4IX4A

Crystal structure of a stt7 homolog from micromonas algae in complex with adp
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
346
structure length
346
Chain Sequence
LKARGGPKTLRRTPGVEPKDIRVLPGPLGSGNFGTVFRGVFKGDQDVVLKNAKADVMAAEELLECEMDVNYHVHANAKGTCARFMGCIELGAKDGGEIYNGTLTEGLWLMWANEGENTVEALMRRGTAPLATAMACADATELGVTKKAMRELLGSLARLHECGVVHRDVKPANLIAAEKDGGVLKLIDLGAAALCLPLPETLNYYPGDGPADPRYAKADELYLLPPGSPRPTKDNAAKLWEAHKPDRFDSWSAGCVMLQLAVVGLRTDAGLERFLADYKAVGYDVNAFRGEKSGEYGTMDFAALDANGGAGWDLCQRLMEAERDARASCEAALSHAFFDAAALEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic domain of a state transition kinase homolog from Micromonas algae
pubmed doi rcsb
source organism Micromonas
molecule tags Transferase
molecule keywords MsStt7d protein
total genus 105
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ix4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ix4A01
5KMNA 3UIMA 3EQRA 3T8OA 4M69B 5F1ZA 4G9CA 4BCMA 3BE9A 3NW6A 3F2AA 1UNHA 5BVDA 4K11A 5HO6A 4O0YA 3SRVB 1TKIA 2R3LA 4FT0A 4N4SA 4W4VA 5HO7A 2Z02A 1PMVA 4O81A 3GENA 3CY2A 5FM3A 2B52A 4QMNA 3F3WA 1WBPA 4PDPA 2GU8A 3O7LB 4WKQA 5EW3A 4YMJA 5FM2A 4Q9SA 3OEZA 3NNVA 2QU6A 3OD6X 3ZFMA 4PL4A 5AV0A 3KRJA 4G6NA 4UV0A 2HW6A 5D9HA 2GS2A 2W4KA 3NCZA 3LCSA 1ZYSA 5LVOA 4QPMA 5EFQA 4ANLA 1YI6A 2B4SB 4RVMA 4YJPA 2PSQA 4I0SA 2YDJA 2XRUA 3KMUA 4LRMA 3TKHA 3TKUA 1BX6A 5L8KA 3FKNA 4FZDB 3P79A 5E8VA 3TZ9A 3N4UA 2J90A 2QCSA 3WZDA 1LEZA 3O7LD 4TNDA 1TVOA 4AX8A 4RVLA 2OF2A 4EYMA 3NUSA 3QD0A 1SYKA 3BYVA 3JVSA 3LCKA 3IDBA 3BU6A 3VO3A 5CAVA 3FQEA 5M4CA 1HCLA 3Q9YA 1H0WA 1J7IA 4LMUA 5I9YA 4WSQA 2W5HA 5EI6A 2XIZA 1XBCA 2JLDA 3MFRA 3S0OA 5D41A 4O82A 1U59A 5FWKK 4C4HA 3Q3BA 4IQ6A 4M68A 4XV9A 4XNEA 5HG5A 1PXKA 3MVMA 4OBQA 5CEKA 2VWWA 4DN5A 2ZYBA 4K18A 4O38A 3DK6A 3Q4UA 3UVQA 3KK8A 4ALUA 2IVTA 4EOOA 3ZH8A 4YU2A 2ITXA 3R71A 4NIFB 4CMTA 1M17A 5KUPA 3ZUUA 3HMOA 2G15A 2UZTA 3LQ8A 3MSSA 4QQJA 4QNAA 5EM5A 4OBPA 2VTLA 3RCJA 4NM7A 3ZSIA 5IZFA 2HWOA 4L46A 3CTHA 4BI0A 2JFLA 5M4FA 3UZRA 4BTMA 1XQZA 1W8CA 3O17A 4BDFA 1UKHA 4P90A 5TF9A 4LOQA 2YM7A 5HHWA 5GIOE 3L1SA 2YAAA 3FZOA 2WTIA 3DNEA 4PDYA 3NR9A 3NUPA 4FTQA 3GC7A 2R3JA 1ZRZA 3EN4A 4L52A 4E6CA 2OJGA 3CGOA 3LM0A 3SOCA 2JD5A 4R5YA 2JBPA 2XEYA 5LCKA 4H3QA 4FG7A 4BCHA 2Y0AA 5KMJA 4EKKA 3D4QA 3C13A 3IECA 4YJRA 2REIA 4CXAA 3REPA 2YISA 3HUBA 3KB7A 2B1PA 2BALA 3DBDA 4QMOA 1URWA 4D9TA 5IF1A 3TJCA 5IQCA 5ETIA 3PA3A 4EH9A 2C0OA 2PULA 2FH9A 4NZWB 4DG0E 3A62A 4JG7A 3TZMA 2R3QA 4FL2A 3HKOA 2WTKB 4FSUA 3OVVA 4N0SA 4ZS0A 3WF7A 3JY9A 3LW0A 4RC4A 4XMOA 4AOJA 4BI1A 2ZVAA 5E9EA 2XYUA 4FKOA 4OT5A 4NJ3A 4AXAA 3HECA 2VWXA 1OIUA 5GHVA 4HPUE 2CGUA 3SLSA 3EHAA 4RA4A 3IW8A 1BMKA 2CDZA 2YABA 4I6BA 2RG6A 1PY5A 4FV5A 4XG9A 1R3CA 1JSTA 4FKIA 2BUJA 1UVRA 2HENA 3HA6A 4HGLA 4NH1A 2BAQA 4R8QA 5FXQA 4BHNA 4NCTC 3E8EA 4IB5A 4G6OA 4OAVB 5LVLA 3GT8A 4MVFA 3TG1A 4BCOA 4O0WA 3OOGA 1YXUA 4OTWA 3ZUTA 3FMLA 3FZTA 3PXZA 5AUUA 3ENHA 5A54A 4XRJA 2GNGA 3QU0A 4I3ZA 4JDHA 3L8XA 3DKGA 4AA5A 3E7OA 3MI9A 4BIBA 3FLNC 4AZVA 3MTFA 2HXLA 2VTSA 2X1NA 5E7RA 4ZEGA 4UMRA 3G6HA 4R77A 5IUHA 1ZLTA 1VYWA 3CJGA 5D12A 1ZWSA 2A1AB 4KIOA 5EKOA 4CLIA 2PVNA 4AW5A 4A06A 3IOPA 3R8MA 1P4FA 4G5PA 2W1IA 1IRKA 3E8DA 2I6LA 4ALWA 2WIHA 4IDVA 4PDOA 4RWLA 2ITQA 3NYOA 3FKOA 4OTGA 2IPXA 2QONA 3QAME 4IVAA 3U4WA 3E93A 4HPTE 1BKXA 2X8EA 4IVCA 3UJGA 4DCEA 5BVFA 4EORA 4HNIA 2BROA 1GZOA 2W7XA 3NIEA 2C30A 3Q04A 4K6ZA 4UB7A 3W2RA 4PP7A 4E6DA 4BKYA 4HVDA 3C5IA 2XNMA 4RZWA 1PKGA 2YM8A 3LFCA 4M84A 3VUKA 5KKRC 4GKIA 3C4XA 4CFVA 4ENXA 5HE2A 4EH3A 4BGQA 3I81A 3MB7A 1UA2A 5E92A 1IR3A 4FK6A 1REKA 5FEDA 1PMEA 5B7VA 3QTSA 5M51A 4IADA 1H4LA 3IKAA 3OCGA 4QTBA 2JITA 2XBAA 3DBFA 3BZ3A 4R1YA 4RRVA 5BPYA 2VGPA 3DA6A 5D7VA 3Q4ZA 4L3LA 4YTIA 3TNQB 1URCA 3BX5A 3PP1A 4V0GA 4Y83A 5ANOA 2GHMA 3E62A 2YWVA 3DTCA 4QMYA 4WBOA 3C0IA 4XJ0A 3TNHA 2X4ZA 2WMXA 4U5JA 3MA6A 5CVFA 5LJJA 3QHRA 3S4QA 1GIHA 4JBPA 4QT1A 4R7HA 4YJUA 4DGOA 2CNVA 2OI4X 5KMKA 4DTBA 4UALA 3W2PA 1L8TA 5JN2A 3H3CA 3RMFA 4UY9A 4IW0A 2FSMX 3ZZEA 1QPDA 4BDIA 1U5RA 1WBNA 4CQEA 4FSMA 4GU9A 5JFWA 2UW8A 4BTJA 4WBBB 2RGPA 4RC2A 4DFBA 2JBOA 3TIZA 4U45A 2XB7A 1W84A 2XEZA 4O1PA 4X6RA 3EQCA 1O6LA 1JVPP 1H01A 3D5XA 3LCTA 4WNMA 5L8LA 5FTQA 4TNBA 2VNYA 1MP8A 2JDTA 4QMLA 4UMPA 4DEDA 4XX9A 2ETMA 3UC4A 4AT4A 4UX9A 4NFNA 4UWBA 3WILA 5K4IA 1REJA 1SVEA 1SM2A 4APCA 5BMMA 2GNJA 2HY0A 3GCSA 3PY3A 3HV3A 2AC3A 4FNZA 3MY0A 4FKWA 5AIRA 4BCGA 4DLJA 2A27A 4II5A 4J99A 4KB8A 3GFEA 4D4VA 3OMVA 4BYIA 4IZ7A 2J9MA 4RPVA 4JDIA 3KF4A 3VBTA 4BRXA 4EHGA 2WU6A 5J95A 5L6OA 1QPJA 3BHVA 2XRWA 4JAJA 4Z3VA 2JDRA 3MPTA 2XIYA 4RJ3A 4O6LA 4FV7A 4EL9A 1OIQA 3DLSA 3EKNA 4NWMA 2H6DA 2EVAA 3VRYA 4DLIA 4EKLA 5KMMA 3G15A 2XS0A 4EEVA 3KU2A 4IB1A 4GW8A 4QP8A 1H27A 2IJMA 2VX3A 4R5SA 4BN1A 3NVKI 2R3HA 4CZYB 3PRFA 4FIGA 2IW9A 3PYYA 1JBPE 2CHLA 3U87A 1PYEA 2J5FA 4FIEA 1U54A 5KBRA 3HRCA 1OKZA 5H9BA 5H3QA 3LCOA 5IQHA 4FKUA 4DEEA 1OPJA 1P2AA 4DGNA 4GUEA 2WAJA 2Z60A 4O6EA 4UZHA 3NYVA 4YNEA 3C7QA 3TEIA 4RFZA 5AAEA 3V5JA 5CEPA 2QOFA 3NIZA 4O1OA 2PVMA 1OUKA 3NNXA 5AR4A 3VHKA 2QHMA 4QTDA 4LOPA 4W4XA 3SVVA 3DFCB 2IVUA 