4QP9A 2EUFB 4XG2A 5GJFA 4KIQA 4FT7A 5K9IA 3VW8A 4DBXA 4RLLA 1H0VA 3N51A 4IDTA 4RQKA 4AA0A 4MQ2A 3GXLA 3IDBA 4EH4A 4TKSA 5I5ZA 4CG8A 2VWZA 4UX9A 3TUDA 3TV6A 2WMUA 5ANDA 5LCJA 4FZFB 1JWHA 3WZUA 4B0GA 5J5TA 4FNYA 4W4YA 4IM2A 4YJUA 3PJ3A 5EKOA 1FGIA 5EKNA 2Z60A 2XH5A 3CJFA 2ONLC 3Q60A 4EK8A 2OLCA 4G6LA 5JGAA 4HGSA 4BCOA 3HNGA 5GIOE 2XJ0A 3Q2JA 2YN8A 4GS6A 5AIKA 3HMOA 3RPVA 3OTVA 4C7TA 5AR8A 1FQ1B 4D9UA 4EK4A 5E8XA 4L00A 1YRPA 1DS5A 3AOXA 4I5HA 3NRMA 3G6GA 4JBQA 4NZWB 4PPBA 1T46A 3QX4A 4PWNA 4XRJA 2OJJA 3QX2A 3WF6A 3MH3A 4BTJA 3ID6C 2WQBA 1RQQA 1BI7A 2LGCA 4IVAA 3NPCA 4XJ0A 2G1TA 3L8PA 4FODA 1H24A 4Q2AA 1MRUA 1NVRA 2ERZE 5AM7A 4ALWA 4E6DA 4ZSAA 3LM0A 4BDKA 5F1ZA 4FL1A 5AR5A 4U80A 4DEDA 3LQ8A 5IQAA 4D0XA 2ACXA 4DINA 5IDNA 5IQFA 1VR2A 1SZMA 3D5UA 4FKJA 4AT5A 3N4TA 1KOAA 2QOIA 3TNIA 1OM1A 5GINE 4MXZA 2X2KA 5KBRA 4QMWA 5DEWA 5FBNC 4QD6A 2W1ZA 1H26A 1CKJA 4AWIA 4A9UA 2WOTA 4GUEA 3R2YA 4YP8A 3G15A 1R78A 4YHFA 1V1KA 1TVOA 3QA0A 4D2PA 5FXSA 2A1AB 3QZIA 2CGXA 2BDWA 3AMBA 4EK6A 3F6XA 2HENA 2V5QA 2J90A 3E3BX 3KN6A 4WRSA 2DS1A 1Q5KA 2F7ZE 1GNGA 3Q52A 4XHKB 5D12A 3NMUF 5EHYA 3BKBA 1SNUA 4X0MA 4AS0A 3VF8A 4KBAA 2XUUA 3P7BA 2CNQA 3Q6UA 3D5XA 1PMNA 3AC4A 2R3NA 3F3ZA 4CQEA 3ENMA 3AD5A 1URWA 4AXAA 2CKQA 4Y72A 3UDBA 2OIDA 2GFSA 2UVYA 4BR3A 3QQLA 5ANGA 5CNOA 4BBMA 2VTTA 2J5EA 2F2CB 5H2UA 4QYFA 3LQ3A 1B39A 2WIHA 3FXZA 2YZAA 2BIKB 2OF4A 3FE3A 2GNIA 4KIPA 1CKIA 4OUCA 4BGQA 2RFNA 2JD5A 3VULA 5LVMA 5AUZA 2CNVA 1BKXA 4EBVA 3P08A 4FNXA 2CGUA 3VVHA 3QTRA 2O0UA 3T3VA 4H3PA 1JBPE 3CLYA 4P4CA 4FKGA 4FUYA 4TL0A 5M51A 3HAVA 3C5UA 5HU9A 2GQSA 4DITA 4JG6A 4RFMA 3KXMA 2RG5A 4BRXA 3WZJA 4FV2A 4M69A 4KINA 4FT3A 3L9LA 4YTIA 4IEBA 4K6ZA 3KA0A 3UMXA 1XR1A 3OW3A 2I1MA 2F7EE 1ZLTA 2ITZA 3ALOA 3U8WA 3R9RA 1K2PA 5M4IA 4RJ4A 4AOJA 4PDYA 2ITPA 4FV0A 4ZEGA 2VGOA 3AD6A 3DJ5A 1VYZA 2X6DA 3EOCA 4O0TA 2O2UA 4LV5A 2IO6A 5F94A 5AR7A 4ZLOA 3COMA 3ZO2A 2WNTA 4GYGA 4YZ9A 3TM0A 2PSQA 3V8SA 2HZIA 5L6OA 3CQWA 3VBYA 4GRBA 4M97A 4B7TA 1H1PA 3CEKA 3QQUA 2CLQA 4CFVA 3PXKA 4E6QA 2EB2A 2R0UA 1PMEA 3KULB 4I6FA 4L3PA 4O0RA 4E5AX 4FV4A 3PVBA 4IAYA 4H05A 3R30A 3FWQA 3EN4A 4LG4A 3MFTA 4X2JA 5DIAA 3EFWA 4DGOA 3MESA 1EH4A 5BVWA 3MW1A 2J50A 3D7ZA 3QC9A 1FINA 3ZTXA 4DT9A 3AT3A 3F3UA 3FZRA 2G2HA 4O2ZA 1WBPA 3PJ2A 2WKMA 4MNFA 5H8EA 5F4NA 5BVNA 5IA4A 2IJMA 4GK2A 1XQZA 3FPMA 5L8LA 4A4OA 4CRLA 3EN7A 4IVCA 4M13A 4PMSA 4PL5A 3B8RA 4O0YA 2IZRA 5BUEA 3NUAA 3PJ1A 2OIBA 3QD4A 3MFUA 2PMLX 3EHAA 4ZTNA 5HG5A 4E4XA 5IUGA 3BLRA 2VGPA 4PQNA 4BI1A 3O7LD 4WA9A 3ZO4A 4M14A 3ZRLA 3BLHA 4FZAB 2UVXA 1YHWA 2YLEA 2BFYA 2Y4PA 4MHAA 4HCTA 4NIFB 2B4SB 4AW5A 1V0BA 1WZYA 2RFSA 3V04A 2YCQA 2Z02A 4XG3A 4B4LA 4ZTRA 4C8BA 4FT5A 4E8AA 4YJPA 3QTIA 5HLPA 3ZXZA 3TUBA 4JAIA 4BI2A 1G8SA 5IQBA 4D1ZA 1AQ1A 3FMEA 1X8BA 4GJ3A 3W2QA 5JGDA 4AFEA 1ZYCA 4F9AA 1SVHA 3B8QA 3LQ5A 3BGQA 1Q8UA 2GS7A 4P7EA 4I41A 4JQ8A 4U43A 3RNIA 3F5XA 2F4JA 2IN6A 2XK6A 4TT7A 3VHKA 2RIOA 3SOAA 3LCTA 1I09A 3AQVA 1HCLA 4MYGA 4QO9A 3FKLA 4PNKA 3HA8A 2I0VA 5HVJA 3PY1A 3AC1A 1YOLA 2A19B 4M12A 5AR4A 4LGGA 3I60A 3VUTA 5HG9A 3JUHA 4BCNA 3NVMB 3W33A 3PDTA 3WZDA 4FK3A 4PNIA 4UYAA 2ZV9A 5EYCA 4TW9A 3FHRA 4ANLA 1H1SA 4USFA 4UWCA 3DK6A 3SHEA 3S4QA 5JEBA 5KMIA 3F5UA 2IWIA 1IA9A 3R1QA 1Y8YA 4BTFA 3GFWA 4FK6A 2PZRA 4CZTA 5ACBC 2R3OA 3R8VA 4EH3A 3QZHA 2KULA 2HXQA 4F63A 5C4LA 3HP5A 4EJ7A 2ETKA 4GVAA 3ZEWA 3VUHA 3ZSGA 4YLJA 5ETIA 2C69A 4AE9A 1F0QA 1W84A 2GHMA 2ZB1A 1P14A 2V62A 3NW6A 5I9YA 1OZ1A 3Q3BA 3LMHA 1CKPA 5LVPA 4NW6A 4V01A 4GT5A 4PP9A 5HBEA 5CEKA 2E9PA 4C3PA 1HCKA 4MVFA 3L1SA 3C0IA 2A27A 4R77A 1QPCA 3LFFA 3I7CA 4QYHA 4ZY4A 5T68A 3UIBA 5AM6A 3Q9XA 1NVQA 4EOMA 2GCDA 4J52A 4DTAA 4EQCA 3FDNA 4QT1A 5AP2A 3P4KA 4UZDA 3ORMA 4UZHA 4XNEA 3LLAA 1JKLA 4JQ7A 2W4KA 4V05A 4EOSA 4BY9E 2J5FA 2QOBA 4QP8A 3RPYA 2VO0A 3O0GA 4WD5A 3GC0A 3TZMA 5HD4A 5IG1A 3VWAA 4ANBA 4GH2A 3BYUA 2JGZA 3QCQA 3JR1A 3MFRA 5A3XA 3HZTA 4ZTLA 4R7BA 4D55A 3DB8A 1QCFA 5M53A 4E6AA 2IVTA 5DMZA 3R1NA 1KE9A 2QR7A 3HV5A 3R9HA 4IB5A 1XH7A 5I0BA 5CASA 3EL8A 3KVWA 3OBGA 2XIKA 1Q3WA 3R7GA 1DAWA 3NR9A 3SD0A 4C37A 1YDSE 4GEOA 3R1SA 4XYFA 4F7NA 5I9ZA 5BUIA 2PZIA 2XK4A 5CWZA 2UW0A 1LR4A 1ZZLA 3QFVA 3RPRA 3ZUVA 5IUIA 4B6LA 2R64A 3KEXA 3V01A 3I6UA 3ZBXA 5JH6A 2JDOA 3ZO3A 3QRUA 3TT0A 4NJDA 4BYIA 3CKXA 4WHZA 2C47A 3HRFA 4X3FA 2SRCA 1FBNA 1H8FA 1ZWSA 2BZJA 5EG3A 4F4PA 2X2LA 3RAIA 4BB4A 2BHHA 5CEQA 4F64A 3MDYA 1JSUA 3BE2A 3CBLA 3EL7A 4FOCA 2NP8A 5EYKA 5AUWA 3EH9A 4RIOA 2IPXA 5LXMA 2F9GA 1SVGA 4RJ5A 3BEGA 4ANSA 2XVDA 3OW4A 4ENYA 3MVJA 4M69B 5AP0A 5AAFA 4JG8A 4QMOA 3VBTA 2HZNA 2YISA 1RDQE 4O91A 2OWBA 4FTAA 4PPAA 5LCKA 3UGCA 2PY3A 4U42A 3DFAA 2BTRA 3LCDA 3DLSA 4ZTHA 1Q61A 2P55A 5I3OA 2OZAA 2X39A 5HEZA 3AC3A 3WBLA 4LOOA 5BYZA 2W1GA 5E8ZA 4ERWA 4RX8A 1LUFA 2WB8A 4C35A 3UG1A 