4IX8A

Crystal structure of tyrosine aminotransferase from leishmania infantum
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
409
structure length
406
Chain Sequence
b'SFRRIASSKHAQRTLQPLNNLTMKPSRSTKSNLRLSIGDPTVDGNLKTPDIVTEAMVDVVRSGKFNGYPPTVGADNLRQVVSTYWRRFCQTKSRQEALKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFDTNVPRLILGGTAYQVCPGWRVGWSILIDPMNVAGDWAVGMERLTQLIAGVNSICQEAIARTLLKCPTECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLSYFQDLKSDMEFYEKLLDEENVQVLPGEIFGMSGFLRATVSRPSAVLNEAVDRIIEFCERHKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine aminotransferase
publication title Structure of tyrosine aminotransferase from Leishmania infantum.
pubmed doi rcsb
source organism Leishmania infantum
molecule tags Transferase
total genus 130
structure length 406
sequence length 409
chains with identical sequence B
ec nomenclature ec 2.6.1.5: Tyrosine transaminase.
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4ix8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4ix8A01
2VYCA 3BCXA 3GSBA 3HQTA 4MQPA 1AAMA 2OQXA 2W8UA 4DBCA 4F5MA 1H1CA 3FD0A 4NOGA 2D65A 1FC4A 1MDZA 3G8MA 1YNUA 3WGBA 4A6TA 5G0AA 3E2YA 2YCPA 1MGVA 2W8JA 4WYGA 4EB7A 2WK7A 3GZDA 3I4JA 4ATPA 2HOXA 2ZJGA 3E2ZB 4OYTA 4W8IA 1TOIA 1MLYA 2DR1A 2YRRA 1MLZA 4R8DA 7AATA 1B5PA 1MDXA 2AY5A 2VMXA 2VMZA 2W8VA 1GBNA 4OBUA 1JS3A 2VI9A 3B1DA 1I41A 3ZZKA 1G7XA 4CBSA 2BHXA 2YKUA 4A0FA 1OXOA 2W7IA 5EIGB 2VGUA 4QGRA 4R5ZA 1IUGA 3B46A 3HT4A 3HDOA 1W7MA 4M2KA 4TMRA 1KKJA 1I48A 1YOOA 1TOEA 2OATA 4GE4A 1B9IA 3EIAA 1B9HA 3FDBA 2XBNA 1XI9A 4A72A 2HUUA 1G7WA 4W5KA 4U2HA 4Q31A 4UOYA 1Y4IA 2D61A 3ASBA 1ARIA 1AMAA 3K40A 3PAAA 1UU2A 2EPJA 1ASEA 2VMOA 2DKJA 1GC3A 3KGXA 3WX9A 1TOGA 3NX3A 1G4XA 1ASFA 3R9AA 3WLXA 1CQ8A 4FFCA 4AOAA 2HOYA 4ZASA 1AIAA 1QZ9A 1I29A 3VK3A 2CJGA 3IF2A 2BWOA 2VLHA 4F5LA 2AY7A 1KL1A 2Z9VA 3AV7A 2O0RA 5TF5A 4E77A 2FNUA 1BQAA 2CANA 2BI2A 1X28A 2X3LA 3JWBA 1D7UA 3DODA 2OGEA 3UWCA 1X29A 4AO9A 2W7KA 4TV7A 3TCMA 2E54A 3NU8A 1AKCA 1Z3ZA 2C44A 1GDEA 4E1OA 2CINA 4F5JA 2E7JA 2YCTA 2FYFA 4GEBA 2WKAA 2JJEA 1VP4A 2VMVA 4BMKA 2W8WA 1ZOBA 4RIZA 3ZRPA 2ZY2A 2YOBA 1SZKA 3MC6A 4BA4A 2VMTA 1AKBA 3N5MA 4ZWMA 1AMQA 3BWOA 2W7JA 3PDXA 1C0NA 3H7FA 5EFSA 3JU7A 1V2FA 2V1PA 2HP2A 1PFFA 3NDNA 5M4BA 1AHYA 2RFVA 2QMAA 4MQRA 4K2IA 2QB3A 4EU1A 4JEXA 2R5CA 2D63A 3QI6A 2D5YA 3FZ7A 4XJOA 2GB3A 2PB2A 1WSTA 2Z61A 3MKJA 2FM1A 2W7DA 4WBTA 3A8UX 1GC0A 2FN6A 2VMWA 2W7HA 1OATA 1YJSA 2BIEA 5BJ3A 2C7TA 2OGAA 1AIBA 4OBVA 3FTBA 1JG8A 4MY5A 3FFHA 5G2QA 4BHDA 3BWNA 2GMSA 4ZSWA 1CQ6A 1MAPA 1YIZA 1E5EA 3VK2A 2EZ1A 3E9KA 4B9BA 4WYFA 2QB2A 1J04A 3RI6A 3ZRQA 3EUCA 3EI8A 3FSLA 2R5CB 1JS6A 3MAFA 3HBXA 4Y0IA 1M4NA 3ACZA 3NYTA 2G6WA 3L8AA 2BWNA 4IY7A 3A9ZA 1D7VA 3FRKA 2YCNA 1IBJA 1AJRA 3ASAA 3FFRA 2ZY3A 4WXBA 1AHEA 1LK9A 1BJOA 2Z1YA 3E2FA 3AEMA 4LNMA 1LW5A 1S07A 3WY7A 1WYVA 1N31A 1RVYA 1YIYA 3PJ0A 3M5UA 1EQBA 3N0LA 3CQ4A 2VGZA 4DQ6A 1RV4A 2VGWA 3FVUA 4F5GA 2AY8A 3P1TA 3FCRA 4WB0A 3DR7A 5JAYA 4ITGA 3RCHA 3ZZJA 1OXPA 4HF8A 1AJSA 2AEVA 2VMYA 3WGCA 4XJMA 3LY1A 3ELPA 1ORDA 4B98A 2HOZA 2JJGA 4WXGA 2AY3A 4A00A 3WKRA 5D95A 4F5HA 1KMJA 3LV2A 1C4KA 3MBBA 2GQNA 3USFA 4ATQA 1ELQA 3GJUA 4N0BA 2E7UA 2D7ZA 4ITXA 2Z9UA 1C7OA 3EZ1A 3PPLA 3TATA 3F9TA 3HL2A 1O4SA 3F6TA 1QIRA 2DGMA 3BS8A 3IHJA 3R4TA 1VEFA 4HVKA 4JEZA 4ZLVA 3RCHB 2X5DA 4MQQA 3T32A 2OKJA 3FZ8A 2HUIA 5FT4A 1ASNA 4UHMA 3MEBA 3VK4A 3AENA 3I16A 5EAAA 5C6UA 1BT4A 3VP6A 2AY6A 2QBTA 1EG5A 3LVMA 5E4ZA 1BKGA 1AKAA 3NYUA 1ZC9A 4W1XA 3HMUA 4P3MA 3AOVA 3FVSA 4ADDA 3UE8A 1D2FA 1SFFA 4U1TA 5G09A 3DXWA 3FKDA 3BB8A 2TPLA 4CXQA 2EO5A 4RAEA 5HHYA 1X2AA 1M7YA 2Z9WA 3GZCA 3GBXA 4XJLA 1Z7DA 1OHVA 1CL2A 3DR4A 2EZ2A 1WYTA 1SZUA 3PDBA 2W7MA 4A0RA 4GE7A 3BC8A 1M0PA 1M32A 1V72A 1W7NA 3DXVA 1JF9A 3N75A 3NRAA 4OCAA 4Q6RA 2W7LA 5HXXA 2Z67A 2F8JA 4JE5A 1MDOA 2NMPA 2BYLA 3AENB 2YKXA 3AELA 3DU4A 3EI9A 2VGVA 4J5UA 1LC5A 4PFNA 4RM1A 1BS0A 1ASBA 3FVXA 2JGTA 3AOWA 1AMSA 4XEWA 1D7RA 1LC7A 2YKVA 2VMRA 2C0RA 2DOUA 2CY8A 4H51A 3BCBA 2CTZA 2VLFA 3JTXA 3EI6A 3G0TA 3PA9A 4WYDA 5E5IA 2E7IA 3LVJA 4M2JA 3TFTA 3ISLA 3KGWA 2ZUKA 4W91A 3FDDA 2X8UA 2W8TA 4AH3A 1TATA 1AMRA 3PIUA 1AY5A 5EQCA 1B5OA 3DZZA 3QPGA 4WLHA 2ZSLA 2EGYA 3RQ1A 1AICA 4CVQA 5EUEA 1DJ9A 5DJ9A 4ZDOA 4OT8A 1TASA 2WK8A 4LNLA 4WLJA 4WXFA 2CH1A 1KL2A 3CQ5A 3QGUA 1B8GA 4F4EA 1XEYA 1S08A 1WYUA 3E77A 4AZJA 2XH1A 4M2MA 4ZM3A 4GRXA 1SVVA 3NTJA 1AX4A 1CL1A 2R5EA 4A0HA 5G2PA 3WCOA 4IX8A 4Y0HA 1KMKA 2Z20A 1E5FA 1YAAA 1CS1A 1X0MA 1TOKA 1GC2A 1W3UA 3EI7A 2W7GA 1ARGA 2V0YA 3DC1A 3II0A 3UAKA 2BWPA 1GD9A 1AAWA 4OC9A 3P6KA 5FT6A 1FG3A 2PB0A 3AEPA 1V2DA 4KXKA 3TFUA 2Z9XA 1YJYA 3CBFA 3LG0A 2YKYA 2GSAA 4RJ0A 1G4VA 3AATA 3VAXA 4PFFA 5E3KA 3A9XA 1I43A 1M0QA 4J8LA 3DRDA 4GSAA 3HVYA 4PVFA 2HUFA 4XK1A 1M6SA 3COGA 5G4IA 1S09A 3QM2A 4FL0A 1OHYA 4ZWVA 4K2BA 1WKHA 3K7YA 2DKBA 4F5IA 3MADA 4WYEA 4LC3A 3NNKA 4Y0DA 5FT5A 3BWNC 3K28A 2DGLA 3E2ZA 2JJHA 4A6UA 4ZSYA 5M4DA 2BIAA 2YHKA 3AEJC 4MSOA 4JEYA 1C7GA 4Q76A 1IX7A 2O1BA 3JW9A 3ZRRA 1ASGA 1C7NA 3EZSA 4DGTA 1LC8A 2ZSMA 1ASMA 1YJZA 2ORDA 2VIAA 1BW0A 3MAFB 4RLGA 2CJDA 2W7FA 4XJPA 4LW4A 5EUNA 1IX8A 3H14A 4ISYA 4L0OA 2FQ6A 3OKSA 2ZC0A 4W1VA 3WCNA 5LH9A 3TQXA 2DGKA 2R0TA 4CXRA 1KKPA 3AEMC 2AY2A 2BKWA 4RKDA 1DGEA 1PG8A 3ATHA 1BJOB 2EH6A 1UKJA 1AHXA 3F0HA 3D6KA 4K2MA 5HDMA 3B1EA 1BJNA 1AY4A 2JISA 4MKKA 1WYVB 5IWQA 1H0CA 3GZDC 3NYSA 4XQ2A 4F5FA 1BQDA 1CJ0A 4PIWA 5I92A 1TARA 1ASDA 8AATA 1MAQA 2D66A 5M46A 1LS3A 4UHNA 3LVKA 3NUIA 1DJEA 3L44A 3E6GA 3GWPA 2D64A 4WB0B 4E3QA 1ECXA 2OKKA 3PD6A 1AJSB 3DYDA 1LKCA 1UU1A 1N8PA 1ARSA 2HP1A 4GDYA 4GE9A 4RJYA 4RITA 4AZKA 4JF0A 5EUDA 3A2BA 4KAMA 1IJIA 1O62A 4BQ0A 2VIBA 1LW4A 5J8QA 4ADBA 4UQVA 2VMNA 4IW7A 3JWAA 1WKGA 1T3IA 3WKSA 4MKJA 1O69A 3WZFA 4BA5A 2VMPA 4ZAHA 1BJ4A 3FQ7A 1DKAA 2AY9A 1BJWA 1IAYA 3FZ6A 1ELUA 4XAUA 3CAIA 3NU7A 4WYAA 1M0NA 1W23A 1QITA 3GR9A 3A9YA 1W7LA 2X5FA 4WYCA 3PD6B 1QGNA 1SPAA 4A0GA 3LVLB 4F5KA 3ECDA 