3DLZA 3KRLA 3ZRMA 5CEIA 2BZKB 5HORA 5IMEA 3U54A 2XM9A 3WE4A 4DEHA 3KMMA 2QOQA 2WQBA 3ZO3A 5FDXA 1R1WA 1ZMUA 4TYIA 4YJOA 4OBOA 4HCVA 3OXIA 3VULA 3HP2A 3R1YA 1OB3A 5CALA 4BTFA 4MEDA 1CTPE 1WBTA 4X2GA 3FQHA 3AG9A 5EOBA 3MN3A 4HZRA 2ONLC 3NMUF 2VX1A 3QZIA 3OWKA 3SD0A 2J2IB 5BX0A 5JQ5A 3ID6C 4FNXA 4PP9A 5DE2A 4EOKA 4IFCA 2VWVA 4ENYA 2VX0A 5K0KA 4FE2A 4XUFA 3LCDA 2OF4A 3O2MA 3FMNA 4LV5A 4BZNA 3QC4A 4HZSA 4JG8A 2W4OA 1H1SA 5AR8A 4J8MA 1VZOA 2OXXA 3MTLA 3EYHA 3R9DA 4ASEA 3FDNA 4RWKA 3FZ1A 4DTKA 5C8KA 4DFZE 2UW5A 3ALNA 3RPYA 2C68A 4CG8A 2FSLX 3I0OA 1BL6A 2WMBA 1WVXA 4YZBA 3SG8A 2QI8A 4NM3A 4WG3A 1E1VA 4XBUA 4MWIA 3B8QA 2FSTX 2O5KA 2PE1A 2W1EA 1OKVA 3D14A 4M13A 4BVUA 4GK4A 3TV7A 3W2SA 3B2WA 5HLWA 1OL2A 2X6EA 3D7ZA 5TE0A 5AR3A 3S3IA 3UNJA 4AQCA 4QYGA 4EK4A 1G8SA 3BV2A 1R78A 5CZIA 2VWUA 4MF1A 5IEXA 5A9UA 3PY0A 3TUCA 5HIDA 4ORKA 4ZY6A 3ZZWA 1B39A 3PVWA 3D2KA 3WYXA 5FDPA 5HNIX 2UW0A 3C51A 2BMCA 2UW9A 5L8JA 3TNIA 4EWHA 4IB0A 4D0WA 4PNKA 3LXPA 4DITA 3EZRA 3FZRA 5GJGA 5H8BA 2BDWA 4DGGA 4M66A 4FZ7A 1YOMA 4CNHA 5IDPA 4XCUA 3I4BA 3V5LA 4D2RA 4F70A 4QO9A 2VWIA 5DG5A 4L53A 3DBEA 1OMWA 4A4LA 4EQMA 3VS6A 4F9WA 4DCAA 3GUBA 2IZRA 3QL8A 4R3PA 4YP8A 3VW8A 4TWNA 3I60A 3NUNA 1WCCA 3OTVA 4F7JA 2JDSA 3BHHA 2HY81 4AZSA 3FHRA 3RTPA 4CEGA 4MTAA 3Q4CA 2PUPA 4QMTA 5KZIA 3VJNA 1OM1A 2ZV9A 4DYMA 4EHZA 3VBVA 5HLNA 2W5BA 4JX3A 2W99B 5CNOA 3KCKA 4D9UA 2PL0A 4LGGA 4L6QA 3ULZA 5HKMA 1DI9A 1UU7A 3QRUA 2HZ4A 3CPBA 4TWOA 4E6AA 3GFWA 5LMKC 2P2HA 3LMGA 3MY1A 4G17A 4MNFA 4ZLZA 4NFMA 4TRLA 5HEZA 3ZYAA 3KN5A 4U7ZA 5BMSA 5FXRA 3QWJA 5CSHA 3EQIA 1O6YA 2KTYA 3LHJA 3WF8A 2E9NA 4XHKB 4B4LA 4EZ7A 3ZEPA 4C3RA 1E1XA 2HCKA 2XIKA 3O8TA 3SW7A 4NW5A 2ITOA 3W16A 2H8HA 2OLCA 2PVHA 4IEBA 3BQRA 1OIRA 3GC9A 2WIPA 2VO0A 2ZM3A 4XP2A 3Q2MA 2I0VA 4TY1A 3AC3A 4J71A 4EUTA 4EK8A 4MD9E 5JFVA 2C6OA 2WMQA 4QYEA 4FL1A 3LE6A 4CCUA 3DJ6A 4DFLA 5C4KA 4QPSA 2VU3A 1Z9XA 1FVTA 4HCUA 5CWZA 4JI9A 3IGOA 3D83A 3CGFA 5CU6A 3EQHA 4AE9A 3AGMA 4NKSA 4IX5A 4D2WA 4HOKA 4RQKA 3FSKA 2DQ7X 2R3KA 2UZUE 3PXFA 4NU1A 5FBNC 1FGKA 1YHWA 3O50A 3Q32A 4MCVA 4RIYA 2OG8A 3K3JA 2R9SA 3UPZA 3OCSA 3ZU7A 1BI7A 3ORNA 5CSXA 2V22A 2QOLA 5HVKA 2C5XA 4CFXA 4PUZA 3QQFA 4KIQA 5DWRA 3G51A 2AC5A 4Y8DA 1YI3A 5BNJA 4IZYA 4BYJA 2WTJA 5A4QA 2OIBA 4RIXB 4XG8A 1JSVA 3OY3A 4USEA 5C8NA 2O3PA 4FEVA 4M12A 3GEQA 2XNOA 4FTKA 5BUJA 4ZTLA 2OWBA 1XJDA 4ZJVA 5KBQA 4BR3A 2VUWA 1YW2A 4OLIA 4EOSA 4HVIA 2OFUA 3NDMA 1LP4A 5GIPE 2XZSA 3AMBA 1XH9A 4GU6A 3CTJA 4JDKA 3VIDA 3HDNA 2BRNA 3VUMA 5HGIA 1GAGA 1KV2A 3WZUA 4AWIA 4GEOA 5JGBA 3PE1A 2CKQA 4G3DA 4IM2A 3QRIA 4L42A 4EHEA 4D2VA 3LFSA 3HLLA 4JJRA 5CQUA 3RP9A 4IVBA 5HX8A 3KL8A 1UKIA 3NNUA 4WIHA 1JQHA 3OUNB 1NVSA 1ZARA 4MBJA 4UZDA 3AQVA 2YM5A 2QG7A 2WQNA 3HVCA 4EOLA 2R4BA 3SDJA 4CTBA 3TV4A 4FSQA 4ZMFA 3A8XA 3QYWA 2BAJA 4G3GA 1SVGA 1WBWA 4FVRA 2XNNA 3K2LA 5FXSA 4X21A 4E4NA 1IA9A 2YA9A 4IWQA 4QOXA 4FZAB 4GH2A 2XJ0A 5EI2A 3SW4A 3V5QA 4FC0A 3R8ZA 3O0GA 3OW4A 4JBQA 1DI8A 4JRVA 4O0VA 5EHYA 2XNBA 5AUVA 1O9UA 3AMYA 3QGWA 3RKBA 4E5AX 3EWHA 3ZLWA 5HTCA 1YDTE 4IJ9A 4ACDA 2VWBA 3HEGA 4ASDA 3FSFA 3Q4TA 2WB8A 4QP9A 4ZJIA 3DTWA 4DA5A 5HI2A 3OT8A 4F63A 4O0XA 4CKRA 2ITYA 2OO8X 2GS6A 4LOOA 1OL1A 4RIOA 5CAUA 3GXLA 5AJQA 5KO1A 2OJFE 5FD2A 3PIZA 4LMNA 2F7XE 2PZRA 1GZNA 3F3VA 5FTGA 3UP7A 2BZIB 2EXEA 2UW6A 4TYGA 4V01A 4RJ4A 5ANGA 5AP2A 3PJ2A 3A4PA 3TJDA 3TT0A 4LL0A 4R1VA 4AS0A 3VNTA 4BWPA 5CY3A 5LCJA 4XP0A 5JZJA 3QKLA 4TPTA 1Y91A 5BYZA 3PZEA 4LGDA 2WD1A 4YJQA 5AP0A 3ZO4A 3UVRA 5IUGA 4YC3A 2XYNA 2QOKA 4D4SA 2FO0A 3FMEA 1WZYA 3BEGA 2IN6A 3QTXA 3R30A 4JBVA 1OL5A 5CU3A 5EI8A 3GVUA 5HD7A 4WD5A 4YR8A 5AEPA 3P23A 1ZYJA 3F2RA 4IC8A 5J79A 3R21A 3KCFA 3CC6A 4DH1A 1J3HA 4FICA 3L8PA 1M2QA 4I5CA 4D58A 5A46A 5BVOA 1OBGA 4FV8A 3ORLA 1IA8A 1IASA 3I6UA 3PUPA 5D11A 4M8TA 3FLQA 3I0QA 4IAZA 2JFMA 3FAAA 3UZTA 4BFMA 4B9DA 2BHHA 3V51A 3RINA 3JS2A 3U6IA 1G8AA 3MH3A 3ZS5A 3DNDA 2E9VA 4RIWB 3ZM9A 1PXPA 5B2KA 3RGFA 4TKSA 2XIXA 1P5EA 3DJ5A 4C8BA 4CV8A 3F7WA 1PJKA 2P55A 3LQ5A 3OZ6A 3TV6A 5I9ZA 5JGAA 2BHEA 2X81A 3ODYX 3D2IA 3QTRA 4KBCA 1GZKA 3PE2A 3GU6A 2VO3A 4S31A 1K9AA 2BIYA 4I6HA 2YDKA 3LOKA 5LVNA 3TDWA 3Q60A 4D4RA 4USDA 3HV7A 5CANA 3Q6WA 4I5HA 4Q5EA 2WTDA 3BHTA 3CBLA 3HRFA 2B55A 3OWJA 4RG0A 4S32A 1GZ8A 4R3CA 4UBAA 5HQ0A 3GNIB 5TOZA 1Q62A 4FYOA 4PMMA 5DHJA 5AR5A 3QTQA 4RBLA 3ZRLA 3CEKA 4F9CA 4LUDA 5IEVA 5L2TA 2V5QA 4NJDA 4RJ5A 5A4LA 4ZOGA 3EYGA 4L7SA 2VTMA 5D1JA 2HW7A 3UOJA 4BZDA 2UZNA 3F88A 5DIAA 3QQGA 5L4QA 1E9HA 3RWPA 3QF9A 2QOBA 4PWNA 3CD3A 1GJOA 2OJIA 3R9NA 1OBDA 5B2LA 5E8SA 4FEXA 4YC8A 3PSCA 3D94A 4ZSEA 3OT3A 2WMRA 3RI1A 2C6LA 4EI4A 3Q96A 1J1BA 3LM5A 4O21A 4KBAA 2HOGA 3RWQA 2ITPA 3ZOSA 2WHBA 3Q2JA 3RBWA 3RAKA 2C1AA 4RFMA 2UZBA 4TN6A 3WF9A 4DFUA 4FSRA 3DCVA 3BELA 1YHSA 2BFYA 3KK9A 3P7AA 2GFSA 4GVJA 4EJNA 2IZTA 3O96A 4G2FA 5J5TA 2B9IA 4YC6A 2C4GA 3HZTA 3LFAA 5HG7A 1GOLA 3OF0A 2HELA 3I79A 4G6LA 3LJ1A 4I4FA 5DN3A 5AX9A 3UIXA 2X7OA 5BUEA 4D55A 5J5SA 4DH3A 3GB2A 3P1AA 3H9OA 5JRSA 4DT8A 3QLFA 4PX6A 4C36A 1H8FA 1BUHA 5J87A 2X8IA 3MA3A 1WBSA 4GJ3A 3M1SA 4FZFB 3FXWA 5KX8A 1FMOE 4MXYA 4FKRA 3QQLA 3EH9A 4HYHA 1VEBA 