4QYGA 2CKOA 3CJGA 3ZDUA 3LHJA 2B52A 2FO0A 1SYKA 4HCUA 5E8SA 3O51A 2ZM4A 4GVJA 4A9YA 4F9BA 1JAMA 4F9CA 4QP7A 3SV0A 5C8MA 4I0SA 3KRWA 3FPQA 2PVLA 4C4JA 3O50A 4O0XA 4OBPA 2R3MA 4HNIA 2V55A 3PLSA 1ZRZA 2I0HA 4FKSA 4IC8A 3ZS5A 1E9HA 3EWHA 4C58A 2ONLA 4CFWA 2CN5A 4FF8A 5I9XA 3FQEA 4FL2A 3UPZA 3VC4A 4LFIA 3A99A 4QNYA 4RJ3A 4DFLA 4K9YA 4XV3A 2YCSA 3FV8A 3HRBA 2F49A 3C4FA 3CIKA 3N9XA 3ZRMA 4YTCA 5IQEA 2OJFE 4BCQA 2WMAA 4FA2A 4IW0A 3AC5A 4N4SA 3OXIA 3U9CA 2Y6OA 3QTZA 1U54B 3ZLWA 3EB0A 3QTWA 2YIXA 4IXPA 4JRVA 2R3LA 4CFMA 1ZYDA 2QKWB 4O1PA 4A9RA 2C5NA 4R6VA 4LRMA 3V5QA 5FUTA 4HZRA 3PXRA 4ZZNA 2C6EA 2W96B 1MQBA 5EYMA 2V7AA 2W1IA 5CTPA 4C2WA 4UN0C 5CAQA 3UC4A 3MVLA 3R02A 3UOJA 4KS8A 1STCE 2GU8A 2CSNA 3FEGA 2WMSA 3QCYA 4A9SA 4C4HA 3A7HA 3EQPA 3UIMA 4KRDA 3UQFA 4NFNA 2YZLA 4XP0A 3QC4A 2JLDA 2UVZA 5BMMA 1R3CA 3NUUA 4CYIA 1AD5A 3Q04A 2PTKA 4YTFA 2B54A 3QKKA 3PE1A 5CU3A 2OXDA 3PG1A 4RFZA 4RZVA 5AP6A 3UYTA 4AAAA 4D2TA 5LMBA 4GK3A 2B55A 2W5AA 3R73A 5HIEA 4W8EA 3BYMA 4BDFA 4YR8A 4FIJA 3CS9A 1H28A 4IAZA 3D5VA 4X7QA 4IJPA 2PUUA 1P2AA 4NM5A 4CLJA 4DA5A 1Q24A 5FTOA 4QMUA 1U5RA 4M3QA 3G9NA 3S2PA 2BRBA 3MVMA 3VS7A 3QHWA 3E8CA 5IH6A 3O7LB 3WF8A 3IDPA 4HYUA 3GI3A 4EOKA 2XNOA 5HCYA 2WEIA 1H07A 1PYEA 4AZSA 2HW7A 4DAWA 5AP7A 3QXOA 4CT2A 2AUHA 3MA6A 4ACMA 1H0WA 4MBLA 3EQIA 4U97A 4AUAA 5GZAA 5CEIA 3TIYA 3W55A 2BZHB 5I4NA 2QHNA 3W8QA 4EONA 3SW7A 2GPHA 3LLTA 2EXMA 4BCFA 3O8PA 2VWBA 3A7IA 4EHVA 4LOQA 4M66A 1YOJA 3M42A 4JNWA 3FMHA 3LZBA 2PZPA 3KY2A 3ORPA 3UP7A 1NW1A 4D2SA 2RKUA 3SOCA 2CKEA 2W99B 3PXYA 3MTLA 4EEVA 2C3LA 3QQFA 3PY0A 2OU7A 1WBTA 5J9ZA 3FXWA 3KC3A 1W8CA 4J98A 3OTUA 2YWVA 3HUBA 2BDJA 1XBAA 2EB3A 4H36A 1M2QA 5AV1A 5E8WA 1LPUA 3TNPC 3DAEA 5ANIA 4O84A 1FVTA 4RMZA 4MWHA 4O6EA 2VTIA 5DA3A 4XUFA 4IB1A 4O1OA 2ZDUA 4LI5A 3PPKA 4FKRA 2W05A 1LP4A 2PZYA 4PPCA 3FKOA 4DGMA 4C38A 3ACJA 4ACCA 4BWKA 4JDKA 4NCTC 5HO7A 2YIYA 3U87A 3DKCA 4A06A 4EZ5A 3S00A 5HTIA 2W1HA 1DM2A 4QYYA 1K3AA 3OT8A 5E90A 4EHEA 4AGWA 1NT2A 2J2IB 2CMWA 2WTIA 4M67A 4NM3A 4C2VA 2P0CA 3C0HA 4PP7A 3E5AA 4ANQA 3MBLA 4FMQA 4YC3A 3OROA 5M4UA 4BIBA 3L8VA 3LXPA 4OTWA 3UG2A 4FKUA 4GU9A 2J0KA 1JKTA 4QTEA 1W83A 5KZ0A 4DH1A 5DNRA 1WVXA 3HDNA 4FSQA 5EYDA 3DXNA 2J9MA 3UOHA 5HG7A 2HAKA 5AAGA 4NT4A 4R3RA 4QMLA 3QTQA 1WMKA 4DTBA 2R0IA 3JPVA 5AP3A 5CAOA 4NM0A 1DI8A 3IQ7A 2PHKA 2GQGA 4A4XA 5CVFA 4HPUE 4CQGA 4F70A 2WTWA 2ITNA 3F3VA 4KABA 4XH6A 4YHTA 4DYMA 3GB2A 5KE0A 2QG7A 4WNPA 3ZFXA 3BELA 4BYJA 2Y0AA 4IC7A 3GU7A 2OZAB 4FTTA 2KTYA 1YW2A 3KN5A 4OTHA 3RK9A 1UU8A 4MNEA 5DN3A 4AZTA 2XM9A 1RJBA 2W4JA 3OOMA 4EHZA 2G2IA 4IZ7A 3ZLXA 1O6YA 2QLQA 3RK7A 5H3QA 5IEXA 3EQFA 3HV3A 5HVYA 1U59A 3A7FA 5EHOA 5D9HA 4ITHA 2CDZA 3GU4A 4HGTA 3RPOA 5B2MA 2WTVA 3IK3A 3PTGA 4B8MA 1XBBA 3G5DA 4S31A 4ZTMA 5TKDA 3ZSHA 3EYGA 5FWKK 3K2LA 5A4QA 4FX3A 3CXWA 3GCVA 3A8XA 3HMMA 3Q6WA 4TWPA 2PVRA 1OBDA 3R7UA 1QPJA 3QZFA 5AV3A 1XH8A 3PXQA 4R78A 2CPKE 3PIZA 4FVQA 3BHUA 3QRJA 4CT1A 2GNJA 2YJSA 4RVLA 3E92A 4RC4A 4J95A 5KKRC 4RWLA 4ASEA 3NYVA 4DEEA 4PF4A 3LXKA 5C01A 2YM6A 4RC2A 4GIHA 3KVXA 4AACA 5J9LA 3BU5A 5AWMA 2VNYA 4CCBA 1J7IA 2CGVA 4F7SA 3E88A 1Y8GA 1S9IA 2AYPA 4JI9A 4PDPA 4XG6A 2E9NA 4J53A 3N4UA 3TDWA 1FOTA 4CRSA 5AP5A 4IVDA 3OWKA 4ZJJA 3C50A 3EQRA 3MY5A 3WF9A 4E73A 5LARA 2GDOA 2RFDA 4ZLYA 4TNBA 4AZEA 4PTGA 5GZ8A 1YXSA 3KMMA 3LM5A 3D4QA 4D4SA 4PMMA 3TACA 1J7LA 3K5VA 4EHGA 4EZ3A 1R39A 4M84A 3TL8A 3FYJX 3GCPA 4HZSA 2UUEA 4N70A 4O96A 4RIXB 1H00A 3OCBA 3TZ9A 3ORXA 4FTUA 3C4WA 3GVUA 4MBJA 1CM8A 2CJMA 4DEBA 2JKKA 2YM8A 4R7IA 4APCA 3QUEA 3WYXA 4ITIA 3ZUTA 4L3LA 3LMIA 5A6NA 3I79A 3CPCA 4IJ9A 4JBPA 3PE2A 4JL9A 3CQEA 4EC8A 4Q9SA 4ZS0A 1BYGA 1UWHA 2QNJA 3DAKA 2R3KA 5AV0A 5DR2A 5IA2A 3ZM9A 2YEXA 4CXAA 2JKQA 2BIYA 5C8NA 2PZ5A 5JRSA 5HX8A 4W9XA 4JX3A 5K5NA 2PU8A 4BCJA 4WG5A 3R7OA 3TIZA 2BHEA 3QUDA 1AGWA 2QOQA 2UZWE 3REPA 3U54A 3VS6A 3Q2MA 5HTCA 4G6NA 3VBXA 3COIA 2WZJA 3NUNA 3NIZA 4YNEA 3KL8A 4FSNA 1JLUE 4CFUA 5ITAA 5E8VA 2YERA 3OEZA 5H8GA 4ARKA 4BDHA 2YM3A 4IX3A 4NSTA 4E1ZA 2X7OA 2OJIA 1OITA 1TQIA 1Z9XA 2X2MA 3WF5A 4ZSLA 2PYWA 2C6MA 3KCKA 3VRZA 2G01A 3VS0A 4XCUA 3ULIA 3CE3A 4WBBB 3ORLA 4WIHA 5CNNA 4EH5A 3DY7A 3LFEA 1FGKA 2QODA 4AW0A 4F7JA 1ZYSA 3WIGA 3ZONA 3NZ0A 3OUKA 5IA5A 4AQCA 1BL7A 5HESA 2O65A 4U6RA 2IVSA 4EOOA 3OUNB 3UIXA 3VF9A 3U9NA 3MGYA 3IS5A 4XBRA 5JZNA 3ZM4A 1YI6A 4K2RA 4U41A 3P78A 1OL2A 2I0YA 3A62A 4LOPA 4BDCA 3UNJA 1OIYA 3DQXA 1CMKE 2QQ7A 2ZMDA 3NUPA 1JQHA 2P2HA 1OL1A 4TXCA 3NSZA 5CXHA 1S9JA 5HE0A 4EOIA 4HYHA 2AC5A 3Q32A 3U6IA 2Z2WA 3WI6A 4RFYA 4R7HA 4YZDA 1H4LA 3KXNA 3T9TA 3VS1A 3FL5A 3ZC6A 4AGCA 1TQPA 5JZJA 3GCUA 3KRXA 1VJYA 2YJRA 1PXIA 1IAHA 4F7LA 4YJSA 4IAAA 4G6OA 2YCRA 4EH9A 3UZPA 5IQGA 2Z7LA 3KKVA 4CEGA 4ZLZA 4IZYA 4TTHB 4MEDA 3KMUA 4QMQA 4BC6A 3P5KA 3FMLA 4G3GA 1BMKA 