1QJ3A 2VI8A 1TOJA 1DFOA 1ASAA 1CZCA 2BI9A 5EAVA 1DTYA 2BI5A 2O7CA 3JZLA 5FT8A 1FG7A 1ZODA 2W7EA 3B1CA 4O6ZA 2CSTA 4ZDLA 1AHGA 4RKCA 3PGYA 4R2NA 5F8VA 3W1JA 2VGTA 1S0AA 4E3RA 3LWSA 2BYJA 2QLRA 1ASCA 1ARHA 1WYTB 2VMUA 3PDBB 3W1IA 1O61A 3FQ8A 1V2EA 1SZSA 1IVRA 4EMYA 3AEOA 1OHWA 3HLMA 2VMQA 4N0WA 2AY4A 4ZM4A 2GMUA 1GEXA 2YRIA 1PMMA 1M0OA 5DX5A 1IX6A 2CFBA 4ZDPA 1ARTA 3Q8NA 4ADCA 2QA3A 3KE3A 3QHXA 3MC6C 4I8AA 4JE5D 4R5FA 3G7QA 3RBFA 1C9CA 5F9SA 2JJFA 2R2NA 2CH2A 1S06A 1TPLA 2BI3A 2VMSA 3BV0A 5BJ4A 2BIGA 4WD2A 3GETA 2FNIA 4IYOA 4IXSA 4EB5A 2ZY5A 2Z1ZA 3EI5A 1U08A 1PMOA 3FQAA 3MAUA 9AATA 3OP7A 4TN4A 4CBRA 4P7YA 2AEUA 4KYOA 4W1WA 2VGSA 3BN1A 4OTLA 3W1HA 1N2TA 1DJUA 4LNJA 4Q75A 1QJ5A 3QBOA 1J32A 1UU0A 3EIBA 4OMAA 5DJ1A 2WK9A 3I5TA 4AO4A 2CJHA 1GC4A 3KKIA 4IXZA 1WYUB 4A6RA 5DB5A 3VOMA 3CQ6A 1CQ7A 3ELEA 2Q7WA 2HORA 4EFFA 1RVUA 3RBLA 2HZPA 1IAXA 4JEVA 2C81A 1DGDA 1QISA 5D5SA 3B8XA 1SF2A 4IYOB 1GCKA 2D7YA 4ADEA 3NUBA 4IXOA 1B4XA 4UHOA 5M49A 5AX8A 3AEJA 1ASLA 4JEWA 4WP0A 2BI1A 4JF1A 2CB1A 4LW2A 4MGRA 2ZY4A 3BCAA 3RUYA 2AY1A 2ZP7A 1D7SA 1CZEA 1P3WA 2JG2A 3QN6A 5G4JA 1EJIA 1AY8A 2AATA 1VJOA 2PO3A 1AHFA 1GEYA 5EIGA 5K8BA 5LHAA 1RV3A 2ZYJA 1GEWA
chains in the Genus database with same CATH superfamily
2VYCA 3BCXA 3GSBA 3HQTA 4MQPA 1AAMA 2OQXA 2W8UA 4DBCA 4F5MA 2WB6A 1H1CA 3FD0A 4NOGA 2D65A 1FC4A 1MDZA 3G8MA 1YNUA 3WGBA 4A6TA 5G0AA 3E2YA 2YCPA 1MGVA 2W8JA 4WYGA 4EB7A 2WK7A 3GZDA 3I4JA 4ATPA 2HOXA 2ZJGA 3E2ZB 4OYTA 4W8IA 1TOIA 1MLYA 2DR1A 2YRRA 1MLZA 4R8DA 7AATA 1B5PA 1MDXA 2AY5A 2VMXA 2VMZA 2W8VA 1GBNA 4OBUA 1JS3A 2VI9A 3B1DA 1I41A 3N4XA 3ZZKA 1G7XA 4CBSA 2BHXA 2YKUA 4A0FA 1OXOA 2W7IA 5EIGB 2VGUA 4QGRA 4R5ZA 1IUGA 3B46A 3HT4A 3HDOA 1W7MA 4M2KA 4TMRA 1KKJA 1I48A 1YOOA 1TOEA 2OATA 4GE4A 1B9IA 3EIAA 1B9HA 3FDBA 2XBNA 1XI9A 4A72A 2HUUA 1G7WA 4W5KA 4U2HA 4Q31A 4UOYA 1Y4IA 2D61A 3ASBA 1ARIA 1AMAA 3K40A 3PAAA 1UU2A 2EPJA 1ASEA 2VMOA 2DKJA 1GC3A 3KGXA 3WX9A 1TOGA 3NX3A 1G4XA 1ASFA 3R9AA 3WLXA 3N4RA 1CQ8A 4FFCA 4AOAA 2HOYA 4ZASA 1AIAA 1QZ9A 1I29A 3VK3A 2CJGA 3IF2A 2BWOA 2VLHA 2QSRA 4F5LA 2AY7A 1KL1A 2Z9VA 3AV7A 2O0RA 5TF5A 4E77A 2FNUA 1BQAA 2CANA 2BI2A 1X28A 2X3LA 3JWBA 1D7UA 3DODA 2OGEA 3UWCA 1X29A 4AO9A 2W7KA 4TV7A 3TCMA 2E54A 3NU8A 1AKCA 1Z3ZA 2C44A 1GDEA 4E1OA 2CINA 4F5JA 2E7JA 2YCTA 2FYFA 4GEBA 2WKAA 2JJEA 1VP4A 2VMVA 4BMKA 2W8WA 1ZOBA 4RIZA 3ZRPA 2ZY2A 2YOBA 1SZKA 3MC6A 2A1VA 4BA4A 2VMTA 2FKIA 1AKBA 3N5MA 4ZWMA 1AMQA 3BWOA 2W7JA 3PDXA 1C0NA 3H7FA 5EFSA 3JU7A 1V2FA 2V1PA 2HP2A 1PFFA 3NDNA 5M4BA 1AHYA 2RFVA 2QMAA 4MQRA 4K2IA 2QB3A 4EU1A 4JEXA 2R5CA 2D63A 3QI6A 2D5YA 3FZ7A 4XJOA 2GB3A 2PB2A 1WSTA 2Z61A 3MKJA 2FM1A 2W7DA 4WBTA 3A8UX 1GC0A 2FN6A 2VMWA 2W7HA 1OATA 1YJSA 2BIEA 5BJ3A 2C7TA 2OGAA 1AIBA 4OBVA 3FTBA 1JG8A 4MY5A 3FFHA 5G2QA 4BHDA 3BWNA 2GMSA 4ZSWA 1CQ6A 1MAPA 1YIZA 1E5EA 3VK2A 2EZ1A 3E9KA 4B9BA 4WYFA 2QB2A 1J04A 3RI6A 3ZRQA 3EUCA 3EI8A 3FSLA 2R5CB 1JS6A 3MAFA 3HBXA 4Y0IA 1M4NA 3ACZA 3NYTA 2G6WA 3L8AA 2BWNA 4IY7A 4H63Q 3A9ZA 1D7VA 3FRKA 2YCNA 1IBJA 1AJRA 3ASAA 3FFRA 2G7JA 2ZY3A 4WXBA 1AHEA 1LK9A 1BJOA 2Z1YA 3E2FA 3AEMA 4LNMA 1LW5A 1S07A 3WY7A 1WYVA 1N31A 1RVYA 1YIYA 3PJ0A 3M5UA 1EQBA 3N0LA 3CQ4A 2VGZA 4DQ6A 1RV4A 2VGWA 3FVUA 4F5GA 2AY8A 3P1TA 3FCRA 4WB0A 3DR7A 5JAYA 4ITGA 3RCHA 3ZZJA 1OXPA 4HF8A 1AJSA 2AEVA 2VMYA 3WGCA 4XJMA 3LY1A 3ELPA 1ORDA 4B98A 2HOZA 2JJGA 4WXGA 2AY3A 4A00A 3WKRA 5D95A 4F5HA 1KMJA 3LV2A 1C4KA 3MBBA 2GQNA 3USFA 4ATQA 1ELQA 3GJUA 4N0BA 2E7UA 2D7ZA 4ITXA 2Z9UA 1C7OA 3EZ1A 3PPLA 3TATA 3F9TA 3HL2A 1O4SA 3F6TA 1QIRA 2DGMA 3BS8A 3IHJA 3R4TA 1VEFA 4HVKA 4JEZA 4ZLVA 3RCHB 2X5DA 4MQQA 3T32A 2OKJA 3FZ8A 2HUIA 5FT4A 1ASNA 4UHMA 3MEBA 3VK4A 3AENA 3I16A 5EAAA 5C6UA 1BT4A 3VP6A 2AY6A 1KAFA 2QBTA 1EG5A 3LVMA 5E4ZA 1BKGA 1AKAA 3NYUA 1ZC9A 4W1XA 3HMUA 4P3MA 3AOVA 3FVSA 4ADDA 3UE8A 1D2FA 1SFFA 4U1TA 5G09A 3DXWA 3FKDA 3BB8A 2TPLA 4CXQA 2EO5A 4RAEA 5HHYA 1X2AA 1M7YA 2Z9WA 3GZCA 3GBXA 4XJLA 1Z7DA 1OHVA 1CL2A 3DR4A 2EZ2A 1WYTA 1SZUA 3PDBA 2W7MA 4A0RA 4GE7A 3BC8A 1M0PA 1M32A 1V72A 1W7NA 3DXVA 1JF9A 3N75A 3NRAA 4OCAA 4Q6RA 2W7LA 5HXXA 2Z67A 2F8JA 4JE5A 1MDOA 2NMPA 2BYLA 3AENB 2YKXA 3AELA 3DU4A 3EI9A 2VGVA 4J5UA 1LC5A 4PFNA 4RM1A 1BS0A 1ASBA 3FVXA 2JGTA 3AOWA 1AMSA 4XEWA 1D7RA 1LC7A 2YKVA 2VMRA 2C0RA 2DOUA 2CY8A 4H51A 3BCBA 2CTZA 2VLFA 3JTXA 3EI6A 3G0TA 3PA9A 4WYDA 5E5IA 2E7IA 3LVJA 4M2JA 3TFTA 3ISLA 3KGWA 2ZUKA 4W91A 3FDDA 2X8UA 2W8TA 4AH3A 1TATA 1AMRA 3PIUA 1AY5A 5EQCA 1B5OA 3DZZA 3QPGA 4WLHA 2ZSLA 2EGYA 3RQ1A 1AICA 4CVQA 5EUEA 1DJ9A 5DJ9A 4ZDOA 4OT8A 1TASA 2WK8A 4LNLA 4WLJA 4WXFA 2CH1A 1KL2A 3CQ5A 3QGUA 1B8GA 4F4EA 1XEYA 5KTBA 1S08A 1WYUA 3E77A 4AZJA 2XH1A 4M2MA 4ZM3A 4GRXA 1SVVA 3NTJA 1AX4A 1CL1A 2R5EA 4A0HA 5G2PA 3WCOA 4IX8A 4Y0HA 1KMKA 2Z20A 1E5FA 1YAAA 1CS1A 1X0MA 1TOKA 1GC2A 1W3UA 3EI7A 2W7GA 1ARGA 2V0YA 3DC1A 3II0A 3UAKA 2BWPA 1GD9A 1AAWA 4OC9A 3P6KA 5FT6A 1FG3A 2PB0A 3AEPA 1V2DA 4KXKA 3TFUA 2Z9XA 1YJYA 3CBFA 3LG0A 2YKYA 2GSAA 4RJ0A 1G4VA 3H9XA 3AATA 3VAXA 4PFFA 5E3KA 3A9XA 1I43A 1M0QA 4J8LA 3DRDA 4GSAA 3HVYA 4PVFA 2HUFA 4XK1A 1M6SA 3COGA 5G4IA 2EYQA 1S09A 3QM2A 4FL0A 1OHYA 4ZWVA 4K2BA 1WKHA 3K7YA 2DKBA 4F5IA 3MADA 4WYEA 4LC3A 3NNKA 4Y0DA 5FT5A 3BWNC 3K28A 2DGLA 3E2ZA 2JJHA 4A6UA 4ZSYA 5M4DA 2BIAA 2YHKA 3AEJC 4MSOA 4JEYA 1C7GA 4Q76A 1IX7A 2O1BA 3JW9A 3ZRRA 1ASGA 1C7NA 3EZSA 4DGTA 1LC8A 2ZSMA 1ASMA 1YJZA 2ORDA 2VIAA 1BW0A 3MAFB 4RLGA 2CJDA 2W7FA 4XJPA 4LW4A 5EUNA 1IX8A 3H14A 4ISYA 4L0OA 2FQ6A 3OKSA 2ZC0A 4W1VA 3WCNA 5LH9A 3TQXA 2DGKA 2R0TA 4CXRA 1KKPA 3AEMC 2AY2A 2BKWA 4RKDA 1DGEA 1PG8A 3ATHA 1BJOB 2EH6A 1UKJA 1AHXA 3F0HA 3D6KA 4K2MA 5HDMA 3B1EA 1BJNA 1AY4A 2JISA 4MKKA 1WYVB 5IWQA 1H0CA 3GZDC 3NYSA 4XQ2A 4F5FA 1BQDA 1CJ0A 4PIWA 5I92A 1TARA 1ASDA 8AATA 1MAQA 2D66A 5M46A 1LS3A 4K05A 4UHNA 3N7NA 3LVKA 3NUIA 1DJEA 3L44A 3E6GA 3GWPA 2D64A 4WB0B 4E3QA 1ECXA 2OKKA 3PD6A 1AJSB 3DYDA 1LKCA 1UU1A 1N8PA 1ARSA 2HP1A 4GDYA 4GE9A 4RJYA 4RITA 4AZKA 4JF0A 5EUDA 3A2BA 4KAMA 1IJIA 