4IX8A

Crystal structure of tyrosine aminotransferase from leishmania infantum
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
409
structure length
406
Chain Sequence
SFRRIASSKHAQRTLQPLNNLTMKPSRSTKSNLRLSIGDPTVDGNLKTPDIVTEAMVDVVRSGKFNGYPPTVGADNLRQVVSTYWRRFCQTKSRQEALKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFDTNVPRLILGGTAYQVCPGWRVGWSILIDPMNVAGDWAVGMERLTQLIAGVNSICQEAIARTLLKCPTECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLSYFQDLKSDMEFYEKLLDEENVQVLPGEIFGMSGFLRATVSRPSAVLNEAVDRIIEFCERHKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of tyrosine aminotransferase from Leishmania infantum.
pubmed doi rcsb
source organism Leishmania infantum
molecule tags Transferase
molecule keywords Tyrosine aminotransferase
total genus 130
structure length 406
sequence length 409
chains with identical sequence B
ec nomenclature ec 2.6.1.5: Tyrosine transaminase.
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4ix8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4ix8A01
2EZ1A 4XJMA 3PJ0A 3BWNC 1BQDA 4OCAA 1FG3A 1AMQA 1RV4A 1WSTA 4ZASA 2X5DA 3DXVA 2YCTA 4UHOA 4EMYA 5EAVA 1O62A 1FC4A 3FTBA 2HUUA 3I4JA 1KKJA 1S08A 5JAYA 1TATA 2F8JA 1AHEA 3NDNA 1M0NA 1W23A 2OKJA 1V72A 3LV2A 3FQ8A 4DBCA 2HUIA 2PB0A 4E77A 5FT6A 1C0NA 1ELQA 2GQNA 1BW0A 3OKSA 1M4NA 1TARA 1QIRA 2VMVA 1X28A 5DB5A 5F9SA 2JJGA 4LW2A 4OMAA 1Y4IA 4CVQA 5J8QA 3JZLA 1ZC9A 2D65A 4PIWA 4A6RA 2CINA 1CZCA 2E54A 3R9AA 2ZY4A 1CL1A 1GC0A 1PG8A 1TPLA 4ZWVA 2FNIA 3EI5A 3AELA 3PD6B 2AY4A 1GC3A 1DKAA 1M0QA 1ASLA 3VOMA 1AICA 2EZ2A 4MY5A 3RQ1A 2W7EA 2DGKA 2VMUA 3AV7A 2VMYA 4DGTA 3AENA 2ZJGA 1BJOB 3NYTA 2BWNA 5EUEA 4ZWMA 3I5TA 2JJFA 2VMOA 1B9HA 2AATA 5FT5A 4WP0A 4A6UA 4HVKA 4W8IA 1V2FA 4WYDA 3BN1A 4A0RA 4DQ6A 3PAAA 3HQTA 4MKKA 4E3RA 3BB8A 1D7SA 1B4XA 2CJDA 4F5LA 2AY7A 5FT4A 2V0YA 4J8LA 3A9YA 2GB3A 2YRRA 1AJSA 1SZKA 3BCAA 2BKWA 3FVUA 3WCNA 1SVVA 2PO3A 4RKCA 3B46A 1AMSA 3AOWA 4XQ2A 3FQ7A 5M4BA 4WXGA 1MAPA 3BS8A 3E9KA 1BQAA 3VK2A 4MQQA 1G7WA 2X5FA 5LH9A 4LC3A 4JEVA 3BWNA 3TATA 4MGRA 3G7QA 3DC1A 2BI1A 3RUYA 1S0AA 3FSLA 3PDBA 4A0FA 2VI8A 2TPLA 3N75A 2AY3A 4MSOA 4ADEA 1M0OA 4AZKA 3FVSA 3CAIA 1I41A 1WYUA 1ECXA 1IX8A 2AY8A 4UHNA 1D7UA 1IX6A 1J04A 1YNUA 3NNKA 2Z9VA 3PIUA 5C6UA 1AJSB 3WZFA 2AY2A 1WYVB 2W7DA 5G4JA 4F5HA 2YKUA 4WYFA 2W7KA 1WKHA 4LNLA 2CY8A 1CL2A 2AY6A 2BHXA 4OTLA 4WB0B 5HXXA 4AO9A 4ATQA 2VGWA 3BWOA 2OATA 3IHJA 1LKCA 3ZRQA 1MLZA 2Z67A 1YAAA 4XJOA 2JISA 1S09A 2CB1A 1IBJA 2VGUA 3AOVA 4IYOA 3DU4A 2FN6A 2BIAA 3F6TA 1AHFA 4W1XA 3UE8A 4R8DA 4GE4A 1O4SA 1BT4A 3KGWA 3QBOA 2EPJA 3TFUA 4Y0DA 4LNJA 3B1CA 4BHDA 1VP4A 1LC7A 1M6SA 3DODA 3MC6A 3FCRA 1JS3A 3PGYA 2AEUA 1X29A 1AHYA 5BJ4A 3HLMA 3LVKA 1DJEA 3LY1A 5EFSA 2BIGA 1BJOA 4JEZA 2FM1A 1M7YA 1QGNA 2JGTA 2QBTA 4TV7A 3EZSA 3QHXA 2CFBA 2OGEA 3JU7A 3CQ5A 3FDDA 3EI9A 5DX5A 5IWQA 1MAQA 3GBXA 3F9TA 3BCBA 3PDBB 1ASCA 5DJ9A 1C7OA 2W7GA 3MAFA 4A0GA 4W5KA 3A9ZA 4EU1A 2QA3A 3P1TA 1N8PA 4JEWA 3G0TA 4ZDLA 4WB0A 4AOAA 2AY9A 3L8AA 2EH6A 1DJUA 1M0PA 3ZZJA 4RLGA 1FG7A 4OT8A 3ELEA 1AKAA 1O69A 2W7MA 1LK9A 3RCHA 2NMPA 2Z9WA 5K8BA 1B5OA 2ZY5A 3CQ4A 3QM2A 1T3IA 2HOZA 1YIYA 1KL1A 3CBFA 1OXPA 4F5MA 3LWSA 4O6ZA 2X3LA 3VK3A 1AIBA 3MBBA 4W1VA 2VMZA 1D7RA 2GMUA 4R5ZA 1YOOA 3EIAA 3E2YA 2ZP7A 1ASBA 4A6TA 4ZAHA 1KKPA 5TF5A 2OQXA 3NUBA 3NRAA 3B1EA 1AY8A 3WGCA 5EIGA 3AEMA 4ZM3A 4QGRA 1QITA 4JEYA 3PD6A 1WKGA 2BI5A 4ITXA 4WYEA 1KMJA 1UU1A 2D7ZA 2AY1A 3NU7A 1UU2A 1H1CA 5G09A 3TQXA 4CBSA 4MQPA 3NYUA 1DGEA 3USFA 3DZZA 1AKCA 2AEVA 2V1PA 3AATA 4F5JA 2VGZA 3RBLA 3UWCA 1GEXA 2PB2A 1M32A 2HUFA 1SZSA 3EI7A 3QGUA 3NYSA 4GSAA 4Q75A 1ARHA 4JE5A 2W7HA 2QMAA 5AX8A 1YJSA 4B98A 3K7YA 5E3KA 5M4DA 2G6WA 2GMSA 3M5UA 4P3MA 2ZYJA 1G4VA 3LVLB 4IXSA 1OXOA 2WKAA 3EZ1A 3E2ZA 1C7GA 1PMOA 2E7JA 2VMRA 3JW9A 3WX9A 1BJWA 3FQAA 5EUDA 3NTJA 4XK1A 5G0AA 3WCOA 3ECDA 2R0TA 2X8UA 2VI9A 2YKYA 1E5EA 4ADBA 1SF2A 3ISLA 2ZSMA 1CQ8A 4XEWA 4GEBA 2VGTA 4MKJA 3WGBA 5M49A 2ZUKA 3GZDA 2W8JA 4I8AA 2CSTA 2YCPA 1G4XA 2E7UA 1X2AA 2D7YA 2FQ6A 1N31A 2EO5A 3VK4A 2CJHA 4UQVA 4GRXA 3FD0A 4M2KA 4RIZA 4ADDA 3LVJA 2QB3A 4Q31A 5F8VA 2BWOA 2HOYA 1ASAA 1RVUA 1E5FA 4P7YA 3FZ7A 2W8UA 1OHVA 4BA5A 4U1TA 2R5CA 1MDOA 4AH3A 3HVYA 5LHAA 1ZODA 3AENB 2CTZA 3QPGA 1CQ7A 3AEJC 1IVRA 4L0OA 3A8UX 4M2JA 3ASBA 4IXOA 4RJ0A 4ZLVA 4PVFA 4RKDA 3DR7A 3PPLA 1ARIA 1CJ0A 3A2BA 5G2QA 3ZRRA 3EI8A 1DGDA 1OHYA 4K2MA 4LNMA 1RV3A 1IJIA 4J5UA 2CH1A 2XH1A 3FZ8A 1G7XA 3E2ZB 2D64A 1ARSA 3PA9A 4JE5D 3HL2A 3I16A 2C44A 4N0BA 2VLFA 4Q76A 4KXKA 1IAYA 1CS1A 1TOKA 4CXRA 1ZOBA 4H51A 2Z9UA 2ORDA 2DGMA 2VMWA 4WLJA 4RAEA 4XAUA 3B1DA 1XI9A 1AAWA 1I48A 4W1WA 1AMAA 1MLYA 3HDOA 4JF0A 1QZ9A 1BJNA 2DKBA 4WXBA 1WYTB 3LVMA 5EAAA 2VYCA 2XBNA 4R5FA 1GCKA 3MKJA 3N0LA 3COGA 3MAUA 2D61A 1AMRA 2FNUA 3W1IA 2Z20A 2Z1ZA 5HHYA 4JF1A 1WYTA 2Z1YA 1GC2A 4FL0A 1QJ3A 2W7LA 4F5FA 1ASEA 4WLHA 3DRDA 1UU0A 1C4KA 3HMUA 4B9BA 2VMPA 3G8MA 3WKRA 2D5YA 3DXWA 4XJLA 5HDMA 2GSAA 1LW5A 4A0HA 4ZM4A 2HORA 2Q7WA 2BWPA 1B5PA 1H0CA 1TOEA 1DFOA 2WK9A 5EQCA 2Z9XA 2JJEA 4W91A 3IF2A 5D95A 3UAKA 3FRKA 2R2NA 1AJRA 1GDEA 2YHKA 4IW7A 1ASNA 2R5EA 1V2DA 5BJ3A 1LW4A 1CZEA 2DR1A 2VLHA 4Y0IA 3ZZKA 3KGXA 1D7VA 3QI6A 3JWAA 1AHGA 1Z3ZA 1ASDA 4MQRA 5E5IA 3Q8NA 3W1JA 4F4EA 3WLXA 4ZDOA 2VIAA 3HBXA 1W7MA 1W3UA 1YIZA 2BYJA 4AZJA 3GSBA 5D5SA 3NUIA 1B8GA 3GZDC 4EB5A 5G4IA 5EUNA 4N0WA 1P3WA 3KKIA 3ASAA 1AKBA 1ELUA 3PDXA 4OC9A 4EFFA 1V2EA 1O61A 3MEBA 4E3QA 3E6GA 3FVXA 4R2NA 4ISYA 1YJYA 4TMRA 3RI6A 3ZRPA 4A72A 3GJUA 1I43A 2O7CA 1TOJA 3HT4A 1IX7A 3BV0A 3RCHB 3R4TA 2RFVA 4CBRA 5M46A 1GC4A 3FKDA 1S06A 1IUGA 4AO4A 2BYLA 1BS0A 4E1OA 1W7LA 3F0HA 1PMMA 3OP7A 3A9XA 3ATHA 1ASFA 1ASMA 1CQ6A 1MDZA 1W7NA 3NX3A 1X0MA 4IY7A 4Y0HA 3K28A 1BJ4A 2W8WA 3EI6A 4ZDPA 3W1HA 1AY4A 3RBFA 3H14A 2VMQA 4GE9A 8AATA 1ASGA 4FFCA 3FFHA 1SPAA 3EIBA 4EB7A 4WBTA 3BCXA 5I92A 3K40A 3DR4A 1VJOA 4NOGA 3AEPA 2FYFA 2OGAA 4BQ0A 2ZY3A 3MAFB 4IXZA 2CH2A 4JEXA 4F5IA 3T32A 4WYAA 1MGVA 2R5CB 2CJGA 4RITA 