2XUUA 2HZNA 3WZJA 2LGCA 4MH7A 2VV9A 4ZTMA 4WT6A 2W05A 2YITA 3EN9A 4BCKA 2BAKA 1YRPA 2OK1A 2W96B 2W1DA 4GL9A 5J1WA 1Q3DA 4YZCA 1Y57A 2HK5A 3R1QA 1FQ1B 4U0IA 4NYEA 1A9UA 4XRLA 5I9WA 4AGWA 3EB0A 5C9CA 5GZAA 2UUEA 4RQVA 4FSZA 2C5OA 4EHVA 3A2CA 4D4YA 2QOHA 4RX7A 3EL8A 3JUHA 3TN8A 4ZXTA 4AT3A 3OFMA 3PVUA 3GCQA 2ERKA 2H96A 4X3FB 1OPKA 4A4OA 4BI2A 4IXPA 4IAFA 2R3RA 2XNPA 3C9WA 3COHA 2YIYA 3BYSA 3D5VA 3DOGA 3MJ1A 3OXTA 1SVHA 2R7IA 3HP5A 4M69A 1VYZA 5KZ0A 3COMA 2JKKA 2CCIA 4IZAA 3UQFA 4O2PA 5H8GA 3W33A 4AW2A 4E7WA 3OS3A 4P4CA 1K3AA 2F7ZE 5EYKA 3UPXA 4EQUA 4BY9E 4QQTA 4LV8A 4BGGA 4GFMA 3HMMA 5CT7A 1KV1A 4C4FA 3PVGA 3OUKA 3EMGA 3FY0A 5AIKA 4BIEA 3TIYA 2PVFA 4XV2A 5B2MA 3DQXA 3ZHPC 1OITA 4Y46A 5IA1A 3C4CA 4HGTA 4QMMA 4ANBA 5J7HA 4MD7E 1V0BA 4E93A 1M7NA 4AW1A 1XO2B 4YHJA 2XM8A 4C3PA 2R3OA 2C1BA 4FV1A 4I5PA 3A7FA 4GK3A 2DWBA 4HYSA 2PUNA 1NXKA 3QGYA 2C3JA 4L67A 5BQ0A 3EQBA 3FMDA 3PA5A 1WMKA 5CQWA 4C61A 3KQ7A 4F6WA 5AV2A 5EOLA 5JRQA 4L44A 3FKLA 3FMJA 5A3XA 4XOYA 5CSPA 5IQGA 3R1NA 2F4JA 5GINE 5CYIA 1ZXEA 3R63A 5IH5A 5IA4A 5EYMA 4R7IA 2CGVA 2F7EE 1FVRA 1VJYA 5C03A 1ERKA 5IQDA 5KHXA 4FTCA 3ORIA 1NW1A 3E88A 4IAKA 2ETKA 2EWAA 2JGZA 3AD6A 4ITJA 3RM6A 5T6KA 4FBXA 3RZFA 1KOAA 5K9IA 4CTCA 2QLUA 3IW6A 3MGYA 3QX4A 4JR7A 4BDJA 2WTWA 3U6JA 4K33A 3TCPA 3VRZA 4XEYA 5C01A 5M53A 1TQPA 4GIHA 4DH7A 4DFXE 4F64A 2XF0A 5HLPA 4UXQA 3TXOA 2RFSA 2C6TA 3QTWA 4MNEA 4EK3A 5M4UA 4QNYA 4IX3A 4N70A 3BKBA 4X2JA 3EIDA 5DA3A 1RDQE 1WBOA 2EB2A 4UMTA 1OL7A 4XG6A 3W2OA 2PMOX 5IEYA 4X3JA 5K5XA 4EZ3A 4HNFA 2DS1A 2WEIA 2QO2A 4MHAA 3UBDA 1OL6A 3V5PA 4GFGA 3UTOA 3MFTA 4AUAA 5E8ZA 2BPMA 4E26A 3PLSA 1ZOGA 3A7JA 4O7LA 5AUZA 3FPQA 1B38A 2UZWE 4HGSA 3QTZA 4OTQA 1KE9A 4S2ZA 4A07A 4R78A 1PMUA 2Y4IC 1JAMA 4H05A 3QBNA 5JSMA 5LMKA 5BVWA 2XCKA 2PZ5A 5EHLA 5EYCA 4X2NA 3MJ2A 3QCQA 4AT5A 5HU9A 3ZSGA 1SNXA 2ZV2A 3PY1A 3KXZA 3WF5A 4BDDA 3P4KA 4C4GA 3ATTA 5M06A 4FV9A 3HL7A 3NAXA 1GIJA 4MYGA 2B7AA 3KREA 4X3FC 1FVVA 3BU5A 5IQAA 4RGJA 4UN0C 4J98A 4KA3A 5K5NA 3LLAA 1QPEA 2W4JA 2ZB1A 3ANRA 4KABA 3U4UA 2CKPA 3OCTA 3CLYA 2UZOA 2W9ZB 3QUPA 3DXPA 1W82A 4G5JA 3NPCA 2VRXA 4AOIA 5JFSA 2R3NA 1OI9A 2AUHA 2CCHA 4BDHA 4JIAA 4PV0A 3MESA 5E1SA 5LWNA 4I92A 3KXNA 4NSTA 2YIWA 5HE1A 4QP4A 3U6HA 3WIGA 4CQGA 3FZSA 4WNKA 3BIZA 2QOOA 2W1ZA 5AX3A 1A06A 3MH2A 3N51A 3U9CA 3FMMA 5ITAA 1Q8UA 3VUIA 4FV0A 2VTAA 4I41A 3A7HA 4Y72A 4H36A 4BTKA 4JOAA 1MUOA 2PZIA 3CQWA 3P9JA 4LM5A 5HNGA 5DYJA 5AAFA 5K3YA 4UYNA 4EOQA 4KS7A 2VD5A 4ACGA 4KUJA 3CKXA 4A4XA 1G3NA 3NCGA 3EQFA 3FYJX 3MVHA 2NNWB 3LFBA 2AYPA 3WIKA 3QCXA 4C57A 4CD0A 3KXGA 4IAYA 2PMIA 4ID7A 2VZ6A 4H39A 5IG1A 3DKFA 2CPKE 4KIKB 5A4TA 4CRLA 3H10A 4RFYA 5A4CA 4NM0A 2OGVA 4IX6A 5AA8A 3F9NA 1H25A 2A19B 2OICA 1CKPA 4YPDA 4HYIA 4RX9A 4D1ZA 5LVPA 3VUHA 4YTFA 2WQOA 1Q61A 2BTSA 2GNLA 3V01A 5I9UA 2UZVA 3GQIA 2WMWA 1Q99A 4FTAA 4RSSA 4BKZA 4DEIA 4EUUA 1PF8A 3RAIA 1XH7A 2QLQA 4F0GA 4AF3A 2J0MB 2JC6A 3R01A 4ZTRA 2B9JA 3TUBA 5EW8A 2UZDA 3G0FA 4O7YA 4ALVA 5KMLA 3C50A 2A0CX 4L00A 3D9VA 2PMLX 2P33A 1NVRA 3E64A 1KOBA 4YSMA 5AP4A 1S9JA 4E20A 2FVDA 2CN8A 4XG3A 4QYYA 2OFVA 5TKDA 4AACA 4E6QA 1YWRA 2RFDA 2W1CA 4ZZNA 4EH5A 3VVHA 1CKJA 4FZ6A 2IZSA 4L9IA 3TZ8A 3VN9A 2DYLA 3PSBA 4CLJA 1FBNA 5DBXA 4WNPA 3D7TB 3KULA 3LZBA 4B6LA 2XKDA 1XHAA 4FG9A 5JQ8A 3UO5A 1NVQA 2VTHA 4RZVA 2R64A 3HV6A 4V04A 5L2QA 4L3PA 4AFEA 3LFDA 4RJ7A 3KF7A 1ND4A 1XH6A 3SQQA 3ATSA 2GQSA 4G31A 4B7TA 3EFKA 1DAYA 2UVXA 3NZ0A 2WPAA 5FTOA 4FOCA 3MVJA 5IA5A 2F2CB 3M2WA 3LFNA 3R28A 4OAUC 3R9RA 4Y85A 5C27A 2WOTA 4BDCA 3GOPA 4J53A 5E1EA 2W17A 4FTLA 4GG5A 5AM6A 2YLEA 3FWQA 3NSZA 5HBEA 4TYHB 2YWPA 4JX7A 2JKOA 3GOKA 4FG8A 4V0GB 4R6VA 3C0HA 3R8VA 4EONA 4PRJA 1JSUA 4PQNA 5DNRA 5IQIA 4O7SA 4EH6A 4GT4A 4LUEA 3UYTA 4ANOA 4FUXA 2X8DA 3FUPA 4J1RA 2Q83A 2G2IA 3A8WA 4FGRA 4IHPA 4IAIA 4PY1A 3PFQA 1H1PA 4C37A 4U40A 3UG1A 3CQUA 4IE9A 4NCTA 2E9UA 3V8WA 1Q8TA 1JKTA 4CFNA 3G33A 4JQEA 5DT0A 1NT2A 4MWHA 1OKYA 1VR2A 3UIUA 4C59A 4BCIA 4XS2A 4G16A 3CP9A 3AGLA 3ZBFA 4QD6A 3F3UA 4U81A 4I6FA 5BUIA 1MQ4A 3PIYA 4D1XA 3I6WA 3UOHA 1ZAOA 4AGUA 3DT1A 4M14A 4E4LA 3BPRA 4IANA 5J8IA 3QRKA 1JKLA 3NYNA 2VNWA 4ACCA 4E5WA 3ZO1A 2PVYA 3KMWA 4PTCA 1Q41A 2ESMA 4AOTA 3IK3A 4TWPA 3VUGA 3S2PA 5CF8A 4L01A 3MFSA 3OG7A 5LOHA 4C62A 2VTRA 5GNKA 4AZTA 2Y7JA 3H4JA 4W4YA 4M67A 3ZUVA 5A6NA 3AMAA 4WRGA 2F9GA 3FHIA 3RAHA 4O7NA 4R7BA 4QPAA 3WE8A 4I21A 4N57A 2PYWA 5DPVA 3CR0A 4BDGA 4KINA 5JGDA 4IFGA 4UWYA 2R2PA 2YDIA 3MPMA 3EQDA 4YHTA 4DG3E 3QQKA 4DBXA 3KFAA 1DAWA 3CY3A 3BLHA 5HCZA 2QR8A 3QHWA 4KSQA 4DF3A 4FV6A 2CKOA 3FL5A 2IO6A 4I5MA 2P3GX 5L3AA 3QA8A 4ANNA 4HJOA 4BDEA 4O0UA 3RPVA 3LAUA 5KMOA 2ZM1A 2Z7RA 4MD8E 1ZOHA 3P5KA 3RK5A 4A7CA 4X7QA 2YCSA 2O0UA 4XLVA 2O64A 5LXMA 2YCQA 2Z2WA 5HCYA 4E5BA 5EM8A 3LMHA 4YZNA 5EM6A 4FF8A 4TT7A 3UO4A 2GDOA 2C6EA 2FSOX 3PPJA 4N6YA 5IH4A 3IONA 4WG4A 3H0ZA 3VF8A 3VBXA 3E8CA 1OZ1A 1OGUA 4CYIA 5BVEA 4NK9A 2FYSA 3EN6A 3R7GA 4FKPA 2WMTA 3F61A 3HV4A 1WBVA 2RIOA 2J6MA 4MBIA 5C1QB 3ZLSA 4RX5A 3KVXA 3NAYA 2YERA 3BLRA 3P7CA 1IG1A 4YLJA 3EFLA 3IW4A 5CZHA 4U80A 3SC1A 2XKCA 2OU7A 2Y4IB 3POZA 4XV3A 5L6PA 4P5QA 5BVNA 4GT5A 3ZLXA 1H1QA 