1O62A 4BQ0A 2VIBA 1LW4A 5J8QA 4ADBA 4UQVA 2VMNA 4IW7A 3JWAA 1WKGA 1T3IA 3WKSA 4MKJA 1O69A 3WZFA 4BA5A 2VMPA 4ZAHA 1BJ4A 3FQ7A 1DKAA 2AY9A 1BJWA 1IAYA 3FZ6A 1ELUA 4XAUA 3CAIA 3NU7A 4WYAA 1M0NA 1W23A 1QITA 3GR9A 3A9YA 1W7LA 2X5FA 4WYCA 3PD6B 1QGNA 1SPAA 4A0GA 3LVLB 4F5KA 3ECDA 1QJ3A 2VI8A 1TOJA 1DFOA 1ASAA 1CZCA 2BI9A 5EAVA 1DTYA 2BI5A 2O7CA 3JZLA 5FT8A 1FG7A 1ZODA 2W7EA 3B1CA 4O6ZA 2CSTA 4ZDLA 1AHGA 4RKCA 3PGYA 4R2NA 5F8VA 3W1JA 2VGTA 1S0AA 4E3RA 3LWSA 2BYJA 2QLRA 1ASCA 1ARHA 1WYTB 2VMUA 3PDBB 3W1IA 1O61A 3FQ8A 1V2EA 1SZSA 1IVRA 4EMYA 3AEOA 1OHWA 3HLMA 2VMQA 4N0WA 2AY4A 4ZM4A 2GMUA 1GEXA 2YRIA 1PMMA 1M0OA 5DX5A 1IX6A 2CFBA 4ZDPA 1ARTA 3Q8NA 4ADCA 2QA3A 3KE3A 3QHXA 3MC6C 4I8AA 4JE5D 4R5FA 3G7QA 3RBFA 1C9CA 5F9SA 2JJFA 2R2NA 2CH2A 1S06A 1TPLA 2BI3A 2VMSA 3BV0A 5BJ4A 2BIGA 4WD2A 3GETA 2FNIA 4IYOA 4IXSA 4EB5A 2ZY5A 2Z1ZA 3EI5A 1U08A 1PMOA 3FQAA 3MAUA 9AATA 3OP7A 4TN4A 4CBRA 4P7YA 2AEUA 4KYOA 4W1WA 2VGSA 3BN1A 2KFPA 4OTLA 3W1HA 1N2TA 1DJUA 4LNJA 4Q75A 1QJ5A 3QBOA 1J32A 1UU0A 3EIBA 4OMAA 5DJ1A 2WK9A 3I5TA 4AO4A 2CJHA 1GC4A 3KKIA 4IXZA 1WYUB 4A6RA 5DB5A 3VOMA 3CQ6A 1CQ7A 3ELEA 2Q7WA 2HORA 4EFFA 1RVUA 3RBLA 2HZPA 1IAXA 4JEVA 2C81A 1DGDA 1QISA 5D5SA 3B8XA 1SF2A 4IYOB 1GCKA 2D7YA 4ADEA 3NUBA 4IXOA 1B4XA 4UHOA 5M49A 5AX8A 3N4SA 3AEJA 1ASLA 4JEWA 4WP0A 2BI1A 4JF1A 2CB1A 4LW2A 4MGRA 2ZY4A 3BCAA 3RUYA 2AY1A 2ZP7A 1D7SA 1CZEA 1P3WA 2JG2A 3QN6A 5G4JA 1EJIA 1AY8A 2AATA 1VJOA 2PO3A 1AHFA 1GEYA 5EIGA 5K8BA 5LHAA 1RV3A 2ZYJA 1GEWA
chains in the Genus database with same CATH topology
2VYCA 3BCXA 3GSBA 3HQTA 4MQPA 1AAMA 2OQXA 2W8UA 4DBCA 4F5MA 2WB6A 1H1CA 3FD0A 4NOGA 2D65A 1FC4A 1MDZA 3G8MA 1YNUA 3WGBA 4A6TA 5G0AA 3E2YA 2YCPA 1MGVA 2W8JA 4WYGA 4EB7A 2WK7A 3GZDA 3I4JA 4ATPA 2HOXA 2ZJGA 3E2ZB 4OYTA 4W8IA 1TOIA 1MLYA 2DR1A 2YRRA 1MLZA 4R8DA 7AATA 1B5PA 1MDXA 2AY5A 2VMXA 2VMZA 2W8VA 1GBNA 4OBUA 1JS3A 2VI9A 3B1DA 1I41A 3N4XA 3ZZKA 1G7XA 4CBSA 2BHXA 2YKUA 4A0FA 1OXOA 2W7IA 5EIGB 2VGUA 4QGRA 4R5ZA 1IUGA 3B46A 3HT4A 3HDOA 1W7MA 4M2KA 4TMRA 1KKJA 1I48A 1YOOA 1TOEA 2OATA 4GE4A 1B9IA 3EIAA 1B9HA 3FDBA 2XBNA 1XI9A 4A72A 2HUUA 1G7WA 4W5KA 4U2HA 4Q31A 4UOYA 1Y4IA 2D61A 3ASBA 1ARIA 1AMAA 3K40A 3PAAA 1UU2A 2EPJA 1ASEA 2VMOA 2DKJA 1GC3A 3KGXA 3WX9A 1TOGA 3NX3A 1G4XA 1ASFA 3R9AA 3WLXA 3N4RA 1CQ8A 4FFCA 4AOAA 2HOYA 4ZASA 1AIAA 1QZ9A 1I29A 3VK3A 2CJGA 3IF2A 2BWOA 2VLHA 2QSRA 4F5LA 2AY7A 1KL1A 2Z9VA 3AV7A 2O0RA 5TF5A 4E77A 2FNUA 1BQAA 2CANA 2BI2A 1X28A 2X3LA 3JWBA 1D7UA 3DODA 2OGEA 3UWCA 1X29A 4AO9A 2W7KA 4TV7A 3TCMA 2E54A 3NU8A 1AKCA 1Z3ZA 2C44A 1GDEA 4E1OA 2CINA 4F5JA 2E7JA 2YCTA 2FYFA 4GEBA 2WKAA 2JJEA 1VP4A 2VMVA 4BMKA 2W8WA 1ZOBA 4RIZA 3ZRPA 2ZY2A 2YOBA 1SZKA 3MC6A 2A1VA 4BA4A 2VMTA 2FKIA 1AKBA 3N5MA 4ZWMA 1AMQA 3BWOA 2W7JA 3PDXA 1C0NA 3H7FA 5EFSA 3JU7A 1V2FA 2V1PA 2HP2A 1PFFA 3NDNA 5M4BA 1AHYA 2RFVA 2QMAA 4MQRA 4K2IA 2QB3A 4EU1A 4JEXA 2R5CA 2D63A 3QI6A 2D5YA 3FZ7A 4XJOA 2GB3A 2PB2A 1WSTA 2Z61A 3MKJA 2FM1A 2W7DA 4WBTA 3A8UX 1GC0A 2FN6A 2VMWA 2W7HA 1OATA 1YJSA 2BIEA 5BJ3A 2C7TA 2OGAA 1AIBA 4OBVA 3FTBA 1JG8A 4MY5A 3FFHA 5G2QA 4BHDA 3BWNA 2GMSA 4ZSWA 1CQ6A 1MAPA 1YIZA 1E5EA 3VK2A 2EZ1A 3E9KA 4B9BA 4WYFA 2QB2A 1J04A 3RI6A 3ZRQA 3EUCA 3EI8A 3FSLA 2R5CB 1JS6A 3MAFA 3HBXA 4Y0IA 1M4NA 3ACZA 3NYTA 2G6WA 3L8AA 2BWNA 4IY7A 4H63Q 3A9ZA 1D7VA 3FRKA 2YCNA 1IBJA 1AJRA 3ASAA 3FFRA 2G7JA 2ZY3A 4WXBA 1AHEA 1LK9A 1BJOA 2Z1YA 3E2FA 3AEMA 4LNMA 1LW5A 1S07A 3WY7A 1WYVA 1N31A 1RVYA 1YIYA 3PJ0A 3M5UA 1EQBA 3N0LA 3CQ4A 2VGZA 4DQ6A 1RV4A 2VGWA 3FVUA 4F5GA 2AY8A 3P1TA 3FCRA 4WB0A 3DR7A 5JAYA 4ITGA 3RCHA 3ZZJA 1OXPA 4HF8A 1AJSA 2AEVA 2VMYA 3WGCA 4XJMA 3LY1A 3ELPA 1ORDA 4B98A 2HOZA 2JJGA 4WXGA 2AY3A 4A00A 3WKRA 5D95A 4F5HA 1KMJA 3LV2A 1C4KA 3MBBA 2GQNA 3USFA 4ATQA 1ELQA 3GJUA 4N0BA 2E7UA 2D7ZA 4ITXA 2Z9UA 1C7OA 3EZ1A 3PPLA 3TATA 3F9TA 3HL2A 1O4SA 3F6TA 1QIRA 2DGMA 3BS8A 3IHJA 3R4TA 1VEFA 4HVKA 4JEZA 4ZLVA 3RCHB 2X5DA 4MQQA 3T32A 2OKJA 3FZ8A 2HUIA 5FT4A 1ASNA 4UHMA 3MEBA 3VK4A 3AENA 3I16A 5EAAA 5C6UA 1BT4A 3VP6A 2AY6A 2QBTA 1EG5A 3LVMA 5E4ZA 1BKGA 1AKAA 3NYUA 1ZC9A 4W1XA 3HMUA 4P3MA 3AOVA 3FVSA 4ADDA 3UE8A 1D2FA 1SFFA 4U1TA 5G09A 3DXWA 3FKDA 3BB8A 2TPLA 4CXQA 2EO5A 4RAEA 5HHYA 1X2AA 1M7YA 2Z9WA 3GZCA 3GBXA 4XJLA 1Z7DA 1OHVA 1CL2A 3DR4A 2EZ2A 1WYTA 1SZUA 3PDBA 2W7MA 4A0RA 4GE7A 3BC8A 1M0PA 1M32A 1V72A 1W7NA 3DXVA 1JF9A 3N75A 3NRAA 4OCAA 4Q6RA 2W7LA 5HXXA 2Z67A 2F8JA 4JE5A 1MDOA 2NMPA 2BYLA 3AENB 2YKXA 3AELA 3DU4A 3EI9A 2VGVA 4J5UA 1LC5A 4PFNA 4RM1A 1BS0A 1ASBA 3FVXA 2JGTA 3AOWA 1AMSA 4XEWA 1D7RA 1LC7A 2YKVA 2VMRA 2C0RA 2DOUA 2CY8A 4H51A 3BCBA 2CTZA 2VLFA 3JTXA 3EI6A 3G0TA 3PA9A 4WYDA 5E5IA 2E7IA 3LVJA 4M2JA 3TFTA 3ISLA 3KGWA 2ZUKA 4W91A 3FDDA 2X8UA 2W8TA 4AH3A 1TATA 1AMRA 3PIUA 1AY5A 5EQCA 1B5OA 3DZZA 3QPGA 4WLHA 2ZSLA 2EGYA 3RQ1A 1AICA 4CVQA 5EUEA 1DJ9A 5DJ9A 4ZDOA 4OT8A 1TASA 2WK8A 4LNLA 4WLJA 4WXFA 2CH1A 1KL2A 3CQ5A 3QGUA 1B8GA 4F4EA 1XEYA 5KTBA 1S08A 1WYUA 3E77A 4AZJA 2XH1A 4M2MA 4ZM3A 4GRXA 1SVVA 3NTJA 1AX4A 1CL1A 2R5EA 4A0HA 5G2PA 3WCOA 4IX8A 4Y0HA 1KMKA 2Z20A 1E5FA 1YAAA 1CS1A 1X0MA 1TOKA 1GC2A 1W3UA 3EI7A 2W7GA 1ARGA 2V0YA 3DC1A 3II0A 3UAKA 2BWPA 1GD9A 1AAWA 4OC9A 3P6KA 5FT6A 1FG3A 2PB0A 3AEPA 1V2DA 4KXKA 3TFUA 2Z9XA 1YJYA 3CBFA 3LG0A 2YKYA 2GSAA 4RJ0A 1G4VA 3H9XA 3AATA 3VAXA 4PFFA 5E3KA 3A9XA 1I43A 1M0QA 4J8LA 3DRDA 4GSAA 3HVYA 4PVFA 2HUFA 4XK1A 1M6SA 3COGA 5G4IA 2EYQA 1S09A 3QM2A 4FL0A 1OHYA 4ZWVA 4K2BA 1WKHA 3K7YA 2DKBA 4F5IA 3MADA 4WYEA 4LC3A 3NNKA 4Y0DA 5FT5A 3BWNC 3K28A 2DGLA 3E2ZA 2JJHA 4A6UA 4ZSYA 5M4DA 2BIAA 2YHKA 3AEJC 4MSOA 4JEYA 1C7GA 4Q76A 1IX7A 2O1BA 3JW9A 3ZRRA 1ASGA 1C7NA 3EZSA 4DGTA 1LC8A 2ZSMA 1ASMA 1YJZA 2ORDA 2VIAA 1BW0A 3MAFB 4RLGA 2CJDA 2W7FA 4XJPA 4LW4A 5EUNA 1IX8A 3H14A 4ISYA 4L0OA 2FQ6A 3OKSA 2ZC0A 4W1VA 3WCNA 5LH9A 3TQXA 2DGKA 2R0TA 4CXRA 1KKPA 3AEMC 2AY2A 2BKWA 4RKDA 1DGEA 1PG8A 3ATHA 1BJOB 2EH6A 1UKJA 1AHXA 3F0HA 3D6KA 4K2MA 5HDMA 3B1EA 1BJNA 1AY4A 2JISA 4MKKA 1WYVB 5IWQA 1H0CA 