7AATA 1UKJA 2AY5A 3GETA 1KMKA 1JG8A 4PFFA 1AX4A 1B9IA 3VP6A 2VGVA 1OATA 3FFRA 3KE3A 3P6KA 2VMXA 4K2BA 2Z61A 1PFFA 4GDYA 5FT8A 3WKSA 3QN6A 4BMKA 3EUCA 2VMTA 2WK7A 4U2HA 4UOYA 1N2TA 2QLRA 3FZ6A 3H7FA 1J32A 2W7JA 4GE7A 4ATPA 3E77A 5E4ZA 9AATA 1I29A 1DJ9A 2JJHA 2OKKA 4IX8A 3GWPA 4PFNA 2ZY2A 4F5KA 3AEMC 4ITGA 3TCMA 2E7IA 4RM1A 4K2IA 2CANA 3ELPA 3MADA 4A00A 4ADCA 3VAXA 2JG2A 2DOUA 2BI3A 2BI9A 2EGYA 1EG5A 2ZSLA 3D6KA 3JWBA 1WYVA 2YKXA 1EQBA 2C81A 1C7NA 2C7TA 4WD2A 1SFFA 2QB2A 1ARTA 1TASA 2YCNA 2W7FA 3BC8A 3GZCA 3II0A 1AHXA 1LC8A 2WK8A 1GD9A 1OHWA 4OYTA 4TN4A 4OBVA 1XEYA 2C0RA 3JTXA 1EJIA 1IAXA 4RJYA 3DYDA 3E2FA 1TOGA 2W8TA 1SZUA 3NU8A 2VMSA 2YOBA 4XJPA 3LG0A 4ZSWA 4LW4A 3AEOA 2D66A 1VEFA 2DGLA 3B8XA 4WYGA 2HP1A 4ZSYA 1DTYA 1GEYA 4BA4A 2DKJA 1JF9A 1GEWA 1TOIA 4WXFA 1D2FA 1LS3A 2W7IA 4CXQA 1ARGA 3N5MA 1U08A 5G2PA 3GR9A 5EIGB 1AY5A 2ZC0A 2YRIA 1GBNA 1QISA 1MDXA 1C9CA 2VMNA 4M2MA 4Q6RA 1QJ5A 2BIEA 2D63A 3WY7A 2YKVA 2HOXA 4KYOA 3FDBA 5DJ1A 2VIBA 1LC5A 1RVYA 4WYCA 1AAMA 1YJZA 3CQ6A 1Z7DA 2HP2A 2VGSA 4F5GA 1KL2A 1WYUB 2BI2A 1S07A 1AIAA 3L44A 1ORDA 3MC6C 3TFTA 4IYOB 1BKGA 2W8VA 4HF8A 1JS6A 2O0RA 4KAMA 4OBUA 2O1BA 4UHMA 3ACZA 3AEJA 2HZPA
chains in the Genus database with same CATH superfamily
2EZ1A 4XJMA 3PJ0A 3BWNC 1BQDA 4OCAA 1FG3A 1AMQA 1RV4A 1WSTA 4ZASA 2X5DA 3DXVA 2YCTA 4UHOA 4EMYA 5EAVA 1O62A 1FC4A 3FTBA 2HUUA 3I4JA 1KKJA 1S08A 5JAYA 1TATA 2F8JA 1AHEA 3NDNA 1M0NA 3N4RA 1W23A 2OKJA 1V72A 3LV2A 3FQ8A 4DBCA 2HUIA 2PB0A 4E77A 5FT6A 1C0NA 1ELQA 2GQNA 1BW0A 3OKSA 1M4NA 1TARA 1QIRA 2VMVA 1X28A 5DB5A 5F9SA 4K05A 2JJGA 4LW2A 4OMAA 1Y4IA 4CVQA 5J8QA 3JZLA 1ZC9A 2D65A 4PIWA 4A6RA 2CINA 1CZCA 2E54A 3R9AA 2ZY4A 1CL1A 1GC0A 1PG8A 1TPLA 4ZWVA 2FNIA 3EI5A 3AELA 2FKIA 3PD6B 2AY4A 1GC3A 1DKAA 1M0QA 1ASLA 3VOMA 1AICA 2EZ2A 4MY5A 3RQ1A 2W7EA 2A1VA 2DGKA 2VMUA 3AV7A 2VMYA 4DGTA 3AENA 2ZJGA 1BJOB 3NYTA 2BWNA 5EUEA 4ZWMA 3I5TA 2JJFA 2VMOA 1B9HA 2AATA 5FT5A 4WP0A 4A6UA 4HVKA 4W8IA 1V2FA 4WYDA 3BN1A 4A0RA 4DQ6A 3PAAA 3HQTA 4MKKA 4E3RA 3BB8A 1D7SA 1B4XA 2CJDA 4F5LA 2AY7A 5FT4A 2V0YA 4J8LA 3A9YA 2GB3A 2YRRA 1AJSA 1SZKA 3BCAA 2BKWA 3FVUA 3WCNA 1SVVA 2PO3A 4RKCA 3B46A 1AMSA 3AOWA 4XQ2A 3FQ7A 5M4BA 4WXGA 1MAPA 3BS8A 3E9KA 1BQAA 3VK2A 4MQQA 1G7WA 2X5FA 5LH9A 4LC3A 4JEVA 3BWNA 3TATA 4MGRA 3G7QA 3DC1A 2BI1A 3RUYA 1S0AA 3FSLA 3PDBA 4A0FA 2VI8A 2TPLA 3N75A 2AY3A 4MSOA 4ADEA 1M0OA 4AZKA 3FVSA 3CAIA 1I41A 1WYUA 1ECXA 1IX8A 2AY8A 4UHNA 1D7UA 1IX6A 1J04A 1YNUA 3NNKA 2Z9VA 3PIUA 5C6UA 1AJSB 3WZFA 2AY2A 1WYVB 2W7DA 5G4JA 4F5HA 2YKUA 4WYFA 2W7KA 1WKHA 4LNLA 2CY8A 1CL2A 2AY6A 2BHXA 4OTLA 4WB0B 5HXXA 4AO9A 4ATQA 2VGWA 3BWOA 2OATA 3IHJA 1LKCA 3ZRQA 1MLZA 2Z67A 1YAAA 4XJOA 2JISA 1S09A 2CB1A 1IBJA 2VGUA 3AOVA 4IYOA 3DU4A 2FN6A 2BIAA 3F6TA 1AHFA 4W1XA 3UE8A 4R8DA 4GE4A 1O4SA 1BT4A 3KGWA 3QBOA 2EPJA 3TFUA 4Y0DA 4LNJA 3B1CA 4BHDA 1VP4A 1LC7A 1M6SA 3DODA 3MC6A 3FCRA 1JS3A 3PGYA 2AEUA 1X29A 1AHYA 5BJ4A 3HLMA 3LVKA 1DJEA 3LY1A 5EFSA 2BIGA 1BJOA 4JEZA 2FM1A 1M7YA 1QGNA 2JGTA 2QBTA 4TV7A 3EZSA 3QHXA 2CFBA 2OGEA 3JU7A 3CQ5A 3FDDA 3EI9A 5DX5A 5IWQA 1MAQA 3GBXA 3F9TA 3BCBA 3PDBB 1ASCA 5DJ9A 1C7OA 2W7GA 3MAFA 4A0GA 4W5KA 3A9ZA 4EU1A 2QA3A 3P1TA 1N8PA 4JEWA 3G0TA 4ZDLA 4WB0A 4AOAA 2AY9A 3L8AA 2EH6A 1DJUA 1M0PA 3ZZJA 4RLGA 1FG7A 4OT8A 3ELEA 1AKAA 1O69A 2W7MA 1LK9A 3RCHA 2NMPA 2Z9WA 5K8BA 1B5OA 2ZY5A 3CQ4A 3QM2A 1T3IA 2HOZA 1YIYA 1KL1A 3CBFA 1OXPA 4F5MA 3LWSA 4O6ZA 2X3LA 3VK3A 1AIBA 3MBBA 4W1VA 2VMZA 1D7RA 2GMUA 4R5ZA 1YOOA 3EIAA 3E2YA 2ZP7A 1ASBA 4A6TA 4ZAHA 1KKPA 5TF5A 2OQXA 3NUBA 3NRAA 3B1EA 1AY8A 3WGCA 5EIGA 3AEMA 4ZM3A 4QGRA 1QITA 4JEYA 3PD6A 1WKGA 2BI5A 4ITXA 4WYEA 1KMJA 1UU1A 2D7ZA 2AY1A 3NU7A 1UU2A 1H1CA 5G09A 3TQXA 4CBSA 4MQPA 3NYUA 1DGEA 3USFA 3DZZA 1AKCA 2AEVA 2V1PA 3AATA 4F5JA 2VGZA 3RBLA 3UWCA 1GEXA 2PB2A 1M32A 2HUFA 1SZSA 3EI7A 3QGUA 3NYSA 4GSAA 4Q75A 1ARHA 4JE5A 2W7HA 2QMAA 5AX8A 1YJSA 4B98A 3K7YA 5E3KA 5M4DA 2G6WA 2GMSA 3M5UA 4P3MA 2ZYJA 1G4VA 3LVLB 2G7JA 4IXSA 1OXOA 2WKAA 3EZ1A 3E2ZA 1C7GA 1PMOA 2E7JA 2VMRA 3JW9A 3WX9A 1BJWA 3FQAA 5EUDA 3NTJA 4XK1A 5G0AA 3WCOA 3ECDA 2R0TA 2X8UA 2VI9A 2YKYA 1E5EA 4ADBA 1SF2A 3ISLA 2ZSMA 1CQ8A 4XEWA 4GEBA 2VGTA 4MKJA 3WGBA 5M49A 2ZUKA 3GZDA 2W8JA 4I8AA 2CSTA 2YCPA 1G4XA 2E7UA 1X2AA 2D7YA 2FQ6A 1N31A 2EO5A 3VK4A 2CJHA 4UQVA 4GRXA 3FD0A 4M2KA 4RIZA 4ADDA 3LVJA 2QB3A 4Q31A 5F8VA 2BWOA 2HOYA 1ASAA 1RVUA 1E5FA 4P7YA 3FZ7A 2W8UA 1OHVA 4BA5A 4U1TA 2R5CA 1MDOA 4AH3A 3HVYA 5LHAA 1ZODA 3AENB 2CTZA 3QPGA 1CQ7A 3AEJC 1IVRA 4L0OA 3A8UX 4M2JA 3ASBA 4IXOA 4RJ0A 4ZLVA 4PVFA 4RKDA 3DR7A 3PPLA 1ARIA 1CJ0A 3A2BA 5G2QA 3ZRRA 3EI8A 1DGDA 1OHYA 4K2MA 4LNMA 1RV3A 1IJIA 4J5UA 2CH1A 2XH1A 3FZ8A 1G7XA 3E2ZB 2D64A 1ARSA 3PA9A 4JE5D 3HL2A 3I16A 2C44A 4N0BA 2VLFA 4Q76A 4KXKA 1IAYA 1CS1A 1TOKA 4CXRA 1ZOBA 4H51A 2Z9UA 2ORDA 2DGMA 2VMWA 4WLJA 4RAEA 4XAUA 3B1DA 1XI9A 1AAWA 1I48A 4W1WA 1AMAA 1MLYA 3HDOA 4JF0A 1QZ9A 1BJNA 2DKBA 4WXBA 1WYTB 3LVMA 5EAAA 2VYCA 2XBNA 4R5FA 1GCKA 3MKJA 3N0LA 3COGA 3MAUA 2KFPA 2QSRA 2D61A 1AMRA 2FNUA 3W1IA 2Z20A 2Z1ZA 5HHYA 4JF1A 1WYTA 2Z1YA 1GC2A 4FL0A 1QJ3A 2W7LA 4F5FA 1ASEA 4WLHA 3DRDA 1UU0A 1C4KA 3HMUA 4B9BA 2VMPA 3G8MA 3WKRA 2D5YA 3DXWA 4XJLA 5HDMA 2GSAA 1LW5A 4A0HA 4ZM4A 2HORA 2Q7WA 2BWPA 1B5PA 1H0CA 1TOEA 1DFOA 2WK9A 5EQCA 2Z9XA 2JJEA 4W91A 3IF2A 5D95A 3UAKA 3FRKA 2R2NA 1AJRA 1GDEA 2YHKA 4IW7A 1ASNA 2R5EA 1V2DA 5BJ3A 1LW4A 1CZEA 2DR1A 2VLHA 4Y0IA 3ZZKA 3KGXA 1D7VA 3QI6A 3JWAA 1AHGA 1Z3ZA 1ASDA 4MQRA 5E5IA 3Q8NA 3W1JA 4F4EA 3WLXA 4ZDOA 2VIAA 3HBXA 1W7MA 1W3UA 1YIZA 2BYJA 4AZJA 3GSBA 5D5SA 3NUIA 1B8GA 3GZDC 4EB5A 5G4IA 5EUNA 4N0WA 1P3WA 3KKIA 3ASAA 1AKBA 1ELUA 3H9XA 3PDXA 4OC9A 4EFFA 1V2EA 1O61A 3MEBA 4E3QA 3E6GA 3FVXA 4R2NA 4ISYA 1YJYA 4TMRA 3RI6A 3ZRPA 4A72A 3GJUA 1I43A 2O7CA 1TOJA 3HT4A 1IX7A 3BV0A 3RCHB 3R4TA 2RFVA 4CBRA 5M46A 1GC4A 3N7NA 3FKDA 1S06A 1IUGA 4AO4A 2BYLA 1BS0A 4E1OA 1W7LA 3F0HA 1PMMA 3OP7A 3A9XA 3ATHA 1ASFA 1ASMA 1CQ6A 1MDZA 1W7NA 3NX3A 1X0MA 4IY7A 