2ITUA 1IAJA 1V1KA 2OH0E 2VTPA 3DU8A 5HVYA 1KE8A 2R0UA 3O8PA 5EG3A 3POOA 3RALA 1YDRE 4K1BA 5DR6A 4APPA 5I4NA 4DT9A 4U42A 3VBYA 5M57A 3BYOA 2WKMA 2PVLA 2I40A 3R04A 4MF0A 3QKMA 4RWJA 2Z7LA 3FBVA 4IAAA 1M2PA 4FIHA 3FXZA 1H08A 5IPJA 1LPUA 3VS4A 4BGHA 5I3RA 1WAKA 1ATPE 4EOJA 2QOIA 1PRYA 3OROA 2R3MA 4ZSGA 4F1OA 3L8SA 4ZS4A 3BWJA 2BRBA 5E4HA 2IW8A 4FIJA 5EM7A 2VTNA 4F6UA 1F3MC 2YFXA 3C5UA 2RG5A 2VWYA 3NS9A 4FT3A 4M3QA 4ZJJA 4NT4A 2OH4A 5DH3A 4YUQA 1OKWA 5IUIA 4C33A 2R5TA 4C35A 4CRSA 4OTPA 4FK3A 3S95A 3RNIA 4YBKA 3DFAA 3CQEA 4X0MA 2O65A 3SV0A 3A4OX 3QD2B 5CF5A 3W18A 4FL3A 5G6VA 5ICPA 3BBTB 4HVHA 4BWKA 5FP6A 3F6XA 3R6XA 4FEQA 5J9ZA 3L9PA 1UNLA 3BI6A 4RC3A 5J7BA 3IW7A 3ERKA 3EQGA 3MVLA 2JDOA 4RX8A 2PU8A 2ACXA 3KY2A 3DAKA 4BDAA 3TZ7A 2V7OA 5I9VA 5J1VA 4IMYA 4MXCA 4YLLA 1Y6AA 2HIWA 4BBFA 2X9FA 3ORTA 4WUNA 5ETAA 5JMSA 5E91A 5ANIA 3MV5A 4QTCA 4E8AA 3PXKA 4L7FA 5M08A 2X2LA 3MBLA 4FT7A 4YO6A 1WVYA 2JAVA 3IPHA 1AQ1A 1LUFA 3QCSA 1W98A 3MYGA 4BDBA 4EBWA 3OEFX 4BF2A 4EJ7A 3MW1A 4ZMEA 2X2KA 2J5EA 3KXMA 3AT3A 2XK6A 2VO7A 1Y6BA 4GK2A 3SA0A 2KULA 4WUAA 3MB6A 4TYEA 2ZB0A 5AV3A 4U43A 3C0GA 4KSPA 4D2TA 2VTQA 3SKCA 3DBQA 3TTIA 5IDNA 3SRVA 3HDMA 1RW8A 5IMXA 3DY7A 5JH6A 2NRYA 1JOWB 3QRTA 2H34A 4U41A 3ZFXA 4YBJA 1TQIA 3SAYA 2QHNA 3FI3A 3IW5A 2GFCA 3BYMA 4I22A 3ZXZA 3VS0A 1PYXA 4G9RA 5HBHA 3C4FA 3WI6A 3M11A 3A99A 4NEUA 3NW7A 1ZMWA 4HCTA 4IJPA 4ANQA 3OHTA 4Y5HA 1I44A 1P4OA 2C47A 3ORKA 5AP3A 4F4PA 1Q4LA 4BZOA 4F0IA 3EKKA 2QO9A 3CIKA 2WMAA 3FI4A 3NW5A 1Q24A 3NWWA 4H1JA 3ZTXA 3CSVA 3ZMMA 1KUTA 1QPCA 1TQMA 1CMKE 2BIKB 3RK9A 4M0ZA 4KNBA 4ZTSA 4Z7GA 3KRXA 1J7UA 2VTOA 4DGMA 3FEGA 4O7VA 3DZQA 4PTEA 3TI1A 5JEBA 4IX4A 3PG1A 3C4WA 3LJ2A 5CI7A 5DEYA 3C1XA 3NNWA 3RZBA 3FV8A 1QL6A 3B2TA 3TNWA 2YJSA 3DDPA 4GSBA 5K4JA 3D5WA 3MH0A 4I94A 4Y5QA 3KXXA 5CXHA 4WA9A 5CAQA 3RJCA 4ZLOA 2JAMA 2OIQA 3IG7A 3V8SA 3ZM4A 3OP5A 5HZNA 2W9FB 3UZPA 2R0IA 5AP7A 2WTVA 2B54A 5C4LA 1U46A 2W1GA 3BRBA 4QMPA 3CTQA 5DRBA 1I09A 3P86A 2G01A 3ORPA 2EB3A 2JEDA 4O0TA 2WGJA 4X3FA 3OTUA 3EJ1A 1ZMVA 5M55A 3DK7A 4DC2A 2R3GA 4X2FA 3FLSA 2E9PA 3CCNA 3II5A 4PDSA 4H3PA 3GC0A 5A14A 1SMHA 2YM4A 4JVGA 4HGEA 5HNBA 3AT4A 3FL4A 3FPMA 1T46A 2G2HA 3ORMA 3UVPA 1OUYA 4EZ5A 3FLWA 3E63A 3HMIA 2OZAB 4XV1A 1UWHA 2YN8A 1UU8A 2CLXA 2WFYA 3EQPA 1PHKA 4XH6A 4QYHA 2BR1A 2XK3A 3UYSA 4CGAA 5ANJA 1UV5A 4QMXA 4TYJA 1KSWA 5CX9A 3FC2A 2C5NA 2B9HA 3PIXA 3QCYA 4OUCA 4F6SA 2PZPA 1UWJA 3GQLA 4F08A 1PKDA 5LMBA 3QZHA 1JNKA 3HGKA 3DZOA 4EOIA 2XCHA 2PUUA 2B53A 3T9TA 4ZLYA 1SNUA 4C58A 5GZ8A 5L2IA 2RSVA 1XWSA 5D10A 4K2RA 4FSWA 4O22A 4W9WA 3K5UA 1LR4A 2QOCA 2ITTA 5DEWA 5EH0A 4I1ZA 2YJRA 2UVYA 2QODA 4IC7A 2HZIA 4D28A 4I0RA 2JKQA 4QP6A 4V05A 3QC9A 4IM3A 5HIBA 4YJTA 2X39A 3UO6A 3K54A 1PMNA 4CFWA 5CU0A 1BI8A 2ZM4A 3TL8A 5A4EA 3W10A 3LMIA 5CU4A 4HVGA 1R0EA 2PHKA 4EK5A 2GTNA 2QD9A 4G3FA 3FE3A 2CGXA 4AE6A 4D0XA 4L8MA 2B0QA 3EZVA 3G5DA 3IQ7A 4NW6A 3LQ3A 4XLIA 4EQCA 3ELJA 3FLYA 3H9FA 3PPKA 3W55A 5JZNA 4D2SA 5KMIA 4Q9ZA 4F1MA 1BYGA 1Q8WA 2R7BA 5JFXA 2IW6A 2CKEA 2C6IA 3UGCA 2HAKA 3DDQA 4KD1A 3PXRA 3PTGA 5AR2A 4TXCA 3R7UA 1OPLA 3TTJA 3A61A 4FKJA 5BYYA 5DMZA 2XBJA 3UOKA 5F95A 2C69A 1H00A 2WTCA 2YCFA 1L3RE 2JIIA 3QD4A 2FB8A 4DEBA 1H1RA 4E4XA 3OC1A 3UIBA 5CNNA 2PVKA 1Z57A 4JR3A 4F7NA 4ZY5A 3VBQA 5J9LA 3VW6A 4GYIA 4FA2A 3LKMA 1WVWA 3QLGA 5HCXA 4A9RA 2YCRA 4DH8A 3H30A 1J7LA 3RAWA 3D7TA 3KULB 4QRCA 5M56A 2GQRA 2PWLA 4NUSA 5CTPA 3DKOA 2BTRA 2OBJA 5FP5A 1UNGA 1MRVA 2PMNX 3H0YA 1B6CB 5TO8A 4QQ5A 1YKRA 3G0EA 4FOBA 2ZDUA 4JIKA 3ODZX 4LL5A 3BWFA 4BHZA 4ZTHA 4TW9A 4Y73A 2W5AA 2RKUA 3AC2A 2C0TA 3JXWA 3PJCA 2J51A 2J0IA 3RNYA 4PPCA 3OWLA 5I3OA 4AAAA 3QYZA 1OECA 5M44A 4BIDA 4JRNA 3FJQE 1FGIA 4F9BA 2VTJA 5CEOA 4K9YA 3FMKA 5HD4A 5JT2A 2RFEA 1CM8A 1FOTA 2RF9A 2BVAA 2CN5A 2XP2A 4C4JA 5DR9A 1U4DA 4AZFA 4FTJA 1XH4A 5KKRB 3R9OA 4JLCA 4YZ9A 5HESA 3PLAE 3SXSA 3I5NA 5TR6A 3K5VA 4YHFA 3BHYA 3UDBA 3AXWA 4OR5A 1W7HA 3SHEA 1P14A 1DS5A 2XA4A 2ZV7A 4JDJA 4NTSA 3NYXA 4LFIA 4FTRA 4PF4A 5G1XA 4E1ZA 4AG8A 4LI5A 1M52A 2XVDA 4YJVA 3VS5A 4BBMA 1W83A 4QMUA 4KIKA 5IA2A 4GUBA 1YWVA 3ET7A 3NUYA 2Z8CA 2GTMA 3E7VA 3BGQA 3NUUA 4FX3A 4PTGA 4NTTA 5IU2A 2OZOA 2ETRA 2QKRA 4FVQA 4A9YA 3JVRA 1KE6A 4P5ZA 3G90X 3Q6UA 4PMTA 4Q5HA 5LMAA 4UWCA 3VS1A 1MRUA 1BLXA 2ITVA 2OIDA 4XOZA 5EDPA 1PW2A 2IWIA 3BCEA 5ACBC 4AP7A 4YO4A 4FTNA 4MXXA 1XBAA 4BKJA 1DM2A 3G9LX 5J9YA 5KCVA 4FGBA 2XJ1A 4C3FA 1J91A 5E8XA 4CVAA 4FNYA 3GBZA 4GT3A 4AN9A 4QMSA 2GPHA 2PVRA 3LIJA 4LGHA 5IA3A 5JKGA 3QQHA 4XG7A 2W1FA 2NO3A 3N9XA 3OY1A 4L45A 4PNIA 3KGAA 3R7IA 4WRSA 5I0BA 4C2VA 3LXLA 4Y95A 1FMKA 3KEXA 3TDVA 3U55A 3LFQA 5C8MA 3ORXA 1M7QA 4NIFA 3Q9ZA 1ZOEA 2ITZA 4M97A 5HG8A 4OGRA 4MAOA 5FUTA 3DXQA 4J8NA 1PXJA 2C5VA 2PE2A 2PVJA 3ROCA 4WSYA 3PVBA 1XH5A 1NY3A 2WTKC 5FGKA 2SRCA 3R7EA 5IA0A 2WU7A 3HMPA 2YIXA 2HYYA 4X2KA 4MX9A 5AUXA 2QU5A 1MQBA 3GU5A 1YXVA 4JT3A 3ZBXA 3DAJA 3W8LA 2PUIA 4X6QC 5AUTA 4XP3A 3N4TA 2YACA 5GJFA 4GFOA 3ENMA 3VS3A 4CKJA 4EH2A 5CENA 3HNGA 3MIAA 4WHZA 3CD8A 3TWJA 3VC4A 2W0JA 1R39A 3G9NA 1UU9A 2ITWA 4ERKA 4QMQA 2YIQA 3F5GA 4BCNA 3L9MA 2DUVA 3C4EA 2Y4PA 4CYJA 3ITZA 5DOSA 2WQMA 