3GZDC 3NYSA 4XQ2A 4F5FA 1BQDA 1CJ0A 4PIWA 5I92A 1TARA 1ASDA 8AATA 1MAQA 2D66A 5M46A 1LS3A 4K05A 4UHNA 3N7NA 3LVKA 3NUIA 1DJEA 3L44A 3E6GA 3GWPA 2D64A 4WB0B 4E3QA 1ECXA 2OKKA 3PD6A 1AJSB 3DYDA 1LKCA 1UU1A 1N8PA 1ARSA 2HP1A 4GDYA 4GE9A 4RJYA 4RITA 4AZKA 4JF0A 5EUDA 3A2BA 4KAMA 1IJIA 1O62A 4BQ0A 2VIBA 1LW4A 5J8QA 4ADBA 4UQVA 2VMNA 4IW7A 3JWAA 1WKGA 1T3IA 3WKSA 4MKJA 1O69A 3WZFA 4BA5A 2VMPA 4ZAHA 1BJ4A 3FQ7A 1DKAA 2AY9A 1BJWA 1IAYA 3FZ6A 1ELUA 4XAUA 3CAIA 3NU7A 4WYAA 1M0NA 1W23A 1QITA 3GR9A 3A9YA 1W7LA 2X5FA 4WYCA 3PD6B 1QGNA 1SPAA 4A0GA 3LVLB 4F5KA 3ECDA 1QJ3A 2VI8A 1TOJA 1DFOA 1ASAA 1CZCA 2BI9A 5EAVA 1DTYA 2BI5A 2O7CA 3JZLA 5FT8A 1FG7A 1ZODA 2W7EA 3B1CA 4O6ZA 2CSTA 4ZDLA 1AHGA 4RKCA 3PGYA 4R2NA 5F8VA 3W1JA 2VGTA 1S0AA 4E3RA 3LWSA 2BYJA 2QLRA 1ASCA 1ARHA 1WYTB 2VMUA 3PDBB 3W1IA 1O61A 3FQ8A 1V2EA 1SZSA 1IVRA 4EMYA 3AEOA 1OHWA 3HLMA 2VMQA 4N0WA 2AY4A 4ZM4A 2GMUA 1GEXA 2YRIA 1PMMA 1M0OA 5DX5A 1IX6A 2CFBA 4ZDPA 1ARTA 3Q8NA 4ADCA 2QA3A 3KE3A 3QHXA 3MC6C 4I8AA 4JE5D 4R5FA 3G7QA 3RBFA 1C9CA 5F9SA 2JJFA 2R2NA 2CH2A 1S06A 1TPLA 2BI3A 2VMSA 3BV0A 5BJ4A 2BIGA 4WD2A 3GETA 2FNIA 4IYOA 4IXSA 4EB5A 2ZY5A 2Z1ZA 3EI5A 1U08A 1PMOA 3FQAA 3MAUA 9AATA 3OP7A 4TN4A 4CBRA 4P7YA 2AEUA 4KYOA 4W1WA 2VGSA 3BN1A 2KFPA 4OTLA 3W1HA 1N2TA 1DJUA 4LNJA 4Q75A 1QJ5A 3QBOA 1J32A 1UU0A 3EIBA 4OMAA 5DJ1A 2WK9A 3I5TA 4AO4A 2CJHA 1GC4A 3KKIA 4IXZA 1WYUB 4A6RA 5DB5A 3VOMA 3CQ6A 1CQ7A 3ELEA 2Q7WA 2HORA 4EFFA 1RVUA 3RBLA 2HZPA 1IAXA 4JEVA 2C81A 1DGDA 1QISA 5D5SA 3B8XA 1SF2A 4IYOB 1GCKA 2D7YA 4ADEA 3NUBA 4IXOA 1B4XA 4UHOA 5M49A 5AX8A 3N4SA 3AEJA 1ASLA 4JEWA 4WP0A 2BI1A 4JF1A 2CB1A 4LW2A 4MGRA 2ZY4A 3BCAA 3RUYA 2AY1A 2ZP7A 1D7SA 1CZEA 1P3WA 2JG2A 3QN6A 5G4JA 1EJIA 1AY8A 2AATA 1VJOA 2PO3A 1AHFA 1GEYA 5EIGA 5K8BA 5LHAA 1RV3A 2ZYJA 1GEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYC A;  3BCX A;  3GSB A;  3HQT A;  4MQP A;  1AAM A;  2OQX A;  2W8U A;  4DBC A;  4F5M A;  1H1C A;  3FD0 A;  4NOG A;  2D65 A;  1FC4 A;  1MDZ A;  3G8M A;  1YNU A;  3WGB A;  4A6T A;  5G0A A;  3E2Y A;  2YCP A;  1MGV A;  2W8J A;  4WYG A;  4EB7 A;  2WK7 A;  3GZD A;  3I4J A;  4ATP A;  2HOX A;  2ZJG A;  3E2Z B;  4OYT A;  4W8I A;  1TOI A;  1MLY A;  2DR1 A;  2YRR A;  1MLZ A;  4R8D A;  7AAT A;  1B5P A;  1MDX A;  2AY5 A;  2VMX A;  2VMZ A;  2W8V A;  1GBN A;  4OBU A;  1JS3 A;  2VI9 A;  3B1D A;  1I41 A;  3ZZK A;  1G7X A;  4CBS A;  2BHX A;  2YKU A;  4A0F A;  1OXO A;  2W7I A;  5EIG B;  2VGU A;  4QGR A;  4R5Z A;  1IUG A;  3B46 A;  3HT4 A;  3HDO A;  1W7M A;  4M2K A;  4TMR A;  1KKJ A;  1I48 A;  1YOO A;  1TOE A;  2OAT A;  4GE4 A;  1B9I A;  3EIA A;  1B9H A;  3FDB A;  2XBN A;  1XI9 A;  4A72 A;  2HUU A;  1G7W A;  4W5K A;  4U2H A;  4Q31 A;  4UOY A;  1Y4I A;  2D61 A;  3ASB A;  1ARI A;  1AMA A;  3K40 A;  3PAA A;  1UU2 A;  2EPJ A;  1ASE A;  2VMO A;  2DKJ A;  1GC3 A;  3KGX A;  3WX9 A;  1TOG A;  3NX3 A;  1G4X A;  1ASF A;  3R9A A;  3WLX A;  1CQ8 A;  4FFC A;  4AOA A;  2HOY A;  4ZAS A;  1AIA A;  1QZ9 A;  1I29 A;  3VK3 A;  2CJG A;  3IF2 A;  2BWO A;  2VLH A;  4F5L A;  2AY7 A;  1KL1 A;  2Z9V A;  3AV7 A;  2O0R A;  5TF5 A;  4E77 A;  2FNU A;  1BQA A;  2CAN A;  2BI2 A;  1X28 A;  2X3L A;  3JWB A;  1D7U A;  3DOD A;  2OGE A;  3UWC A;  1X29 A;  4AO9 A;  2W7K A;  4TV7 A;  3TCM A;  2E54 A;  3NU8 A;  1AKC A;  1Z3Z A;  2C44 A;  1GDE A;  4E1O A;  2CIN A;  4F5J A;  2E7J A;  2YCT A;  2FYF A;  4GEB A;  2WKA A;  2JJE A;  1VP4 A;  2VMV A;  4BMK A;  2W8W A;  1ZOB A;  4RIZ A;  3ZRP A;  2ZY2 A;  2YOB A;  1SZK A;  3MC6 A;  4BA4 A;  2VMT A;  1AKB A;  3N5M A;  4ZWM A;  1AMQ A;  3BWO A;  2W7J A;  3PDX A;  1C0N A;  3H7F A;  5EFS A;  3JU7 A;  1V2F A;  2V1P A;  2HP2 A;  1PFF A;  3NDN A;  5M4B A;  1AHY A;  2RFV A;  2QMA A;  4MQR A;  4K2I A;  2QB3 A;  4EU1 A;  4JEX A;  2R5C A;  2D63 A;  3QI6 A;  2D5Y A;  3FZ7 A;  4XJO A;  2GB3 A;  2PB2 A;  1WST A;  2Z61 A;  3MKJ A;  2FM1 A;  2W7D A;  4WBT A;  3A8U X;  1GC0 A;  2FN6 A;  2VMW A;  2W7H A;  1OAT A;  1YJS A;  2BIE A;  5BJ3 A;  2C7T A;  2OGA A;  1AIB A;  4OBV A;  3FTB A;  1JG8 A;  4MY5 A;  3FFH A;  5G2Q A;  4BHD A;  3BWN A;  2GMS A;  4ZSW A;  1CQ6 A;  1MAP A;  1YIZ A;  1E5E A;  3VK2 A;  2EZ1 A;  3E9K A;  4B9B A;  4WYF A;  2QB2 A;  1J04 A;  3RI6 A;  3ZRQ A;  3EUC A;  3EI8 A;  3FSL A;  2R5C B;  1JS6 A;  3MAF A;  3HBX A;  4Y0I A;  1M4N A;  3ACZ A;  3NYT A;  2G6W A;  3L8A A;  2BWN A;  4IY7 A;  3A9Z A;  1D7V A;  3FRK A;  2YCN A;  1IBJ A;  1AJR A;  3ASA A;  3FFR A;  2ZY3 A;  4WXB A;  1AHE A;  1LK9 A;  1BJO A;  2Z1Y A;  3E2F A;  3AEM A;  4LNM A;  1LW5 A;  1S07 A;  3WY7 A;  1WYV A;  1N31 A;  1RVY A;  1YIY A;  3PJ0 A;  3M5U A;  1EQB A;  3N0L A;  3CQ4 A;  2VGZ A;  4DQ6 A;  1RV4 A;  2VGW A;  3FVU A;  4F5G A;  2AY8 A;  3P1T A;  3FCR A;  4WB0 A;  3DR7 A;  5JAY A;  4ITG A;  3RCH A;  3ZZJ A;  1OXP A;  4HF8 A;  1AJS A;  2AEV A;  2VMY A;  3WGC A;  4XJM A;  3LY1 A;  3ELP A;  1ORD A;  4B98 A;  2HOZ A;  2JJG A;  4WXG A;  2AY3 A;  4A00 A;  3WKR A;  5D95 A;  4F5H A;  1KMJ A;  3LV2 A;  1C4K A;  3MBB A;  2GQN A;  3USF A;  4ATQ A;  1ELQ A;  3GJU A;  4N0B A;  2E7U A;  2D7Z A;  4ITX A;  2Z9U A;  1C7O A;  3EZ1 A;  3PPL A;  3TAT A;  3F9T A;  3HL2 A;  1O4S A;  3F6T A;  1QIR A;  2DGM A;  3BS8 A;  3IHJ A;  3R4T A;  1VEF A;  4HVK A;  4JEZ A;  4ZLV A;  3RCH B;  2X5D A;  4MQQ A;  3T32 A;  2OKJ A;  3FZ8 A;  2HUI A;  5FT4 A;  1ASN A;  4UHM A;  3MEB A;  3VK4 A;  3AEN A;  3I16 A;  5EAA A;  5C6U A;  1BT4 A;  3VP6 A;  2AY6 A;  2QBT A;  1EG5 A;  3LVM A;  5E4Z A;  1BKG A;  1AKA A;  3NYU A;  1ZC9 A;  4W1X A;  3HMU A;  4P3M A;  3AOV A;  3FVS A;  4ADD A;  3UE8 A;  1D2F A;  1SFF A;  4U1T A;  5G09 A;  3DXW A;  3FKD A;  3BB8 A;  2TPL A;  4CXQ A;  2EO5 A;  4RAE A;  5HHY A;  1X2A A;  1M7Y A;  2Z9W A;  3GZC A;  3GBX A;  4XJL A;  1Z7D A;  1OHV A;  1CL2 A;  3DR4 A;  2EZ2 A;  1WYT A;  1SZU A;  3PDB A;  2W7M A;  4A0R A;  4GE7 A;  3BC8 A;  1M0P A;  1M32 A;  1V72 A;  1W7N A;  3DXV A;  1JF9 A;  