4Y0HA 3K28A 1BJ4A 2W8WA 3EI6A 4ZDPA 3W1HA 1AY4A 3RBFA 3H14A 2VMQA 4GE9A 3N4XA 8AATA 1ASGA 4FFCA 3FFHA 1SPAA 3EIBA 4EB7A 4WBTA 3BCXA 5I92A 3K40A 3DR4A 1VJOA 4NOGA 3AEPA 2FYFA 2OGAA 4BQ0A 2ZY3A 3MAFB 4IXZA 2CH2A 4JEXA 4F5IA 3T32A 4WYAA 1MGVA 2R5CB 2CJGA 4RITA 7AATA 1UKJA 2AY5A 3GETA 1KMKA 1JG8A 4PFFA 1AX4A 1B9IA 3VP6A 2VGVA 1OATA 3FFRA 3KE3A 3P6KA 2VMXA 4K2BA 2Z61A 1PFFA 4GDYA 5FT8A 3WKSA 3QN6A 4BMKA 3EUCA 1KAFA 2VMTA 2WK7A 4U2HA 4UOYA 1N2TA 2QLRA 3FZ6A 3H7FA 1J32A 2W7JA 4GE7A 4ATPA 3E77A 5E4ZA 2EYQA 3N4SA 9AATA 1I29A 1DJ9A 2JJHA 2OKKA 4IX8A 3GWPA 4PFNA 2ZY2A 4F5KA 3AEMC 4ITGA 3TCMA 2E7IA 4RM1A 4K2IA 2CANA 3ELPA 3MADA 4A00A 4ADCA 3VAXA 2JG2A 2DOUA 2BI3A 2BI9A 2EGYA 1EG5A 2ZSLA 3D6KA 3JWBA 1WYVA 2YKXA 1EQBA 2C81A 1C7NA 2C7TA 4WD2A 1SFFA 2QB2A 1ARTA 1TASA 2YCNA 2W7FA 3BC8A 3GZCA 3II0A 1AHXA 5KTBA 1LC8A 2WK8A 1GD9A 1OHWA 4OYTA 4TN4A 4OBVA 2WB6A 1XEYA 2C0RA 3JTXA 1EJIA 1IAXA 4RJYA 3DYDA 3E2FA 1TOGA 2W8TA 1SZUA 3NU8A 2VMSA 2YOBA 4XJPA 3LG0A 4ZSWA 4LW4A 3AEOA 2D66A 1VEFA 2DGLA 3B8XA 4WYGA 2HP1A 4ZSYA 1DTYA 1GEYA 4BA4A 2DKJA 1JF9A 1GEWA 1TOIA 4WXFA 4H63Q 1D2FA 1LS3A 2W7IA 4CXQA 1ARGA 3N5MA 1U08A 5G2PA 3GR9A 5EIGB 1AY5A 2ZC0A 2YRIA 1GBNA 1QISA 1MDXA 1C9CA 2VMNA 4M2MA 4Q6RA 1QJ5A 2BIEA 2D63A 3WY7A 2YKVA 2HOXA 4KYOA 3FDBA 5DJ1A 2VIBA 1LC5A 1RVYA 4WYCA 1AAMA 1YJZA 3CQ6A 1Z7DA 2HP2A 2VGSA 4F5GA 1KL2A 1WYUB 2BI2A 1S07A 1AIAA 3L44A 1ORDA 3MC6C 3TFTA 4IYOB 1BKGA 2W8VA 4HF8A 1JS6A 2O0RA 4KAMA 4OBUA 2O1BA 4UHMA 3ACZA 3AEJA 2HZPA
chains in the Genus database with same CATH topology
2EZ1A 4XJMA 3PJ0A 3BWNC 1BQDA 4OCAA 1FG3A 1AMQA 1RV4A 1WSTA 4ZASA 2X5DA 3DXVA 2YCTA 4UHOA 4EMYA 5EAVA 1O62A 1FC4A 3FTBA 2HUUA 3I4JA 1KKJA 1S08A 5JAYA 1TATA 2F8JA 1AHEA 3NDNA 1M0NA 3N4RA 1W23A 2OKJA 1V72A 3LV2A 3FQ8A 4DBCA 2HUIA 2PB0A 4E77A 5FT6A 1C0NA 1ELQA 2GQNA 1BW0A 3OKSA 1M4NA 1TARA 1QIRA 2VMVA 1X28A 5DB5A 5F9SA 4K05A 2JJGA 4LW2A 4OMAA 1Y4IA 4CVQA 5J8QA 3JZLA 1ZC9A 2D65A 4PIWA 4A6RA 2CINA 1CZCA 2E54A 3R9AA 2ZY4A 1CL1A 1GC0A 1PG8A 1TPLA 4ZWVA 2FNIA 3EI5A 3AELA 2FKIA 3PD6B 2AY4A 1GC3A 1DKAA 1M0QA 1ASLA 3VOMA 1AICA 2EZ2A 4MY5A 3RQ1A 2W7EA 2A1VA 2DGKA 2VMUA 3AV7A 2VMYA 4DGTA 3AENA 2ZJGA 1BJOB 3NYTA 2BWNA 5EUEA 4ZWMA 3I5TA 2JJFA 2VMOA 1B9HA 2AATA 5FT5A 4WP0A 4A6UA 4HVKA 4W8IA 1V2FA 4WYDA 3BN1A 4A0RA 4DQ6A 3PAAA 3HQTA 4MKKA 4E3RA 3BB8A 1D7SA 1B4XA 2CJDA 4F5LA 2AY7A 5FT4A 2V0YA 4J8LA 3A9YA 2GB3A 2YRRA 1AJSA 1SZKA 3BCAA 2BKWA 3FVUA 3WCNA 1SVVA 2PO3A 4RKCA 3B46A 1AMSA 3AOWA 4XQ2A 3FQ7A 5M4BA 4WXGA 1MAPA 3BS8A 3E9KA 1BQAA 3VK2A 4MQQA 1G7WA 2X5FA 5LH9A 4LC3A 4JEVA 3BWNA 3TATA 4MGRA 3G7QA 3DC1A 2BI1A 3RUYA 1S0AA 3FSLA 3PDBA 4A0FA 2VI8A 2TPLA 3N75A 2AY3A 4MSOA 4ADEA 1M0OA 4AZKA 3FVSA 3CAIA 1I41A 1WYUA 1ECXA 1IX8A 2AY8A 4UHNA 1D7UA 1IX6A 1J04A 1YNUA 3NNKA 2Z9VA 3PIUA 5C6UA 1AJSB 3WZFA 2AY2A 1WYVB 2W7DA 5G4JA 4F5HA 2YKUA 4WYFA 2W7KA 1WKHA 4LNLA 2CY8A 1CL2A 2AY6A 2BHXA 4OTLA 4WB0B 5HXXA 4AO9A 4ATQA 2VGWA 3BWOA 2OATA 3IHJA 1LKCA 3ZRQA 1MLZA 2Z67A 1YAAA 4XJOA 2JISA 1S09A 2CB1A 1IBJA 2VGUA 3AOVA 4IYOA 3DU4A 2FN6A 2BIAA 3F6TA 1AHFA 4W1XA 3UE8A 4R8DA 4GE4A 1O4SA 1BT4A 3KGWA 3QBOA 2EPJA 3TFUA 4Y0DA 4LNJA 3B1CA 4BHDA 1VP4A 1LC7A 1M6SA 3DODA 3MC6A 3FCRA 1JS3A 3PGYA 2AEUA 1X29A 1AHYA 5BJ4A 3HLMA 3LVKA 1DJEA 3LY1A 5EFSA 2BIGA 1BJOA 4JEZA 2FM1A 1M7YA 1QGNA 2JGTA 2QBTA 4TV7A 3EZSA 3QHXA 2CFBA 2OGEA 3JU7A 3CQ5A 3FDDA 3EI9A 5DX5A 5IWQA 1MAQA 3GBXA 3F9TA 3BCBA 3PDBB 1ASCA 5DJ9A 1C7OA 2W7GA 3MAFA 4A0GA 4W5KA 3A9ZA 4EU1A 2QA3A 3P1TA 1N8PA 4JEWA 3G0TA 4ZDLA 4WB0A 4AOAA 2AY9A 3L8AA 2EH6A 1DJUA 1M0PA 3ZZJA 4RLGA 1FG7A 4OT8A 3ELEA 1AKAA 1O69A 2W7MA 1LK9A 3RCHA 2NMPA 2Z9WA 5K8BA 1B5OA 2ZY5A 3CQ4A 3QM2A 1T3IA 2HOZA 1YIYA 1KL1A 3CBFA 1OXPA 4F5MA 3LWSA 4O6ZA 2X3LA 3VK3A 1AIBA 3MBBA 4W1VA 2VMZA 1D7RA 2GMUA 4R5ZA 1YOOA 3EIAA 3E2YA 2ZP7A 1ASBA 4A6TA 4ZAHA 1KKPA 5TF5A 2OQXA 3NUBA 3NRAA 3B1EA 1AY8A 3WGCA 5EIGA 3AEMA 4ZM3A 4QGRA 1QITA 4JEYA 3PD6A 1WKGA 2BI5A 4ITXA 4WYEA 1KMJA 1UU1A 2D7ZA 2AY1A 3NU7A 1UU2A 1H1CA 5G09A 3TQXA 4CBSA 4MQPA 3NYUA 1DGEA 3USFA 3DZZA 1AKCA 2AEVA 2V1PA 3AATA 4F5JA 2VGZA 3RBLA 3UWCA 1GEXA 2PB2A 1M32A 2HUFA 1SZSA 3EI7A 3QGUA 3NYSA 4GSAA 4Q75A 1ARHA 4JE5A 2W7HA 2QMAA 5AX8A 1YJSA 4B98A 3K7YA 5E3KA 5M4DA 2G6WA 2GMSA 3M5UA 4P3MA 2ZYJA 1G4VA 3LVLB 2G7JA 4IXSA 1OXOA 2WKAA 3EZ1A 3E2ZA 1C7GA 1PMOA 2E7JA 2VMRA 3JW9A 3WX9A 1BJWA 3FQAA 5EUDA 3NTJA 4XK1A 5G0AA 3WCOA 3ECDA 2R0TA 2X8UA 2VI9A 2YKYA 1E5EA 4ADBA 1SF2A 3ISLA 2ZSMA 1CQ8A 4XEWA 4GEBA 2VGTA 4MKJA 3WGBA 5M49A 2ZUKA 3GZDA 2W8JA 4I8AA 2CSTA 2YCPA 1G4XA 2E7UA 1X2AA 2D7YA 2FQ6A 1N31A 2EO5A 3VK4A 2CJHA 4UQVA 4GRXA 3FD0A 4M2KA 4RIZA 4ADDA 3LVJA 2QB3A 4Q31A 5F8VA 2BWOA 2HOYA 1ASAA 1RVUA 1E5FA 4P7YA 3FZ7A 2W8UA 1OHVA 4BA5A 4U1TA 2R5CA 1MDOA 4AH3A 3HVYA 5LHAA 1ZODA 3AENB 2CTZA 3QPGA 1CQ7A 3AEJC 1IVRA 4L0OA 3A8UX 4M2JA 3ASBA 4IXOA 4RJ0A 4ZLVA 4PVFA 4RKDA 3DR7A 3PPLA 1ARIA 1CJ0A 3A2BA 5G2QA 3ZRRA 3EI8A 1DGDA 1OHYA 4K2MA 4LNMA 1RV3A 1IJIA 4J5UA 2CH1A 2XH1A 3FZ8A 1G7XA 3E2ZB 2D64A 1ARSA 3PA9A 4JE5D 3HL2A 3I16A 2C44A 4N0BA 2VLFA 4Q76A 4KXKA 1IAYA 1CS1A 1TOKA 4CXRA 1ZOBA 4H51A 2Z9UA 2ORDA 2DGMA 2VMWA 4WLJA 4RAEA 4XAUA 3B1DA 1XI9A 1AAWA 1I48A 4W1WA 1AMAA 1MLYA 3HDOA 4JF0A 1QZ9A 1BJNA 2DKBA 4WXBA 1WYTB 3LVMA 5EAAA 2VYCA 2XBNA 4R5FA 1GCKA 3MKJA 3N0LA 3COGA 3MAUA 2KFPA 2QSRA 2D61A 1AMRA 2FNUA 3W1IA 2Z20A 2Z1ZA 5HHYA 4JF1A 1WYTA 2Z1YA 1GC2A 4FL0A 1QJ3A 2W7LA 4F5FA 1ASEA 4WLHA 3DRDA 1UU0A 1C4KA 3HMUA 4B9BA 2VMPA 3G8MA 3WKRA 2D5YA 3DXWA 4XJLA 5HDMA 2GSAA 1LW5A 4A0HA 4ZM4A 2HORA 2Q7WA 2BWPA 1B5PA 1H0CA 1TOEA 1DFOA 2WK9A 5EQCA 2Z9XA 2JJEA 4W91A 3IF2A 5D95A 3UAKA 3FRKA 2R2NA 1AJRA 1GDEA 2YHKA 4IW7A 1ASNA 2R5EA 1V2DA 5BJ3A 1LW4A 1CZEA 2DR1A 2VLHA 4Y0IA 3ZZKA 3KGXA 1D7VA 3QI6A 3JWAA 1AHGA 1Z3ZA 1ASDA 4MQRA 5E5IA 3Q8NA 3W1JA 4F4EA 3WLXA 4ZDOA 2VIAA 3HBXA 1W7MA 1W3UA 1YIZA 2BYJA 4AZJA 3GSBA 5D5SA 3NUIA 1B8GA 3GZDC 4EB5A 5G4IA 5EUNA 4N0WA 1P3WA 3KKIA 3ASAA 1AKBA 1ELUA 3H9XA 3PDXA 4OC9A 4EFFA 