4IXAA

Structure of dna-binding domain of the response regulator saer from staphylococcus epidermidis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
102
structure length
102
Chain Sequence
MEQLEFDGLVLKNLSKTLTINNIEIPMRIKEFELLWYLASREGEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEKHDFLPYTITTVWGLGYKFERSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of DNA-binding domain of the response regulator SaeR from Staphylococcus epidermidis
rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription
molecule keywords Response regulator SaeR
total genus 31
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ixaA00
5E18F 3O2PE 3FZVA 2D1VA 1DPUA 2EA2A 1KU9A 1XB4A 1JXSA 2FNPA 1FYKA 1BIBA 5ILVA 1T39A 2ZNZA 1YS7A 1IXCA 2ZFWA 2DTRA 3CUQA 3E6BA 4MTDA 4WWCA 4L18B 2F5DA 3WGGA 4KICA 3KLOA 5HOOA 1FBUA 2DLLA 5FGMA 4HW0A 1XSXA 4FX4A 1Z7UA 3KZZA 2OU2A 2FNAA 4P9FA 1XSVA 4I98B 2VBYA 4IHSA 2GIVA 5ED4A 4WXDA 2DPUA 3WODF 2K27A 1SD5A 5HS9A 3TO6A 3DF8A 3R0JA 4KIFA 3WG9A 2H94A 1U5TA 2ZKZA 3EUHA 3W6KB 2VC0A 3IWZA 4G8XA 2MA3A 4Q5SF 4A12A 3CO6C 1SD4A 3JSPA 2ETHA 1BI3A 1WI9A 3GVAA 4BHBA 1FSEA 3JW4A 4FT8A 2CWEA 3QP5A 2ZJ2A 3BJ6A 4GGGA 4YFNF 3QPHA 3TQNA 4A5MA 1R5GA 3FWEA 2W85A 1U3EM 4EGZA 4LFUA 1MJBA 2HGCA 2O0YA 2BGCA 3MZHA 4G6QA 5AIQA 3NRVA 2OQGA 4N0BA 5E20A 2VXZA 2COMA 3C3WA 3HRMA 1U5TC 4OIPF 4WXCA 3B02A 4R79A 2ZMEB 5D8LB 4Y15A 4CGZA 4UXNA 1RIOH 1X3UA 4LJZF 2Y0MA 4A6DA 1YW8A 1J0RA 4BHPA 2ACJA 1P2FA 2ZXJA 4BH9A 2X0LA 3O6BB 1IN5A 2EFNA 2XUBA 1HQCA 3R60A 3TGNA 1ZHFA 1EH7A 1FT9A 3GEZA 2DQRA 2MLGA 5FFXA 4KMUX 2QQAA 2LKPA 1T38A 2UWMA 1FP1D 5BQTA 2ZMEA 4A0YA 5CVVA 3J81K 1ZN2A 3HTSB 5LRRA 2FEZA 4RS8A 4ASNA 2DI3A 4HDUA 1MKMA 2EV5A 2GA2A 1HW1A 4EQQA 1REPC 3FX3A 4DQ2A 2UXXA 1XMKA 4KN4X 4JK1X 2P8TA 5JVTA 1WKMA 2PG4A 3JTGA 2F5FA 3EYIA 2J5OA 4N9IA 3T5XA 5E1WA 3IKVA 1ZLJA 2GA1A 1RUNA 2W84A 3N4MA 2W25A 1SFUA 2XVCA 4YG2F 4OU0A 5LBQA 2F5CA 3CTAA 4M6XA 2HWVA 3LAJA 3K69A 4M72A 4E70A 1ON1A 2R7DA 3HTUA 1R23A 5FO5A 4WF2A 2P7CB 2RGVA 1B6AA 1UHWA 1O7LA 2FE3A 1FWZA 3ABUA 1QO0D 3W6JB 3D5LA 4A0ZA 1WWXA 3GWZA 2IA2A 2FSWA 1P4XA 1I27A 2X4HA 4EJVA 4EM0B 3KFWX 5HVQC 4XRFA 