3N75 A;  3NRA A;  4OCA A;  4Q6R A;  2W7L A;  5HXX A;  2Z67 A;  2F8J A;  4JE5 A;  1MDO A;  2NMP A;  2BYL A;  3AEN B;  2YKX A;  3AEL A;  3DU4 A;  3EI9 A;  2VGV A;  4J5U A;  1LC5 A;  4PFN A;  4RM1 A;  1BS0 A;  1ASB A;  3FVX A;  2JGT A;  3AOW A;  1AMS A;  4XEW A;  1D7R A;  1LC7 A;  2YKV A;  2VMR A;  2C0R A;  2DOU A;  2CY8 A;  4H51 A;  3BCB A;  2CTZ A;  2VLF A;  3JTX A;  3EI6 A;  3G0T A;  3PA9 A;  4WYD A;  5E5I A;  2E7I A;  3LVJ A;  4M2J A;  3TFT A;  3ISL A;  3KGW A;  2ZUK A;  4W91 A;  3FDD A;  2X8U A;  2W8T A;  4AH3 A;  1TAT A;  1AMR A;  3PIU A;  1AY5 A;  5EQC A;  1B5O A;  3DZZ A;  3QPG A;  4WLH A;  2ZSL A;  2EGY A;  3RQ1 A;  1AIC A;  4CVQ A;  5EUE A;  1DJ9 A;  5DJ9 A;  4ZDO A;  4OT8 A;  1TAS A;  2WK8 A;  4LNL A;  4WLJ A;  4WXF A;  2CH1 A;  1KL2 A;  3CQ5 A;  3QGU A;  1B8G A;  4F4E A;  1XEY A;  1S08 A;  1WYU A;  3E77 A;  4AZJ A;  2XH1 A;  4M2M A;  4ZM3 A;  4GRX A;  1SVV A;  3NTJ A;  1AX4 A;  1CL1 A;  2R5E A;  4A0H A;  5G2P A;  3WCO A;  4IX8 A;  4Y0H A;  1KMK A;  2Z20 A;  1E5F A;  1YAA A;  1CS1 A;  1X0M A;  1TOK A;  1GC2 A;  1W3U A;  3EI7 A;  2W7G A;  1ARG A;  2V0Y A;  3DC1 A;  3II0 A;  3UAK A;  2BWP A;  1GD9 A;  1AAW A;  4OC9 A;  3P6K A;  5FT6 A;  1FG3 A;  2PB0 A;  3AEP A;  1V2D A;  4KXK A;  3TFU A;  2Z9X A;  1YJY A;  3CBF A;  3LG0 A;  2YKY A;  2GSA A;  4RJ0 A;  1G4V A;  3AAT A;  3VAX A;  4PFF A;  5E3K A;  3A9X A;  1I43 A;  1M0Q A;  4J8L A;  3DRD A;  4GSA A;  3HVY A;  4PVF A;  2HUF A;  4XK1 A;  1M6S A;  3COG A;  5G4I A;  1S09 A;  3QM2 A;  4FL0 A;  1OHY A;  4ZWV A;  4K2B A;  1WKH A;  3K7Y A;  2DKB A;  4F5I A;  3MAD A;  4WYE A;  4LC3 A;  3NNK A;  4Y0D A;  5FT5 A;  3BWN C;  3K28 A;  2DGL A;  3E2Z A;  2JJH A;  4A6U A;  4ZSY A;  5M4D A;  2BIA A;  2YHK A;  3AEJ C;  4MSO A;  4JEY A;  1C7G A;  4Q76 A;  1IX7 A;  2O1B A;  3JW9 A;  3ZRR A;  1ASG A;  1C7N A;  3EZS A;  4DGT A;  1LC8 A;  2ZSM A;  1ASM A;  1YJZ A;  2ORD A;  2VIA A;  1BW0 A;  3MAF B;  4RLG A;  2CJD A;  2W7F A;  4XJP A;  4LW4 A;  5EUN A;  1IX8 A;  3H14 A;  4ISY A;  4L0O A;  2FQ6 A;  3OKS A;  2ZC0 A;  4W1V A;  3WCN A;  5LH9 A;  3TQX A;  2DGK A;  2R0T A;  4CXR A;  1KKP A;  3AEM C;  2AY2 A;  2BKW A;  4RKD A;  1DGE A;  1PG8 A;  3ATH A;  1BJO B;  2EH6 A;  1UKJ A;  1AHX A;  3F0H A;  3D6K A;  4K2M A;  5HDM A;  3B1E A;  1BJN A;  1AY4 A;  2JIS A;  4MKK A;  1WYV B;  5IWQ A;  1H0C A;  3GZD C;  3NYS A;  4XQ2 A;  4F5F A;  1BQD A;  1CJ0 A;  4PIW A;  5I92 A;  1TAR A;  1ASD A;  8AAT A;  1MAQ A;  2D66 A;  5M46 A;  1LS3 A;  4UHN A;  3LVK A;  3NUI A;  1DJE A;  3L44 A;  3E6G A;  3GWP A;  2D64 A;  4WB0 B;  4E3Q A;  1ECX A;  2OKK A;  3PD6 A;  1AJS B;  3DYD A;  1LKC A;  1UU1 A;  1N8P A;  1ARS A;  2HP1 A;  4GDY A;  4GE9 A;  4RJY A;  4RIT A;  4AZK A;  4JF0 A;  5EUD A;  3A2B A;  4KAM A;  1IJI A;  1O62 A;  4BQ0 A;  2VIB A;  1LW4 A;  5J8Q A;  4ADB A;  4UQV A;  2VMN A;  4IW7 A;  3JWA A;  1WKG A;  1T3I A;  3WKS A;  4MKJ A;  1O69 A;  3WZF A;  4BA5 A;  2VMP A;  4ZAH A;  1BJ4 A;  3FQ7 A;  1DKA A;  2AY9 A;  1BJW A;  1IAY A;  3FZ6 A;  1ELU A;  4XAU A;  3CAI A;  3NU7 A;  4WYA A;  1M0N A;  1W23 A;  1QIT A;  3GR9 A;  3A9Y A;  1W7L A;  2X5F A;  4WYC A;  3PD6 B;  1QGN A;  1SPA A;  4A0G A;  3LVL B;  4F5K A;  3ECD A;  1QJ3 A;  2VI8 A;  1TOJ A;  1DFO A;  1ASA A;  1CZC A;  2BI9 A;  5EAV A;  1DTY A;  2BI5 A;  2O7C A;  3JZL A;  5FT8 A;  1FG7 A;  1ZOD A;  2W7E A;  3B1C A;  4O6Z A;  2CST A;  4ZDL A;  1AHG A;  4RKC A;  3PGY A;  4R2N A;  5F8V A;  3W1J A;  2VGT A;  1S0A A;  4E3R A;  3LWS A;  2BYJ A;  2QLR A;  1ASC A;  1ARH A;  1WYT B;  2VMU A;  3PDB B;  3W1I A;  1O61 A;  3FQ8 A;  1V2E A;  1SZS A;  1IVR A;  4EMY A;  3AEO A;  1OHW A;  3HLM A;  2VMQ A;  4N0W A;  2AY4 A;  4ZM4 A;  2GMU A;  1GEX A;  2YRI A;  1PMM A;  1M0O A;  5DX5 A;  1IX6 A;  2CFB A;  4ZDP A;  1ART A;  3Q8N A;  4ADC A;  2QA3 A;  3KE3 A;  3QHX A;  3MC6 C;  4I8A A;  4JE5 D;  4R5F A;  3G7Q A;  3RBF A;  1C9C A;  5F9S A;  2JJF A;  2R2N A;  2CH2 A;  1S06 A;  1TPL A;  2BI3 A;  2VMS A;  3BV0 A;  5BJ4 A;  2BIG A;  4WD2 A;  3GET A;  2FNI A;  4IYO A;  4IXS A;  4EB5 A;  2ZY5 A;  2Z1Z A;  3EI5 A;  1U08 A;  1PMO A;  3FQA A;  3MAU A;  9AAT A;  3OP7 A;  4TN4 A;  4CBR A;  4P7Y A;  2AEU A;  4KYO A;  4W1W A;  2VGS A;  3BN1 A;  4OTL A;  3W1H A;  1N2T A;  1DJU A;  4LNJ A;  4Q75 A;  1QJ5 A;  3QBO A;  1J32 A;  1UU0 A;  3EIB A;  4OMA A;  5DJ1 A;  2WK9 A;  3I5T A;  4AO4 A;  2CJH A;  1GC4 A;  3KKI A;  4IXZ A;  1WYU B;  4A6R A;  5DB5 A;  3VOM A;  3CQ6 A;  1CQ7 A;  3ELE A;  2Q7W A;  2HOR A;  4EFF A;  1RVU A;  3RBL A;  2HZP A;  1IAX A;  4JEV A;  2C81 A;  1DGD A;  1QIS A;  5D5S A;  3B8X A;  1SF2 A;  4IYO B;  1GCK A;  2D7Y A;  4ADE A;  3NUB A;  4IXO A;  1B4X A;  4UHO A;  5M49 A;  5AX8 A;  3AEJ A;  1ASL A;  4JEW A;  4WP0 A;  2BI1 A;  4JF1 A;  2CB1 A;  4LW2 A;  4MGR A;  2ZY4 A;  3BCA A;  3RUY A;  2AY1 A;  2ZP7 A;  1D7S A;  1CZE A;  1P3W A;  2JG2 A;  3QN6 A;  5G4J A;  1EJI A;  1AY8 A;  2AAT A;  1VJO A;  2PO3 A;  1AHF A;  1GEY A;  5EIG A;  5K8B A;  5LHA A;  1RV3 A;  2ZYJ A;  1GEW A; 
#chains in the Genus database with same CATH topology