1V2EA 1O61A 3MEBA 4E3QA 3E6GA 3FVXA 4R2NA 4ISYA 1YJYA 4TMRA 3RI6A 3ZRPA 4A72A 3GJUA 1I43A 2O7CA 1TOJA 3HT4A 1IX7A 3BV0A 3RCHB 3R4TA 2RFVA 4CBRA 5M46A 1GC4A 3N7NA 3FKDA 1S06A 1IUGA 4AO4A 2BYLA 1BS0A 4E1OA 1W7LA 3F0HA 1PMMA 3OP7A 3A9XA 3ATHA 1ASFA 1ASMA 1CQ6A 1MDZA 1W7NA 3NX3A 1X0MA 4IY7A 4Y0HA 3K28A 1BJ4A 2W8WA 3EI6A 4ZDPA 3W1HA 1AY4A 3RBFA 3H14A 2VMQA 4GE9A 3N4XA 8AATA 1ASGA 4FFCA 3FFHA 1SPAA 3EIBA 4EB7A 4WBTA 3BCXA 5I92A 3K40A 3DR4A 1VJOA 4NOGA 3AEPA 2FYFA 2OGAA 4BQ0A 2ZY3A 3MAFB 4IXZA 2CH2A 4JEXA 4F5IA 3T32A 4WYAA 1MGVA 2R5CB 2CJGA 4RITA 7AATA 1UKJA 2AY5A 3GETA 1KMKA 1JG8A 4PFFA 1AX4A 1B9IA 3VP6A 2VGVA 1OATA 3FFRA 3KE3A 3P6KA 2VMXA 4K2BA 2Z61A 1PFFA 4GDYA 5FT8A 3WKSA 3QN6A 4BMKA 3EUCA 2VMTA 2WK7A 4U2HA 4UOYA 1N2TA 2QLRA 3FZ6A 3H7FA 1J32A 2W7JA 4GE7A 4ATPA 3E77A 5E4ZA 2EYQA 3N4SA 9AATA 1I29A 1DJ9A 2JJHA 2OKKA 4IX8A 3GWPA 4PFNA 2ZY2A 4F5KA 3AEMC 4ITGA 3TCMA 2E7IA 4RM1A 4K2IA 2CANA 3ELPA 3MADA 4A00A 4ADCA 3VAXA 2JG2A 2DOUA 2BI3A 2BI9A 2EGYA 1EG5A 2ZSLA 3D6KA 3JWBA 1WYVA 2YKXA 1EQBA 2C81A 1C7NA 2C7TA 4WD2A 1SFFA 2QB2A 1ARTA 1TASA 2YCNA 2W7FA 3BC8A 3GZCA 3II0A 1AHXA 5KTBA 1LC8A 2WK8A 1GD9A 1OHWA 4OYTA 4TN4A 4OBVA 2WB6A 1XEYA 2C0RA 3JTXA 1EJIA 1IAXA 4RJYA 3DYDA 3E2FA 1TOGA 2W8TA 1SZUA 3NU8A 2VMSA 2YOBA 4XJPA 3LG0A 4ZSWA 4LW4A 3AEOA 2D66A 1VEFA 2DGLA 3B8XA 4WYGA 2HP1A 4ZSYA 1DTYA 1GEYA 4BA4A 2DKJA 1JF9A 1GEWA 1TOIA 4WXFA 4H63Q 1D2FA 1LS3A 2W7IA 4CXQA 1ARGA 3N5MA 1U08A 5G2PA 3GR9A 5EIGB 1AY5A 2ZC0A 2YRIA 1GBNA 1QISA 1MDXA 1C9CA 2VMNA 4M2MA 4Q6RA 1QJ5A 2BIEA 2D63A 3WY7A 2YKVA 2HOXA 4KYOA 3FDBA 5DJ1A 2VIBA 1LC5A 1RVYA 4WYCA 1AAMA 1YJZA 3CQ6A 1Z7DA 2HP2A 2VGSA 4F5GA 1KL2A 1WYUB 2BI2A 1S07A 1AIAA 3L44A 1ORDA 3MC6C 3TFTA 4IYOB 1BKGA 2W8VA 4HF8A 1JS6A 2O0RA 4KAMA 4OBUA 2O1BA 4UHMA 3ACZA 3AEJA 2HZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZ1 A;  4XJM A;  3PJ0 A;  3BWN C;  1BQD A;  4OCA A;  1FG3 A;  1AMQ A;  1RV4 A;  1WST A;  4ZAS A;  2X5D A;  3DXV A;  2YCT A;  4UHO A;  4EMY A;  5EAV A;  1O62 A;  1FC4 A;  3FTB A;  2HUU A;  3I4J A;  1KKJ A;  1S08 A;  5JAY A;  1TAT A;  2F8J A;  1AHE A;  3NDN A;  1M0N A;  1W23 A;  2OKJ A;  1V72 A;  3LV2 A;  3FQ8 A;  4DBC A;  2HUI A;  2PB0 A;  4E77 A;  5FT6 A;  1C0N A;  1ELQ A;  2GQN A;  1BW0 A;  3OKS A;  1M4N A;  1TAR A;  1QIR A;  2VMV A;  1X28 A;  5DB5 A;  5F9S A;  2JJG A;  4LW2 A;  4OMA A;  1Y4I A;  4CVQ A;  5J8Q A;  3JZL A;  1ZC9 A;  2D65 A;  4PIW A;  4A6R A;  2CIN A;  1CZC A;  2E54 A;  3R9A A;  2ZY4 A;  1CL1 A;  1GC0 A;  1PG8 A;  1TPL A;  4ZWV A;  2FNI A;  3EI5 A;  3AEL A;  3PD6 B;  2AY4 A;  1GC3 A;  1DKA A;  1M0Q A;  1ASL A;  3VOM A;  1AIC A;  2EZ2 A;  4MY5 A;  3RQ1 A;  2W7E A;  2DGK A;  2VMU A;  3AV7 A;  2VMY A;  4DGT A;  3AEN A;  2ZJG A;  1BJO B;  3NYT A;  2BWN A;  5EUE A;  4ZWM A;  3I5T A;  2JJF A;  2VMO A;  1B9H A;  2AAT A;  5FT5 A;  4WP0 A;  4A6U A;  4HVK A;  4W8I A;  1V2F A;  4WYD A;  3BN1 A;  4A0R A;  4DQ6 A;  3PAA A;  3HQT A;  4MKK A;  4E3R A;  3BB8 A;  1D7S A;  1B4X A;  2CJD A;  4F5L A;  2AY7 A;  5FT4 A;  2V0Y A;  4J8L A;  3A9Y A;  2GB3 A;  2YRR A;  1AJS A;  1SZK A;  3BCA A;  2BKW A;  3FVU A;  3WCN A;  1SVV A;  2PO3 A;  4RKC A;  3B46 A;  1AMS A;  3AOW A;  4XQ2 A;  3FQ7 A;  5M4B A;  4WXG A;  1MAP A;  3BS8 A;  3E9K A;  1BQA A;  3VK2 A;  4MQQ A;  1G7W A;  2X5F A;  5LH9 A;  4LC3 A;  4JEV A;  3BWN A;  3TAT A;  4MGR A;  3G7Q A;  3DC1 A;  2BI1 A;  3RUY A;  1S0A A;  3FSL A;  3PDB A;  4A0F A;  2VI8 A;  2TPL A;  3N75 A;  2AY3 A;  4MSO A;  4ADE A;  1M0O A;  4AZK A;  3FVS A;  3CAI A;  1I41 A;  1WYU A;  1ECX A;  1IX8 A;  2AY8 A;  4UHN A;  1D7U A;  1IX6 A;  1J04 A;  1YNU A;  3NNK A;  2Z9V A;  3PIU A;  5C6U A;  1AJS B;  3WZF A;  2AY2 A;  1WYV B;  2W7D A;  5G4J A;  4F5H A;  2YKU A;  4WYF A;  2W7K A;  1WKH A;  4LNL A;  2CY8 A;  1CL2 A;  2AY6 A;  2BHX A;  4OTL A;  4WB0 B;  5HXX A;  4AO9 A;  4ATQ A;  2VGW A;  3BWO A;  2OAT A;  3IHJ A;  1LKC A;  3ZRQ A;  1MLZ A;  2Z67 A;  1YAA A;  4XJO A;  2JIS A;  1S09 A;  2CB1 A;  1IBJ A;  2VGU A;  3AOV A;  4IYO A;  3DU4 A;  2FN6 A;  2BIA A;  3F6T A;  1AHF A;  4W1X A;  3UE8 A;  4R8D A;  4GE4 A;  1O4S A;  1BT4 A;  3KGW A;  3QBO A;  2EPJ A;  3TFU A;  4Y0D A;  4LNJ A;  3B1C A;  4BHD A;  1VP4 A;  1LC7 A;  1M6S A;  3DOD A;  3MC6 A;  3FCR A;  1JS3 A;  3PGY A;  2AEU A;  1X29 A;  1AHY A;  5BJ4 A;  3HLM A;  3LVK A;  1DJE A;  3LY1 A;  5EFS A;  2BIG A;  1BJO A;  4JEZ A;  2FM1 A;  1M7Y A;  1QGN A;  2JGT A;  2QBT A;  4TV7 A;  3EZS A;  3QHX A;  2CFB A;  2OGE A;  3JU7 A;  3CQ5 A;  3FDD A;  3EI9 A;  5DX5 A;  5IWQ A;  1MAQ A;  3GBX A;  3F9T A;  3BCB A;  3PDB B;  1ASC A;  5DJ9 A;  1C7O A;  2W7G A;  3MAF A;  4A0G A;  4W5K A;  3A9Z A;  4EU1 A;  2QA3 A;  3P1T A;  1N8P A;  4JEW A;  3G0T A;  4ZDL A;  4WB0 A;  4AOA A;  2AY9 A;  3L8A A;  2EH6 A;  1DJU A;  1M0P A;  3ZZJ A;  4RLG A;  1FG7 A;  4OT8 A;  3ELE A;  1AKA A;  1O69 A;  2W7M A;  1LK9 A;  3RCH A;  2NMP A;  2Z9W A;  5K8B A;  1B5O A;  2ZY5 A;  3CQ4 A;  3QM2 A;  1T3I A;  2HOZ A;  1YIY A;  1KL1 A;  3CBF A;  1OXP A;  4F5M A;  3LWS A;  4O6Z A;  2X3L A;  3VK3 A;  1AIB A;  3MBB A;  4W1V A;  2VMZ A;  1D7R A;  2GMU A;  4R5Z A;  1YOO A;  3EIA A;  3E2Y A;  2ZP7 A;  1ASB A;  4A6T A;  4ZAH A;  1KKP A;  5TF5 A;  2OQX A;  3NUB A;  3NRA A;  3B1E A;  1AY8 A;  3WGC A;  5EIG A;  3AEM A;  4ZM3 A;  4QGR A;  1QIT A;  4JEY A;  3PD6 A;  1WKG A;  2BI5 A;  4ITX A;  4WYE A;  1KMJ A;  1UU1 A;  2D7Z A;  2AY1 A;  3NU7 A;  1UU2 A;  1H1C A;  5G09 A;  3TQX A;  4CBS A;  4MQP A;  3NYU A;  1DGE A;  3USF A;  3DZZ A;  1AKC A;  2AEV A;  2V1P A;  3AAT A;  4F5J A;  2VGZ A;  3RBL A;  3UWC A;  1GEX A;  2PB2 A;  1M32 A;  2HUF A;  1SZS A;  3EI7 A;  3QGU A;  3NYS A;  4GSA A;  4Q75 A;  1ARH A;  4JE5 A;  2W7H A;  2QMA A;  5AX8 A;  1YJS A;  4B98 A;  3K7Y A;  5E3K A;  5M4D A;  2G6W A;  2GMS A;  3M5U A;  4P3M A;  2ZYJ A;  1G4V A;  3LVL B;  4IXS A;  1OXO A;  2WKA A;  3EZ1 A;  3E2Z A;  1C7G A;  1PMO A;  2E7J A;  