5FQDC 3OCBA 4R3RA 5IQBA 4FSYA 1H07A 1T45A 1G5SA 1YVJA 3BU3A 4LG4A 2J50A 4WOVA 1WFCA 1GY3A 3QA0A 3P08A 1A48A 4DFYA 2IZUA 4O7ZA 1JLUE 4GKHA 2ZMCA 3QRJA 4YNOA 5HG9A 2OJJA 3DB6A 4KKGA 3I5ZA 4M7IA 1F5QA 3EN5A 4GG7A 5EK7A 4FIIA 4ZAUA 4CT1A 4FV3A 2CJMA 3AC5A 3CE3A 4D5KA 1W0XC 3IDCA 3K3IA 4O0RA 4W8EA 3OBGA 3ETAA 2H9VA 3Q9WA 4BCFA 2WXVA 3R8PA 3WBLA 3UMXA 4EOMA 2WQEA 1Y8GA 3A7IA 3KC3A 5DLSA 3H9RA 5EQYA 3F5UA 3R73A 3QXPA 4A9UA 4EH4A 4C2WA 3HX4A 2WELA 2BKKA 2J4ZA 4KWPA 4AZWA 4AZEA 4F1TA 4BCPA 2UW4A 4JBOA 2XK9A 3VS2A 5IQEA 2RL5A 3MS9A 3L8VA 3PJ3A 4LRKA 4OTFA 1ZYDA 3F66A 3Q52A 3BE2A 3UC3A 4OTHA 2Z7SA 3IS5A 3E87A 2GQGA 4D1SA 4EK6A 1X8BA 3TACA 3UQCA 4RLKA 3SG9A 3ZONA 4B0GA 3NUAA 3DKCA 3RHKA 4CT2A 1YI4A 5LVMA 3BGZA 2BRMA 5DGZA 4C4EA 2F49A 2FA2A 3AD4A 4DGLC 2XKFA 4AN2A 4BL1A 4ANSA 2I0HA 2Y6OA 4IWPA 4O0SA 3BV3A 3V3VA 2R3FA 4I24A 5ANKA 4EH7A 2WZJA 4CKIA 2A2AA 2XNEA 4Z7HA 5KHWA 1ZZ2A 4KRCA 1YXXA 5M4IA 4O91A 3KVWA 5AV1A 1HOWA 3CPCA 3QKKA 4FIFA 2C6MA 4FVPA 1IEPA 3QX2A 4EOPA 2EUFB 3P7BA 5FEQA 3B8RA 3BGPA 2EU9A 3HV5A 3UG2A 4YTCA 2G9XA 5CEMA 1APME 3R22A 4ANMA 4U44A 4UMQA 2YAKA 2B9FA 4FTUA 4PL3A 3HRBA 3EFWA 1Q97A 1CSNA 3AD5A 3T9IA 1Q3WA 5CASA 2XKEA 5AWMA 2QVSE 3GU4A 4L68A 5I9XA 4CV9A 1QMZA 2FUMA 3MY5A 3U9NA 3LPBA 4FUYA 4F0FA 4PMPA 4ONAA 1MRYA 2BRHA 2JKMA 2V7AA 4ASZA 3IDPA 4IIRA 3RHXA 3W2QA 3OWPA 4MXZA 4TTHB 3GU8A 5FLFA 1M2RA 4I20A 3I7CA 4RJ8A 4FTMA 4B8LA 1UU3A 4F9AA 4QMVA 2WMVA 3PG3A 3R1SA 4IZ5A 4BB4A 4O2ZA 3PDTA 4G3CA 3UOLA 5DVRA 5HU3A 3BQCA 4PL5A 1KE5A 1YQJA 4GCJA 4YJNA 3Q9XA 4OTIA 3F3TA 2VTTA 4XBRA 2HXQA 4FSTA 5HX6A 5CS6A 3QQJA 4Q2AA 4RT7A 3F3ZA 3V5WA 5B0XA 3HA8A 5CI6A 1H0VA 4BDKA 5EDRA 3VBWA 3CKWA 2C3LA 2JDVA 2QR7A 1RE8A 3L9LA 4HYUA 1YOJA 2BZJA 4F7SA 3R7VA 4EC8A 4UMUA 5H8EA 2WEVA 4FTIA 4LYNA 4ZTNA 4EC9A 5IKWA 2XMYA 3G2FA 5TT7A 5HE3A 3SX9A 5GZ9A 5AP5A 2VTIA 3ACKA 3A7GA 3R8LA 5EQEA 3F5PA 2OXYA 2J7TA 3S00A 4TZRA 3GGFA 3E5AA 3MWUA 4U3YA 4I23A 4QTEA 2ZAZA 4IM0A 1PXIA 3CJFA 3ZCLA 5KE0A 4WG5A 3V04A 3DB8A 2GHLA 3PA4A 3LXNA 3QTUA 5DRDA 2I0EA 3M42A 4I0TA 3LFFA 3R2BA 2O2UA 4CZUA 4DFNA 5A6OA 1Q8YA 2X2MA 3VHEA 1Y8YA 4YGAA 3VS7A 2C3IB 3PSDA 5T68A 1RQQA 3QALE 3BHUA 2BFXA 3F5XA 2NRUA 3WARA 4G3EA 4ZIMA 5AV4A 1CKIA 3MFUA 5CAOA 3MIYA 5CVGA 3ULIA 2CNUA 3NUXA 4Z16A 4D5HA 2V55A 4GYGA 2WMUA 2JIVA 1U54B 3JPVA 3SXRA 2Z7QA 4DE4A 3VF9A 4O7TA 3FLZA 3W2CA 1NA7A 4YJSA 3T3VA 4IVDA 5GJDA 3BLQA 4JXFA 4O7RA 5M09A 4C02A 4ZZMA 5F4NA 3VQUA 4CFMA 5HTIA 4AFJA 3ZDUA 3HUCA 1F0QA 3KKVA 4NL0A 2IVSA 5HE0A 3BEAA 4QP7A 3DV3A 5AUYA 2BZHB 2XIRA 4B99A 4RMZA 4FV2A 5AAGA 2VGOA 4H3BA 4TL0A 4AU8A 4ZK5A 3COKA 4FKGA 4XYFA 2UZLA 3E92A 3QQUA 4CZTA 3LFEA 4S34A 2OJ9A 2Q0NA 3DJ7A 3UP2A 2BDJA 4FR4A 4D2PA 5BYLA 4J97A 4CG9A 5AUWA 4DEAA 3F7ZA 4ASXA 4ZY4A 3WOWA 2XK8A 3ZO2A 1PXNA 3R9HA 2QKWB 2X4FA 3NVMB 5JK3A 2ZV8A 4RJ6A 4C4IA 2P4IA 1FINA 2A4LA 3I7BA 3PPZA 4UYAA 3PRIA 2FGIA 4U3ZA 4ZTQA 1ZYLA 5CVHA 3DXNA 3AOXA 2OW3A 3ZXTA 1RJBA 3GI3A 4MQ2A 4A9SA 4AA4A 4C34A 1PXLA 4W8DA 4E4MA 4GMYA 3F82A 3Q5IA 3ORZA 1OVEA 3EN7A 3SGCA 1ZZLA 5LQFA 1YWNA 3QD3A 2P0CA 1M14A 1XR1A 3W32A 3AT2A 1H26A 1ZY4A 5K0XA 3EOCA 5F94A 3D0EA 3UNZA 5M07A 2R3IA 3U8WA 4IBMA 4ARKA 3F69A 2QNJA 3HYHA 3SOAA 3R0TA 4KKHA 1Q8ZA 1YDSE 1O6KA 4IDTA 1CDKA 2XK4A 1JKKA 2XJ2A 2I7QA 2GNFA 2GSFA 4O84A 1S9IA 4RVKA 1Z5MA 1U5QA 2ITNA 3Q53A 3NGAA 3NX8A 3LLTA 2VAGA 4KBKA 2P2IA 4GS6A 4K8AA 1YXSA 4E73A 2I0YA 3N4VA 2X7GA 2BKZA 3I1AA 1IAHA 2IVVA 3ZEWA 3P78A 5HICA 2F2UA 4FYNA 5T3QA 2W1HA 5IQFA 2C3KA 1AD5A 2QC6A 3FMHA 3KA0A 4TYHA 3FXXA 3GC8A 3L9NA 4PPAA 4WNOA 3HMNA 2GS7A 3CS9A 4CFFA 4DBNA 5ACKA 1H28A 4F99A 4H1MA 4FEWA 2NPQA 3EFJA 3PWYA 4LRJA 4F7LA 3DS6A 4JNWA 2C0IA 3R02A 3U51A 3QUDA 3V5TA 4KKEA 3IO7A 2PPQA 4RWIA 2J0JA 5AM7A 5LARA 2VO6A 3NRMA 2ERZE 2EXMA 3KRRA 3UNKA 2YM3A 2O8YA 2V0DA 4IWDA 4YURA 4GRBA 5HBJA 5AP6A 2UVZA 3V8TA 1JWHA 2XH5A 2LAVA 4DAWA 5L2SA 3FI2A 3AC4A 4ITHA 1XBBA 4P7EA 4U97A 4CMOA 5F9EA 3R83A 3MPAA 5ETFA 2CMWA 4MQ1A 2G1TA 2GHGA 2QQ7A 3O51A 3DAEA 4U6RA 3WZEA 3EL7A 2ZMDA 4I93A 4ACHA 5DR2A 4PPBA 4CMUA 4W9XA 1STCE 2PK9A 4J52A 4O7WA 5AFVA 1XKKA 2W06A 4ZZOA 4YZDA 5E8TA 3QZFA 4IACA 4BCJA 4UXLA 4ZSJA 4XG2A 5FBOA 5L6WL 3QZGA 4NKAA 4IWOA 4RVTA 3GCVA 4H58A 2XNGA 3ALOA 4KRDA 4FODA 4M0YA 4RIWA 4FKQA 3ZC6A 4EWQA 4YSJA 5EQPA 3UQGA 2Y6MA 2WMSA 3ZLYA 4RA5A 2IG7A 3GU7A 2EXCX 3JYAA 4QP2A 5KNJA 4C0TA 4FKLA 3BYUA 3PXQA 4M15A 2OKRA 4ZSAA 4HVSA 4CCBA 4IH8A 4GVAA 3SXFA 4MKCA 5IH6A 3WF6A 2VN9A 4Z9LA 1FPUA 5ANEA 1V0OA 3A60A 3LJ0A 4E3CA 5EW9A 2UW7A 3ZSHA 3ZRKA 2PY3A 4U9AA 2E9OA 2HWPA 1SZMA 4MXOA 4B8MA 5E8WA 5CF6A 4A9TA 2PZYA 5IISA 4G1WA 3OOMA 4HW7A 2C6DA 1XH8A 3WZKA 4J96A 5ANDA 1ZYCA 5CLPA 2ZJWA 5CXZA 3DPKA 4QYFA 2CGWA 3E3BX 4U8ZA 2R3PA 3FYKX 4NM5A 3Q5ZA 5F20A 3RVGA 4EBVA 2QURA 4MBLA 4YPSA 4ACMA 4CFUA 3S1HA 3TKIA 2UZEA 3VWAA 4Z55A 4AN3A 1QCFA 2Q0BA 3AC8A 4QQCA 4JQ7A 2V62A 3R7OA 3V6RA 5AR7A 4LQMA 4G34A 2BDFA 4L3JA 3UE4A 3PJ8A 4IB3A 2PE0A 4UEUA 5CT0A 4BCQA 1GIIA 3WYYA 5HVJA 4YZMA 1BL7A 3CXWA 4I4EA 2RFNA 4FT9A 4U79A 5E90A 1JKSA 4DH5A 3THBA 3R7YA 2J0KA 4W4WA 4MXAA 4FNWA 2QO7A 3GCUA 5CAPA 4BWXA 3ZDIA 2NP8A 3KRWA 1Q5KA 3FQSA 2GCDA 4FI1A 3ZFYA 