2NAZA 3F8CA 4AVPA 4YFKF 1IRGA 4A6EA 1XN7A 1KYZA 1I1GA 2RQPA 3I71A 4OIQF 1ZG5A 5ILSA 2KIMA 3K1NA 4GCVA 1ZARA 4ZYHA 3WGHA 1CGPA 2JRTA 2K02A 3BY6A 3TDUC 2WV0A 2V1UA 1F4KA 4JBAA 4M9ZA 1OMIA 5HDKA 1FP2A 3M9AA 1PP8F 1S7OA 1MDMB 3NEUA 3WTSC 3OV8A 2DK8A 3DEUA 2FBIA 5BS6A 2EJRA 2CFXA 2VN2A 5ICEA 2W57A 1LQ1A 1IXRC 4LB6B 2VOPA 1OPCA 2YX4A 2Z33A 3O3KA 3MAJA 1MZBA 4RB3C 4ENJA 5BMZA 1DDNA 4U0VA 4ETSA 3I4PA 4GYIA 1GHCA 3BWGA 2PI0A 1O7FA 4MHGA 2QQ9A 3F3XA 1WQ2A 3MEXA 3CUQB 5EEHA 3S2WA 4O3MA 2M5WA 4WXHA 4HOBA 3HSRA 2VBXA 3F22A 4M6YA 1U2WA 1TNSA 4L9NA 1QNTA 4EJOA 1K78B 2GAUA 5E8GA 2XAFA 4I0BA 3REOA 3VOEA 1O3TA 4RGRA 2B0LA 1MGTA 5KK1A 3WU1B 1YIOA 3M1EA 1W4MA 5F64A 3KEOA 1UFMA 4ZH4F 5ICGA 1FYMA 4OIOF 1A04A 3FHZA 2MBFA 2MLKA 4R8HA 4XBFA 2R3SA 2QENA 3EYYA 5FFZA 3GFJA 4HQMA 1BI2A 1E2XA 3WE2A 4YFXF 2BE5F 5FD5A 3ULQB 3DQVC 2DT5A 3I59B 4IF4A 3U2RA 1PP7U 3RJPA 5IT9Z 1QQIA 2STTA 4EM2A 3DP7A 4UV8A 2VOOA 3K0LA 1JGSA 3WU0A 4UNOA 3CDHA 3E97A 2EV6A 2E7XA 2E1NA 1FY7A 2FRHA 1UCRA 3QU3A 1KQ8A 1U8RA 5L3GA 2MH9A 1IN4A 1ZAOA 3GYHX 1MJ9A 2RV8A 4I09A 4GXOA 2GWRA 2P6SA 3Q9VA 3GZ6A 2HS5A 4WCGA 2E7WA 3HRSA 2KJBA 2XKPA 3I59A 4AD9A 1ZG1A 3FXQA 4AIKA 4L0YB 3ZMZA 3BPVA 3L00A 2D2WA 2LSOA 3L9FA 4IRHA 5CVUA 4LLLA 3F8FA 4WX9A 2HYFA 1MJAA 3RYPA 1SD6A 4B09A 4EVIA 1G3YA 3CJNA 2NRAC 2DU9A 2DAOA 4M9SA 1YYVA 1ODDA 1W7PD 4ZYDA 1R7JA 4UVCA 1IAWA 3GUDA 3GFIA 3RI4A 4BAYA 1RNLA 3V7SA 5HS7A 2Z9OA 1O3RA 2IP2A 1H0MA 3MZYA 2VC1A 1DP7P 1T2KA 1IXSB 1YW9A 3WTTC 3L09A 3QRFF 3EETA 2VE8A 1S7AA 2IT0A 5HLIA 3SZTA 3TKYA 4KA4A 5AIPA 4FX0A 2G9WA 2IA0A 1RZ4A 1Z6TA 3SHFA 4KFCA 3BOQA 2QZ8A 4ZZDA 5E1ZB 4PCQA 1O3QA 4EJTA 1BJAA 4M73A 5LEKA 4KIBA 5FD6A 3ZMSA 3WGIA 3GX4X 4BQAA 2WWYA 5BPIA 5KVRA 4CXFA 2KIFA 1KU2A 2PEXA 4LB5A 1J7KA 2BEOA 1B9NA 4P96A 1J9IA 1KQ0A 4IRIA 1OYYA 4G7ZF 2F5EA 4UUVA 2K86A 1JE8A 3B73A 3F21A 4HX4A 2KKOA 2A69F 3IHUA 2XGXA 3RIRA 5ICCA 2EA4A 5IT3A 1O3SA 2FQ3A 2L4AA 5LHIA 1STZA 3SQNA 1TQPA 2H27A 3ZQ7A 1UHMA 2JZYA 4RGUA 2A68F 2EK5A 5DUKA 1G3WA 1ZG3A 4LMYA 1IF1A 3FM3A 1YS6A 2CSOA 1D5VA 3KP2A 1S6LA 1SFXA 2HYGD 2XRNA 4Y17A 2EWNA 2C6YA 3GXOA 3ML6A 3KP5A 2MD5A 1ZH5A 3HRTA 4BXUA 1HKQA 2L01A 3TDZC 5DEQA 