2VMR A;  3JW9 A;  3WX9 A;  1BJW A;  3FQA A;  5EUD A;  3NTJ A;  4XK1 A;  5G0A A;  3WCO A;  3ECD A;  2R0T A;  2X8U A;  2VI9 A;  2YKY A;  1E5E A;  4ADB A;  1SF2 A;  3ISL A;  2ZSM A;  1CQ8 A;  4XEW A;  4GEB A;  2VGT A;  4MKJ A;  3WGB A;  5M49 A;  2ZUK A;  3GZD A;  2W8J A;  4I8A A;  2CST A;  2YCP A;  1G4X A;  2E7U A;  1X2A A;  2D7Y A;  2FQ6 A;  1N31 A;  2EO5 A;  3VK4 A;  2CJH A;  4UQV A;  4GRX A;  3FD0 A;  4M2K A;  4RIZ A;  4ADD A;  3LVJ A;  2QB3 A;  4Q31 A;  5F8V A;  2BWO A;  2HOY A;  1ASA A;  1RVU A;  1E5F A;  4P7Y A;  3FZ7 A;  2W8U A;  1OHV A;  4BA5 A;  4U1T A;  2R5C A;  1MDO A;  4AH3 A;  3HVY A;  5LHA A;  1ZOD A;  3AEN B;  2CTZ A;  3QPG A;  1CQ7 A;  3AEJ C;  1IVR A;  4L0O A;  3A8U X;  4M2J A;  3ASB A;  4IXO A;  4RJ0 A;  4ZLV A;  4PVF A;  4RKD A;  3DR7 A;  3PPL A;  1ARI A;  1CJ0 A;  3A2B A;  5G2Q A;  3ZRR A;  3EI8 A;  1DGD A;  1OHY A;  4K2M A;  4LNM A;  1RV3 A;  1IJI A;  4J5U A;  2CH1 A;  2XH1 A;  3FZ8 A;  1G7X A;  3E2Z B;  2D64 A;  1ARS A;  3PA9 A;  4JE5 D;  3HL2 A;  3I16 A;  2C44 A;  4N0B A;  2VLF A;  4Q76 A;  4KXK A;  1IAY A;  1CS1 A;  1TOK A;  4CXR A;  1ZOB A;  4H51 A;  2Z9U A;  2ORD A;  2DGM A;  2VMW A;  4WLJ A;  4RAE A;  4XAU A;  3B1D A;  1XI9 A;  1AAW A;  1I48 A;  4W1W A;  1AMA A;  1MLY A;  3HDO A;  4JF0 A;  1QZ9 A;  1BJN A;  2DKB A;  4WXB A;  1WYT B;  3LVM A;  5EAA A;  2VYC A;  2XBN A;  4R5F A;  1GCK A;  3MKJ A;  3N0L A;  3COG A;  3MAU A;  2D61 A;  1AMR A;  2FNU A;  3W1I A;  2Z20 A;  2Z1Z A;  5HHY A;  4JF1 A;  1WYT A;  2Z1Y A;  1GC2 A;  4FL0 A;  1QJ3 A;  2W7L A;  4F5F A;  1ASE A;  4WLH A;  3DRD A;  1UU0 A;  1C4K A;  3HMU A;  4B9B A;  2VMP A;  3G8M A;  3WKR A;  2D5Y A;  3DXW A;  4XJL A;  5HDM A;  2GSA A;  1LW5 A;  4A0H A;  4ZM4 A;  2HOR A;  2Q7W A;  2BWP A;  1B5P A;  1H0C A;  1TOE A;  1DFO A;  2WK9 A;  5EQC A;  2Z9X A;  2JJE A;  4W91 A;  3IF2 A;  5D95 A;  3UAK A;  3FRK A;  2R2N A;  1AJR A;  1GDE A;  2YHK A;  4IW7 A;  1ASN A;  2R5E A;  1V2D A;  5BJ3 A;  1LW4 A;  1CZE A;  2DR1 A;  2VLH A;  4Y0I A;  3ZZK A;  3KGX A;  1D7V A;  3QI6 A;  3JWA A;  1AHG A;  1Z3Z A;  1ASD A;  4MQR A;  5E5I A;  3Q8N A;  3W1J A;  4F4E A;  3WLX A;  4ZDO A;  2VIA A;  3HBX A;  1W7M A;  1W3U A;  1YIZ A;  2BYJ A;  4AZJ A;  3GSB A;  5D5S A;  3NUI A;  1B8G A;  3GZD C;  4EB5 A;  5G4I A;  5EUN A;  4N0W A;  1P3W A;  3KKI A;  3ASA A;  1AKB A;  1ELU A;  3PDX A;  4OC9 A;  4EFF A;  1V2E A;  1O61 A;  3MEB A;  4E3Q A;  3E6G A;  3FVX A;  4R2N A;  4ISY A;  1YJY A;  4TMR A;  3RI6 A;  3ZRP A;  4A72 A;  3GJU A;  1I43 A;  2O7C A;  1TOJ A;  3HT4 A;  1IX7 A;  3BV0 A;  3RCH B;  3R4T A;  2RFV A;  4CBR A;  5M46 A;  1GC4 A;  3FKD A;  1S06 A;  1IUG A;  4AO4 A;  2BYL A;  1BS0 A;  4E1O A;  1W7L A;  3F0H A;  1PMM A;  3OP7 A;  3A9X A;  3ATH A;  1ASF A;  1ASM A;  1CQ6 A;  1MDZ A;  1W7N A;  3NX3 A;  1X0M A;  4IY7 A;  4Y0H A;  3K28 A;  1BJ4 A;  2W8W A;  3EI6 A;  4ZDP A;  3W1H A;  1AY4 A;  3RBF A;  3H14 A;  2VMQ A;  4GE9 A;  8AAT A;  1ASG A;  4FFC A;  3FFH A;  1SPA A;  3EIB A;  4EB7 A;  4WBT A;  3BCX A;  5I92 A;  3K40 A;  3DR4 A;  1VJO A;  4NOG A;  3AEP A;  2FYF A;  2OGA A;  4BQ0 A;  2ZY3 A;  3MAF B;  4IXZ A;  2CH2 A;  4JEX A;  4F5I A;  3T32 A;  4WYA A;  1MGV A;  2R5C B;  2CJG A;  4RIT A;  7AAT A;  1UKJ A;  2AY5 A;  3GET A;  1KMK A;  1JG8 A;  4PFF A;  1AX4 A;  1B9I A;  3VP6 A;  2VGV A;  1OAT A;  3FFR A;  3KE3 A;  3P6K A;  2VMX A;  4K2B A;  2Z61 A;  1PFF A;  4GDY A;  5FT8 A;  3WKS A;  3QN6 A;  4BMK A;  3EUC A;  2VMT A;  2WK7 A;  4U2H A;  4UOY A;  1N2T A;  2QLR A;  3FZ6 A;  3H7F A;  1J32 A;  2W7J A;  4GE7 A;  4ATP A;  3E77 A;  5E4Z A;  9AAT A;  1I29 A;  1DJ9 A;  2JJH A;  2OKK A;  4IX8 A;  3GWP A;  4PFN A;  2ZY2 A;  4F5K A;  3AEM C;  4ITG A;  3TCM A;  2E7I A;  4RM1 A;  4K2I A;  2CAN A;  3ELP A;  3MAD A;  4A00 A;  4ADC A;  3VAX A;  2JG2 A;  2DOU A;  2BI3 A;  2BI9 A;  2EGY A;  1EG5 A;  2ZSL A;  3D6K A;  3JWB A;  1WYV A;  2YKX A;  1EQB A;  2C81 A;  1C7N A;  2C7T A;  4WD2 A;  1SFF A;  2QB2 A;  1ART A;  1TAS A;  2YCN A;  2W7F A;  3BC8 A;  3GZC A;  3II0 A;  1AHX A;  1LC8 A;  2WK8 A;  1GD9 A;  1OHW A;  4OYT A;  4TN4 A;  4OBV A;  1XEY A;  2C0R A;  3JTX A;  1EJI A;  1IAX A;  4RJY A;  3DYD A;  3E2F A;  1TOG A;  2W8T A;  1SZU A;  3NU8 A;  2VMS A;  2YOB A;  4XJP A;  3LG0 A;  4ZSW A;  4LW4 A;  3AEO A;  2D66 A;  1VEF A;  2DGL A;  3B8X A;  4WYG A;  2HP1 A;  4ZSY A;  1DTY A;  1GEY A;  4BA4 A;  2DKJ A;  1JF9 A;  1GEW A;  1TOI A;  4WXF A;  1D2F A;  1LS3 A;  2W7I A;  4CXQ A;  1ARG A;  3N5M A;  1U08 A;  5G2P A;  3GR9 A;  5EIG B;  1AY5 A;  2ZC0 A;  2YRI A;  1GBN A;  1QIS A;  1MDX A;  1C9C A;  2VMN A;  4M2M A;  4Q6R A;  1QJ5 A;  2BIE A;  2D63 A;  3WY7 A;  2YKV A;  2HOX A;  4KYO A;  3FDB A;  5DJ1 A;  2VIB A;  1LC5 A;  1RVY A;  4WYC A;  1AAM A;  1YJZ A;  3CQ6 A;  1Z7D A;  2HP2 A;  2VGS A;  4F5G A;  1KL2 A;  1WYU B;  2BI2 A;  1S07 A;  1AIA A;  3L44 A;  1ORD A;  3MC6 C;  3TFT A;  4IYO B;  1BKG A;  2W8V A;  4HF8 A;  1JS6 A;  2O0R A;  4KAM A;  4OBU A;  2O1B A;  4UHM A;  3ACZ A;  3AEJ A;  2HZP A; 
#chains in the Genus database with same CATH topology