 2VYC A;  3BCX A;  3GSB A;  3HQT A;  4MQP A;  1AAM A;  2OQX A;  2W8U A;  4DBC A;  4F5M A;  2WB6 A;  1H1C A;  3FD0 A;  4NOG A;  2D65 A;  1FC4 A;  1MDZ A;  3G8M A;  1YNU A;  3WGB A;  4A6T A;  5G0A A;  3E2Y A;  2YCP A;  1MGV A;  2W8J A;  4WYG A;  4EB7 A;  2WK7 A;  3GZD A;  3I4J A;  4ATP A;  2HOX A;  2ZJG A;  3E2Z B;  4OYT A;  4W8I A;  1TOI A;  1MLY A;  2DR1 A;  2YRR A;  1MLZ A;  4R8D A;  7AAT A;  1B5P A;  1MDX A;  2AY5 A;  2VMX A;  2VMZ A;  2W8V A;  1GBN A;  4OBU A;  1JS3 A;  2VI9 A;  3B1D A;  1I41 A;  3N4X A;  3ZZK A;  1G7X A;  4CBS A;  2BHX A;  2YKU A;  4A0F A;  1OXO A;  2W7I A;  5EIG B;  2VGU A;  4QGR A;  4R5Z A;  1IUG A;  3B46 A;  3HT4 A;  3HDO A;  1W7M A;  4M2K A;  4TMR A;  1KKJ A;  1I48 A;  1YOO A;  1TOE A;  2OAT A;  4GE4 A;  1B9I A;  3EIA A;  1B9H A;  3FDB A;  2XBN A;  1XI9 A;  4A72 A;  2HUU A;  1G7W A;  4W5K A;  4U2H A;  4Q31 A;  4UOY A;  1Y4I A;  2D61 A;  3ASB A;  1ARI A;  1AMA A;  3K40 A;  3PAA A;  1UU2 A;  2EPJ A;  1ASE A;  2VMO A;  2DKJ A;  1GC3 A;  3KGX A;  3WX9 A;  1TOG A;  3NX3 A;  1G4X A;  1ASF A;  3R9A A;  3WLX A;  3N4R A;  1CQ8 A;  4FFC A;  4AOA A;  2HOY A;  4ZAS A;  1AIA A;  1QZ9 A;  1I29 A;  3VK3 A;  2CJG A;  3IF2 A;  2BWO A;  2VLH A;  2QSR A;  4F5L A;  2AY7 A;  1KL1 A;  2Z9V A;  3AV7 A;  2O0R A;  5TF5 A;  4E77 A;  2FNU A;  1BQA A;  2CAN A;  2BI2 A;  1X28 A;  2X3L A;  3JWB A;  1D7U A;  3DOD A;  2OGE A;  3UWC A;  1X29 A;  4AO9 A;  2W7K A;  4TV7 A;  3TCM A;  2E54 A;  3NU8 A;  1AKC A;  1Z3Z A;  2C44 A;  1GDE A;  4E1O A;  2CIN A;  4F5J A;  2E7J A;  2YCT A;  2FYF A;  4GEB A;  2WKA A;  2JJE A;  1VP4 A;  2VMV A;  4BMK A;  2W8W A;  1ZOB A;  4RIZ A;  3ZRP A;  2ZY2 A;  2YOB A;  1SZK A;  3MC6 A;  2A1V A;  4BA4 A;  2VMT A;  2FKI A;  1AKB A;  3N5M A;  4ZWM A;  1AMQ A;  3BWO A;  2W7J A;  3PDX A;  1C0N A;  3H7F A;  5EFS A;  3JU7 A;  1V2F A;  2V1P A;  2HP2 A;  1PFF A;  3NDN A;  5M4B A;  1AHY A;  2RFV A;  2QMA A;  4MQR A;  4K2I A;  2QB3 A;  4EU1 A;  4JEX A;  2R5C A;  2D63 A;  3QI6 A;  2D5Y A;  3FZ7 A;  4XJO A;  2GB3 A;  2PB2 A;  1WST A;  2Z61 A;  3MKJ A;  2FM1 A;  2W7D A;  4WBT A;  3A8U X;  1GC0 A;  2FN6 A;  2VMW A;  2W7H A;  1OAT A;  1YJS A;  2BIE A;  5BJ3 A;  2C7T A;  2OGA A;  1AIB A;  4OBV A;  3FTB A;  1JG8 A;  4MY5 A;  3FFH A;  5G2Q A;  4BHD A;  3BWN A;  2GMS A;  4ZSW A;  1CQ6 A;  1MAP A;  1YIZ A;  1E5E A;  3VK2 A;  2EZ1 A;  3E9K A;  4B9B A;  4WYF A;  2QB2 A;  1J04 A;  3RI6 A;  3ZRQ A;  3EUC A;  3EI8 A;  3FSL A;  2R5C B;  1JS6 A;  3MAF A;  3HBX A;  4Y0I A;  1M4N A;  3ACZ A;  3NYT A;  2G6W A;  3L8A A;  2BWN A;  4IY7 A;  4H63 Q;  3A9Z A;  1D7V A;  3FRK A;  2YCN A;  1IBJ A;  1AJR A;  3ASA A;  3FFR A;  2G7J A;  2ZY3 A;  4WXB A;  1AHE A;  1LK9 A;  1BJO A;  2Z1Y A;  3E2F A;  3AEM A;  4LNM A;  1LW5 A;  1S07 A;  3WY7 A;  1WYV A;  1N31 A;  1RVY A;  1YIY A;  3PJ0 A;  3M5U A;  1EQB A;  3N0L A;  3CQ4 A;  2VGZ A;  4DQ6 A;  1RV4 A;  2VGW A;  3FVU A;  4F5G A;  2AY8 A;  3P1T A;  3FCR A;  4WB0 A;  3DR7 A;  5JAY A;  4ITG A;  3RCH A;  3ZZJ A;  1OXP A;  4HF8 A;  1AJS A;  2AEV A;  2VMY A;  3WGC A;  4XJM A;  3LY1 A;  3ELP A;  1ORD A;  4B98 A;  2HOZ A;  2JJG A;  4WXG A;  2AY3 A;  4A00 A;  3WKR A;  5D95 A;  4F5H A;  1KMJ A;  3LV2 A;  1C4K A;  3MBB A;  2GQN A;  3USF A;  4ATQ A;  1ELQ A;  3GJU A;  4N0B A;  2E7U A;  2D7Z A;  4ITX A;  2Z9U A;  1C7O A;  3EZ1 A;  3PPL A;  3TAT A;  3F9T A;  3HL2 A;  1O4S A;  3F6T A;  1QIR A;  2DGM A;  3BS8 A;  3IHJ A;  3R4T A;  1VEF A;  4HVK A;  4JEZ A;  4ZLV A;  3RCH B;  2X5D A;  4MQQ A;  3T32 A;  2OKJ A;  3FZ8 A;  2HUI A;  5FT4 A;  1ASN A;  4UHM A;  3MEB A;  3VK4 A;  3AEN A;  3I16 A;  5EAA A;  5C6U A;  1BT4 A;  3VP6 A;  2AY6 A;  1KAF A;  2QBT A;  1EG5 A;  3LVM A;  5E4Z A;  1BKG A;  1AKA A;  3NYU A;  1ZC9 A;  4W1X A;  3HMU A;  4P3M A;  3AOV A;  3FVS A;  4ADD A;  3UE8 A;  1D2F A;  1SFF A;  4U1T A;  5G09 A;  3DXW A;  3FKD A;  3BB8 A;  2TPL A;  4CXQ A;  2EO5 A;  4RAE A;  5HHY A;  1X2A A;  1M7Y A;  2Z9W A;  3GZC A;  3GBX A;  4XJL A;  1Z7D A;  1OHV A;  1CL2 A;  3DR4 A;  2EZ2 A;  1WYT A;  1SZU A;  3PDB A;  2W7M A;  4A0R A;  4GE7 A;  3BC8 A;  1M0P A;  1M32 A;  1V72 A;  1W7N A;  3DXV A;  1JF9 A;  3N75 A;  3NRA A;  4OCA A;  4Q6R A;  2W7L A;  5HXX A;  2Z67 A;  2F8J A;  4JE5 A;  1MDO A;  2NMP A;  2BYL A;  3AEN B;  2YKX A;  3AEL A;  3DU4 A;  3EI9 A;  2VGV A;  4J5U A;  1LC5 A;  4PFN A;  4RM1 A;  1BS0 A;  1ASB A;  3FVX A;  2JGT A;  3AOW A;  1AMS A;  4XEW A;  1D7R A;  1LC7 A;  2YKV A;  2VMR A;  2C0R A;  2DOU A;  2CY8 A;  4H51 A;  3BCB A;  2CTZ A;  2VLF A;  3JTX A;  3EI6 A;  3G0T A;  3PA9 A;  4WYD A;  5E5I A;  2E7I A;  3LVJ A;  4M2J A;  3TFT A;  3ISL A;  3KGW A;  2ZUK A;  4W91 A;  3FDD A;  2X8U A;  2W8T A;  4AH3 A;  1TAT A;  1AMR A;  3PIU A;  1AY5 A;  5EQC A;  1B5O A;  3DZZ A;  3QPG A;  4WLH A;  2ZSL A;  2EGY A;  3RQ1 A;  1AIC A;  4CVQ A;  5EUE A;  1DJ9 A;  5DJ9 A;  4ZDO A;  4OT8 A;  1TAS A;  2WK8 A;  4LNL A;  4WLJ A;  4WXF A;  2CH1 A;  1KL2 A;  3CQ5 A;  3QGU A;  1B8G A;  4F4E A;  1XEY A;  5KTB A;  1S08 A;  1WYU A;  3E77 A;  4AZJ A;  2XH1 A;  4M2M A;  4ZM3 A;  4GRX A;  1SVV A;  3NTJ A;  1AX4 A;  1CL1 A;  2R5E A;  4A0H A;  5G2P A;  3WCO A;  4IX8 A;  4Y0H A;  1KMK A;  2Z20 A;  1E5F A;  1YAA A;  1CS1 A;  1X0M A;  1TOK A;  1GC2 A;  1W3U A;  3EI7 A;  2W7G A;  1ARG A;  2V0Y A;  3DC1 A;  3II0 A;  3UAK A;  2BWP A;  1GD9 A;  1AAW A;  4OC9 A;  3P6K A;  5FT6 A;  1FG3 A;  2PB0 A;  3AEP A;  1V2D A;  4KXK A;  3TFU A;  2Z9X A;  1YJY A;  3CBF A;  3LG0 A;  2YKY A;  2GSA A;  4RJ0 A;  1G4V A;  3H9X A;  3AAT A;  3VAX A;  4PFF A;  5E3K A;  3A9X A;  1I43 A;  1M0Q A;  4J8L A;  3DRD A;  4GSA A;  3HVY A;  4PVF A;  2HUF A;  4XK1 A;  1M6S A;  3COG A;  5G4I A;  2EYQ A;  1S09 A;  3QM2 A;  4FL0 A;  1OHY A;  4ZWV A;  4K2B A;  1WKH A;  3K7Y A;  2DKB A;  4F5I A;  3MAD A;  4WYE A;  4LC3 A;  3NNK A;  4Y0D A;  5FT5 A;  3BWN C;  3K28 A;  2DGL A;  3E2Z A;  2JJH A;  4A6U A;  4ZSY A;  5M4D A;  2BIA A;  2YHK A;  3AEJ C;  4MSO A;  4JEY A;  1C7G A;  4Q76 A;  1IX7 A;  2O1B A;  3JW9 A;  3ZRR A;  1ASG A;  1C7N A;  3EZS A;  4DGT A;  1LC8 A;  2ZSM A;  1ASM A;  1YJZ A;  2ORD A;  2VIA A;  1BW0 A;  3MAF B;  4RLG A;  2CJD A;  2W7F A;  4XJP A;  4LW4 A;  5EUN A;  1IX8 A;  3H14 A;  4ISY A;  4L0O A;  2FQ6 A;  3OKS A;  2ZC0 A;  4W1V A;  3WCN A;  5LH9 A;  3TQX A;  2DGK A;  2R0T A;  4CXR A;  1KKP A;  3AEM C;  2AY2 A;  2BKW A;  4RKD A;  1DGE A;  1PG8 A;  3ATH A;  1BJO B;  2EH6 A;  1UKJ A;  1AHX A;  3F0H A;  3D6K A;  4K2M A;  5HDM A;  3B1E A;  1BJN A;  1AY4 A;  2JIS A;  4MKK A;  1WYV B;  5IWQ A;  1H0C A;  3GZD C;  3NYS A;  4XQ2 A;  4F5F A;  1BQD A;  1CJ0 A;  4PIW A;  5I92 A;  1TAR A;  1ASD A;  8AAT A;  1MAQ A;  2D66 A;  5M46 A;  1LS3 A;  4K05 A;  4UHN A;  3N7N A;  3LVK A;  3NUI A;  1DJE A;  3L44 