2EV0A 3GF2A 1XGSA 4ENNA 3RPQA 2K4BA 4RGSA 4IRGA 4HDVA 5K5QA 3LA7A 1J5YA 2PFBA 1KA8A 5ICFA 4IXAA 3M7GA 1LB2A 2HKXA 4P5OA 1HKSA 4XLNF 2WC2A 1JHFA 3J80Z 4B8XA 2WTEA 3EDPA 3DPTA 5E17F 3F23A 2JSCA 2PMHA 4L0ZB 3P9IA 1YO5C 3T0YA 3SXYA 3RKWA 5F6FA 4Q48A 1K6OA 6PAXA 2LDUA 2IPQX 4KDPA 5K5OA 4KNYA 3HSEA 3ZMVA 2ZO4A 1EH8A 3ZMUA 1BC7C 2Z5UA 4L9TA 3C1DA 4KIGA 2OAZA 1NHAA 3FMSA 3F72A 3V7CA 2JT1A 4D0PA 3LWFA 1G4DA 1G3TA 2MH2A 4CO8A 4IVNA 2XAGA 4HLYA 2Z99A 2OBPA 3ZP5A 2HTJA 2EB7A 5LHHA 2L54A 4OINF 1XMAA 3KE2A 2YX7A 5IT9K 4HAMA 1LDJA 4S04A 2KJCA 1HW2A 2H6BA 1KQ9A 4GYGA 1RI7A 1QZYA 4HYEA 2OZ6A 2L3DA 1K79A 3DFGA 4NQWA 1KYWA 3K9TA 2HFHA 3R61A 3MFKA 2QBYA 2HDCA 4AWXB 3L2CA 4RB1A 4Q47A 3ZPLA 3Q5FA 3E3VA 3DXJF 2DO7A 1FOKA 4PGHA 4M71A 2D45A 1BN5A 5LHGA 3SZPA 3R4KA 1MDMA 2DFIA 2FU4A 1D8KA 3ERED 3HUGA 5HDNA 1EH6A 3IRRA 3I58A 1BM9A 4Y13A 1G3SA 4O6JA 1K78A 2O3FA 4F7ZA 3LSTA 5D4RA 3K1MA 4HZFA 2FF4A 1HXDA 2IW5A 4A5NA 4HBLA 1IN6A 4PZJA 5CVJA 3FMQA 4ZYEA 1BOAA 3ROUA 2EFPA 3V8LA 4U0WA 5D5UB 2A5YB 4U88A 1UB9A 4K2EA 1S29A 4EV0A 3ECOA 2VONA 3BP8A 1DPRA 2ESHA 3FXUA 2UXNA 3Q9SA 1U6GA 5D4SA 2PBIA 2VBWA 4I7HA 3HSFA 4LK1F 1R22A 2PN6A 2FMYA 2XV4S 1PUEE 5TRDA 1IZ1A 2OD5A 1FLIA 2KIUA 3EQLF 3T8TA 5E8IA 1ZYRF 3J80K 1P92A 4KT5C 1XCBA 4JQFA 2CW0F 2XKOA 1AOYA 2NNYA 3HIFA 2Y48A 3IL2A 2O6GE 1HW5A 3K1PA 3HHGA 1FYLA 2VODA 4G94A 1QZZA 4HV5A 1B1BA 3KZYA 3RTRA 3VB2A 2P4WA 4LLGF 4HF0A 5FLXZ 2STWA 2A3SA 4HA8A 1LNWA 2ZBKA 1P4WA 4L9VA 3F8MA 3R6SA 3G73A 4MEYF 5DYMA 3VEPA 2J5PA 5H6RA 2DQLA 3GO5A 2R7FA 5A2QK 4I01A 2HKOA 5HDGA 4EJUA 4YIIA 4HX7A 1FPQA 1IW7F 2Q0OA 2PJPA 4H0EA 1F1ZA 3ZMDA 2V1DA 2NS0A 3FM5A 3U9GA 5D5VB 2OZUA 2PLYA 1L3LA 5L3EA 1I1SA 2PQ8A 1FNNA 1CF7B 2IJLA 5AONA 3TO9A 1ZREA 1YLFA 3COAC 3CO7C 3HOTA 2HEOA 3KP6A 4YIFA 1P4AA 3BJOA 3DPLC 4P9UA 2XROA 2DPDA 1B59A 4G9YA 2ELHA 4CHUA 4HV6A 1LEBA 3WTVC 1J2XA 3U1DA 2CQKA 4KN7X 4CYDA 2A61A 3ELKA 5LEJA 1U78A 5CJ9A 1SD7A 4MEXF 2M8EA 3T8RA 3QAHA 1WRJA 2DBBA 2JTVA 1EV7A 5FB2A 3PFIA 1I6XA 5K1YA 1IRFA 1P6RA 3C7JA 1ULYA 1W5TA 2KRFA 2QM3A 3E5UA 3K2ZA 5DV5A 3BJAA 2NNNA 2E1CA 2Q8KA 2RDPA 3HYIA 3T1BA 4LG0A 1R00A 3F8BA 1J75A 1YTYA 5BPDA 3QU6A 2HR3A 