 2EZ1 A;  4XJM A;  3PJ0 A;  3BWN C;  1BQD A;  4OCA A;  1FG3 A;  1AMQ A;  1RV4 A;  1WST A;  4ZAS A;  2X5D A;  3DXV A;  2YCT A;  4UHO A;  4EMY A;  5EAV A;  1O62 A;  1FC4 A;  3FTB A;  2HUU A;  3I4J A;  1KKJ A;  1S08 A;  5JAY A;  1TAT A;  2F8J A;  1AHE A;  3NDN A;  1M0N A;  3N4R A;  1W23 A;  2OKJ A;  1V72 A;  3LV2 A;  3FQ8 A;  4DBC A;  2HUI A;  2PB0 A;  4E77 A;  5FT6 A;  1C0N A;  1ELQ A;  2GQN A;  1BW0 A;  3OKS A;  1M4N A;  1TAR A;  1QIR A;  2VMV A;  1X28 A;  5DB5 A;  5F9S A;  4K05 A;  2JJG A;  4LW2 A;  4OMA A;  1Y4I A;  4CVQ A;  5J8Q A;  3JZL A;  1ZC9 A;  2D65 A;  4PIW A;  4A6R A;  2CIN A;  1CZC A;  2E54 A;  3R9A A;  2ZY4 A;  1CL1 A;  1GC0 A;  1PG8 A;  1TPL A;  4ZWV A;  2FNI A;  3EI5 A;  3AEL A;  2FKI A;  3PD6 B;  2AY4 A;  1GC3 A;  1DKA A;  1M0Q A;  1ASL A;  3VOM A;  1AIC A;  2EZ2 A;  4MY5 A;  3RQ1 A;  2W7E A;  2A1V A;  2DGK A;  2VMU A;  3AV7 A;  2VMY A;  4DGT A;  3AEN A;  2ZJG A;  1BJO B;  3NYT A;  2BWN A;  5EUE A;  4ZWM A;  3I5T A;  2JJF A;  2VMO A;  1B9H A;  2AAT A;  5FT5 A;  4WP0 A;  4A6U A;  4HVK A;  4W8I A;  1V2F A;  4WYD A;  3BN1 A;  4A0R A;  4DQ6 A;  3PAA A;  3HQT A;  4MKK A;  4E3R A;  3BB8 A;  1D7S A;  1B4X A;  2CJD A;  4F5L A;  2AY7 A;  5FT4 A;  2V0Y A;  4J8L A;  3A9Y A;  2GB3 A;  2YRR A;  1AJS A;  1SZK A;  3BCA A;  2BKW A;  3FVU A;  3WCN A;  1SVV A;  2PO3 A;  4RKC A;  3B46 A;  1AMS A;  3AOW A;  4XQ2 A;  3FQ7 A;  5M4B A;  4WXG A;  1MAP A;  3BS8 A;  3E9K A;  1BQA A;  3VK2 A;  4MQQ A;  1G7W A;  2X5F A;  5LH9 A;  4LC3 A;  4JEV A;  3BWN A;  3TAT A;  4MGR A;  3G7Q A;  3DC1 A;  2BI1 A;  3RUY A;  1S0A A;  3FSL A;  3PDB A;  4A0F A;  2VI8 A;  2TPL A;  3N75 A;  2AY3 A;  4MSO A;  4ADE A;  1M0O A;  4AZK A;  3FVS A;  3CAI A;  1I41 A;  1WYU A;  1ECX A;  1IX8 A;  2AY8 A;  4UHN A;  1D7U A;  1IX6 A;  1J04 A;  1YNU A;  3NNK A;  2Z9V A;  3PIU A;  5C6U A;  1AJS B;  3WZF A;  2AY2 A;  1WYV B;  2W7D A;  5G4J A;  4F5H A;  2YKU A;  4WYF A;  2W7K A;  1WKH A;  4LNL A;  2CY8 A;  1CL2 A;  2AY6 A;  2BHX A;  4OTL A;  4WB0 B;  5HXX A;  4AO9 A;  4ATQ A;  2VGW A;  3BWO A;  2OAT A;  3IHJ A;  1LKC A;  3ZRQ A;  1MLZ A;  2Z67 A;  1YAA A;  4XJO A;  2JIS A;  1S09 A;  2CB1 A;  1IBJ A;  2VGU A;  3AOV A;  4IYO A;  3DU4 A;  2FN6 A;  2BIA A;  3F6T A;  1AHF A;  4W1X A;  3UE8 A;  4R8D A;  4GE4 A;  1O4S A;  1BT4 A;  3KGW A;  3QBO A;  2EPJ A;  3TFU A;  4Y0D A;  4LNJ A;  3B1C A;  4BHD A;  1VP4 A;  1LC7 A;  1M6S A;  3DOD A;  3MC6 A;  3FCR A;  1JS3 A;  3PGY A;  2AEU A;  1X29 A;  1AHY A;  5BJ4 A;  3HLM A;  3LVK A;  1DJE A;  3LY1 A;  5EFS A;  2BIG A;  1BJO A;  4JEZ A;  2FM1 A;  1M7Y A;  1QGN A;  2JGT A;  2QBT A;  4TV7 A;  3EZS A;  3QHX A;  2CFB A;  2OGE A;  3JU7 A;  3CQ5 A;  3FDD A;  3EI9 A;  5DX5 A;  5IWQ A;  1MAQ A;  3GBX A;  3F9T A;  3BCB A;  3PDB B;  1ASC A;  5DJ9 A;  1C7O A;  2W7G A;  3MAF A;  4A0G A;  4W5K A;  3A9Z A;  4EU1 A;  2QA3 A;  3P1T A;  1N8P A;  4JEW A;  3G0T A;  4ZDL A;  4WB0 A;  4AOA A;  2AY9 A;  3L8A A;  2EH6 A;  1DJU A;  1M0P A;  3ZZJ A;  4RLG A;  1FG7 A;  4OT8 A;  3ELE A;  1AKA A;  1O69 A;  2W7M A;  1LK9 A;  3RCH A;  2NMP A;  2Z9W A;  5K8B A;  1B5O A;  2ZY5 A;  3CQ4 A;  3QM2 A;  1T3I A;  2HOZ A;  1YIY A;  1KL1 A;  3CBF A;  1OXP A;  4F5M A;  3LWS A;  4O6Z A;  2X3L A;  3VK3 A;  1AIB A;  3MBB A;  4W1V A;  2VMZ A;  1D7R A;  2GMU A;  4R5Z A;  1YOO A;  3EIA A;  3E2Y A;  2ZP7 A;  1ASB A;  4A6T A;  4ZAH A;  1KKP A;  5TF5 A;  2OQX A;  3NUB A;  3NRA A;  3B1E A;  1AY8 A;  3WGC A;  5EIG A;  3AEM A;  4ZM3 A;  4QGR A;  1QIT A;  4JEY A;  3PD6 A;  1WKG A;  2BI5 A;  4ITX A;  4WYE A;  1KMJ A;  1UU1 A;  2D7Z A;  2AY1 A;  3NU7 A;  1UU2 A;  1H1C A;  5G09 A;  3TQX A;  4CBS A;  4MQP A;  3NYU A;  1DGE A;  3USF A;  3DZZ A;  1AKC A;  2AEV A;  2V1P A;  3AAT A;  4F5J A;  2VGZ A;  3RBL A;  3UWC A;  1GEX A;  2PB2 A;  1M32 A;  2HUF A;  1SZS A;  3EI7 A;  3QGU A;  3NYS A;  4GSA A;  4Q75 A;  1ARH A;  4JE5 A;  2W7H A;  2QMA A;  5AX8 A;  1YJS A;  4B98 A;  3K7Y A;  5E3K A;  5M4D A;  2G6W A;  2GMS A;  3M5U A;  4P3M A;  2ZYJ A;  1G4V A;  3LVL B;  2G7J A;  4IXS A;  1OXO A;  2WKA A;  3EZ1 A;  3E2Z A;  1C7G A;  1PMO A;  2E7J A;  2VMR A;  3JW9 A;  3WX9 A;  1BJW A;  3FQA A;  5EUD A;  3NTJ A;  4XK1 A;  5G0A A;  3WCO A;  3ECD A;  2R0T A;  2X8U A;  2VI9 A;  2YKY A;  1E5E A;  4ADB A;  1SF2 A;  3ISL A;  2ZSM A;  1CQ8 A;  4XEW A;  4GEB A;  2VGT A;  4MKJ A;  3WGB A;  5M49 A;  2ZUK A;  3GZD A;  2W8J A;  4I8A A;  2CST A;  2YCP A;  1G4X A;  2E7U A;  1X2A A;  2D7Y A;  2FQ6 A;  1N31 A;  2EO5 A;  3VK4 A;  2CJH A;  4UQV A;  4GRX A;  3FD0 A;  4M2K A;  4RIZ A;  4ADD A;  3LVJ A;  2QB3 A;  4Q31 A;  5F8V A;  2BWO A;  2HOY A;  1ASA A;  1RVU A;  1E5F A;  4P7Y A;  3FZ7 A;  2W8U A;  1OHV A;  4BA5 A;  4U1T A;  2R5C A;  1MDO A;  4AH3 A;  3HVY A;  5LHA A;  1ZOD A;  3AEN B;  2CTZ A;  3QPG A;  1CQ7 A;  3AEJ C;  1IVR A;  4L0O A;  3A8U X;  4M2J A;  3ASB A;  4IXO A;  4RJ0 A;  4ZLV A;  4PVF A;  4RKD A;  3DR7 A;  3PPL A;  1ARI A;  1CJ0 A;  3A2B A;  5G2Q A;  3ZRR A;  3EI8 A;  1DGD A;  1OHY A;  4K2M A;  4LNM A;  1RV3 A;  1IJI A;  4J5U A;  2CH1 A;  2XH1 A;  3FZ8 A;  1G7X A;  3E2Z B;  2D64 A;  1ARS A;  3PA9 A;  4JE5 D;  3HL2 A;  3I16 A;  2C44 A;  4N0B A;  2VLF A;  4Q76 A;  4KXK A;  1IAY A;  1CS1 A;  1TOK A;  4CXR A;  1ZOB A;  4H51 A;  2Z9U A;  2ORD A;  2DGM A;  2VMW A;  4WLJ A;  4RAE A;  4XAU A;  3B1D A;  1XI9 A;  1AAW A;  1I48 A;  4W1W A;  1AMA A;  1MLY A;  3HDO A;  4JF0 A;  1QZ9 A;  1BJN A;  2DKB A;  4WXB A;  1WYT B;  3LVM A;  5EAA A;  2VYC A;  2XBN A;  4R5F A;  1GCK A;  3MKJ A;  3N0L A;  3COG A;  3MAU A;  2KFP A;  2QSR A;  2D61 A;  1AMR A;  2FNU A;  3W1I A;  2Z20 A;  2Z1Z A;  5HHY A;  4JF1 A;  1WYT A;  2Z1Y A;  1GC2 A;  4FL0 A;  1QJ3 A;  2W7L A;  4F5F A;  1ASE A;  4WLH A;  3DRD A;  1UU0 A;  1C4K A;  3HMU A;  4B9B A;  2VMP A;  3G8M A;  3WKR A;  2D5Y A;  3DXW A;  4XJL A;  5HDM A;  2GSA A;  1LW5 A;  4A0H A;  4ZM4 A;  2HOR A;  2Q7W A;  2BWP A;  1B5P A;  1H0C A;  1TOE A;  1DFO A;  2WK9 A;  5EQC A;  2Z9X A;  2JJE A;  4W91 A;  3IF2 A;  5D95 A;  3UAK A;  3FRK A;  2R2N A;  1AJR A;  1GDE A;  2YHK A;  4IW7 A;  1ASN A;  2R5E A;  1V2D A;  5BJ3 A;  1LW4 A;  1CZE A;  2DR1 A;  2VLH A;  4Y0I A;  3ZZK A;  3KGX A;  1D7V A;  3QI6 A;  3JWA A;  1AHG A;  1Z3Z A;  1ASD A;  4MQR A;  5E5I A;  3Q8N A;  3W1J A;  4F4E A;  3WLX A;  4ZDO A;  2VIA A;  3HBX A;  1W7M A;  1W3U A;  1YIZ A;  2BYJ A;  4AZJ A;  3GSB A;  5D5S A;  3NUI A;  1B8G A;  3GZD C;  4EB5 A;  5G4I A;  5EUN A;  4N0W A;  1P3W A;  3KKI A;  3ASA A;  1AKB A;  1ELU A;  3H9X A;  3PDX A;  4OC9 A;  4EFF A;  1V2E A;  1O61 A;  3MEB A;  4E3Q A;  3E6G A;  3FVX A;  4R2N A;  4ISY A;  1YJY A;  4TMR A;  3RI6 A;  3ZRP A;  4A72 A;  3GJU A;  1I43 A;  2O7C A;  1TOJ A;  3HT4 A;  1IX7 A;  3BV0 A;  3RCH B;  3R4T A;  2RFV A;  