1H24A 1OIYA 3QTIA 3VUTA 3W8QA 4PMSA 3PXYA 3UODA 3VAPA 5AADA 2BRGA 4FSNA 3MH1A 1K2PA 2UW3A 5E8UA 3IGGA 3FZPA 2CLQA 5AP1A 3ROYA 4C38A 3TNPC 4O27B 4BICA 4O86A 4K77A 2X6DA 4KS8A 4FTTA 4DEGA 3DBCA 4TWCA 4P2KA 2O63A 4GIIA 5DI1A 3JR1A 4FTOA 3GCPA 2Y8OA 2YM6A 3E8NA 4QP1A 5CF4A 3R2YA 4OT6A 4EYJA 4JAIA 3VUDA 4QMZA 2YEXA 3NEWA 4GJ2A 2OXDA 4S30A 4DG2E 1PXMA 3TUDA 2YIRA 5HTBA 1KE7A 5HOAA 3RK7A 4F09A 2F57A 3QXOA 3D15A 4S33A 1PXOA 5CSWA 3NLBA 5H2UA 4DINA 4AGDA 3IOKA 3PJ1A 2G2FA 2XK7A 2GNHA 3R8UA 2YZAA 4J95A 4WO5A 2C5YA 3FC1X 5HIEA 5DFPA 3AC1A 5CEQA 3HAVA 5EHOA 1GNGA 4FKTA 5LWMA 4RIXA 3MDYA 3O71A 1EH4A 3PP0A 2OZAA 3QFVA 1V0PA 4USFA 4QMWA 3BBWA 3DGKA 4KAOA 3FI8A 3COIA 3T3UA 3RM7A 3V6SA 5I5ZA 1JPAA 5ETCA 5HO8A 2CNQA 2X7FA 1YXTA 3D5UA 4K0YA 3UMWA 4MNEB 4ZP5A 5C26A 2ZDTA 5E8YA 4JS8A 4FKSA 3O8UA 1YHVA 4MK0A 3QWKA 5AMNA 2ONLA 4RIYB 5FEEA 1H1WA 3G6GA 3KN6A 4O96A 4EH8A 3R00A 4F9YA 2WNTA 4JG6A 3KXHA 2C6KA 4JL9A 5CU2A 3VQHA 3ACJA 4L43A 1AGWA 3QUEA 2WO6A 4RLLA 4ZSLA 4BBEA 3PWDA 4FMQA 2QG5A 3OBJA 2BCJA 3P0MA 2I1MA 5CSVA 3VJOA 3HAMA 4FEUA 2PTKA 2Y9QA 3ANQA 3DQWA 2HZ0A 5DT3A 4AGCA 3E3PA 2JIUA 1J1CA 3DK3A 3TM0A 3C4ZA 4I6QA 3W1FA 3OW3A 3F2NA 4XG4A 2X0GA 1R0PA 3FY2A 4FKVA 2E2BA 3RCDA 5EYDA 2YHVA 3LXKA 4DTAA 4QTAA 2GMXA 4FV4A 4QP3A 4J7BA 4OW8A 5D7AA 2YZLA 2J0LA 1KWPA 3O23A 2ZOQA 1ZY5A 2OSCA 4ITIA 4AW0A 2CSNA 5AA9A 4FT5A 3RPOA 2GNIA 3ZC5A 1HCKA 2X9EA 3LVPA 2VWZA 5L2WA 4DHFA 1LEWA 3GP0A 5EDQA 4ERWA 2YLFA 4OTRA 4YTHA 4C7TA 3PZHA 4O83A 4F65A 2WOUA 4GV1A 4OTDA 2UV2A 4CSVA 2BILB 3OXZA 4YLKA 5EKNA 3JY0A 5DT4A 5BVKA 4KIPA 4AA0A 1YOLA 3RPRA 4JQ8A 4BC6A 4N6ZA 5FG8A 3RPSA 5FRIA
chains in the Genus database with same CATH superfamily
5KMNA 3UIMA 3EQRA 3T8OA 4M69B 5F1ZA 4G9CA 4BCMA 3BE9A 3NW6A 3F2AA 1UNHA 5BVDA 4K11A 5HO6A 4O0YA 3SRVB 1TKIA 2R3LA 4FT0A 4N4SA 4W4VA 5HO7A 2Z02A 1PMVA 4O81A 4DDGA 3GENA 3CY2A 5FM3A 2B52A 4QMNA 3F3WA 1WBPA 4PDPA 2GU8A 3O7LB 4WKQA 5EW3A 4YMJA 5FM2A 4Q9SA 3OEZA 3NNVA 2QU6A 3OD6X 3ZFMA 4PL4A 5AV0A 3KRJA 4G6NA 4UV0A 2HW6A 5D9HA 2GS2A 2W4KA 3NCZA 3LCSA 1ZYSA 5LVOA 4QPMA 5EFQA 4ANLA 1YI6A 2B4SB 4RVMA 4YJPA 2PSQA 4I0SA 2YDJA 2XRUA 3KMUA 4LRMA 3TKHA 3TKUA 1BX6A 5L8KA 3FKNA 4FZDB 3P79A 5E8VA 3TZ9A 3N4UA 2J90A 2QCSA 3WZDA 1LEZA 3O7LD 4TNDA 1TVOA 4AX8A 4RVLA 2OF2A 4EYMA 3NUSA 3QD0A 1SYKA 3BYVA 3JVSA 3LCKA 3IDBA 3BU6A 3VO3A 5CAVA 3FQEA 5M4CA 1HCLA 3Q9YA 1H0WA 1J7IA 4LMUA 5I9YA 4WSQA 2W5HA 5EI6A 2XIZA 1XBCA 2JLDA 3MFRA 3S0OA 5D41A 4O82A 1U59A 5FWKK 4C4HA 3Q3BA 4IQ6A 4M68A 4XV9A 4XNEA 5HG5A 1PXKA 3MVMA 4OBQA 5CEKA 2VWWA 4DN5A 2ZYBA 4K18A 4O38A 3DK6A 3Q4UA 3UVQA 3KK8A 4ALUA 2IVTA 4EOOA 3ZH8A 4YU2A 2ITXA 3R71A 4NIFB 4CMTA 1M17A 5KUPA 3ZUUA 3HMOA 2G15A 2UZTA 3LQ8A 3MSSA 4QQJA 4QNAA 5EM5A 4OBPA 2VTLA 3RCJA 4NM7A 3ZSIA 5IZFA 2HWOA 4L46A 3CTHA 4BI0A 2JFLA 5M4FA 3UZRA 4BTMA 1XQZA 1W8CA 3O17A 4BDFA 1UKHA 4P90A 5TF9A 4LOQA 2YM7A 5HHWA 5GIOE 3L1SA 2YAAA 3FZOA 2WTIA 3DNEA 4PDYA 3NR9A 3NUPA 4FTQA 3GC7A 2R3JA 1ZRZA 3EN4A 4L52A 4E6CA 2OJGA 3CGOA 3LM0A 3SOCA 2JD5A 4R5YA 2JBPA 2XEYA 5LCKA 4H3QA 4FG7A 4BCHA 2Y0AA 5KMJA 4EKKA 3D4QA 3C13A 3IECA 4YJRA 2REIA 4CXAA 3REPA 2YISA 3HUBA 3KB7A 2B1PA 2BALA 3DBDA 4QMOA 1URWA 4D9TA 5IF1A 3TJCA 3W0QA 5IQCA 5ETIA 3PA3A 4EH9A 2C0OA 2PULA 2FH9A 4NZWB 4DG0E 3A62A 4JG7A 3TZMA 2R3QA 4FL2A 3HKOA 2WTKB 4FSUA 4O4CA 3OVVA 4N0SA 4ZS0A 3WF7A 3JY9A 3LW0A 4RC4A 4XMOA 4AOJA 4BI1A 2ZVAA 5E9EA 2XYUA 4FKOA 4OT5A 4NJ3A 4AXAA 3HECA 2VWXA 1OIUA 5GHVA 4HPUE 2CGUA 3SLSA 3EHAA 4AXCA 4RA4A 3IW8A 1BMKA 2CDZA 2YABA 4I6BA 2RG6A 1PY5A 4FV5A 4XG9A 1R3CA 1JSTA 4FKIA 2BUJA 1UVRA 2HENA 3HA6A 4HGLA 4NH1A 2BAQA 4R8QA 5FXQA 4BHNA 4NCTC 3E8EA 4IB5A 4G6OA 4OAVB 5LVLA 3GT8A 4MVFA 3TG1A 4BCOA 4O0WA 3OOGA 1YXUA 4OTWA 3ZUTA 3FMLA 3FZTA 3PXZA 5AUUA 3ENHA 5A54A 4XRJA 2GNGA 3QU0A 4I3ZA 4JDHA 3L8XA 3DKGA 4AA5A 3E7OA 3MI9A 4BIBA 3FLNC 4AZVA 3KIOC 3MTFA 2HXLA 2VTSA 2X1NA 5E7RA 4ZEGA 4UMRA 3G6HA 4R77A 5IUHA 1ZLTA 1VYWA 3CJGA 5D12A 1ZWSA 2A1AB 4KIOA 5EKOA 4CLIA 2PVNA 4AW5A 4A06A 3IOPA 3R8MA 1P4FA 4G5PA 2W1IA 1IRKA 3E8DA 2I6LA 4ALWA 2WIHA 4IDVA 4PDOA 4RWLA 2ITQA 3NYOA 3FKOA 4OTGA 2IPXA 2QONA 3QAME 4IVAA 3U4WA 3E93A 4HPTE 1BKXA 2X8EA 4IVCA 3UJGA 4DCEA 5BVFA 4EORA 4HNIA 2BROA 1GZOA 2W7XA 3NIEA 2C30A 3Q04A 4K6ZA 4UB7A 3W2RA 4PP7A 4E6DA 4BKYA 4HVDA 3C5IA 2XNMA 4RZWA 1PKGA 2YM8A 3LFCA 4M84A 3VUKA 5KKRC 4GKIA 3C4XA 4CFVA 4ENXA 5HE2A 4EH3A 4BGQA 3I81A 3MB7A 1UA2A 5E92A 1IR3A 4FK6A 1REKA 5FEDA 1PMEA 5B7VA 3QTSA 5M51A 4IADA 1H4LA 3IKAA 3OCGA 4QTBA 2JITA 2XBAA 3DBFA 3BZ3A 4R1YA 4RRVA 5BPYA 2VGPA 3DA6A 5D7VA 3Q4ZA 4L3LA 4YTIA 3TNQB 1URCA 3BX5A 3PP1A 4V0GA 4Y83A 5ANOA 2GHMA 3E62A 2YWVA 3DTCA 4QMYA 4WBOA 3C0IA 4XJ0A 3TNHA 2ZFYA 2X4ZA 2WMXA 4U5JA 3MA6A 5CVFA 5LJJA 3QHRA 3S4QA 1GIHA 4JBPA 4QT1A 4R7HA 4YJUA 4DGOA 2CNVA 2OI4X 5KMKA 4DTBA 4UALA 3W2PA 1L8TA 5JN2A 3H3CA 3RMFA 4UY9A 4IW0A 2FSMX 3ZZEA 1QPDA 4BDIA 1U5RA 1WBNA 4CQEA 4FSMA 4GU9A 5JFWA 2UW8A 4BTJA 2IEWA 4WBBB 2RGPA 4RC2A 4DFBA 2JBOA 3TIZA 4U45A 2XB7A 1W84A 2XEZA 4O1PA 4X6RA 3EQCA 1O6LA 1JVPP 1H01A 3D5XA 3LCTA 4WNMA 5L8LA 5FTQA 4TNBA 2VNYA 1MP8A 2JDTA 4QMLA 4UMPA 4DEDA 4XX9A 2ETMA 3UC4A 