4LD5A 2EFOA 2YU3A 1YG2A 3BZ6A 1T98A 3M8FA 4XLPF 1QGPA 3RKXA 5D6FA 1HKTA 2CO5A 1ZGJA 5ERIA 4L5JA 2V1XA 3FMRA 5CLSA 4LLNA 5HLGA 5J8CA 3DV8A 3JAMZ 2QYOA 5LGTA 5ILUA 2VT3A 1HSTA 3FF5A 1BI0A 3BDDA 4M74A 1FBQA 3VODA 2FBKA 1R1VA 2A07F 4MQ9F 1TW3A 4QWQA 1XD7A 4IHTA 4NHJA 3WTWC 2BYVE 5FLXK 2RN7A 1GVJA 3D0SA 1TBXA 4KYWA 1O57A 1LDDA 1R1UA 1FZPB 3LAPA 5K5RA 2DK5A 2A6HF 2JPCA 4LG0B 4EJWA 1BI1A 1TLHB 5DCMA 2YSRA 1R58A 5A2QZ 2K4JA 1JHHA 1U5TB 2HQRA 2P6TA 4L9JA 3KP7A 1XCVA 4MNUA 3HOSA 4P55A 1ZLKA 5HLHA 1ONVA 1USSA 5L3BA 5CYVA 3JAMK 1V3FA 4ON0A 2ZCWA 3KLNA 4MTEA 2CYYA 5DD4A 1YW7A 3ABTA 2GQQA 2O8XA 3I5UA 2RC4A 4I02A 3VFZA 3ZMTA 4CICA 5L3DA 4BHCA 1F5TA 3JSOA 1OYIA 3LA3A 2LF7A 1SFEA 4EGYA 2ISZA 1LVAA 1J59A 2AXLA 2FOKA 1W7PA 2Q2EA 1KU7A 2CGPA 5LLQA 3E5QA 3M8EA 1OR7A 3P9KA 4TV7A 1Y0UA 1IUYA 1YFHA 2BBYA 4G7OF 1KU3A 4M9XA 4BYYA 2XAQA 4LK0F 1OKRA 1FSHA 5TJJA 1XDUA 2V6CA 3TOBA 4AIHA 1TTYA 3CUOA 2K7LA 3TOAA 2H09A 1FC3A 3C18A 4KUMA 3MCZA 3H3UA 3DKWA 1TQIA 4XSXF 3NQOA 2F2EA 3I54A 1B4AA 5L3CA 3GFLA 4IPAA 3ECHA 2JPBA 2QLZA 4GO1A 4Z2YA 1T0FA 3R0AA 1R5HA 5JFRA 3WTYC 1C0WA 2M1BA 5CVIA 5J8FA 2VE9A 4ZYGA 4BNCA 2RVCA 3MWMA 1FBSA 3I0TA 2M45A 4L5IA 1I5ZA 4ESJA 2ESNA 1OYWA 4A2UA 3J7AO 3P9CA 1XSDA 2P7VB 3LQQA 5JHUA 5D5WB 3HRUA 2XASA 1USTA 3OOPA 2XAHA 1H9GA 1TNTA 2V9VA 2FMLA 4PDKA 3IC7A 1Z1DA 2P5LC 2IVMA 3H92A 4ENMA 3PQKA 5DUIA 1QPMA 5D5XB 5DCFA 2QBYB 3I53A 3IRQA 5H6QA 2GZWA 4OIRF 5E1XA 2L02A 3FXRA 2ZNYA 4RGXA 4PGGA 3V8KA 3RPUA 1R36A 3BPXA 3V8JA 3H3ZA 5JR3A 1CF7A 1L0OC 3E6MA 5HS8A 2LF8A 4UVBA 1ZGAA 3CLOA 1R1TA 5DDGA 4FHTA 2Z3YA 3KP4A 2FBHA 4N9HA 3BROA 1VTNC 4RAYA 3JTHA 1B9MA 1GXPA 5DD8A 4RAZA 4ESBA 1W5SA 1AWCA 5BOXA 5EEGA 3HHHA 4HQEA 3ZN0A 3GW2A 4R1HA 4OOIA 4UV9A 2A6EF 3RDIA 4OMZA 1D3YA 5LGUA 1BC8C 3QP6A 2VT2A 2O03A 2XAJA 3LA2A 3WTUC 2HZTA 2LNBA 4HX8A 1GXQA 1ON2A 1XGNA 1D8JA 4HF1A 1Z91A 1TW2A 4S05A 1Z9CA 2ADUA 3E5XA 4UHTA 2W24A 2QVOA 4CZZA 2ISYA 3G3ZA 4EM1A 5JI6A 2FA5A 1BBYA 2YR2A 5LRSA 3KP3A 4ZZLA 4KMFA 4I0AA 5L3FA 2Y75A 4I2OA 2L4MA 3F8NA 1RUOA 1SMYF 2PMUA 5LGNA 1SMTA 4NB5A 1XGMA 2EFWA 2UZKA 5H20A 3GZ5A 3F6OA 1K7AA 1Z05A 2QQBA 4RB0A 1HBXG 4HF2A 3I64A 3N97A 3L7WA 4IJAA 