3BHVA 3KGAA 3BYVA 4NWMA 5FP6A 3NNUA 4D5HA 3RMFA 2G9XA 4EQUA 1MRVA 2OK1A 2VO7A 3RZBA 4AN2A 5CAUA 2BALA 3DTCA 5DI1A 2OO8X 3WARA 4ZZOA 4TZRA 1A9UA 5ANOA 3UNZA 2BRGA 4CCUA 3TJCA 1CSNA 3GC9A 5A14A 4I5PA 4R3CA 4O0VA 4OTGA 4DH3A 1KE7A 4MXAA 1XKKA 2XKDA 2YAAA 1REKA 1UV5A 2FSMX 4JBOA 2BRNA 3EYHA 1WBOA 4H58A 4JVGA 3SC1A 2UZUE 3WYYA 5KHWA 5E9EA 3O17A 4UY9A 5CY3A 3BLQA 3ZDIA 2HXLA 5IA0A 4TNDA 2JIIA 5BMSA 2J0JA 2WU6A 4TWOA 2ZVAA 3FC1X 3TWJA 4UYNA 2OIQA 1G5SA 4C4FA 5DR6A 1I44A 5HCXA 4IB0A 4BL1A 1UU9A 3JVSA 2W1CA 2WO6A 4NYEA 2OBJA 3DJ6A 3MA3A 4O22A 4DGLC 2BCJA 2CCIA 4H3BA 2VO6A 4FSRA 5AUXA 5TE0A 4D2VA 5IEYA 4K77A 4MNEB 1Q8ZA 1H08A 5EI2A 3DU8A 2VTNA 3E8EA 4FSTA 3EQGA 4EC9A 4I3ZA 5D11A 2PUIA 4HCVA 5M56A 1NXKA 5HGIA 3H3CA 2YDKA 1Q97A 1OMWA 5L4QA 1BUHA 4RPVA 1H25A 4JXFA 3DFCB 4W4WA 4FGBA 4I6BA 4MD8E 4X2FA 5LVLA 4LUDA 2UZTA 2Y4IB 3KMWA 2FVDA 2C6KA 3LFQA 4RA5A 4LQMA 2J51A 4BCKA 5ETAA 1FMKA 4I0TA 2Z8CA 5DRBA 4RSSA 4I94A 4C3RA 1PKDA 2CHLA 2B1PA 4LGHA 5HHWA 4B99A 4OBOA 3MB6A 2YWPA 4JDJA 4YO4A 3QRTA 3D9VA 3VJNA 5AA8A 3R63A 2IVUA 5IA1A 4KBKA 3C0GA 3VUKA 2ETRA 4E5WA 4AP7A 1SNXA 3O2MA 3NWWA 3PP0A 4L67A 4D4YA 2XZSA 3VUIA 4DE4A 3NGAA 4XS2A 3RP9A 4Y5QA 5FQDC 1Q8YA 3PJ8A 1ZARA 2IW8A 3RM6A 5BYLA 3ZLSA 2UZNA 2ZM3A 5BVFA 4QQTA 5CT7A 2NRUA 4OTDA 5E7RA 2YABA 4YZCA 2QKRA 3RZFA 2UZVA 1O9UA 4QMNA 4G5JA 5AJQA 5A4TA 4L6QA 2JFLA 4R8QA 1WAKA 4XMOA 3QWJA 4GT4A 1U54A 4YJNA 4I92A 4FV8A 4CZUA 2YM7A 4Y95A 1U5QA 5J87A 4U9AA 4KAOA 2ZM1A 5DOSA 4BTMA 4QTBA 2OICA 4FVPA 3ZMMA 3DKOA 4FZ7A 4BICA 3GQIA 3G51A 1UNGA 4LGDA 5HCZA 1ND4A 1MQ4A 1UU3A 3COKA 3F3TA 3GP0A 3KK8A 4CTBA 4FOBA 3TJDA 5K0KA 4X6QC 3RWQA 3PLAE 3DNDA 2PVJA 4YJTA 3DBCA 4FKLA 2XF0A 4DEIA 1BLXA 3FYKX 2BRHA 3AMYA 2X4ZA 1SM2A 3DZOA 4FSWA 3QUPA 4K33A 4TRLA 4FTQA 3ENHA 2O63A 4O7TA 3VS3A 4I5CA 3TUCA 4ZZMA 1CDKA 2XIXA 1PMVA 4UBAA 1PMUA 5LMAA 3UVRA 3BEAA 4USEA 3GU5A 4DH5A 1XH5A 3FLWA 3SW4A 3HDMA 4J99A 4DCAA 2FH9A 4X21A 2BKKA 3UC3A 4C0TA 4FT0A 2JBOA 1WFCA 2VU3A 4MF1A 4YTHA 3RAHA 4Z3VA 1ZYLA 2XJ2A 2PPQA 1XWSA 2J0MB 3HP2A 4RIWA 4YURA 3Q5ZA 4NKSA 4FZDB 4QTCA 3PA3A 2WTKB 5IKWA 3NEWA 2WMVA 3MIYA 4FE2A 2YIWA 5DRDA 1H01A 5J8IA 4QRCA 5A6OA 3D2KA 3I5ZA 5CVGA 5BVKA 3H0YA 3QA8A 4I4FA 4XG9A 2UZDA 4GT3A 2VX1A 4KB8A 5CEOA 5KUPA 4EZ7A 5CYIA 2P2IA 4IIRA 3FLNC 4U3YA 1OKYA 4ENXA 3ZYAA 1Q4LA 3HGKA 3F88A 3FI8A 3HX4A 3IO7A 4PX6A 2IZTA 4L01A 4QMTA 4F9YA 2WMBA 1GY3A 5IEVA 4RJ7A 3TDVA 4BZOA 4FG8A 4ZSJA 1OUKA 2QU6A 1OL6A 3VS4A 4C57A 3V6SA 4EKKA 4YLKA 4DF3A 3ZXTA 5B2KA 3S1HA 3F66A 3FZOA 4O38A 4YGAA 5IQDA 3HUCA 4MAOA 3BV3A 3ANRA 3OWPA 5CSVA 4BZDA 3EMGA 3OFMA 3Q9YA 2W4OA 4UMTA 4KUJA 1JKKA 3LXNA 2CN8A 2OKRA 4M0ZA 2UZEA 3E3PA 3RHKA 2W1EA 4AW1A 1FPUA 2X8IA 3ETAA 1K9AA 4IAFA 2VRXA 3P23A 4XV1A 1M52A 3OS3A 3DK7A 3TZ7A 1OB3A 1OUYA 3AGMA 3WZEA 4FEUA 1KV2A 2UW9A 4WUNA 3F82A 2YA9A 5CI6A 1M14A 5L2IA 4C62A 3LCSA 3CTJA 5JT2A 4GYIA 2RF9A 5DHJA 4ACDA 1Q62A 3K3JA 4X3JA 2GHLA 3LOKA 4GKHA 5FTQA 3HKOA 4EH2A 5KMNA 3ZLYA 1ZMUA 3PY3A 4FIGA 4I4EA 4K8AA 3BWFA 4D4VA 2OJGA 1A06A 5HNBA 3W2RA 3KRJA 1BX6A 1H1QA 3CKWA 4FKIA 5F95A 2VWXA 5IA3A 4U81A 4XX9A 4ZY6A 3R71A 3LFBA 4AGUA 4EI4A 4KWPA 4EOPA 3H9RA 2WHBA 4G16A 2A4LA 1DAYA 2ITXA 3MYGA 5AX3A 5EK7A 5IQCA 2H9VA 2PE2A 5C9CA 2ZJWA 3UVQA 3RJCA 2YACA 4KSPA 3E93A 4L7FA 2XBJA 5CSHA 3NW5A 5HIBA 4IWPA 1KOBA 3LFCA 3M2WA 4P5ZA 4AU8A 2IG7A 4O86A 4AF3A 4AG8A 4E20A 5M44A 1PXPA 5LMKA 1JKSA 4N6ZA 4D1XA 4O0SA 5AMNA 2Z7QA 4MX9A 1YDTE 2X81A 3R7IA 5CANA 3UNKA 4BCIA 1P4OA 5AIRA 5CSPA 2GMXA 5L2WA 5EFQA 2F57A 4L53A 4WT6A 5DH3A 2WFYA 2VAGA 5K5XA 3GCQA 4YHJA 1WBSA 4FTNA 4PDOA 4DEAA 3FZPA 3SAYA 3W8LA 4JIAA 3PVUA 3QTSA 3QLFA 2OH0E 4M68A 4YZMA 2C3KA 2HZ0A 2QLUA 2UZBA 4G9RA 1J91A 4EWHA 5ANKA 4LRJA 3TN8A 1SMHA 2PUNA 3QQHA 3W16A 4BIDA 3R9NA 2A2AA 3FQSA 2WEVA 4U8ZA 2C5OA 3FSKA 3LJ0A 4G31A 4D2RA 3IGGA 3CGFA 4I5MA 1BL6A 2QI8A 2R3HA 5FLFA 3QF9A 1KE6A 1P4FA 2FGIA 2PE1A 2R4BA 4QMMA 1YXTA 3AD4A 3OY3A 3ODYX 4CD0A 4Q9ZA 4KRCA 5L2SA 2WAJA 2R3JA 2W9FB 2H8HA 3OF0A 4UWBA 2WMQA 1XH4A 3BZ3A 2UZLA 3C51A 2Y9QA 3FLYA 3HL7A 5LVOA 4NFMA 3PSBA 3NLBA 3F9NA 4FTRA 4D1SA 3RVGA 5E1SA 5KMKA 3JY0A 5M06A 2ERKA 2UW3A 3H10A 2OGVA 4FI1A 5AP4A 3PXZA 3VUMA 3BHYA 4MQ1A 4QQ5A 5CENA 3VBVA 4O7YA 1GOLA 3DGKA 4S32A 4LL5A 2XA4A 1YVJA 5EQEA 3E63A 4FTKA 4WSQA 1L8TA 1H1WA 2X7GA 4Z9LA 4BKJA 2WMWA 3QKMA 1ZMWA 3BYOA 3UQCA 1ZZ2A 2F7XE 3ANQA 4YZNA 3MN3A 4HGEA 4XBUA 2BDFA 2W7XA 4MWIA 3TXOA 4GW8A 4L46A 5DFPA 4PL3A 4CFFA 1KUTA 5FM3A 3E62A 4APPA 3M11A 3PRIA 3NAYA 2PMIA 5AR2A 4RX9A 4S30A 2ITUA 5HLNA 2ITYA 2XS0A 4JIKA 1NY3A 4AFJA 4E7WA 4IAIA 4IFCA 3HEGA 4EUUA 3D83A 3F5PA 4RIXA 3R2BA 4USDA 4HPTE 2YAKA 3VO3A 3KREA 1PKGA 1Z5MA 3MPTA 2VTAA 1KE5A 5CU0A 5FXRA 2XBAA 5BX0A 2Y6MA 4NTTA 5IISA 4L44A 4UV0A 3AC2A 3IECA 5CF5A 5F9EA 1U46A 4D2WA 5LVNA 3E8DA 