4CBR A;  5M46 A;  1GC4 A;  3N7N A;  3FKD A;  1S06 A;  1IUG A;  4AO4 A;  2BYL A;  1BS0 A;  4E1O A;  1W7L A;  3F0H A;  1PMM A;  3OP7 A;  3A9X A;  3ATH A;  1ASF A;  1ASM A;  1CQ6 A;  1MDZ A;  1W7N A;  3NX3 A;  1X0M A;  4IY7 A;  4Y0H A;  3K28 A;  1BJ4 A;  2W8W A;  3EI6 A;  4ZDP A;  3W1H A;  1AY4 A;  3RBF A;  3H14 A;  2VMQ A;  4GE9 A;  3N4X A;  8AAT A;  1ASG A;  4FFC A;  3FFH A;  1SPA A;  3EIB A;  4EB7 A;  4WBT A;  3BCX A;  5I92 A;  3K40 A;  3DR4 A;  1VJO A;  4NOG A;  3AEP A;  2FYF A;  2OGA A;  4BQ0 A;  2ZY3 A;  3MAF B;  4IXZ A;  2CH2 A;  4JEX A;  4F5I A;  3T32 A;  4WYA A;  1MGV A;  2R5C B;  2CJG A;  4RIT A;  7AAT A;  1UKJ A;  2AY5 A;  3GET A;  1KMK A;  1JG8 A;  4PFF A;  1AX4 A;  1B9I A;  3VP6 A;  2VGV A;  1OAT A;  3FFR A;  3KE3 A;  3P6K A;  2VMX A;  4K2B A;  2Z61 A;  1PFF A;  4GDY A;  5FT8 A;  3WKS A;  3QN6 A;  4BMK A;  3EUC A;  1KAF A;  2VMT A;  2WK7 A;  4U2H A;  4UOY A;  1N2T A;  2QLR A;  3FZ6 A;  3H7F A;  1J32 A;  2W7J A;  4GE7 A;  4ATP A;  3E77 A;  5E4Z A;  2EYQ A;  3N4S A;  9AAT A;  1I29 A;  1DJ9 A;  2JJH A;  2OKK A;  4IX8 A;  3GWP A;  4PFN A;  2ZY2 A;  4F5K A;  3AEM C;  4ITG A;  3TCM A;  2E7I A;  4RM1 A;  4K2I A;  2CAN A;  3ELP A;  3MAD A;  4A00 A;  4ADC A;  3VAX A;  2JG2 A;  2DOU A;  2BI3 A;  2BI9 A;  2EGY A;  1EG5 A;  2ZSL A;  3D6K A;  3JWB A;  1WYV A;  2YKX A;  1EQB A;  2C81 A;  1C7N A;  2C7T A;  4WD2 A;  1SFF A;  2QB2 A;  1ART A;  1TAS A;  2YCN A;  2W7F A;  3BC8 A;  3GZC A;  3II0 A;  1AHX A;  5KTB A;  1LC8 A;  2WK8 A;  1GD9 A;  1OHW A;  4OYT A;  4TN4 A;  4OBV A;  2WB6 A;  1XEY A;  2C0R A;  3JTX A;  1EJI A;  1IAX A;  4RJY A;  3DYD A;  3E2F A;  1TOG A;  2W8T A;  1SZU A;  3NU8 A;  2VMS A;  2YOB A;  4XJP A;  3LG0 A;  4ZSW A;  4LW4 A;  3AEO A;  2D66 A;  1VEF A;  2DGL A;  3B8X A;  4WYG A;  2HP1 A;  4ZSY A;  1DTY A;  1GEY A;  4BA4 A;  2DKJ A;  1JF9 A;  1GEW A;  1TOI A;  4WXF A;  4H63 Q;  1D2F A;  1LS3 A;  2W7I A;  4CXQ A;  1ARG A;  3N5M A;  1U08 A;  5G2P A;  3GR9 A;  5EIG B;  1AY5 A;  2ZC0 A;  2YRI A;  1GBN A;  1QIS A;  1MDX A;  1C9C A;  2VMN A;  4M2M A;  4Q6R A;  1QJ5 A;  2BIE A;  2D63 A;  3WY7 A;  2YKV A;  2HOX A;  4KYO A;  3FDB A;  5DJ1 A;  2VIB A;  1LC5 A;  1RVY A;  4WYC A;  1AAM A;  1YJZ A;  3CQ6 A;  1Z7D A;  2HP2 A;  2VGS A;  4F5G A;  1KL2 A;  1WYU B;  2BI2 A;  1S07 A;  1AIA A;  3L44 A;  1ORD A;  3MC6 C;  3TFT A;  4IYO B;  1BKG A;  2W8V A;  4HF8 A;  1JS6 A;  2O0R A;  4KAM A;  4OBU A;  2O1B A;  4UHM A;  3ACZ A;  3AEJ A;  2HZP A; 
#chains in the Genus database with same CATH homology
 2EZ1 A;  4XJM A;  3PJ0 A;  3BWN C;  1BQD A;  4OCA A;  1FG3 A;  1AMQ A;  1RV4 A;  1WST A;  4ZAS A;  2X5D A;  3DXV A;  2YCT A;  4UHO A;  4EMY A;  5EAV A;  1O62 A;  1FC4 A;  3FTB A;  2HUU A;  3I4J A;  1KKJ A;  1S08 A;  5JAY A;  1TAT A;  2F8J A;  1AHE A;  3NDN A;  1M0N A;  3N4R A;  1W23 A;  2OKJ A;  1V72 A;  3LV2 A;  3FQ8 A;  4DBC A;  2HUI A;  2PB0 A;  4E77 A;  5FT6 A;  1C0N A;  1ELQ A;  2GQN A;  1BW0 A;  3OKS A;  1M4N A;  1TAR A;  1QIR A;  2VMV A;  1X28 A;  5DB5 A;  5F9S A;  4K05 A;  2JJG A;  4LW2 A;  4OMA A;  1Y4I A;  4CVQ A;  5J8Q A;  3JZL A;  1ZC9 A;  2D65 A;  4PIW A;  4A6R A;  2CIN A;  1CZC A;  2E54 A;  3R9A A;  2ZY4 A;  1CL1 A;  1GC0 A;  1PG8 A;  1TPL A;  4ZWV A;  2FNI A;  3EI5 A;  3AEL A;  2FKI A;  3PD6 B;  2AY4 A;  1GC3 A;  1DKA A;  1M0Q A;  1ASL A;  3VOM A;  1AIC A;  2EZ2 A;  4MY5 A;  3RQ1 A;  2W7E A;  2A1V A;  2DGK A;  2VMU A;  3AV7 A;  2VMY A;  4DGT A;  3AEN A;  2ZJG A;  1BJO B;  3NYT A;  2BWN A;  5EUE A;  4ZWM A;  3I5T A;  2JJF A;  2VMO A;  1B9H A;  2AAT A;  5FT5 A;  4WP0 A;  4A6U A;  4HVK A;  4W8I A;  1V2F A;  4WYD A;  3BN1 A;  4A0R A;  4DQ6 A;  3PAA A;  3HQT A;  4MKK A;  4E3R A;  3BB8 A;  1D7S A;  1B4X A;  2CJD A;  4F5L A;  2AY7 A;  5FT4 A;  2V0Y A;  4J8L A;  3A9Y A;  2GB3 A;  2YRR A;  1AJS A;  1SZK A;  3BCA A;  2BKW A;  3FVU A;  3WCN A;  1SVV A;  2PO3 A;  4RKC A;  3B46 A;  1AMS A;  3AOW A;  4XQ2 A;  3FQ7 A;  5M4B A;  4WXG A;  1MAP A;  3BS8 A;  3E9K A;  1BQA A;  3VK2 A;  4MQQ A;  1G7W A;  2X5F A;  5LH9 A;  4LC3 A;  4JEV A;  3BWN A;  3TAT A;  4MGR A;  3G7Q A;  3DC1 A;  2BI1 A;  3RUY A;  1S0A A;  3FSL A;  3PDB A;  4A0F A;  2VI8 A;  2TPL A;  3N75 A;  2AY3 A;  4MSO A;  4ADE A;  1M0O A;  4AZK A;  3FVS A;  3CAI A;  1I41 A;  1WYU A;  1ECX A;  1IX8 A;  2AY8 A;  4UHN A;  1D7U A;  1IX6 A;  1J04 A;  1YNU A;  3NNK A;  2Z9V A;  3PIU A;  5C6U A;  1AJS B;  3WZF A;  2AY2 A;  1WYV B;  2W7D A;  5G4J A;  4F5H A;  2YKU A;  4WYF A;  2W7K A;  1WKH A;  4LNL A;  2CY8 A;  1CL2 A;  2AY6 A;  2BHX A;  4OTL A;  4WB0 B;  5HXX A;  4AO9 A;  4ATQ A;  2VGW A;  3BWO A;  2OAT A;  3IHJ A;  1LKC A;  3ZRQ A;  1MLZ A;  2Z67 A;  1YAA A;  4XJO A;  2JIS A;  1S09 A;  2CB1 A;  1IBJ A;  2VGU A;  3AOV A;  4IYO A;  3DU4 A;  2FN6 A;  2BIA A;  3F6T A;  1AHF A;  4W1X A;  3UE8 A;  4R8D A;  4GE4 A;  1O4S A;  1BT4 A;  3KGW A;  3QBO A;  2EPJ A;  3TFU A;  4Y0D A;  4LNJ A;  3B1C A;  4BHD A;  1VP4 A;  1LC7 A;  1M6S A;  3DOD A;  3MC6 A;  3FCR A;  1JS3 A;  3PGY A;  2AEU A;  1X29 A;  1AHY A;  5BJ4 A;  3HLM A;  3LVK A;  1DJE A;  3LY1 A;  5EFS A;  2BIG A;  1BJO A;  4JEZ A;  2FM1 A;  1M7Y A;  1QGN A;  2JGT A;  2QBT A;  4TV7 A;  3EZS A;  3QHX A;  2CFB A;  2OGE A;  3JU7 A;  3CQ5 A;  3FDD A;  3EI9 A;  5DX5 A;  5IWQ A;  1MAQ A;  3GBX A;  3F9T A;  3BCB A;  3PDB B;  1ASC A;  5DJ9 A;  1C7O A;  2W7G A;  3MAF A;  4A0G A;  4W5K A;  3A9Z A;  4EU1 A;  2QA3 A;  3P1T A;  1N8P A;  4JEW A;  3G0T A;  4ZDL A;  4WB0 A;  4AOA A;  2AY9 A;  3L8A A;  2EH6 A;  1DJU A;  1M0P A;  3ZZJ A;  4RLG A;  1FG7 A;  4OT8 A;  3ELE A;  1AKA A;  1O69 A;  2W7M A;  1LK9 A;  3RCH A;  2NMP A;  2Z9W A;  5K8B A;  1B5O A;  2ZY5 A;  3CQ4 A;  3QM2 A;  1T3I A;  2HOZ A;  1YIY A;  1KL1 A;  3CBF A;  1OXP A;  4F5M A;  3LWS A;  4O6Z A;  2X3L A;  3VK3 A;  1AIB A;  3MBB A;  4W1V A;  2VMZ A;  1D7R A;  2GMU A;  4R5Z A;  1YOO A;  3EIA A;  3E2Y A;  2ZP7 A;  1ASB A;  4A6T