4AT4A 4UX9A 4NFNA 4UWBA 3WILA 4I6LA 5K4IA 1REJA 1SVEA 1SM2A 4APCA 5BMMA 2GNJA 2HY0A 3GCSA 3PY3A 3HV3A 2AC3A 4FNZA 1OGYA 3MY0A 4FKWA 5AIRA 4BCGA 4DLJA 2A27A 4II5A 4J99A 4KB8A 3GFEA 4D4VA 3OMVA 4BYIA 4IZ7A 2J9MA 4RPVA 4LV7A 4JDIA 3KF4A 3VBTA 4BRXA 4EHGA 2WU6A 5J95A 5L6OA 1QPJA 3BHVA 2XRWA 4JAJA 4Z3VA 2JDRA 3MPTA 2XIYA 4RJ3A 4O6LA 4FV7A 4EL9A 1OIQA 3DLSA 3EKNA 4NWMA 2H6DA 2EVAA 3VRYA 4DLIA 4EKLA 5KMMA 3G15A 2XS0A 4EEVA 3KU2A 4IB1A 4GW8A 4QP8A 1H27A 2IJMA 2VX3A 4R5SA 4BN1A 3NVKI 2R3HA 4CZYB 3PRFA 4FIGA 2IW9A 3PYYA 1JBPE 2CHLA 3U87A 1PYEA 2J5FA 4FIEA 1U54A 5KBRA 3HRCA 1OKZA 5H9BA 5H3QA 3LCOA 5IQHA 4FKUA 4DEEA 1OPJA 1P2AA 4DGNA 4GUEA 2WAJA 2Z60A 4O6EA 4UZHA 3NYVA 4YNEA 3C7QA 3TEIA 4RFZA 5AAEA 3V5JA 5CEPA 2QOFA 3NIZA 4O1OA 2PVMA 1OUKA 3NNXA 5AR4A 3VHKA 2QHMA 4QTDA 4LOPA 4W4XA 3SVVA 3DFCB 2IVUA 3DLZA 3KRLA 3ZRMA 5CEIA 2BZKB 5HORA 5IMEA 3U54A 2XM9A 3WE4A 4DEHA 3KMMA 2QOQA 2WQBA 3ZO3A 5FDXA 1R1WA 1ZMUA 4TYIA 4YJOA 4OBOA 4HCVA 3OXIA 3VULA 3HP2A 3R1YA 1OB3A 5CALA 4BTFA 4MEDA 1CTPE 1WBTA 4X2GA 3FQHA 3AG9A 5EOBA 3MN3A 4HZRA 2ONLC 3NMUF 2VX1A 3QZIA 3OWKA 3SD0A 2J2IB 5BX0A 5JQ5A 3ID6C 4FNXA 4PP9A 5DE2A 4EOKA 4IFCA 2VWVA 4ENYA 2VX0A 5K0KA 4FE2A 4XUFA 3LCDA 2OF4A 3O2MA 3FMNA 4LV5A 4BZNA 3QC4A 4HZSA 4JG8A 2W4OA 1H1SA 5AR8A 4J8MA 1VZOA 2OXXA 3MTLA 3EYHA 3R9DA 4ASEA 3FDNA 4RWKA 3FZ1A 4DTKA 5C8KA 4DFZE 2UW5A 3ALNA 3RPYA 2C68A 4CG8A 2FSLX 3I0OA 1BL6A 2WMBA 1WVXA 4YZBA 3SG8A 1TZDA 2QI8A 4NM3A 4WG3A 1E1VA 4XBUA 4MWIA 3B8QA 2FSTX 2O5KA 2PE1A 2W1EA 1OKVA 3D14A 4M13A 4BVUA 4GK4A 3TV7A 3W2SA 3B2WA 5HLWA 1OL2A 2X6EA 3D7ZA 5TE0A 5AR3A 3S3IA 3UNJA 4AQCA 4QYGA 4EK4A 1G8SA 3BV2A 1R78A 5CZIA 2VWUA 4MF1A 5IEXA 5A9UA 3PY0A 3TUCA 5HIDA 4ORKA 4ZY6A 3ZZWA 4QDVA 1B39A 3PVWA 3D2KA 3WYXA 5FDPA 5HNIX 2UW0A 3C51A 2BMCA 2UW9A 5L8JA 3TNIA 4EWHA 4IB0A 4D0WA 4PNKA 3LXPA 4DITA 3EZRA 3FZRA 5GJGA 5H8BA 2BDWA 4DGGA 4M66A 4FZ7A 1YOMA 4CNHA 5IDPA 4XCUA 3I4BA 3V5LA 4D2RA 4F70A 4QO9A 2VWIA 5DG5A 4L53A 3DBEA 1OMWA 4A4LA 4EQMA 2AEGA 3VS6A 4F9WA 4DCAA 3GUBA 2IZRA 3QL8A 4R3PA 4YP8A 3VW8A 4TWNA 3I60A 3NUNA 1WCCA 3OTVA 4F7JA 2JDSA 3BHHA 2HY81 4AZSA 3FHRA 3RTPA 4CEGA 4MTAA 3BL7A 3Q4CA 2PUPA 4QMTA 5KZIA 3VJNA 1OM1A 1W2CA 2ZV9A 4DYMA 3VBVA 4EHZA 5HLNA 2W5BA 4JX3A 2W99B 5CNOA 3KCKA 4D9UA 2PL0A 4LGGA 4L6QA 3ULZA 5HKMA 1DI9A 1UU7A 3QRUA 2HZ4A 3CPBA 4TWOA 4E6AA 3GFWA 5LMKC 2P2HA 3LMGA 3MY1A 4G17A 4MNFA 4ZLZA 4NFMA 4TRLA 5HEZA 3ZYAA 3KN5A 4U7ZA 5BMSA 5FXRA 3QWJA 5CSHA 3EQIA 1O6YA 2KTYA 3LHJA 3WF8A 2E9NA 4XHKB 4B4LA 4EZ7A 3ZEPA 4C3RA 1E1XA 2HCKA 2XIKA 3O8TA 3SW7A 4NW5A 3ML1A 2ITOA 3W16A 2H8HA 2OLCA 2PVHA 4IEBA 3BQRA 1OIRA 3GC9A 2WIPA 2VO0A 2ZM3A 4XP2A 3Q2MA 2I0VA 4TY1A 3AC3A 4J71A 4EUTA 4EK8A 4MD9E 5JFVA 2C6OA 2WMQA 4QYEA 4FL1A 3LE6A 4CCUA 3DJ6A 4DFLA 5C4KA 4QPSA 2VU3A 1Z9XA 1FVTA 4HCUA 5CWZA 4JI9A 3IGOA 3D83A 3CGFA 5CU6A 3EQHA 4AE9A 3AGMA 4NKSA 4IX5A 4D2WA 4HOKA 4RQKA 3FSKA 2DQ7X 2R3KA 2UZUE 3PXFA 4NU1A 5FBNC 1FGKA 1YHWA 3O50A 3Q32A 4MCVA 4RIYA 2OG8A 3K3JA 2R9SA 3UPZA 3OCSA 3ZU7A 1BI7A 3ORNA 5CSXA 2V22A 2QOLA 5HVKA 2C5XA 4CFXA 4PUZA 3QQFA 4KIQA 5DWRA 3G51A 2AC5A 4Y8DA 1YI3A 5BNJA 4IZYA 4BYJA 2WTJA 5A4QA 2OIBA 4RIXB 4XG8A 1JSVA 3OY3A 4USEA 5C8NA 2O3PA 4FEVA 4M12A 3GEQA 2XNOA 4FTKA 5BUJA 4ZTLA 2OWBA 1XJDA 4ZJVA 5KBQA 4BR3A 2VUWA 1YW2A 4OLIA 4EOSA 4HVIA 2OFUA 3NDMA 1LP4A 5GIPE 2XZSA 2XALA 3AMBA 1XH9A 4DHJA 4GU6A 3CTJA 4JDKA 3VIDA 3HDNA 2BRNA 3VUMA 5HGIA 1GAGA 1KV2A 3WZUA 4AWIA 4GEOA 5JGBA 3PE1A 2CKQA 4G3DA 4IM2A 3QRIA 4L42A 4EHEA 4D2VA 3LFSA 3HLLA 4JJRA 5CQUA 3RP9A 4IVBA 5HX8A 3KL8A 1UKIA 3NNUA 4WIHA 1JQHA 3OUNB 1NVSA 1ZARA 4MBJA 4UZDA 3AQVA 2YM5A 2QG7A 2WQNA 3HVCA 4EOLA 2R4BA 3SDJA 4CTBA 3TV4A 4FSQA 4ZMFA 3A8XA 3QYWA 2BAJA 4G3GA 4FRFA 1SVGA 1WBWA 4FVRA 2XNNA 3K2LA 5FXSA 4X21A 4E4NA 1IA9A 2YA9A 4IWQA 4QOXA 4FZAB 4GH2A 2XJ0A 5EI2A 3SW4A 3V5QA 4FC0A 3R8ZA 3O0GA 3OW4A 4JBQA 1DI8A 4JRVA 4O0VA 5EHYA 2XNBA 5AUVA 1O9UA 3AMYA 3QGWA 3RKBA 4E5AX 3EWHA 3ZLWA 5HTCA 1YDTE 4IJ9A 4ACDA 2VWBA 3HEGA 4ASDA 3FSFA 3Q4TA 2WB8A 4QP9A 4ZJIA 3DTWA 4DA5A 5HI2A 3OT8A 4F63A 4O0XA 4CKRA 2ITYA 2OO8X 2GS6A 4LOOA 1OL1A 4RIOA 5CAUA 3GXLA 5AJQA 5KO1A 2OJFE 5FD2A 3PIZA 4LMNA 2F7XE 1W2DA 2PZRA 1GZNA 3F3VA 5FTGA 3UP7A 2BZIB 2EXEA 2UW6A 4TYGA 4V01A 4RJ4A 5ANGA 5AP2A 3PJ2A 3A4PA 3TJDA 3TT0A 4LL0A 4R1VA 4AS0A 3VNTA 4BWPA 5CY3A 5LCJA 4XP0A 5JZJA 3QKLA 4TPTA 1Y91A 5BYZA 3PZEA 4LGDA 2WD1A 4YJQA 5AP0A 3ZO4A 3UVRA 5IUGA 4YC3A 2XYNA 2QOKA 4D4SA 2FO0A 3FMEA 1WZYA 3BEGA 2IN6A 3QTXA 3R30A 4JBVA 1OL5A 5CU3A 5EI8A 3GVUA 5HD7A 4WD5A 4YR8A 5AEPA 3P23A 1ZYJA 3F2RA 4IC8A 5J79A 3R21A 3KCFA 3CC6A 4DH1A 1J3HA 4FICA 3L8PA 1M2QA 4I5CA 4D58A 5A46A 5BVOA 1OBGA 4FV8A 3ORLA 1IA8A 1IASA 3I6UA 3PUPA 5D11A 4M8TA 3FLQA 3I0QA 4IAZA 2JFMA 3FAAA 3UZTA 4BFMA 4B9DA 2BHHA 3V51A 3RINA 3JS2A 3U6IA 1G8AA 3MH3A 3ZS5A 3DNDA 2E9VA 4RIWB 3ZM9A 1PXPA 5B2KA 3RGFA 4TKSA 2XIXA 1P5EA 3DJ5A 4C8BA 4CV8A 3F7WA 1PJKA 2P55A 3LQ5A 3OZ6A 3TV6A 5I9ZA 5JGAA 2BHEA 2X81A 3ODYX 3D2IA 3QTRA 4KBCA 1GZKA 3PE2A 3GU6A 3UDZA 2VO3A 4S31A 1K9AA 2BIYA 4I6HA 2YDKA 3LOKA 5LVNA 3TDWA 3W0SA 3Q60A 2X0PA 4D4RA 4USDA 3HV7A 5CANA 3Q6WA 4I5HA 4Q5EA 