3KEQA 1LDKB 2XIGA 2YPRA 3ISPA 3KETA 1LEAA 4O5VA 3LQRA 1Z6RA 5D6EA 4U7BA 2IRFG 3AAFA 1IN7A 1LJ9A 3E6DA 5F1RA 3ZN1A 1DUXC 2DW4A 1W7PB 3SFZA 2GXGA 3WE3A 3J81Z 4MQVA 4QLCU 4ESFA 2FXAA 3CUQC 4LGWA 2XHKA 1KGSA 4U7DA 2P5KA 3RYRA 3QPTA 2IA1A 4XSZF 4HLXA 4MGRA 2HOEA 2EFQA 2QUFA 2BV6A 1F9NA 2D1HA 4WK8F 4CDGA 2O61A 1YQAA 5D8KB 2G7UA 1FX7A 1IN8A 3MQ0A 3IKTA 1MD0A 2RNJA 2GXBA 3PQJA 1SAXA 3IWFA 3E6CC 3LFKA 2H6CA 2VBZA 3P7NA 1ZRCA 3GLXA 2M87A 5CVRA 4U0YA 1XDSA 2AS5F 2G7HA 4G7HF 2MC3A 1T6SA 4Q4ZF 1ZRFA 1HSJA 3V4GA 1ZRDA 1BIAA 3TO7A 5DCMB 5J6XA 1XGOA 1S3JA 2QWWA 2RKHA 1Q1HA 4AIJA 1V4RA 2HTSA 3V7RA 2CG4A 3RKYA 3WTZA 4G6DA 1TQMA 1E17A 4OMYA 3F6VA 4A0XA 1PDNC 2TDXA 4DNCA 4RB2C 1QBJA 2NYXA 1H9TA 2V79A 2P5VA 3WTXC 1WSUA 1S8NA 3QOPA 2OQRA 1G6NA 3KCCA 3GFMA 2M30A 2OA4A 4UVAA 4EMSA 4ENKA 2HQNA
chains in the Genus database with same CATH superfamily
2HNHA 5E18F 3O2PE 2L2OA 4AIDA 3FZVA 2D1VA 4NC7A 4OWRB 2V1NA 1DPUA 2EA2A 3PNYA 1K61A 3QYEA 4MFEA 1KU9A 1XB4A 1VQ4I 1JXSA 1AU7A 2FNPA 3K4MA 2XAUA 1FYKA 1BIBA 1MW7A 3S1NJ 2E2IJ 5ILVA 1T39A 1UMQA 2ZNZA 1YS7A 5EYRA 3BQZA 2IS1A 1IXCA 2ZFWA 3DLLF 2DTRA 4IHVA 3CUQA 3L2VA 1S72I 1MMGA 2X9DA 2LH9A 3E6BA 1MSFC 2BY1A 3FDYA 2W48A 4MTDA 4HSTA 4B43A 1T56A 4WWCA 4L18B 4J00A 2F5DA 2ZMEC 1SFOJ 3WGGA 4KICA 3KLOA 5HOOA 1FBUA 1FOXA 2DLLA 1GLNA 1RKTA 3CESA 1T08B 4XLAA 1V55H 2CS3A 1LE8B 2L7MP 2M7BA 3FBIB 3SZGA 5FGMA 4HW0A 1XSXA 4FX4A 1Z7UA 4U87A 3L2UA 3HB9A 3AG1H 1IJWC 3HC7A 2P0WA 3KZZA 2OU2A 4J19A 2FNAA 3OOUA 4P9FA 1XSVA 4I98B 2VBYA 4C2TA 4IHSA 2XSJC 2GIVA 3BR5A 5ED4A 4WXDA 2DPUA 2YU9J 3WODF 5FLMJ 2K27A 2LP0A 1HF0A 5EZGA 1SD5A 4PSXA 4XRMA 1ITYA 5KAIC 1MMSA 5HS9A 3TO6A 4Y33A 1UELB 3DF8A 4D5FA 3L2QA 2Z2SB 3R0JA 4A3JJ 4XN0A 4KIFA 3WG9A 2H94A 3KYLA 3MN2A 4BDYA 1OLTA 4NQWB 4JX4A 1U5TA 2ZKZA 4BXXJ 5J40A 3EUHA 3W6KB 2VC0A 1JUSA 3IWZA 4G8XA 2MA3A 2DMPA 5B5EC 4A69C 4Q5SF 4ZDLA 2GBYA 3QYFA 2NVQJ 1QU3A 4RM3A 4A12A 3PJRA 2VL8A 3CO6C 1SD4A 3JSPA 2ETHA 1BI3A 1WI9A 3GVAA 1MNMC 4BHBA 1LVKA 2DA4A 1FSEA 2NOGA 3JW4A 3QYBA 5IPAA 4FT8A 2CWEA 2TCTA 3QP5A 2LFBA 3S3MA 2ZJ2A 2OCCH 3BJ6A 3HG9A 4GGGA 4YFNF 3QPHA 3HKZA 3TQNA 4A5MA 3HEFA 2LC2A 1R5GA 3FWEA 