4ERKA 4FTIA 4BKYA 5IZFA 5JK3A 1GZNA 2GS6A 2FYSA 4NK9A 3U6HA 3W18A 2VTHA 3IW4A 4JDIA 4ALVA 4MTAA 3C1XA 4G34A 3AXWA 3P9JA 4O7LA 4RIWB 4DBNA 3EJ1A 3LW0A 5C4KA 4UMPA 3TCPA 4I6HA 3E8NA 3JS2A 4UMRA 3FZTA 5A9UA 4RQVA 3RAWA 2YFXA 2GQRA 2JDSA 3MPMA 2VX3A 4J96A 2BZIB 3RI1A 3KXHA 1YOMA 5M09A 3FY0A 2C4GA 2ZV8A 5L8KA 5BNJA 2O64A 3G9LX 4S2ZA 4ZTQA 2NNWB 4MXOA 3QHRA 3UO6A 1Y57A 4MXYA 1YWVA 5C27A 2IZUA 1WBWA 1PXKA 2BAJA 2C1AA 3A4PA 2GHGA 3R6XA 4FKQA 3PG3A 4QP4A 4F0IA 4DFBA 4PTEA 4X6RA 5J7BA 5HX6A 4IQ6A 2PVYA 2PVHA 4IX5A 5JQ8A 1VYWA 5BVEA 2X6EA 3RWPA 3TNHA 3E7OA 4PV0A 5DR9A 5E8YA 2HWPA 2LAVA 4F0GA 5HQ0A 3BCEA 4EOJA 4W8DA 2VTJA 2BZKB 3C7QA 3OG7A 3ZZEA 4QPSA 4UMUA 2JDVA 3ZHPC 4E4NA 5KMJA 2B9IA 4PDSA 3NYNA 5CEPA 5J9YA 4PMPA 3UP2A 2G15A 3GU6A 3RBWA 5KMLA 3GBZA 5IF1A 5KCVA 3F3WA 4G3DA 5C1QB 3W32A 1PJKA 4ACGA 3FI4A 3NNXA 4II5A 3L9MA 5DWRA 2VX0A 5E4HA 4ZMEA 3D14A 3OD6X 4JJRA 5JRQA 4CZYB 3PZEA 3NIEA 4KKHA 4EWQA 4FIEA 3UVPA 4FSZA 4CFNA 3PJCA 2HY81 3RAKA 3UOKA 2C6LA 4KKEA 3IONA 2QG5A 4FKPA 4O21A 4RG0A 4F09A 1XHAA 4C34A 5BVOA 1DI9A 5J1WA 3I1AA 3EKKA 2J4ZA 4RC3A 1OL7A 3IKAA 2Z7SA 5E92A 2YLFA 3FUPA 3OWLA 4A07A 3P0MA 3PIYA 5FGKA 3U51A 1JPAA 2ITTA 4JDHA 4ZSGA 3A2CA 5L2QA 4RA4A 4UXLA 3QWKA 4WRGA 4AZVA 3UZRA 3H9OA 3BGPA 4TYGA 4ZSEA 4KIKA 4L7SA 5AUUA 4TYHA 3PXFA 5AV2A 3VAPA 4E4LA 2PULA 4OTPA 5J95A 5GIPE 4Y5HA 4KKGA 4QP3A 4R5SA 4YSMA 4OAVB 3BX5A 4O2PA 4DH8A 5KMOA 1MP8A 5FEQA 4YBJA 2C6DA 3FC2A 4NKAA 2QC6A 3FLQA 4OBQA 3W2SA 4UB7A 3EQCA 3PA4A 1YXVA 3PWYA 2OFUA 4K18A 1VZOA 3PPJA 4RIYA 3OWJA 4RRVA 3N4VA 1YWNA 2QO2A 2JEDA 3KFAA 3E7VA 4FSMA 5FDXA 4WNOA 3VJOA 4CMUA 3R8ZA 1L3RE 4ZOGA 3RGFA 5EW9A 4EUTA 3ORTA 3P7AA 3NCZA 4P2KA 3GNIB 4XEYA 1YHVA 3WE8A 4A7CA 3C13A 4OAUC 1OPKA 3ALNA 3D7TA 3UZTA 2PL0A 4A4LA 1J1BA 3MY0A 4IADA 3FMNA 3BRBA 3UPXA 3FL4A 4FKTA 1OVEA 2QU5A 4BKZA 2F2UA 2JFMA 5CSWA 4FIFA 1FVVA 2FA2A 1GZOA 2B53A 2QOLA 5GNKA 4YLLA 5CU4A 3IW7A 3CCNA 3ERKA 3GUBA 5TO8A 4R5YA 4IE9A 4ALUA 3UBDA 3KRLA 2VD5A 1YI4A 4O27B 4IFGA 5TT7A 3G33A 2ZMCA 4IMYA 4QQCA 3EN9A 4NH1A 1Q3DA 5FM2A 4M7IA 4YU2A 3FAAA 3P7CA 2E9OA 3EN6A 1WVYA 3SXRA 4Y85A 2Q0BA 2XNNA 4XLVA 4XG8A 4FVRA 3V5JA 4BVUA 4O7RA 4QTDA 4TWNA 3KF7A 4FV9A 2WQMA 3SQQA 4CG9A 2VNWA 2XIZA 5CT0A 2BPMA 2DQ7X 2W1FA 3PUPA 3S95A 3EFLA 1ZOGA 1PF8A 4ONAA 4CTCA 5TOZA 5FG8A 5EOBA 4DFNA 1W82A 4OR5A 4RVMA 4UWYA 5CZIA 4L9IA 4CMTA 5HNIX 5BQ0A 1PY5A 2XK8A 3P79A 4L8MA 5TF9A 5KNJA 2I6LA 4GG7A 4QMZA 5I9VA 5IH4A 4BDAA 5LOHA 5E91A 4BI0A 3BQCA 4GJ2A 4BBEA 4HVSA 4JT3A 2WMRA 5CS6A 5HE3A 5BYYA 2XNPA 3MWUA 1ZXEA 3QTUA 4FKVA 5I3RA 4O0WA 2IZSA 2R9SA 4ANNA 5L6WL 3DDPA 4Z55A 1H1RA 2WU7A 5IMEA 2WQEA 4FIIA 2ZV2A 2ZV7A 4ZK5A 4F99A 3CQUA 5LQFA 2BAQA 3TZ8A 4IH8A 3FLZA 4C33A 3V3VA 4BDIA 4HVIA 4I0RA 4ZJIA 2PVKA 4TWCA 4X3FC 1YXUA 3ET7A 3HV4A 3GOKA 5CQUA 4YJRA 1W0XC 3VUDA 5HD7A 2OG8A 5HICA 3LCKA 3QD0A 4MF0A 4WKQA 3R7YA 5D7AA 5FD2A 1TKIA 3JVRA 3MVHA 4XP2A 3TV4A 2QOCA 3VNTA 4ZAUA 3BWJA 1ZYJA 3GU8A 5H9BA 2VTSA 3QCSA 3KF4A 3L9NA 4IX4A 2C30A 5M08A 2Y8OA 4YMJA 4GV1A 2CNUA 2JKOA 1YQJA 4FTJA 2WQOA 5HI2A 3SA0A 4HGLA 4DLJA 2R7BA 3THBA 5FBOA 4N6YA 1O6KA 4V0GB 5M4FA 2AC3A 3SXFA 4ZIMA 2VUWA 4J8MA 4IVBA 2C3JA 4WNKA 2HELA 2XKEA 3MY1A 3VRYA 3PVWA 4JLCA 3D94A 3Q4CA 3BU6A 2VWIA 3V8WA 4GFMA 4YC6A 4EK3A 2IW9A 3QAME 4BDDA 3OVVA 3VBWA 5HG8A 3ZRKA 5IPJA 1E1VA 4YBKA 2C6OA 4FSUA 5ANJA 5KBQA 4P5QA 4GIIA 1GJOA 2VO3A 4U79A 4FNZA 3FZSA 4C3FA 3D5WA 4TYIA 4AX8A 4GFGA 4DEGA 5A4CA 4AT3A 4DFXE 5CLPA 3O8UA 3C5IA 3CTQA 1M7QA 2UV2A 2HK5A 2OH4A 3FMKA 2Y7JA 1W98A 4D58A 3FSFA 2R3IA 2X4FA 1Z57A 5CI7A 3II5A 3NX8A 4CSVA 5CF8A 3NYXA 4U45A 3VS2A 4EK5A 4L52A 4QMSA 4FBXA 4G2FA 4LYNA 3DKFA 4FC0A 4NTSA 2J6MA 3FI3A 3OZ6A 4D0WA 4U7ZA 3BIZA 4EH8A 4AW2A 4AN3A 5HBJA 1XBCA 5G6VA 3A7GA 3NCGA 3A4OX 5CU6A 5HBHA 4FV7A 3BBWA 4K0YA 5JFSA 4BCMA 4R1YA 3W2PA 4D28A 4OTQA 2OJ9A 4KD1A 5DGZA 3DNEA 3POZA 3UYSA 3VN9A 3LFSA 3V5WA 3ZUUA 3A7JA 4C02A 1REJA 4H39A 4LUEA 4YZBA 4QP6A 1OIRA 5EDPA 4BCGA 2C0OA 2QURA 3R9OA 2O5KA 3SG8A 3W1FA 1Q8TA 2UW4A 2V7OA 3NUSA 3B2WA 3I4BA 4KIKB 1PRYA 3U55A 5C26A 4TYHB 2ITOA 4IAKA 3PP1A 3HAMA 3RPSA 4AZWA 4DLIA 3GGFA 4L45A 3GC8A 1YDRE 5FXQA 5HE2A 3IDCA 1WVWA 4IACA 4YPSA 1PYXA 4QPAA 4Y46A 3SKCA 3W10A 2UW7A 3BGZA 4RIYB 2H6DA 1LEZA 2QONA 2VTMA 1IA8A 2XNMA 4FEXA 3IGOA 4WSYA 3ATSA 4S33A 3CY3A 2W17A 3G90X 3HMIA 3MTFA 4ANOA 3FMDA 4ZS4A 3D7TB 1OGUA 1Q41A 1SVEA 4OT5A 2OSCA 5D10A 4BHNA 1F5QA 4FEWA 4XOZA 2FB8A 2XCKA 3NNWA 3FJQE 3OHTA 5L3AA 1JSTA 3HVCA 4MD7E 5EDQA 4FNWA 5GZ9A 4BFMA 1ZY5A 1ERKA 5AADA 1KSWA 3GENA 1T45A 3TNWA 4EYJA 3KB7A 5CSXA 1PHKA 4C4IA 2WMXA 1GIJA 3C9WA 3QQJA 4V04A 4F6SA 2R3QA 5DT4A 3BBTB 1E1XA 4O83A 2Z7RA 3I7BA 1W7HA 1PXMA 3IW5A 5B7VA 5CAPA 3R7EA 2ESMA 4MK0A 3P1AA 3BQRA 1OKVA 3QRKA 4BDBA 3SRVB 2QO7A 1UU7A 2DUVA 2H34A 3MH0A 4JR3A 