2WTDA 3BHTA 3CBLA 3HRFA 2B55A 3OWJA 4RG0A 4S32A 1GZ8A 4R3CA 4UBAA 5HQ0A 3GNIB 5TOZA 1Q62A 4FYOA 4PMMA 5DHJA 5AR5A 3QTQA 4RBLA 3ZRLA 3CEKA 4F9CA 4LUDA 5IEVA 5L2TA 2V5QA 4NJDA 4RJ5A 5A4LA 4ZOGA 3EYGA 4L7SA 2VTMA 5D1JA 2HW7A 3UOJA 4BZDA 2UZNA 3F88A 5DIAA 3QQGA 5L4QA 1E9HA 3RWPA 3QF9A 2QOBA 4PWNA 3CD3A 1GJOA 2OJIA 3R9NA 1OBDA 5B2LA 5E8SA 4FEXA 4YC8A 3PSCA 3D94A 4ZSEA 3OT3A 2WMRA 3RI1A 2C6LA 4EI4A 3Q96A 1J1BA 3LM5A 4O21A 1TFFA 4KBAA 2HOGA 3RWQA 2ITPA 3ZOSA 2WHBA 3Q2JA 3RBWA 3RAKA 2C1AA 4RFMA 2UZBA 4TN6A 3WF9A 4DFUA 4FSRA 3DCVA 3BELA 1YHSA 2BFYA 3KK9A 3P7AA 2GFSA 4GVJA 4EJNA 2IZTA 3O96A 4G2FA 5J5TA 2B9IA 4YC6A 3NFFB 2C4GA 3HZTA 3LFAA 5HG7A 1GOLA 3OF0A 2HELA 3I79A 4G6LA 3LJ1A 4I4FA 5DN3A 5AX9A 3UIXA 2X7OA 5BUEA 4D55A 5J5SA 4DH3A 3GB2A 3P1AA 3H9OA 5JRSA 4DT8A 3QLFA 4PX6A 4C36A 1H8FA 1BUHA 5J87A 3UDSA 2X8IA 3MA3A 1WBSA 4GJ3A 3M1SA 4FZFB 3FXWA 5KX8A 1FMOE 4MXYA 4FKRA 3QQLA 3EH9A 4HYHA 1VEBA 2XUUA 2HZNA 3WZJA 2LGCA 4MH7A 2VV9A 4ZTMA 4WT6A 4AXDA 2W05A 2YITA 3EN9A 4BCKA 2BAKA 3W0RA 1YRPA 2OK1A 2W96B 2W1DA 4GL9A 5J1WA 1Q3DA 4YZCA 1Y57A 2HK5A 3R1QA 1FQ1B 4U0IA 4NYEA 1A9UA 4XRLA 5I9WA 4AGWA 3EB0A 5C9CA 5GZAA 2UUEA 4RQVA 4FSZA 2C5OA 4EHVA 3A2CA 4D4YA 2QOHA 4RX7A 3EL8A 3JUHA 3TN8A 4ZXTA 4AT3A 3OFMA 3PVUA 3GCQA 2ERKA 2H96A 4X3FB 1OPKA 4A4OA 4BI2A 4IXPA 4IAFA 2R3RA 2XNPA 3C9WA 3COHA 2YIYA 3BYSA 3D5VA 3DOGA 3MJ1A 3OXTA 1SVHA 2R7IA 3HP5A 4M69A 1VYZA 5KZ0A 3COMA 2JKKA 2CCIA 4IZAA 3UQFA 2XAOA 4O2PA 5H8GA 3W33A 4AW2A 4E7WA 3OS3A 4P4CA 1K3AA 2F7ZE 5EYKA 3UPXA 4EQUA 4BY9E 4QQTA 4LV8A 4BGGA 4GFMA 3HMMA 5CT7A 1KV1A 4C4FA 3PVGA 3OUKA 3EMGA 3FY0A 5AIKA 4BIEA 3TIYA 2PVFA 4XV2A 5B2MA 3DQXA 3ZHPC 1OITA 4Y46A 5IA1A 3C4CA 4HGTA 4QMMA 4ANBA 5J7HA 4MD7E 1V0BA 4DHZA 4E93A 1M7NA 4AW1A 1XO2B 4YHJA 2XM8A 4C3PA 2R3OA 2C1BA 4FV1A 4I5PA 3A7FA 4GK3A 2DWBA 2IF8A 4HYSA 2PUNA 1NXKA 3QGYA 2C3JA 4L67A 5BQ0A 3EQBA 3FMDA 3PA5A 1WMKA 5CQWA 4C61A 3KQ7A 4F6WA 5AV2A 5EOLA 5JRQA 4L44A 3FKLA 3FMJA 5A3XA 4XOYA 5CSPA 5IQGA 3R1NA 2F4JA 5GINE 5CYIA 1ZXEA 3R63A 5IH5A 4QDEA 5IA4A 5EYMA 4R7IA 2CGVA 2F7EE 1FVRA 1VJYA 5C03A 1ERKA 5IQDA 5KHXA 4FTCA 3ORIA 1NW1A 3E88A 4IAKA 2ETKA 2EWAA 2JGZA 3AD6A 4ITJA 3RM6A 5T6KA 4FBXA 3RZFA 1KOAA 5K9IA 1W2FA 4CTCA 2QLUA 3IW6A 3MGYA 3QX4A 4JR7A 4BDJA 2WTWA 3U6JA 4K33A 3TCPA 3VRZA 4XEYA 5C01A 5M53A 1TQPA 4GIHA 4DH7A 4DFXE 4F64A 2XF0A 5HLPA 4UXQA 3TXOA 2RFSA 2C6TA 3QTWA 4MNEA 4EK3A 5M4UA 4QNYA 4IX3A 4N70A 3BKBA 4X2JA 3EIDA 5DA3A 1RDQE 1WBOA 2EB2A 4UMTA 1OL7A 4XG6A 3W2OA 2PMOX 5IEYA 4X3JA 5K5XA 4EZ3A 4HNFA 2DS1A 2WEIA 2QO2A 4MHAA 3UBDA 1OL6A 3V5PA 4GFGA 3UTOA 4BJJB 3MFTA 4AUAA 5E8ZA 2BPMA 4E26A 3PLSA 1ZOGA 3A7JA 4O7LA 5AUZA 3BLAA 3FPQA 1B38A 2UZWE 4HGSA 3QTZA 4OTQA 1KE9A 4S2ZA 4A07A 4R78A 1PMUA 2Y4IC 1JAMA 4H05A 3QBNA 5JSMA 5LMKA 5BVWA 2XCKA 2PZ5A 5EHLA 5EYCA 4X2NA 3MJ2A 3QCQA 4AT5A 5HU9A 3ZSGA 1SNXA 2ZV2A 3PY1A 3KXZA 3WF5A 4BDDA 3P4KA 4C4GA 3ATTA 5M06A 4FV9A 3HL7A 3NAXA 1GIJA 4MYGA 2B7AA 3KREA 4X3FC 1FVVA 3BU5A 5IQAA 4RGJA 4UN0C 4J98A 4KA3A 5K5NA 3LLAA 1QPEA 2W4JA 2ZB1A 3ANRA 4KABA 3U4UA 2CKPA 3OCTA 3CLYA 2UZOA 2W9ZB 3QUPA 3DXPA 1W82A 4G5JA 3NPCA 2VRXA 4AOIA 5JFSA 2R3NA 1OI9A 2AUHA 2CCHA 4BDHA 4JIAA 4PV0A 3MESA 5E1SA 5LWNA 4I92A 3KXNA 4NSTA 2YIWA 5HE1A 4QP4A 3U6HA 3WIGA 4CQGA 3FZSA 4WNKA 3BIZA 2QOOA 2W1ZA 5AX3A 1A06A 3MH2A 3N51A 3U9CA 3FMMA 5ITAA 1Q8UA 3VUIA 4FV0A 2VTAA 4I41A 3A7HA 4Y72A 4H36A 4BTKA 4JOAA 1MUOA 2PZIA 3CQWA 3P9JA 4LM5A 5HNGA 5DYJA 5AAFA 5K3YA 4UYNA 4EOQA 4KS7A 2VD5A 4ACGA 4KUJA 3CKXA 4A4XA 1G3NA 3NCGA 3EQFA 3FYJX 3MVHA 2NNWB 3LFBA 2AYPA 3WIKA 3QCXA 4C57A 4CD0A 3KXGA 4IAYA 2PMIA 4ID7A 2VZ6A 4H39A 5IG1A 3DKFA 2CPKE 4KIKB 5A4TA 4CRLA 3AKKA 3H10A 4RFYA 5A4CA 4NM0A 2OGVA 4IX6A 5AA8A 3F9NA 1H25A 2A19B 2OICA 1CKPA 4YPDA 4HYIA 4RX9A 4D1ZA 5LVPA 3VUHA 4YTFA 2WQOA 1Q61A 2BTSA 2GNLA 3V01A 5I9UA 2UZVA 3GQIA 2WMWA 1Q99A 4FTAA 4RSSA 4BKZA 4DEIA 1XMMA 4EUUA 1PF8A 3RAIA 1XH7A 2QLQA 4F0GA 4AF3A 2J0MB 2JC6A 3R01A 4ZTRA 2B9JA 3TUBA 5EW8A 2UZDA 3G0FA 4O7YA 4ALVA 5KMLA 3C50A 2A0CX 4L00A 3D9VA 2PMLX 2P33A 1NVRA 3E64A 1KOBA 4YSMA 5AP4A 3TYKA 1S9JA 4E20A 2FVDA 2CN8A 4XG3A 4QYYA 2OFVA 5TKDA 4AACA 4E6QA 1YWRA 2RFDA 2W1CA 4ZZNA 4EH5A 3VVHA 1CKJA 3VONA 4FZ6A 2IZSA 4L9IA 3TZ8A 3VN9A 2DYLA 3PSBA 4CLJA 1FBNA 5DBXA 4WNPA 3D7TB 3KULA 3LZBA 4B6LA 2XKDA 1XHAA 4FG9A 5JQ8A 3UO5A 1NVQA 2VTHA 4RZVA 2R64A 3HV6A 4V04A 5L2QA 4L3PA 4AFEA 3LFDA 4RJ7A 3KF7A 1ND4A 1XH6A 3SQQA 3ATSA 2GQSA 4G31A 4B7TA 3EFKA 1DAYA 2UVXA 3NZ0A 2WPAA 5FTOA 4FOCA 3MVJA 5IA5A 2F2CB 3M2WA 3LFNA 3R28A 4OAUC 3R9RA 4Y85A 5C27A 2WOTA 4BDCA 3GOPA 4J53A 5E1EA 2W17A 4DHIB 4FTLA 4GG5A 5AM6A 2YLEA 3FWQA 3AKLA 3NSZA 5HBEA 4TYHB 2YWPA 4JX7A 2JKOA 3GOKA 4FG8A 4V0GB 4R6VA 3C0HA 3R8VA 4EONA 4PRJA 1JSUA 4PQNA 5DNRA 5IQIA 4O7SA 4EH6A 4GT4A 4LUEA 3UYTA 4ANOA 4FUXA 2X8DA 3FUPA 4J1RA 2Q83A 2G2IA 3A8WA 4FGRA 4IHPA 4IAIA 4PY1A 3PFQA 1H1PA 4C37A 4U40A 3UG1A 3CQUA 4IE9A 4NCTA 2E9UA 4LDTA 3V8WA 1Q8TA 1JKTA 4CFNA 3G33A 4JQEA 5DT0A 1NT2A 4MWHA 1OKYA 1VR2A 3UIUA 4C59A 4BCIA 4XS2A 4G16A 3CP9A 3AGLA 3ZBFA 4QD6A 3F3UA 4U81A 4I6FA 5BUIA 1MQ4A 3PIYA 4D1XA 3I6WA 3UOHA 1ZAOA 4AGUA 3DT1A 4M14A