3H0GJ 2V9KA 1MH4A 2W85A 3OR1C 1U3EM 4EGZA 4C3JJ 4LFUA 3H36A 4A93J 1MJBA 2HGCA 2O0YA 2BGCA 3MZHA 2K9LA 4G6QA 2JQ7A 5AIQA 4PK4A 2LY1A 3VSLA 1WJCA 4KISA 2VJJA 3NRVA 2OQGA 4IHWA 2XF6A 1BW6A 1MBEA 4N0BA 5E20A 2VXZA 2COMA 3C3WA 5J1RA 4BE2A 3HRMA 1U5TC 1K83J 4OIPF 4WXCA 2KHMA 3S17J 2ME6A 3B02A 2XPVA 4R79A 2KFDA 5IP7J 1OCZH 4NC6A 1JKRC 2ZMEB 1LFPA 4IQ4A 5D8LB 4Y15A 4E7JA 1GT0C 4CGZA 2EQRA 4UXNA 1RIOH 1X3UA 3ASNH 3G1OA 2IGMA 2Y0MA 4LJZF 2NVUB 1YW8A 4A6DA 2M9HA 2HQAA 3OYNA 1J0RA 4BHPA 1OJLA 5GTHC 3ONQA 1D5YA 1UJ8A 2ACJA 1P2FA 4YELA 2ZXJA 4BH9A 2X0LA 3O6BB 1UAAA 1IN5A 1YJ9I 2EFNA 3NWTA 1MSEC 2XUBA 3PO2J 1HQCA 3R60A 3TGNA 1QVUA 1ZHFA 1EH7A 1FT9A 3DLAA 2W4SA 2DOAA 3GEZA 3OS2A 2DQRA 2MLGA 5FFXA 3HGGA 4KMUX 2QQAA 1IO2A 3OYAA 1D0XA 2LKPA 1T38A 2UWMA 3BCAA 2WBMA 1FP1D 5BQTA 4YRVA 2ZMEA 3JRCA 2WADA 2V9PA 3I4MJ 1Y0NA 4A0YA 1R71A 5CVVA 1B72B 2QCOA 2R4GA 3J81K 3BG6A 5IYBJ 1ZN2A 4CCLA 1IC8A 3O8GA 3HTSB 4G6TB 1T95A 4HRIA 4XONA 1VQNI 5LRRA 4E7KA 1NTCA 3GTKJ 3FBNB 2FEZA 4RS8A 3S93A 4ASNA 2DI3A 3H9QA 4HDUA 2HPMA 1MKMA 1U9OA 3OYDA 2EV5A 2GA2A 1HW1A 4EATA 2R7VA 5J4VA 4EQQA 3ZQHA 1REPC 3FX3A 3FK7A 2DJNA 4DQ2A 1K4SA 2UXXA 1XMKA 2OC6A 4KN4X 1TWCJ 5FKKA 2LY9A 4JK1X 2P8TA 4ZTFA 5TISC 5JVTA 1TL8A 1WKMA 2PG4A 3SFIA 5KCMA 3JTGA 5F0CA 2F5FA 3EYIA 4Y7NJ 1XS9A 2J5OA 4N9IA 3T5XA 3DTEA 3UR3C 3D5RC 2IGOA 5E1WA 3IKVA 4ANJA 4RBOA 1A35A 1ZLJA 2GA1A 3A01B 1RUNA 2W84A 3BZCA 5DM7F 3N4MA 3W3CA 1TWGJ 2W25A 2M4KA 4KJZA 1SFUA 2CQNA 2OUMA 2XVCA 4YG2F 4OU0A 5LBQA 2BOLA 4UUTA 2F5CA 3CCUI 3CTAA 4M6XA 1ZELA 2DFFA 2HWVA 2DFHA 4IOCF 3LAJA 3K69A 4M72A 4E70A 1OISA 2QEXI 1WJEA 1A6IA 1ON1A 2R7DA 3HTUA 1JUPA 2H8RA 4KITB 1R23A 5FO5A 5J1UA 4XIDA 3CCVI 2R7ZJ 4WF2A 2P7CB 4YEJA 5EF6A 2RGVA 1B6AA 1UHWA 2CQQA 1O7LA 2R93J 1YJWI 2R0QC 3JRAA 2FE3A 3CCSI 1Z0XA 4JX6A 4LIVA 1FWZA 3OYBA 2OTLI 2VQCA 3ABUA 4XNFA 3G71I 1A36A 3OYEA 1QO0D 3W6JB 3Q0VA 1XMXA 3D5LA 1WWXA 1S5LC 4A0ZA 3GWZA 2DA5A 3IH4A 3SYTA 2CW8A 2IA2A 2XGCA 2FSWA 1P4XA 1I27A 2LBFB 2X4HA 4EJVA 4EM0B 3KFWX 5HVQC 1TZLA 4BEHB 2XPWA 4XRFA 3WG7H 4IHXA 3CJTB 1SVOA 2NAZA 4NBQA 3F8CA 3AL0C 4AVPA 4YFKF 1IRGA 4GDFA 4A6EA 2IGNA 1XN7A 2DOEA 1KYZA 1I1GA 1V54H 