4HW7A 4YJOA 3CR0A 4RGJA 2ITWA 3CD3A 4WBOA 4FKOA 2QOHA 2R3RA 2VTQA 5GJGA 5L2TA 2GS2A 3HA6A 5J79A 3ZFMA 5HE1A 5AP1A 1OECA 2X8EA 2C68A 2XM8A 3KXGA 5IMXA 4XRLA 2PVFA 4YPDA 3TI1A 2BMCA 5FRIA 3HMNA 3ZEPA 2R3PA 5KO1A 2XCHA 2YM4A 5FTGA 2DYLA 4BHZA 4EH6A 2B0QA 3DK3A 5D7VA 3FY2A 4RBLA 4JS8A 3O96A 4G5PA 5EH0A 3WOWA 4EOQA 3HV7A 3NDMA 4F1OA 4DG3E 2XRWA 3L8XA 3ROCA 3F69A 3OCGA 4QYEA 5C03A 4BCHA 3R21A 4I24A 3UODA 3NUYA 5AEPA 2BVAA 4NL0A 1R0PA 2UW6A 1URCA 1NVSA 1OPLA 1IAJA 4BGHA 3CP9A 3MH1A 3SGCA 4EOLA 3EN5A 5ICPA 3KXZA 3E87A 4WUAA 4ACHA 4GSBA 4EKLA 3U4WA 1JVPP 3RM7A 3UTOA 1YI3A 3S0OA 4NCTA 4WNMA 2YITA 5HOAA 3RTPA 4I21A 3DXPA 5ACKA 3GEQA 2QR8A 2BILB 4ZXTA 3H9FA 3TV7A 1F3MC 3E64A 2RGPA 1LEWA 4IWQA 2GNGA 3V5LA 4HOKA 4JX7A 4RVKA 4ID7A 3POOA 5G1XA 5K3YA 4C61A 5KMMA 3EFKA 4Y83A 4O81A 4KIOA 4RLKA 1YXXA 3A61A 3OC1A 1ZMVA 4G3EA 5HZNA 2VTRA 4XLIA 4QPMA 4E26A 4E3CA 4L68A 2FUMA 3COHA 4AT4A 5J1VA 1FMOE 3PRFA 2EXCX 3O8TA 3GT8A 2G2FA 2YIQA 4J1RA 4Y8DA 5JQ5A 1UNLA 2C6IA 3Q96A 2HY0A 5B0XA 4GKIA 5GHVA 2UW8A 2WTJA 3A60A 3U4UA 3L9PA 3ULZA 4C4GA 3PFQA 5DT0A 3MIAA 4J8NA 1R1WA 3ZZWA 1UKHA 2XIRA 1UWJA 4MBIA 3RNYA 3RINA 5JKGA 5B2LA 4DN5A 2P33A 4FIHA 3FLSA 5AX9A 1JSVA 3QGWA 2NRYA 5F20A 5DT3A 2W5HA 5I9UA 2YIRA 5HLWA 4N57A 5EQYA 1YWRA 4C59A 4BDGA 4IDVA 2B7AA 2P4IA 2GTNA 5JN2A 3W2CA 1OL5A 4FG9A 4CYJA 4BDJA 1VEBA 5HORA 2WPAA 4RVTA 4TYEA 5A54A 4OTRA 5EQPA 3BYSA 4EYMA 4GL9A 2Y4IC 3IPHA 3GQLA 4FV3A 4FV6A 4RT7A 4DFZE 4QP1A 2JITA 3KCFA 1M17A 5EW3A 3SLSA 1UKIA 2YHVA 3TG1A 1PXLA 4K11A 2JKMA 3F2RA 3CD8A 3QU0A 3PYYA 3MPAA 1KWPA 3WF7A 2ZDTA 2C6TA 3UJGA 4IANA 4CLIA 2JIUA 4FEQA 4YJVA 2VV9A 3F61A 1KV1A 2EWAA 3H30A 3IOKA 4ZP5A 3VBQA 4BCPA 4YC8A 1FVRA 1R0EA 2BRMA 4QP2A 1IRKA 3GOPA 4F1TA 1JNKA 2XK7A 4QNAA 3EQBA 3AMAA 3LJ1A 3FZ1A 5CAVA 4BZNA 1HOWA 1OIUA 4O0UA 3WILA 2XYNA 3DDQA 5BPYA 5C8KA 4XG4A 3NW7A 5A4LA 4FYOA 2QHMA 2VTPA 2W5BA 2X1NA 2FSTX 5HTBA 2WMTA 3IW6A 4GMYA 4D9TA 1OKWA 5FEEA 4M8TA 4CV8A 4O7SA 3VIDA 4L42A 2I0EA 4AE6A 4D5KA 2O3PA 3SG9A 3OMVA 5EI6A 3K54A 4ASZA 5KHXA 3Q9ZA 3V5TA 2J7TA 2JDRA 5AUVA 3RHXA 4M0YA 4J71A 4GG5A 1U4DA 2OF2A 5DEYA 3QD3A 4F1MA 1TQMA 3JY9A 4FTOA 2ZOQA 4R1VA 4O6LA 2BR1A 4ZY5A 5JGBA 2V22A 4GU6A 3L8SA 4Y73A 2R3GA 5HU3A 3AT4A 4QTAA 4O7WA 2ZAZA 4OLIA 3I0OA 3B2TA 4Q5EA 4GCJA 1ZAOA 5EM6A 4RX7A 3V51A 4Z7GA 2VWYA 3Q53A 2XK9A 1WCCA 2HIWA 4AGDA 4HJOA 3LFNA 3D0EA 4MXXA 4HYSA 3ORZA 4GFOA 5DPVA 5EOLA 3TTJA 4H1JA 3BU3A 4X2NA 2O8YA 2VTLA 2JAVA 5L8JA 3DZQA 3QLGA 3ROYA 3VUGA 3DJ7A 4KSQA 3IW8A 2XKFA 4FKWA 2IVVA 3LE6A 2XEZA 1QMZA 4HVHA 2J0LA 3DXQA 2JDTA 2EXEA 3EKNA 4I23A 4IM0A 2C0TA 4GUBA 3BI6A 4FT9A 4QQJA 4YSJA 3ORIA 4YUQA 5T6KA 4FYNA 3BHTA 3F2AA 4ZJVA 2Q83A 5M55A 3ZH8A 1ZOHA 1V0PA 2WTKC 2VZ6A 3KQ7A 5DLSA 3TNQB 2B9FA 2XRUA 3DA6A 3VW6A 4FTLA 1PXOA 2X0GA 2XMYA 4O82A 2W1DA 1PXJA 3QL8A 1GZKA 4BBFA 5M07A 2PWLA 4JG7A 3CTHA 5LWNA 1OKZA 2I40A 4MCVA 3UOLA 2XB7A 4HVGA 5KZIA 3IG7A 4XOYA 4RJ6A 3MSSA 2OW3A 4FZ6A 3C4CA 3TKUA 4HNFA 2E9UA 4L43A 3TTIA 4Z16A 4JOAA 3QQGA 4FR4A 3RCDA 3S3IA 2NPQA 3ZSIA 3A8WA 4I1ZA 3G0FA 3UE4A 4KNBA 4F6WA 1XH9A 2WGJA 5TR6A 3G0EA 3LIJA 3H0ZA 2PE0A 3T3UA 3NUXA 2PK9A 1GAGA 3PPZA 4LMUA 4UMQA 3SXSA 3ZCLA 4I6QA 5AUYA 3BPRA 3UO5A 1Q8WA 3LFAA 5EDRA 5K4IA 3CSVA 4CMOA 3SX9A 1MUOA 3ZC5A 3EIDA 5K0XA 4BN1A 5IDPA 3ZBFA 2C5YA 3Q9WA 2B9JA 2IW6A 3C4EA 4CKRA 4UEUA 5DYJA 4H3QA 4IZ5A 4DTKA 5A46A 4FTMA 3VQUA 3TKIA 3UIUA 3OEFX 4XV2A 3QGYA 1M2PA 2C5XA 3F7ZA 2ZYBA 5T3QA 4ORKA 4NU1A 4BIEA 4WOVA 3R22A 2ITVA 1PW2A 4G9CA 1B38A 2X9EA 2C5VA 2R5TA 2GNLA 2XEYA 4KS7A 5FEDA 4F65A 5ANEA 3HYHA 5FP5A 5IU2A 5CVHA 5A4EA 1J7UA 4LMNA 4WO5A 2HWOA 1J3HA 1GZ8A 2HCKA 2P3GX 4H1MA 2OXXA 3LPBA 4R3PA 1A48A 4XP3A 5E8TA 3T9IA 1WBNA 5JFXA 5IQIA 2YDIA 3OP5A 3SDJA 5M57A 5CALA 3FMJA 4U5JA 3TKHA 3NVKI 3OCTA 4S34A 1GIIA 4AA5A 1Q99A 3V5PA 5LWMA 1JOWB 5CF4A 1IASA 1Y6AA 4B9DA 1G8AA 2FSOX 4DFYA 2GTMA 5JFWA 2RL5A 3QYZA 4FV1A 4P90A 2OFVA 3F7WA 3Q4UA 3DT1A 5HO8A 2ITQA 4ASDA 5GJDA 2QO9A 3BV2A 3JXWA 5HNGA 3M1SA 3R04A 4I93A 2QCSA 4U3ZA 3DQWA 3PA5A 2VWUA 5HO6A 4DEHA 3NNVA 3Q4ZA 3DTWA 4FICA 3CY2A 2XIYA 4HYIA 2JBPA 4J7BA 2CKPA 1ZOEA 4G17A 3FI2A 4EH7A 4OW8A 4TYJA 4F6UA 5HVKA 2X9FA 3KK9A 2BTSA 2QOFA 3KU2A 5DE2A 4UXQA 4PUZA 2I7QA 2RSVA 2WTCA 2FSLX 3MI9A 2GNHA 1OPJA 3CGOA 3DV3A 2E2BA 3FMMA 4V0GA 2JIVA 3VS5A 3QRIA 4AN9A 2ZB0A 3HMPA 2XP2A 4DGGA 4RWJA 5J7HA 3DBFA 4U40A 3HRCA 3VHEA 4FSYA 3OBJA 4BF2A 4CGAA 4A9TA 3OY1A 2Q0NA 4JAJA 2RFEA 5KX8A 1YKRA 4MKCA 1H27A 2UZOA 4DFUA 2RG6A 1IG1A 3QXPA 2JAMA 3Q5IA 4G1WA 4BGGA 3QZGA 4DG0E 3RK5A 2R3FA 3NAXA 3ACKA 2C3IB 3W2OA 3LJ2A 5HIDA 5JMSA 2W06A 2PVMA 4LRKA 3EQHA 4BWPA 4RWKA 5KKRB 3LKMA 2XNGA 4IWDA 1IEPA 4G3CA 3VQHA 4C36A 2XYUA 4QOXA 4J97A 3MJ2A 4M15A 4TPTA 5K4JA 4RZWA 5CU2A 5CZHA 3GFEA 3ORKA 3DOGA 3R83A 3EQDA 2GSFA 3ZFYA 2BUJA 4TN6A 4GK4A 3LFDA 3V8TA 4DH7A 2REIA 4JQEA 4EORA 1G3NA 3RKBA 3MS9A 5L6PA 3F2NA 5DG5A 2VWWA 3R8UA 4KA3A 3MFSA 3DAJA 3R1YA 3IOPA 4K1BA 3WE4A 3JYAA 2GNFA 4AZFA 2OXYA 3OT3A 1UNHA 4MXCA 3I6WA 3OXTA 4ANMA 4CKJA 5D41A 5EI8A 3V6RA 3BHHA 3PZHA 3T8OA 3OXZA 3O23A 4FTCA 3TEIA 4YNOA 4DHFA 5ETFA 2H96A 3DKGA 4OTIA 3DBDA 4EL9A 3FXXA 1XH6A 3D2IA 3AC8A 3OOGA 4QMVA 2W9ZB 3DB6A 4Q5HA 4U0IA 2YM5A 3EZRA 4EBWA 2QOOA 4U44A 4O7ZA 4OGRA 2ETMA 1MRYA 3FBVA 3MB7A 2GFCA 3PVGA 5EM7A 2X7FA 3LXLA 3QD2B 3QALE 3ORNA 5E8UA 3PWDA 1WBVA 2CCHA 4W4XA 4AA4A 5I9WA 4RWIA 1RW8A 1XO2B 2WOUA 3GCSA 3C4XA 3G2FA 5AV4A 3F5GA