A;  3E6G A;  3GWP A;  2D64 A;  4WB0 B;  4E3Q A;  1ECX A;  2OKK A;  3PD6 A;  1AJS B;  3DYD A;  1LKC A;  1UU1 A;  1N8P A;  1ARS A;  2HP1 A;  4GDY A;  4GE9 A;  4RJY A;  4RIT A;  4AZK A;  4JF0 A;  5EUD A;  3A2B A;  4KAM A;  1IJI A;  1O62 A;  4BQ0 A;  2VIB A;  1LW4 A;  5J8Q A;  4ADB A;  4UQV A;  2VMN A;  4IW7 A;  3JWA A;  1WKG A;  1T3I A;  3WKS A;  4MKJ A;  1O69 A;  3WZF A;  4BA5 A;  2VMP A;  4ZAH A;  1BJ4 A;  3FQ7 A;  1DKA A;  2AY9 A;  1BJW A;  1IAY A;  3FZ6 A;  1ELU A;  4XAU A;  3CAI A;  3NU7 A;  4WYA A;  1M0N A;  1W23 A;  1QIT A;  3GR9 A;  3A9Y A;  1W7L A;  2X5F A;  4WYC A;  3PD6 B;  1QGN A;  1SPA A;  4A0G A;  3LVL B;  4F5K A;  3ECD A;  1QJ3 A;  2VI8 A;  1TOJ A;  1DFO A;  1ASA A;  1CZC A;  2BI9 A;  5EAV A;  1DTY A;  2BI5 A;  2O7C A;  3JZL A;  5FT8 A;  1FG7 A;  1ZOD A;  2W7E A;  3B1C A;  4O6Z A;  2CST A;  4ZDL A;  1AHG A;  4RKC A;  3PGY A;  4R2N A;  5F8V A;  3W1J A;  2VGT A;  1S0A A;  4E3R A;  3LWS A;  2BYJ A;  2QLR A;  1ASC A;  1ARH A;  1WYT B;  2VMU A;  3PDB B;  3W1I A;  1O61 A;  3FQ8 A;  1V2E A;  1SZS A;  1IVR A;  4EMY A;  3AEO A;  1OHW A;  3HLM A;  2VMQ A;  4N0W A;  2AY4 A;  4ZM4 A;  2GMU A;  1GEX A;  2YRI A;  1PMM A;  1M0O A;  5DX5 A;  1IX6 A;  2CFB A;  4ZDP A;  1ART A;  3Q8N A;  4ADC A;  2QA3 A;  3KE3 A;  3QHX A;  3MC6 C;  4I8A A;  4JE5 D;  4R5F A;  3G7Q A;  3RBF A;  1C9C A;  5F9S A;  2JJF A;  2R2N A;  2CH2 A;  1S06 A;  1TPL A;  2BI3 A;  2VMS A;  3BV0 A;  5BJ4 A;  2BIG A;  4WD2 A;  3GET A;  2FNI A;  4IYO A;  4IXS A;  4EB5 A;  2ZY5 A;  2Z1Z A;  3EI5 A;  1U08 A;  1PMO A;  3FQA A;  3MAU A;  9AAT A;  3OP7 A;  4TN4 A;  4CBR A;  4P7Y A;  2AEU A;  4KYO A;  4W1W A;  2VGS A;  3BN1 A;  2KFP A;  4OTL A;  3W1H A;  1N2T A;  1DJU A;  4LNJ A;  4Q75 A;  1QJ5 A;  3QBO A;  1J32 A;  1UU0 A;  3EIB A;  4OMA A;  5DJ1 A;  2WK9 A;  3I5T A;  4AO4 A;  2CJH A;  1GC4 A;  3KKI A;  4IXZ A;  1WYU B;  4A6R A;  5DB5 A;  3VOM A;  3CQ6 A;  1CQ7 A;  3ELE A;  2Q7W A;  2HOR A;  4EFF A;  1RVU A;  3RBL A;  2HZP A;  1IAX A;  4JEV A;  2C81 A;  1DGD A;  1QIS A;  5D5S A;  3B8X A;  1SF2 A;  4IYO B;  1GCK A;  2D7Y A;  4ADE A;  3NUB A;  4IXO A;  1B4X A;  4UHO A;  5M49 A;  5AX8 A;  3N4S A;  3AEJ A;  1ASL A;  4JEW A;  4WP0 A;  2BI1 A;  4JF1 A;  2CB1 A;  4LW2 A;  4MGR A;  2ZY4 A;  3BCA A;  3RUY A;  2AY1 A;  2ZP7 A;  1D7S A;  1CZE A;  1P3W A;  2JG2 A;  3QN6 A;  5G4J A;  1EJI A;  1AY8 A;  2AAT A;  1VJO A;  2PO3 A;  1AHF A;  1GEY A;  5EIG A;  5K8B A;  5LHA A;  1RV3 A;  2ZYJ A;  1GEW A; 
#chains in the Genus database with same CATH homology
 2VYC A;  3BCX A;  3GSB A;  3HQT A;  4MQP A;  1AAM A;  2OQX A;  2W8U A;  4DBC A;  4F5M A;  2WB6 A;  1H1C A;  3FD0 A;  4NOG A;  2D65 A;  1FC4 A;  1MDZ A;  3G8M A;  1YNU A;  3WGB A;  4A6T A;  5G0A A;  3E2Y A;  2YCP A;  1MGV A;  2W8J A;  4WYG A;  4EB7 A;  2WK7 A;  3GZD A;  3I4J A;  4ATP A;  2HOX A;  2ZJG A;  3E2Z B;  4OYT A;  4W8I A;  1TOI A;  1MLY A;  2DR1 A;  2YRR A;  1MLZ A;  4R8D A;  7AAT A;  1B5P A;  1MDX A;  2AY5 A;  2VMX A;  2VMZ A;  2W8V A;  1GBN A;  4OBU A;  1JS3 A;  2VI9 A;  3B1D A;  1I41 A;  3N4X A;  3ZZK A;  1G7X A;  4CBS A;  2BHX A;  2YKU A;  4A0F A;  1OXO A;  2W7I A;  5EIG B;  2VGU A;  4QGR A;  4R5Z A;  1IUG A;  3B46 A;  3HT4 A;  3HDO A;  1W7M A;  4M2K A;  4TMR A;  1KKJ A;  1I48 A;  1YOO A;  1TOE A;  2OAT A;  4GE4 A;  1B9I A;  3EIA A;  1B9H A;  3FDB A;  2XBN A;  1XI9 A;  4A72 A;  2HUU A;  1G7W A;  4W5K A;  4U2H A;  4Q31 A;  4UOY A;  1Y4I A;  2D61 A;  3ASB A;  1ARI A;  1AMA A;  3K40 A;  3PAA A;  1UU2 A;  2EPJ A;  1ASE A;  2VMO A;  2DKJ A;  1GC3 A;  3KGX A;  3WX9 A;  1TOG A;  3NX3 A;  1G4X A;  1ASF A;  3R9A A;  3WLX A;  3N4R A;  1CQ8 A;  4FFC A;  4AOA A;  2HOY A;  4ZAS A;  1AIA A;  1QZ9 A;  1I29 A;  3VK3 A;  2CJG A;  3IF2 A;  2BWO A;  2VLH A;  2QSR A;  4F5L A;  2AY7 A;  1KL1 A;  2Z9V A;  3AV7 A;  2O0R A;  5TF5 A;  4E77 A;  2FNU A;  1BQA A;  2CAN A;  2BI2 A;  1X28 A;  2X3L A;  3JWB A;  1D7U A;  3DOD A;  2OGE A;  3UWC A;  1X29 A;  4AO9 A;  2W7K A;  4TV7 A;  3TCM A;  2E54 A;  3NU8 A;  1AKC A;  1Z3Z A;  2C44 A;  1GDE A;  4E1O A;  2CIN A;  4F5J A;  2E7J A;  2YCT A;  2FYF A;  4GEB A;  2WKA A;  2JJE A;  1VP4 A;  2VMV A;  4BMK A;  2W8W A;  1ZOB A;  4RIZ A;  3ZRP A;  2ZY2 A;  2YOB A;  1SZK A;  3MC6 A;  2A1V A;  4BA4 A;  2VMT A;  2FKI A;  1AKB A;  3N5M A;  4ZWM A;  1AMQ A;  3BWO A;  2W7J A;  3PDX A;  1C0N A;  3H7F A;  5EFS A;  3JU7 A;  1V2F A;  2V1P A;  2HP2 A;  1PFF A;  3NDN A;  5M4B A;  1AHY A;  2RFV A;  2QMA A;  4MQR A;  4K2I A;  2QB3 A;  4EU1 A;  4JEX A;  2R5C A;  2D63 A;  3QI6 A;  2D5Y A;  3FZ7 A;  4XJO A;  2GB3 A;  2PB2 A;  1WST A;  2Z61 A;  3MKJ A;  2FM1 A;  2W7D A;  4WBT A;  3A8U X;  1GC0 A;  2FN6 A;  2VMW A;  2W7H A;  1OAT A;  1YJS A;  2BIE A;  5BJ3 A;  2C7T A;  2OGA A;  1AIB A;  4OBV A;  3FTB A;  1JG8 A;  4MY5 A;  3FFH A;  5G2Q A;  4BHD A;  3BWN A;  2GMS A;  4ZSW A;  1CQ6 A;  1MAP A;  1YIZ A;  1E5E A;  3VK2 A;  2EZ1 A;  3E9K A;  4B9B A;  4WYF A;  2QB2 A;  1J04 A;  3RI6 A;  3ZRQ A;  3EUC A;  3EI8 A;  3FSL A;  2R5C B;  1JS6 A;  3MAF A;  3HBX A;  4Y0I A;  1M4N A;  3ACZ A;  3NYT A;  2G6W A;  3L8A A;  2BWN A;  4IY7 A;  4H63 Q;  3A9Z A;  1D7V A;  3FRK A;  2YCN A;  1IBJ A;  1AJR A;  3ASA A;  3FFR A;  2G7J A;  2ZY3 A;  4WXB A;  1AHE A;  1LK9 A;  1BJO A;  2Z1Y A;  3E2F A;  3AEM A;  4LNM A;  1LW5 A;  1S07 A;  3WY7 A;  1WYV A;  1N31 A;  1RVY A;  1YIY A;  3PJ0 A;  3M5U A;  1EQB A;  3N0L A;  3CQ4 A;  2VGZ A;  4DQ6 A;  1RV4 A;  2VGW A;  3FVU A;  4F5G A;  2AY8 A;  3P1T A;  3FCR A;  4WB0 A;  3DR7 A;  5JAY A;  4ITG A;  3RCH A;  3ZZJ A;  1OXP A;  4HF8 A;  1AJS A;  2AEV A;  2VMY A;  3WGC A;  4XJM A;  3LY1 A;  3ELP A;  1ORD A;  4B98 A;  2HOZ A;  2JJG A;  4WXG A;  2AY3 A;  4A00 A;  3WKR A;  5D95 A;  4F5H A;  1KMJ A;  3LV2 A;  1C4K A;  3MBB A;  2GQN A;  3USF A;  4ATQ A;  1ELQ A;  3GJU A;  4N0B A;  2E7U A;  2D7Z A;  4ITX A;  2Z9U A;  1C7O A;  3EZ1 A;  3PPL A;  3TAT A;  3F9T