3GLLA 2RQPA 4EEFG 1NG6A 3CMMA 3I71A 3IUOA 3MKLA 1ETOA 4A3MJ 1VQ7I 2HVSA 4OIQF 1ZG5A 1Y39A 3DPUA 5ILSA 2KIMA 1Y1VJ 2CQXA 3K1NA 4H4KC 4GCVA 1ZARA 2E19A 4ZYHA 1OCPA 3WGHA 4AYBN 1CGPA 4XOPA 2JRTA 2K02A 3OSGA 2GOMA 2K5CA 3BY6A 3TDUC 2WV0A 3IH3A 4RDUA 2V1UA 1K4TA 1F4KA 2VJ5A 4JBAA 4M9ZA 1OMIA 5HDKA 1FP2A 3M9AA 1PP8F 2AHQA 1S7OA 1YOVB 1MDMB 3BG5A 1QRYA 2O8KA 2R5YB 3NEUA 1IG7A 3FISA 3WTSC 5KHDA 3OV8A 2DK8A 2Y9YA 1OQYA 3DEUA 4XKBA 1SFKA 1VQ5I 2FBIA 5BS6A 2EJRA 3BR2A 2CFXA 2VN2A 5ICEA 2W57A 4XN3A 2ELJA 4E7LA 1LQ1A 3MVPA 4Y3OA 1IXRC 2L7FP 4LB6B 3DCFA 2VOPA 1OPCA 2BY2A 2YX4A 2Z33A 3M4OJ 1JKPC 3O3KA 4IHYA 3MAJA 1MZBA 4RB3C 4ENJA 5BMZA 2XSDC 4RLFA 2KRHA 1DDNA 2PJRA 4RM2A 4IOAF 4C2UA 4U0VA 4ETSA 4XLEA 3I4PA 4AC0A 3RKQA 1MMAA 1X2NA 4GYIA 1LE8A 1XTAA 1GHCA 1XC5A 3L2RA 3CDLA 3BWGA 1WCMJ 1O7FA 2H8WA 3BT9A 5K7ZA 2PI0A 1NK2P 4I76A 4MHGA 2CRGA 2CV0A 4M3FA 2EZKA 4CYCA 3DBRB 3DTKA 2QQ9A 3OYJA 4BS9A 3F3XA 1GDTA 3QQAA 1WQ2A 2ZJPF 3BG7A 3GTMJ 5IOYA 1D1BA 3HOZJ 2ZFUA 2R7SA 3MZ8A 3MEXA 3CUQB 5EEHA 3S2WA 4O3MA 2X6WA 1VQ9I 2M5WA 2CW7A 4WXHA 1ZTRA 4MO7A 2HU9A 4HOBA 2LREA 3HSRA 1I3QJ 2VBXA 3F22A 4M6YA 1U2WA 3PNVA 1TNSA 4L9NA 1QNTA 2FD5A 1I6HJ 2IS2A 1A5JA 4EJOA 1K78B 2COBA 3ZQIA 3AKZA 2GAUA 2F4IA 2OF7A 1VFCA 5E8GA 3UNGC 2QKMB 4CH7A 5F0HA 2X51A 3BR6A 2XAFA 4I0BA 3REOA 3VOEA 1O3TA 4RGRA 2B0LA 2VQHA 1MGTA 5KK1A 2R92J 2ECCA 3H9JA 3WU1B 4GFBA 1YIOA 3M1EA 1W4MA 5F64A 3KEOA 1UFMA 1XG1A 3C2GA 2ID3A 4ZH4F 5M5WJ 4A3DJ 5ICGA 1FYMA 4OIOF 1A04A 3FHZA 1FIPA 1X4OA 2JK3A 2MBFA 3CQZJ 2MLKA 4R8HA 2VPRA 4XBFA 2R3SA 2QENA 3EYYA 2HQ5A 3GFJA 5FFZA 4HQMA 5B1BH 1BI2A 2E1MC 2R7QA 1E2XA 3WE2A 4YFXF 2BE5F 5FD5A 3VDXA 4I6ZA 4HEA2 5CPRB 3ULQB 3DQVC 2DT5A 3I59B 4IF4A 3U2RA 1PP7U 3PL8A 3RJPA 5IT9Z 1QQIA 2STTA 4EM2A 3DP7A 4UV8A 2VOOA 3K0LA 1JGSA 3WU0A 4UNOA 3CDHA 3HXLA 4HSRA 3E97A 4X6AJ 2EV6A 4LIUA 2E7XA 2E1NA 3OYKA 2VKVA 4QTRA 1FY7A 2FRHA 2RAEA 1UCRA 5FKMA 4IZZA 3QU3A 1KQ8A 1U8RA 3JREA 3N05A 1X1CA 5L3GA 2MH9A 1IN4A 3MKYB 1ZAOA 3GYHX 1MJ9A 3M8JA 4QPQA 2RV8A 4I09A 1Z77A 4GXOA 2GWRA 2P6SA 4FETA 3ZQFA 3K4NA 1ETQA 3VYUB 2JMWA 4CUGA 1WH5A 3Q9VA 3GZ6A 3NAUA 2HS5A 2DT7B 4WCGA 3C2BA 3JCUC 3D1NI 2E7WA 