A;  4ZAH A;  1KKP A;  5TF5 A;  2OQX A;  3NUB A;  3NRA A;  3B1E A;  1AY8 A;  3WGC A;  5EIG A;  3AEM A;  4ZM3 A;  4QGR A;  1QIT A;  4JEY A;  3PD6 A;  1WKG A;  2BI5 A;  4ITX A;  4WYE A;  1KMJ A;  1UU1 A;  2D7Z A;  2AY1 A;  3NU7 A;  1UU2 A;  1H1C A;  5G09 A;  3TQX A;  4CBS A;  4MQP A;  3NYU A;  1DGE A;  3USF A;  3DZZ A;  1AKC A;  2AEV A;  2V1P A;  3AAT A;  4F5J A;  2VGZ A;  3RBL A;  3UWC A;  1GEX A;  2PB2 A;  1M32 A;  2HUF A;  1SZS A;  3EI7 A;  3QGU A;  3NYS A;  4GSA A;  4Q75 A;  1ARH A;  4JE5 A;  2W7H A;  2QMA A;  5AX8 A;  1YJS A;  4B98 A;  3K7Y A;  5E3K A;  5M4D A;  2G6W A;  2GMS A;  3M5U A;  4P3M A;  2ZYJ A;  1G4V A;  3LVL B;  2G7J A;  4IXS A;  1OXO A;  2WKA A;  3EZ1 A;  3E2Z A;  1C7G A;  1PMO A;  2E7J A;  2VMR A;  3JW9 A;  3WX9 A;  1BJW A;  3FQA A;  5EUD A;  3NTJ A;  4XK1 A;  5G0A A;  3WCO A;  3ECD A;  2R0T A;  2X8U A;  2VI9 A;  2YKY A;  1E5E A;  4ADB A;  1SF2 A;  3ISL A;  2ZSM A;  1CQ8 A;  4XEW A;  4GEB A;  2VGT A;  4MKJ A;  3WGB A;  5M49 A;  2ZUK A;  3GZD A;  2W8J A;  4I8A A;  2CST A;  2YCP A;  1G4X A;  2E7U A;  1X2A A;  2D7Y A;  2FQ6 A;  1N31 A;  2EO5 A;  3VK4 A;  2CJH A;  4UQV A;  4GRX A;  3FD0 A;  4M2K A;  4RIZ A;  4ADD A;  3LVJ A;  2QB3 A;  4Q31 A;  5F8V A;  2BWO A;  2HOY A;  1ASA A;  1RVU A;  1E5F A;  4P7Y A;  3FZ7 A;  2W8U A;  1OHV A;  4BA5 A;  4U1T A;  2R5C A;  1MDO A;  4AH3 A;  3HVY A;  5LHA A;  1ZOD A;  3AEN B;  2CTZ A;  3QPG A;  1CQ7 A;  3AEJ C;  1IVR A;  4L0O A;  3A8U X;  4M2J A;  3ASB A;  4IXO A;  4RJ0 A;  4ZLV A;  4PVF A;  4RKD A;  3DR7 A;  3PPL A;  1ARI A;  1CJ0 A;  3A2B A;  5G2Q A;  3ZRR A;  3EI8 A;  1DGD A;  1OHY A;  4K2M A;  4LNM A;  1RV3 A;  1IJI A;  4J5U A;  2CH1 A;  2XH1 A;  3FZ8 A;  1G7X A;  3E2Z B;  2D64 A;  1ARS A;  3PA9 A;  4JE5 D;  3HL2 A;  3I16 A;  2C44 A;  4N0B A;  2VLF A;  4Q76 A;  4KXK A;  1IAY A;  1CS1 A;  1TOK A;  4CXR A;  1ZOB A;  4H51 A;  2Z9U A;  2ORD A;  2DGM A;  2VMW A;  4WLJ A;  4RAE A;  4XAU A;  3B1D A;  1XI9 A;  1AAW A;  1I48 A;  4W1W A;  1AMA A;  1MLY A;  3HDO A;  4JF0 A;  1QZ9 A;  1BJN A;  2DKB A;  4WXB A;  1WYT B;  3LVM A;  5EAA A;  2VYC A;  2XBN A;  4R5F A;  1GCK A;  3MKJ A;  3N0L A;  3COG A;  3MAU A;  2KFP A;  2QSR A;  2D61 A;  1AMR A;  2FNU A;  3W1I A;  2Z20 A;  2Z1Z A;  5HHY A;  4JF1 A;  1WYT A;  2Z1Y A;  1GC2 A;  4FL0 A;  1QJ3 A;  2W7L A;  4F5F A;  1ASE A;  4WLH A;  3DRD A;  1UU0 A;  1C4K A;  3HMU A;  4B9B A;  2VMP A;  3G8M A;  3WKR A;  2D5Y A;  3DXW A;  4XJL A;  5HDM A;  2GSA A;  1LW5 A;  4A0H A;  4ZM4 A;  2HOR A;  2Q7W A;  2BWP A;  1B5P A;  1H0C A;  1TOE A;  1DFO A;  2WK9 A;  5EQC A;  2Z9X A;  2JJE A;  4W91 A;  3IF2 A;  5D95 A;  3UAK A;  3FRK A;  2R2N A;  1AJR A;  1GDE A;  2YHK A;  4IW7 A;  1ASN A;  2R5E A;  1V2D A;  5BJ3 A;  1LW4 A;  1CZE A;  2DR1 A;  2VLH A;  4Y0I A;  3ZZK A;  3KGX A;  1D7V A;  3QI6 A;  3JWA A;  1AHG A;  1Z3Z A;  1ASD A;  4MQR A;  5E5I A;  3Q8N A;  3W1J A;  4F4E A;  3WLX A;  4ZDO A;  2VIA A;  3HBX A;  1W7M A;  1W3U A;  1YIZ A;  2BYJ A;  4AZJ A;  3GSB A;  5D5S A;  3NUI A;  1B8G A;  3GZD C;  4EB5 A;  5G4I A;  5EUN A;  4N0W A;  1P3W A;  3KKI A;  3ASA A;  1AKB A;  1ELU A;  3H9X A;  3PDX A;  4OC9 A;  4EFF A;  1V2E A;  1O61 A;  3MEB A;  4E3Q A;  3E6G A;  3FVX A;  4R2N A;  4ISY A;  1YJY A;  4TMR A;  3RI6 A;  3ZRP A;  4A72 A;  3GJU A;  1I43 A;  2O7C A;  1TOJ A;  3HT4 A;  1IX7 A;  3BV0 A;  3RCH B;  3R4T A;  2RFV A;  4CBR A;  5M46 A;  1GC4 A;  3N7N A;  3FKD A;  1S06 A;  1IUG A;  4AO4 A;  2BYL A;  1BS0 A;  4E1O A;  1W7L A;  3F0H A;  1PMM A;  3OP7 A;  3A9X A;  3ATH A;  1ASF A;  1ASM A;  1CQ6 A;  1MDZ A;  1W7N A;  3NX3 A;  1X0M A;  4IY7 A;  4Y0H A;  3K28 A;  1BJ4 A;  2W8W A;  3EI6 A;  4ZDP A;  3W1H A;  1AY4 A;  3RBF A;  3H14 A;  2VMQ A;  4GE9 A;  3N4X A;  8AAT A;  1ASG A;  4FFC A;  3FFH A;  1SPA A;  3EIB A;  4EB7 A;  4WBT A;  3BCX A;  5I92 A;  3K40 A;  3DR4 A;  1VJO A;  4NOG A;  3AEP A;  2FYF A;  2OGA A;  4BQ0 A;  2ZY3 A;  3MAF B;  4IXZ A;  2CH2 A;  4JEX A;  4F5I A;  3T32 A;  4WYA A;  1MGV A;  2R5C B;  2CJG A;  4RIT A;  7AAT A;  1UKJ A;  2AY5 A;  3GET A;  1KMK A;  1JG8 A;  4PFF A;  1AX4 A;  1B9I A;  3VP6 A;  2VGV A;  1OAT A;  3FFR A;  3KE3 A;  3P6K A;  2VMX A;  4K2B A;  2Z61 A;  1PFF A;  4GDY A;  5FT8 A;  3WKS A;  3QN6 A;  4BMK A;  3EUC A;  2VMT A;  2WK7 A;  4U2H A;  4UOY A;  1N2T A;  2QLR A;  3FZ6 A;  3H7F A;  1J32 A;  2W7J A;  4GE7 A;  4ATP A;  3E77 A;  5E4Z A;  2EYQ A;  3N4S A;  9AAT A;  1I29 A;  1DJ9 A;  2JJH A;  2OKK A;  4IX8 A;  3GWP A;  4PFN A;  2ZY2 A;  4F5K A;  3AEM C;  4ITG A;  3TCM A;  2E7I A;  4RM1 A;  4K2I A;  2CAN A;  3ELP A;  3MAD A;  4A00 A;  4ADC A;  3VAX A;  2JG2 A;  2DOU A;  2BI3 A;  2BI9 A;  2EGY A;  1EG5 A;  2ZSL A;  3D6K A;  3JWB A;  1WYV A;  2YKX A;  1EQB A;  2C81 A;  1C7N A;  2C7T A;  4WD2 A;  1SFF A;  2QB2 A;  1ART A;  1TAS A;  2YCN A;  2W7F A;  3BC8 A;  3GZC A;  3II0 A;  1AHX A;  5KTB A;  1LC8 A;  2WK8 A;  1GD9 A;  1OHW A;  4OYT A;  4TN4 A;  4OBV A;  2WB6 A;  1XEY A;  2C0R A;  3JTX A;  1EJI A;  1IAX A;  4RJY A;  3DYD A;  3E2F A;  1TOG A;  2W8T A;  1SZU A;  3NU8 A;  2VMS A;  2YOB A;  4XJP A;  3LG0 A;  4ZSW A;  4LW4 A;  3AEO A;  2D66 A;  1VEF A;  2DGL A;  3B8X A;  4WYG A;  2HP1 A;  4ZSY A;  1DTY A;  1GEY A;  4BA4 A;  2DKJ A;  1JF9 A;  1GEW A;  1TOI A;  4WXF A;  4H63 Q;  1D2F A;  1LS3 A;  2W7I A;  4CXQ A;  1ARG A;  3N5M A;  1U08 A;  5G2P A;  3GR9 A;  5EIG B;  1AY5 A;  2ZC0 A;  2YRI A;  1GBN A;  1QIS A;  1MDX A;  1C9C A;  2VMN A;  4M2M A;  4Q6R A;  1QJ5 A;  2BIE A;  2D63 A;  3WY7 A;  2YKV A;  2HOX A;  4KYO A;  3FDB A;  5DJ1 A;  2VIB A;  1LC5 A;  1RVY A;  4WYC A;  1AAM A;  1YJZ A;  3CQ6 A;  1Z7D A;  2HP2 A;  2VGS A;  4F5G A;  1KL2 A;  1WYU B;  2BI2 A;  1S07 A;  1AIA A;  3L44 A;  1ORD A;  3MC6 C;  3TFT A;  4IYO B;  1BKG A;  2W8V A;  4HF8 A;  1JS6 A;  2O0R A;  4KAM A;  4OBU A;  2O1B A;  4UHM A;  3ACZ A;  3AEJ A;  2HZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...