chains in the Genus database with same CATH superfamily
2R2PA 3O71A 3EFJA 5E1EA 5EW8A 4CNHA 2VTOA 3DLZA 3MH2A 3KRRA 3I5NA 3Q4TA 2NO3A 2HZ4A 4X3FB 4X2KA 5JFVA 4DCEA 4F0FA 4MH7A 4JRNA 5IQHA 2UW5A 2XJ1A 2OI4X 2HYYA 3GC7A 3ZU7A 4E6CA 3U6JA 4IBMA 4OT6A 4W9WA 4X2GA 4QMYA 2CGWA 1ATPE 2J0IA 3HV6A 4DT8A 1V0OA 2XK3A 4WG3A 2WXVA 4CV9A 2BFXA 4JR7A 2HOGA 4F9WA 1XMMA 2PMNX 1NA7A 4L3JA 4EJNA 4PRJA 4UALA 5AA9A 5JSMA 4RJ8A 4CVAA 5AUTA 4BWXA 5ETCA 3QYWA 4ZMFA 3BE9A 3H4JA 3LVPA 3NYOA 3ODZX 2JC6A 4PL4A 2BROA 3UMWA 3UO4A 2QVSE 3FKNA 4AOTA 2QD9A 4F08A 4I22A 4ITJA 4NEUA 4XG7A 5AR3A 5FDPA 4DG2E 4XV9A 1P5EA 2W0JA 3R00A 1M2RA 3I0QA 3SRVA 2PMOX 4PY1A 3R7VA 5CQWA 5DVRA 5CXZA 2WQNA 2QOKA 2WELA 1Y6BA 3HECA 3MJ1A 5HKMA 2PVNA 2C1BA 1BI8A 4DHJA 1CTPE 4KBCA 4QMXA 3BL7A 5H8BA 3UQGA 4JBVA 3RALA 3DCVA 4BTKA 3AG9A 3QCXA 1QPEA 4RX5A 2YDJA 5J5SA 1GIHA 4FUXA 3MV5A 2YCFA 5EM5A 3EZVA 3QBNA 1OBGA 3PIXA 4PTCA 3R01A 4OTFA 4YJQA 3FHIA 4IB3A 3PSCA 2E9VA 4C4EA 4QMPA 2EU9A 1UA2A 2HW6A 3LMGA 1Y91A 3CPBA 1PXNA 3QKLA 5BUJA 3AT2A 5IUHA 3C4ZA 3OCSA 4WG4A 4CKIA 3G6HA 3KULA 3QTXA 1IR3A 1OI9A 3ITZA 1KE8A 3ZOSA 4DDGA 2BKZA 4DC2A 4FGRA 4BDEA 1B6CB 3R9DA 3R28A 3ZO1A 4E5BA 4E4MA 4FEVA 2EVAA 1J1CA 3DS6A 3QQKA 5D1JA 3CC6A 4FL3A 3DBQA 3AGLA 2V0DA 3K5UA 4MD9E 5IH5A 2DWBA 4PMTA 3SVVA 3HLLA 4IHPA 3KXXA 4IZAA 3DPKA 4NM7A 4NW5A 4ZTSA 2PUPA 4BJJA 2XNBA 4TY1A 5CEMA 5AAEA 5M4CA 5AFVA 3WZKA 4FV5A 2R7IA 4LV8A 3DBEA 4YO6A 2BAKA 2WIPA 2X8DA 3K3IA 3R0TA 4W4VA 1UVRA 3FQHA 1OIQA 3R8PA 1QPDA 3R8LA 4D4RA 5BVDA 5CX9A 4Z7HA 4O7VA 3D15A 2C0IA 5LMKC 4IX6A 4CFXA 3ELJA 4HVDA 4G3FA 4DGNA 2A0CX 1QL6A 4EQMA 2WD1A 5LJJA 3ATTA 4IM3A 4NIFA 3RCJA 4LM5A 2CLXA 4AOIA 3I81A 4B8LA 4AQKA 1ZY4A 3LAUA 3P86A 2XKCA 1M7NA 1YHSA 2VN9A 4N0SA 1XJDA 4IWOA 4NJ3A 4NUSA 3R8MA 4I20A 5CF6A 2B9HA 5DBXA 4O7NA 2XNEA 1APME 4LL0A 2VWVA 2OZOA 4ASXA 3LCOA 4FG7A 5EM8A 1RE8A 3WIKA 2WTDA 1O6LA 3PSDA 4E93A 5EHLA 3NS9A 4QP9A 2EUFB 4XG2A 5GJFA 4KIQA 4FT7A 5K9IA 3VW8A 4DBXA 4RLLA 1H0VA 3N51A 4IDTA 4RQKA 4AA0A 4MQ2A 3GXLA 3IDBA 4EH4A 4TKSA 5I5ZA 4CG8A 2VWZA 4UX9A 3TUDA 3TV6A 2WMUA 5ANDA 5LCJA 4FZFB 1JWHA 3WZUA 4B0GA 5J5TA 4FNYA 4W4YA 4IM2A 4YJUA 3PJ3A 5EKOA 1FGIA 5EKNA 2Z60A 2XH5A 3CJFA 2ONLC 3Q60A 4EK8A 2OLCA 4G6LA 5JGAA 4HGSA 4BCOA 3HNGA 5GIOE 2XJ0A 3Q2JA 2YN8A 4GS6A 5AIKA 3HMOA 3RPVA 3OTVA 4C7TA 5AR8A 1FQ1B 4D9UA 4EK4A 5E8XA 4L00A 1YRPA 1DS5A 3AOXA 4I5HA 3NRMA 3G6GA 4JBQA 4NZWB 4PPBA 1T46A 3QX4A 4PWNA 4XRJA 2OJJA 3QX2A 3WF6A 3MH3A 4BTJA 3ID6C 2WQBA 1RQQA 1BI7A 2LGCA 4IVAA 3NPCA 4XJ0A 2G1TA 3L8PA 4FODA 1H24A 4Q2AA 1MRUA 1NVRA 2ERZE 5AM7A 4ALWA 4E6DA 4ZSAA 3LM0A 4BDKA 5F1ZA 4FL1A 5AR5A 4U80A 4DEDA 3LQ8A 5IQAA 4D0XA 2ACXA 4DINA 5IDNA 5IQFA 1VR2A 1SZMA 3D5UA 4FKJA 4AT5A 3N4TA 1KOAA 2QOIA 3TNIA 1OM1A 5GINE 4MXZA 2X2KA 5KBRA 4QMWA 5DEWA 5FBNC 4QD6A 2W1ZA 1H26A 1CKJA 4AWIA 4A9UA 2WOTA 4GUEA 3R2YA 4YP8A 3G15A 1R78A 4YHFA 1V1KA 1TVOA 3QA0A 4D2PA 5FXSA 2A1AB 3QZIA 2CGXA 2BDWA 3AMBA 4EK6A 3F6XA 2HENA 2V5QA 2J90A 3E3BX 3KN6A 4WRSA 2DS1A 1Q5KA 2F7ZE 1GNGA 3Q52A 4XHKB 5D12A 3NMUF 5EHYA 3BKBA 1SNUA 4X0MA 4AS0A 3VF8A 4KBAA 2XUUA 3P7BA 2CNQA 3Q6UA 3D5XA 1PMNA 3AC4A 2R3NA 3F3ZA 4CQEA 3ENMA 3AD5A 1URWA 4AXAA 2CKQA 4Y72A 3UDBA 2OIDA 2GFSA 2UVYA 4BR3A 3QQLA 5ANGA 5CNOA 4BBMA 2VTTA 2J5EA 2F2CB 5H2UA 4QYFA 3LQ3A 1B39A 2WIHA 3FXZA 2YZAA 2BIKB 2OF4A 3FE3A 2GNIA 4KIPA 1CKIA 4OUCA 4BGQA 2RFNA 2JD5A 3VULA 5LVMA 5AUZA 2CNVA 1BKXA 4EBVA 3P08A 4FNXA 2CGUA 3VVHA 3QTRA 2O0UA 3T3VA 4H3PA 1JBPE 3CLYA 4P4CA 4FKGA 4FUYA 4TL0A 5M51A 3HAVA 3C5UA 5HU9A 2GQSA 4DITA 4JG6A 4RFMA 3KXMA 2RG5A 4BRXA 3WZJA 4FV2A 4M69A 4KINA 4FT3A 3L9LA 4YTIA 4IEBA 4K6ZA 3KA0A 3UMXA 1XR1A 3OW3A 2I1MA 2F7EE 1ZLTA 2ITZA 3ALOA 3U8WA 3R9RA 1K2PA 5M4IA 4RJ4A 4AOJA 4PDYA 2ITPA 4FV0A 4ZEGA 2VGOA 3AD6A 3DJ5A 1VYZA 2X6DA 3EOCA 4O0TA 4O4CA 2O2UA 4LV5A 2IO6A 5F94A 5AR7A 4ZLOA 3COMA 3ZO2A 2WNTA 4GYGA 4YZ9A 3TM0A 2PSQA 3V8SA 2HZIA 5L6OA 3CQWA 3VBYA 4GRBA 4M97A 4B7TA 1H1PA 3CEKA 3QQUA 2CLQA 4CFVA 3PXKA 4E6QA 2EB2A 2R0UA 1PMEA 3KULB 4I6FA 4L3PA 4O0RA 4E5AX 4FV4A 3PVBA 4IAYA 4H05A 3R30A 3FWQA 3EN4A 4LG4A 3MFTA 4X2JA 5DIAA 3EFWA 4DGOA 3MESA 1EH4A 5BVWA 3MW1A 2J50A 3D7ZA 3QC9A 