A;  3HL2 A;  1O4S A;  3F6T A;  1QIR A;  2DGM A;  3BS8 A;  3IHJ A;  3R4T A;  1VEF A;  4HVK A;  4JEZ A;  4ZLV A;  3RCH B;  2X5D A;  4MQQ A;  3T32 A;  2OKJ A;  3FZ8 A;  2HUI A;  5FT4 A;  1ASN A;  4UHM A;  3MEB A;  3VK4 A;  3AEN A;  3I16 A;  5EAA A;  5C6U A;  1BT4 A;  3VP6 A;  2AY6 A;  2QBT A;  1EG5 A;  3LVM A;  5E4Z A;  1BKG A;  1AKA A;  3NYU A;  1ZC9 A;  4W1X A;  3HMU A;  4P3M A;  3AOV A;  3FVS A;  4ADD A;  3UE8 A;  1D2F A;  1SFF A;  4U1T A;  5G09 A;  3DXW A;  3FKD A;  3BB8 A;  2TPL A;  4CXQ A;  2EO5 A;  4RAE A;  5HHY A;  1X2A A;  1M7Y A;  2Z9W A;  3GZC A;  3GBX A;  4XJL A;  1Z7D A;  1OHV A;  1CL2 A;  3DR4 A;  2EZ2 A;  1WYT A;  1SZU A;  3PDB A;  2W7M A;  4A0R A;  4GE7 A;  3BC8 A;  1M0P A;  1M32 A;  1V72 A;  1W7N A;  3DXV A;  1JF9 A;  3N75 A;  3NRA A;  4OCA A;  4Q6R A;  2W7L A;  5HXX A;  2Z67 A;  2F8J A;  4JE5 A;  1MDO A;  2NMP A;  2BYL A;  3AEN B;  2YKX A;  3AEL A;  3DU4 A;  3EI9 A;  2VGV A;  4J5U A;  1LC5 A;  4PFN A;  4RM1 A;  1BS0 A;  1ASB A;  3FVX A;  2JGT A;  3AOW A;  1AMS A;  4XEW A;  1D7R A;  1LC7 A;  2YKV A;  2VMR A;  2C0R A;  2DOU A;  2CY8 A;  4H51 A;  3BCB A;  2CTZ A;  2VLF A;  3JTX A;  3EI6 A;  3G0T A;  3PA9 A;  4WYD A;  5E5I A;  2E7I A;  3LVJ A;  4M2J A;  3TFT A;  3ISL A;  3KGW A;  2ZUK A;  4W91 A;  3FDD A;  2X8U A;  2W8T A;  4AH3 A;  1TAT A;  1AMR A;  3PIU A;  1AY5 A;  5EQC A;  1B5O A;  3DZZ A;  3QPG A;  4WLH A;  2ZSL A;  2EGY A;  3RQ1 A;  1AIC A;  4CVQ A;  5EUE A;  1DJ9 A;  5DJ9 A;  4ZDO A;  4OT8 A;  1TAS A;  2WK8 A;  4LNL A;  4WLJ A;  4WXF A;  2CH1 A;  1KL2 A;  3CQ5 A;  3QGU A;  1B8G A;  4F4E A;  1XEY A;  5KTB A;  1S08 A;  1WYU A;  3E77 A;  4AZJ A;  2XH1 A;  4M2M A;  4ZM3 A;  4GRX A;  1SVV A;  3NTJ A;  1AX4 A;  1CL1 A;  2R5E A;  4A0H A;  5G2P A;  3WCO A;  4IX8 A;  4Y0H A;  1KMK A;  2Z20 A;  1E5F A;  1YAA A;  1CS1 A;  1X0M A;  1TOK A;  1GC2 A;  1W3U A;  3EI7 A;  2W7G A;  1ARG A;  2V0Y A;  3DC1 A;  3II0 A;  3UAK A;  2BWP A;  1GD9 A;  1AAW A;  4OC9 A;  3P6K A;  5FT6 A;  1FG3 A;  2PB0 A;  3AEP A;  1V2D A;  4KXK A;  3TFU A;  2Z9X A;  1YJY A;  3CBF A;  3LG0 A;  2YKY A;  2GSA A;  4RJ0 A;  1G4V A;  3H9X A;  3AAT A;  3VAX A;  4PFF A;  5E3K A;  3A9X A;  1I43 A;  1M0Q A;  4J8L A;  3DRD A;  4GSA A;  3HVY A;  4PVF A;  2HUF A;  4XK1 A;  1M6S A;  3COG A;  5G4I A;  2EYQ A;  1S09 A;  3QM2 A;  4FL0 A;  1OHY A;  4ZWV A;  4K2B A;  1WKH A;  3K7Y A;  2DKB A;  4F5I A;  3MAD A;  4WYE A;  4LC3 A;  3NNK A;  4Y0D A;  5FT5 A;  3BWN C;  3K28 A;  2DGL A;  3E2Z A;  2JJH A;  4A6U A;  4ZSY A;  5M4D A;  2BIA A;  2YHK A;  3AEJ C;  4MSO A;  4JEY A;  1C7G A;  4Q76 A;  1IX7 A;  2O1B A;  3JW9 A;  3ZRR A;  1ASG A;  1C7N A;  3EZS A;  4DGT A;  1LC8 A;  2ZSM A;  1ASM A;  1YJZ A;  2ORD A;  2VIA A;  1BW0 A;  3MAF B;  4RLG A;  2CJD A;  2W7F A;  4XJP A;  4LW4 A;  5EUN A;  1IX8 A;  3H14 A;  4ISY A;  4L0O A;  2FQ6 A;  3OKS A;  2ZC0 A;  4W1V A;  3WCN A;  5LH9 A;  3TQX A;  2DGK A;  2R0T A;  4CXR A;  1KKP A;  3AEM C;  2AY2 A;  2BKW A;  4RKD A;  1DGE A;  1PG8 A;  3ATH A;  1BJO B;  2EH6 A;  1UKJ A;  1AHX A;  3F0H A;  3D6K A;  4K2M A;  5HDM A;  3B1E A;  1BJN A;  1AY4 A;  2JIS A;  4MKK A;  1WYV B;  5IWQ A;  1H0C A;  3GZD C;  3NYS A;  4XQ2 A;  4F5F A;  1BQD A;  1CJ0 A;  4PIW A;  5I92 A;  1TAR A;  1ASD A;  8AAT A;  1MAQ A;  2D66 A;  5M46 A;  1LS3 A;  4K05 A;  4UHN A;  3N7N A;  3LVK A;  3NUI A;  1DJE A;  3L44 A;  3E6G A;  3GWP A;  2D64 A;  4WB0 B;  4E3Q A;  1ECX A;  2OKK A;  3PD6 A;  1AJS B;  3DYD A;  1LKC A;  1UU1 A;  1N8P A;  1ARS A;  2HP1 A;  4GDY A;  4GE9 A;  4RJY A;  4RIT A;  4AZK A;  4JF0 A;  5EUD A;  3A2B A;  4KAM A;  1IJI A;  1O62 A;  4BQ0 A;  2VIB A;  1LW4 A;  5J8Q A;  4ADB A;  4UQV A;  2VMN A;  4IW7 A;  3JWA A;  1WKG A;  1T3I A;  3WKS A;  4MKJ A;  1O69 A;  3WZF A;  4BA5 A;  2VMP A;  4ZAH A;  1BJ4 A;  3FQ7 A;  1DKA A;  2AY9 A;  1BJW A;  1IAY A;  3FZ6 A;  1ELU A;  4XAU A;  3CAI A;  3NU7 A;  4WYA A;  1M0N A;  1W23 A;  1QIT A;  3GR9 A;  3A9Y A;  1W7L A;  2X5F A;  4WYC A;  3PD6 B;  1QGN A;  1SPA A;  4A0G A;  3LVL B;  4F5K A;  3ECD A;  1QJ3 A;  2VI8 A;  1TOJ A;  1DFO A;  1ASA A;  1CZC A;  2BI9 A;  5EAV A;  1DTY A;  2BI5 A;  2O7C A;  3JZL A;  5FT8 A;  1FG7 A;  1ZOD A;  2W7E A;  3B1C A;  4O6Z A;  2CST A;  4ZDL A;  1AHG A;  4RKC A;  3PGY A;  4R2N A;  5F8V A;  3W1J A;  2VGT A;  1S0A A;  4E3R A;  3LWS A;  2BYJ A;  2QLR A;  1ASC A;  1ARH A;  1WYT B;  2VMU A;  3PDB B;  3W1I A;  1O61 A;  3FQ8 A;  1V2E A;  1SZS A;  1IVR A;  4EMY A;  3AEO A;  1OHW A;  3HLM A;  2VMQ A;  4N0W A;  2AY4 A;  4ZM4 A;  2GMU A;  1GEX A;  2YRI A;  1PMM A;  1M0O A;  5DX5 A;  1IX6 A;  2CFB A;  4ZDP A;  1ART A;  3Q8N A;  4ADC A;  2QA3 A;  3KE3 A;  3QHX A;  3MC6 C;  4I8A A;  4JE5 D;  4R5F A;  3G7Q A;  3RBF A;  1C9C A;  5F9S A;  2JJF A;  2R2N A;  2CH2 A;  1S06 A;  1TPL A;  2BI3 A;  2VMS A;  3BV0 A;  5BJ4 A;  2BIG A;  4WD2 A;  3GET A;  2FNI A;  4IYO A;  4IXS A;  4EB5 A;  2ZY5 A;  2Z1Z A;  3EI5 A;  1U08 A;  1PMO A;  3FQA A;  3MAU A;  9AAT A;  3OP7 A;  4TN4 A;  4CBR A;  4P7Y A;  2AEU A;  4KYO A;  4W1W A;  2VGS A;  3BN1 A;  2KFP A;  4OTL A;  3W1H A;  1N2T A;  1DJU A;  4LNJ A;  4Q75 A;  1QJ5 A;  3QBO A;  1J32 A;  1UU0 A;  3EIB A;  4OMA A;  5DJ1 A;  2WK9 A;  3I5T A;  4AO4 A;  2CJH A;  1GC4 A;  3KKI A;  4IXZ A;  1WYU B;  4A6R A;  5DB5 A;  3VOM A;  3CQ6 A;  1CQ7 A;  3ELE A;  2Q7W A;  2HOR A;  4EFF A;  1RVU A;  3RBL A;  2HZP A;  1IAX A;  4JEV A;  2C81 A;  1DGD A;  1QIS A;  5D5S A;  3B8X A;  1SF2 A;  4IYO B;  1GCK A;  2D7Y A;  4ADE A;  3NUB A;  4IXO A;  1B4X A;  4UHO A;  5M49 A;  5AX8 A;  3N4S A;  3AEJ A;  1ASL A;  4JEW A;  4WP0 A;  2BI1 A;  4JF1 A;  2CB1 A;  4LW2 A;  4MGR A;  2ZY4 A;  3BCA A;  3RUY A;  2AY1 A;  2ZP7 A;  1D7S A;  1CZE A;  1P3W A;  2JG2 A;  3QN6 A;  5G4J A;  1EJI A;  1AY8 A;  2AAT A;  1VJO A;  2PO3 A;  1AHF A;  1GEY A;  5EIG A;  5K8B A;  5LHA A;  1RV3 A;  2ZYJ A;  1GEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...