1FINA 3ZTXA 3BLAA 3AT3A 4DT9A 3F3UA 3FZRA 2G2HA 4O2ZA 1WBPA 3PJ2A 2WKMA 4MNFA 5H8EA 5F4NA 5BVNA 5IA4A 4BJJB 2IJMA 4GK2A 1XQZA 3FPMA 5L8LA 4A4OA 4CRLA 3EN7A 4IVCA 4M13A 4PMSA 4PL5A 3B8RA 4O0YA 2IZRA 5BUEA 3NUAA 3PJ1A 2OIBA 3QD4A 3MFUA 2PMLX 3EHAA 4ZTNA 5HG5A 4E4XA 5IUGA 3BLRA 2VGPA 4PQNA 4BI1A 3O7LD 4WA9A 3ZO4A 4M14A 3ZRLA 3BLHA 4FZAB 2UVXA 1YHWA 2YLEA 2BFYA 2Y4PA 4MHAA 4HCTA 4NIFB 2B4SB 3O5AA 4AW5A 1V0BA 1WZYA 2RFSA 3V04A 2YCQA 2Z02A 4XG3A 4B4LA 4ZTRA 4C8BA 4FT5A 4E8AA 4YJPA 3QTIA 5HLPA 3ZXZA 3TUBA 4JAIA 4BI2A 1G8SA 5IQBA 4D1ZA 1AQ1A 3FMEA 1X8BA 4GJ3A 3W2QA 5JGDA 4AFEA 1ZYCA 4F9AA 1SVHA 3B8QA 3LQ5A 3BGQA 1Q8UA 2GS7A 4P7EA 4I41A 4JQ8A 4U43A 3RNIA 3F5XA 2F4JA 2IN6A 2XK6A 4TT7A 3VHKA 2RIOA 3SOAA 3LCTA 1I09A 3AQVA 1HCLA 4MYGA 4QO9A 3FKLA 4PNKA 3HA8A 2I0VA 5HVJA 3PY1A 3AC1A 1YOLA 2A19B 4M12A 5AR4A 4LGGA 3I60A 3VUTA 5HG9A 3JUHA 4BCNA 3NVMB 3W33A 3PDTA 3WZDA 4FK3A 4PNIA 4UYAA 2ZV9A 5EYCA 4TW9A 3FHRA 4ANLA 1H1SA 4USFA 4UWCA 3DK6A 3SHEA 3S4QA 5JEBA 5KMIA 3F5UA 2IWIA 1IA9A 3R1QA 1Y8YA 4BTFA 3GFWA 4FK6A 2PZRA 4CZTA 5ACBC 2R3OA 3R8VA 4EH3A 3QZHA 2KULA 2HXQA 4F63A 5C4LA 3HP5A 4EJ7A 2ETKA 4GVAA 3ZEWA 3VUHA 3ZSGA 4YLJA 5ETIA 2C69A 4AE9A 1F0QA 1W84A 2GHMA 2ZB1A 1P14A 2V62A 3NW6A 5I9YA 1OZ1A 3Q3BA 3LMHA 1CKPA 5LVPA 4NW6A 4V01A 4GT5A 4PP9A 5HBEA 5CEKA 2E9PA 4C3PA 1HCKA 4MVFA 3L1SA 3C0IA 2A27A 4R77A 1QPCA 3LFFA 3I7CA 4QYHA 4ZY4A 5T68A 3UIBA 5AM6A 3Q9XA 1NVQA 4EOMA 2GCDA 4J52A 4DTAA 4EQCA 3FDNA 4QT1A 5AP2A 3P4KA 4UZDA 3ORMA 4UZHA 4QEBA 4XNEA 3LLAA 1JKLA 4JQ7A 2W4KA 4V05A 4EOSA 4BY9E 2J5FA 2QOBA 4QP8A 3RPYA 2VO0A 3O0GA 4WD5A 3GC0A 3TZMA 5HD4A 5IG1A 3VWAA 4ANBA 4GH2A 3BYUA 2JGZA 3QCQA 3JR1A 3MFRA 5A3XA 3HZTA 4ZTLA 4R7BA 4D55A 3DB8A 1QCFA 5M53A 4E6AA 2IVTA 5DMZA 3R1NA 1KE9A 2QR7A 3HV5A 3R9HA 4IB5A 1XH7A 5I0BA 5CASA 3EL8A 3KVWA 3OBGA 2XIKA 1Q3WA 3R7GA 1DAWA 3NR9A 3SD0A 4C37A 1YDSE 4GEOA 3R1SA 4XYFA 4F7NA 5I9ZA 5BUIA 2PZIA 2XK4A 5CWZA 2UW0A 1LR4A 1ZZLA 3QFVA 3RPRA 3ZUVA 5IUIA 4B6LA 2R64A 3KEXA 3V01A 3I6UA 3ZBXA 5JH6A 2JDOA 3ZO3A 3QRUA 3TT0A 4NJDA 4BYIA 3CKXA 4WHZA 2C47A 3HRFA 4X3FA 2SRCA 1FBNA 1H8FA 1ZWSA 2BZJA 5EG3A 4F4PA 2X2LA 3RAIA 4BB4A 2BHHA 5CEQA 4F64A 3MDYA 1JSUA 3BE2A 3CBLA 3EL7A 4FOCA 2NP8A 5EYKA 5AUWA 3EH9A 4RIOA 2IPXA 5LXMA 2F9GA 1SVGA 4RJ5A 3BEGA 4ANSA 2XVDA 3OW4A 4ENYA 3MVJA 4M69B 5AP0A 5AAFA 4JG8A 4QMOA 3VBTA 4QDVA 2HZNA 2YISA 1RDQE 4O91A 2OWBA 4FTAA 4PPAA 5LCKA 3UGCA 2PY3A 4U42A 3DFAA 2BTRA 3LCDA 3DLSA 4ZTHA 1Q61A 2P55A 5I3OA 2OZAA 2X39A 5HEZA 3AC3A 3WBLA 4LOOA 5BYZA 3AKKA 2W1GA 5E8ZA 4ERWA 4RX8A 1LUFA 2WB8A 4C35A 3UG1A 4QYGA 2CKOA 3CJGA 3ZDUA 3LHJA 2B52A 2FO0A 1SYKA 4HCUA 5E8SA 3O51A 2X0QA 2ZM4A 4GVJA 4A9YA 4F9BA 1JAMA 4F9CA 4QP7A 3SV0A 5C8MA 4I0SA 3KRWA 3FPQA 2PVLA 4C4JA 1W2CA 3O50A 4O0XA 4OBPA 2R3MA 4HNIA 2V55A 3PLSA 1ZRZA 2I0HA 4FKSA 4IC8A 3ZS5A 1E9HA 3EWHA 4C58A 2ONLA 4CFWA 2CN5A 4FF8A 5I9XA 3FQEA 4FL2A 3UPZA 3VC4A 4LFIA 3A99A 4QNYA 4RJ3A 4DFLA 4K9YA 4XV3A 2YCSA 3FV8A 3HRBA 2F49A 3C4FA 3CIKA 3N9XA 3ZRMA 4YTCA 5IQEA 2OJFE 4BCQA 2WMAA 4FA2A 4IW0A 3AC5A 4N4SA 3OXIA 3U9CA 2Y6OA 3QTZA 1U54B 3ZLWA 3EB0A 3QTWA 2YIXA 4IXPA 4JRVA 2R3LA 4CFMA 1ZYDA 2QKWB 4O1PA 4A9RA 2C5NA 4R6VA 4LRMA 3V5QA 5FUTA 4HZRA 3PXRA 4ZZNA 2C6EA 2W96B 1MQBA 5EYMA 2V7AA 2W1IA 5CTPA 4C2WA 4UN0C 5CAQA 3UC4A 3MVLA 3R02A 3UOJA 4KS8A 1STCE 2GU8A 2CSNA 3FEGA 2WMSA 3QCYA 4A9SA 4C4HA 3A7HA 3EQPA 3UIMA 4KRDA 3UQFA 4NFNA 2YZLA 4XP0A 3QC4A 2JLDA 2UVZA 5BMMA 1R3CA 3NUUA 4CYIA 1AD5A 3Q04A 2PTKA 4YTFA 2B54A 3QKKA 3PE1A 5CU3A 2OXDA 3PG1A 4RFZA 4RZVA 5AP6A 3UYTA 4AAAA 4D2TA 5LMBA 4GK3A 2B55A 2W5AA 3R73A 5HIEA 4W8EA 3BYMA 4BDFA 4YR8A 1XMLA 4FIJA 3CS9A 1H28A 4IAZA 3D5VA 4X7QA 4IJPA 2PUUA 1P2AA 4NM5A 4O4EA 4CLJA 4DA5A 1Q24A 5FTOA 4QMUA 1U5RA 4M3QA 3G9NA 3S2PA 2BRBA 3MVMA 3VS7A 3QHWA 3E8CA 5IH6A 3O7LB 3WF8A 3IDPA 4HYUA 3GI3A 4EOKA 2XNOA 5HCYA 2WEIA 1H07A 1PYEA 4AZSA 2HW7A 4DAWA 5AP7A 3QXOA 4CT2A 2AUHA 3MA6A 4ACMA 1H0WA 4MBLA 3EQIA 4U97A 4AUAA 5GZAA 5CEIA 3TIYA 3W55A 2BZHB 5I4NA 2QHNA 3W8QA 4EONA 3SW7A 2GPHA 3LLTA 2EXMA 4BCFA 3O8PA 2VWBA 3A7IA 4EHVA 4LOQA 4M66A 1YOJA 3M42A 4JNWA 3FMHA 3LZBA 2PZPA 3KY2A 3ORPA 3UP7A 1NW1A 4D2SA 2RKUA 3SOCA 2CKEA 2W99B 3PXYA 3MTLA 4EEVA 2C3LA 3QQFA 3PY0A 2OU7A 1WBTA 5J9ZA 3FXWA 3KC3A 1W8CA 4J98A 3OTUA 2YWVA 3HUBA 2BDJA 3W0RA 1XBAA 2EB3A 4H36A 1M2QA 5AV1A 5E8WA 1LPUA 3TNPC 3DAEA 5ANIA 4O84A 1FVTA 4RMZA 3W0MA 4MWHA 4O6EA 2VTIA 5DA3A 4XUFA 4IB1A 4O1OA 2ZDUA 4LI5A 3PUFC 3PPKA 4FKRA 2W05A 1LP4A 2PZYA 4PPCA 3FKOA 4DGMA 4C38A 3ACJA 4ACCA 4BWKA 4JDKA 4NCTC 5HO7A 2YIYA 3U87A 3DKCA 4A06A 4EZ5A 3S00A 5HTIA 2W1HA 1DM2A 4QYYA 1K3AA 3OT8A 5E90A 4EHEA 4AGWA 1NT2A 2J2IB 2CMWA 2WTIA 4M67A 4NM3A 4C2VA 2P0CA 3C0HA 4PP7A 3E5AA 4ANQA 3MBLA 4FMQA 4YC3A 3OROA 5M4UA 4BIBA 3L8VA 3LXPA 4OTWA 3UG2A 4FKUA 4GU9A 2J0KA 1JKTA 4QTEA 1W83A 5KZ0A 4DH1A 5DNRA 1WVXA 3HDNA 4FSQA 5EYDA 3DXNA 2J9MA 3UOHA 5HG7A 2HAKA 5AAGA 4NT4A 4F78A 4R3RA 4QMLA 3QTQA 1WMKA 4DTBA 2R0IA 3JPVA 5AP3A 5CAOA 4NM0A 1DI8A 3IQ7A 2PHKA 2GQGA 4A4XA 5CVFA 4HPUE 4CQGA 4F70A 2WTWA 2ITNA 3F3VA 4KABA 4XH6A 4YHTA 4DYMA 3GB2A 5KE0A 2QG7A 4WNPA 3ZFXA 3BELA 4BYJA 2Y0AA 4IC7A 3GU7A 2OZAB 4FTTA 2KTYA 1YW2A 3KN5A 4OTHA 2XANA 3RK9A 1UU8A 4MNEA 5DN3A 4AZTA 2XM9A 1RJBA 2W4JA 3OOMA 4EHZA 2G2IA 4IZ7A 3ZLXA 1O6YA 2QLQA 3RK7A 5H3QA 5IEXA 3EQFA 3HV3A 5HVYA 1U59A 3A7FA 5EHOA 5D9HA 4ITHA 2CDZA 3GU4A 4HGTA 3RPOA 5B2MA 2WTVA 3IK3A 3PTGA 4B8MA 1XBBA 3G5DA 4S31A 4ZTMA 5TKDA 3ZSHA 3EYGA 5FWKK 3K2LA 5A4QA 4FX3A 3CXWA 3GCVA 3A8XA 3HMMA 3Q6WA 4TWPA 2PVRA 1OBDA 3R7UA 1QPJA 3QZFA 5AV3A 1XH8A 3TMOA 3PXQA 4R78A 2CPKE 3PIZA 4FVQA 3BHUA 3QRJA 4CT1A 2GNJA 2YJSA 4RVLA 1W2FA 3E92A 4RC4A 4J95A 5KKRC 4RWLA 4ASEA 3NYVA 4DEEA 4PF4A 3LXKA 5C01A 2YM6A 4RC2A 4GIHA 3KVXA 4AACA 2IEWA 5J9LA 3BU5A 5AWMA 3PFYA 2VNYA 4CCBA 1J7IA 2CGVA 4F7SA 2XAMA 3E88A 1Y8GA 1S9IA 2AYPA 4JI9A 4PDPA 4XG6A 2E9NA 4J53A 3N4UA 3TDWA 1FOTA 4CRSA 5AP5A 4IVDA 3OWKA 4ZJJA 3C50A 3EQRA 3MY5A 3WF9A 4E73A 5LARA 2GDOA 2RFDA 4ZLYA 4TNBA 4AZEA 4PTGA 5GZ8A 1YXSA 3KMMA 3LM5A 3D4QA 4D4SA 4PMMA 3TACA 1J7LA 3K5VA 4EHGA 4EZ3A 1R39A 4M84A 3TL8A 3FYJX 3GCPA 4HZSA 2UUEA 4N70A 4O96A 4RIXB 1H00A 3OCBA 3TZ9A 3ORXA 4FTUA 3C4WA 3GVUA 4MBJA 1CM8A 2CJMA 4DEBA 2JKKA 2YM8A 4R7IA 4APCA 3QUEA 3WYXA 4ITIA 3ZUTA 4L3LA 3LMIA 5A6NA 3I79A 3CPCA 4IJ9A 4JBPA 3PE2A 4JL9A 2XAOA 3CQEA 4EC8A 4Q9SA 4ZS0A 1BYGA 1UWHA 2QNJA 3DAKA 2R3KA 5AV0A 5DR2A 5IA2A 3ZM9A 2YEXA 4CXAA 2JKQA 2BIYA 5C8NA 2PZ5A 5JRSA 5HX8A 4W9XA 4JX3A 5K5NA 2PU8A 4BCJA 4WG5A 3R7OA 3TIZA 2BHEA 3QUDA 1AGWA 2QOQA 2UZWE 3REPA 3U54A 3VS6A 3Q2MA 5HTCA 4G6NA 3VBXA 3COIA 2WZJA 3NUNA 4AXEA 3NIZA 4YNEA 3KL8A 4FSNA 1JLUE 4CFUA 5ITAA 5E8VA 2YERA 3OEZA 5H8GA 4ARKA 4BDHA 2YM3A 4IX3A 4NSTA 4E1ZA 2X7OA 2OJIA 1OITA 1TQIA 1Z9XA 2X2MA 3WF5A 4ZSLA 2PYWA 2C6MA 3KCKA 3VRZA 2G01A 3VS0A 4XCUA 3ULIA 3CE3A 4WBBB 3ORLA 4WIHA 5CNNA 4EH5A 3DY7A 3LFEA 1FGKA 2QODA 4AW0A 4F7JA 1ZYSA 3WIGA 3ZONA 3NZ0A 3OUKA 5IA5A 4AQCA 1BL7A 5HESA 2O65A 4U6RA 2IVSA 4EOOA 3OUNB 3UIXA 3VF9A 3U9NA 3MGYA 3IS5A 4XBRA 5JZNA 3ZM4A 1YI6A 4K2RA 4U41A 3P78A 1OL2A 2I0YA 3A62A 4LOPA 4BDCA 3UNJA 1OIYA 3DQXA 1CMKE 2QQ7A 2ZMDA 3NUPA 1JQHA 2P2HA 1OL1A 4TXCA 3NSZA 5CXHA 1S9JA 5HE0A 4EOIA 4HYHA 2AC5A 3Q32A 2XALA 3U6IA 2Z2WA 3WI6A 4RFYA 4R7HA 4YZDA 1H4LA 3KXNA 3T9TA 3VS1A 3FL5A 3ZC6A 4AGCA 1TQPA 5JZJA 1G8JA 3GCUA 3KRXA 1VJYA 2YJRA 1PXIA 1IAHA 4F7LA 4YJSA 4MUQA 4IAAA 4G6OA 2YCRA 4EH9A 3UZPA 5IQGA 2Z7LA 3KKVA 4CEGA 4ZLZA 4IZYA 4TTHB 4MEDA 3KMUA 4QMQA 4BC6A 3P5KA 3FMLA 4G3GA 1BMKA 3BHVA 3KGAA 3BYVA 4NWMA 5FP6A 3NNUA 4D5HA 3RMFA 2G9XA 4EQUA 1MRVA 2OK1A 2VO7A 3RZBA 4AN2A 5CAUA 2BALA 3DTCA 5DI1A 2OO8X 3WARA 4ZZOA 4TZRA 1A9UA 5ANOA 3UNZA 2BRGA 4CCUA 3TJCA 1CSNA 3GC9A 5A14A 4I5PA 3UDZA 4R3CA 4O0VA 4OTGA 4DH3A 1KE7A 4MXAA 1XKKA 2XKDA 2YAAA 1REKA 1UV5A 2FSMX 4JBOA 2BRNA 3EYHA 1WBOA 4H58A 4JVGA 3SC1A 2UZUE 3WYYA 5KHWA 5E9EA 3O17A 4UY9A 5CY3A 3W0QA 3BLQA 3ZDIA 2HXLA 5IA0A 4TNDA 2JIIA 5BMSA 2J0JA 2WU6A 4TWOA 2ZVAA 3FC1X 3TWJA 4UYNA 2OIQA 1G5SA 4C4FA 5DR6A 1I44A 5HCXA 4IB0A 4BL1A 1UU9A 3JVSA 2W1CA 2WO6A 4NYEA 2OBJA 3DJ6A 3MA3A 4O22A 4DGLC 2BCJA 2CCIA 4H3BA 1ST0A 2VO6A 4FSRA 5AUXA 5TE0A 4D2VA 5IEYA 4K77A 4MNEB 1Q8ZA 1H08A 5EI2A 4JMQA 3DU8A 2VTNA 3E8EA 4FSTA 3EQGA 4EC9A 4I3ZA 5D11A 2PUIA 4HCVA 5M56A 1NXKA 5HGIA 3H3CA 2YDKA 1Q97A 1OMWA 5L4QA 1BUHA 1VLRA 4RPVA 1H25A 4JXFA 3DFCB 4W4WA 4FGBA 4I6BA 4MD8E 4X2FA 5LVLA 4LUDA 2UZTA 2Y4IB 3KMWA 2FVDA 2C6KA 3LFQA 4RA5A 4I6LA 4LQMA 2J51A 4BCKA 5ETAA 1FMKA 4I0TA 2Z8CA 5DRBA 4RSSA 4I94A 4C3RA 1PKDA 2CHLA 2B1PA 4LGHA 5HHWA 4B99A 4OBOA 3MB6A 2YWPA 4JDJA 2IF8A 4YO4A 3QRTA 3D9VA 3VJNA 5AA8A 3R63A 2IVUA 5IA1A 4KBKA 3C0GA 3VUKA 2ETRA 4E5WA 4AP7A 1SNXA 3O2MA 3NWWA 3PP0A 4L67A 4D4YA 2XZSA 3VUIA 4DE4A 3NGAA 4XS2A 3RP9A 4Y5QA 5FQDC 1Q8YA 3PJ8A 1ZARA 2IW8A 3RM6A 5BYLA 3ZLSA 2UZNA 2ZM3A 5BVFA 4QQTA 5CT7A 2NRUA 4OTDA 5E7RA 2YABA 4YZCA 2QKRA 3RZFA 2UZVA 1O9UA 4QMNA 4G5JA 5AJQA 5A4TA 4L6QA 2JFLA 4R8QA 1WAKA 4XMOA 3QWJA 4GT4A 1U54A 4YJNA 4I92A 4FV8A 4CZUA 2YM7A 4Y95A 1U5QA 5J87A 4U9AA 4KAOA 2ZM1A 5DOSA 4BTMA 4QTBA 2OICA 4FVPA 2ZFYA 3ZMMA 3DKOA 4FZ7A 4BICA 3GQIA 3G51A 1UNGA 4LGDA 5HCZA 1ND4A 1MQ4A 1UU3A 3COKA 3F3TA 3GP0A 3KK8A 4CTBA 4FOBA 3TJDA 5K0KA 4X6QC 3RWQA 3PLAE 3DNDA 2PVJA 4YJTA 3DBCA 4FKLA 2XF0A 4DEIA 1BLXA 3FYKX 2BRHA 3AMYA 2X4ZA 1SM2A 3DZOA 4FSWA 3QUPA 2X0PA 4K33A 4TRLA 4FTQA 3ENHA 2O63A 4O7TA 3VS3A 4I5CA 3TUCA 4ZZMA 1CDKA 2XIXA 1PMVA 4UBAA 1PMUA 5LMAA 3UVRA 3BEAA 4USEA 3GU5A 4DH5A 1XH5A 3FLWA 3SW4A 3HDMA 4J99A 4DCAA 2FH9A 4X21A 2BKKA 3UC3A 4C0TA 4FT0A 2JBOA 1WFCA 2VU3A 4MF1A 4YTHA 3RAHA