3HRSA 4D7MA 2KJBA 2L0KA 2XKPA 4L5EA 3I59A 4AD9A 1ZG1A 1XPXA 3FXQA 4AIKA 4L0YB 3ZMZA 3BPVA 2V6EA 2W82A 1OCRH 2BY0A 2M4GA 3L00A 2E36A 4E6KG 2D2WA 3JRIA 9ANTA 2LSOA 3L9FA 4IRHA 5CVUA 4LLLA 3F8FA 4WX9A 5GAGJ 2HYFA 1MJAA 3RYPA 3QPLA 1SD6A 2VKEA 4B09A 3S8PA 4EVIA 1G3YA 1QA6A 2DODA 3CJNA 2NRAC 3S15J 2DU9A 2DAOA 2ICWG 3LSRA 3RQIA 4M9SA 1YYVA 5CQGA 2UV1A 1ODDA 1W7PD 4II3A 4ZYDA 4HG2A 3DU6A 4BU2A 1R7JA 2CUZA 4UVCA 4A3EJ 1IAWA 3GUDA 2BVLA 3GFIA 1HA8A 3KZIC 3RI4A 2X48A 1WVRA 2OJED 4BAYA 1LUJB 3H1CA 2PX9A 3FK6A 4P1WA 1RNLA 2JRMA 3V7SA 5HS7A 3TBIA 3RPUD 2Z9OA 1O4XA 1O3RA 3FXJA 3QWLA 2IP2A 3TW7A 3JR9A 1H0MA 3MZYA 2VC1A 1DP7P 1T2KA 1IXSB 1MBKA 3ABLH 5B1AH 1YW9A 3WTTC 1R4NB 3L09A 4J01A 4I99C 3EETA 3QRFF 1M1EB 2VE8A 3A2KA 1S7AA 3Q0UA 2IT0A 4C2MJ 2DOFA 4M3BA 1RKWA 1NK3P 1VZ0A 5HLIA 3SZTA 2XDVA 3TKYA 4KA4A 1HDPA 1KONA 3A01A 4D1QA 2Y30A 1R6RA 3ZGKA 4XK4A 3X2QH 5AIPA 4FX0A 2G9WA 5F1JA 2IA0A 1RZ4A 1Z6TA 2CUJA 3SHFA 5GPCA 4KFCA 3BTLA 2LOOA 3B6AA 3BOQA 2QZ8A 4ZZDA 5E1ZB 1Z3YA 1Z7LA 2M8GX 4PCQA 1O3QA 3S2HJ 3A4CA 4EJTA 2HVRA 3BTCA 1BJAA 2I8DA 4M73A 3HOVJ 4D5CA 3LSJA 5LEKA 4A3CJ 3CCRI 4KIBA 4AUXA 4BACA 2CV1A 5FD6A 3ZMSA 1ETVA 1VQKI 3WGIA 3GX4X 3S1RJ 4BQNA 4CCJA 1UZCA 4BQAA 2WWYA 5BPIA 2X6OA 5KVRA 2KIFA 4CXFA 1KU2A 2PEXA 4XM3A 4LB5A 1J7KA 2BEOA 1B9NA 4P96A 2VJIA 2IBDA 3TP3A 4Y4RA 1J9IA 5EGOA 1KQ0A 1IV6A 4IRIA 1OYYA 4G7ZF 3HOYJ 2JUCA 2F5EA 4UUVA 2ID6A 2K86A 4IKFA 1ZGWA 3J7ZI 3BTIA 3B73A 3F21A 1JE8A 2XB0X 4PJLA 4HX4A 3BQYA 2KKOA 3K4CA 1IDYA 2A69F 2XGXA 3IHUA 3RIRA 4B3AA 3K2AA 5ICCA 2EA4A 5IT3A 1O3SA 2FQ3A 2L4AA 5LHIA 4M3GA 2E2HJ 3K4JA 2NOJB 1STZA 2PMZA 3HDDA 3SQNA 3BG9A 1TQPA 4BY7J 2H27A 3ZQ7A 1UHMA 1I3AA 2JZYA 1YI2I 4RGUA 2A68F 2RNGA 2Y9ZA 2EK5A 5EZHA 4CSWA 4BJ5C 5DUKA 1G3WA 1PUFB 5M3FJ 1ZG3A 1X1PA 4LMYA 1IF1A 2DTZA 2E60A 4M3DA 3LSIA 3FM3A 2OCEA 3S16J 1YS6A 2CSOA 1D5VA 4QIWN 2DYSH 1I39A 3LMMA 2JN6A 3KP2A 1S6LA 2JUGA 1SFXA 3CP8A 2HYGD 3LSGA 4UUSA 1VQPI 2VJ4A 2XRNA 3HZJA 2DN0A 2KPMA 4Y17A 2EWNA 2C6YA 3GXOA 3ML6A 2MD0A 3GTLJ 3KP5A 2MD5A 1IDZA 1ZH5A 3UKGA 3FIWA 4M3EA 2KT0A 1X4PA 1QZEA 2KZGA 2E5NA 3HRTA 3LOCA 3A03A 4BXUA 1XX5A 1HKQA 2L01A 4OAZA 3TDZC 5DEQA 3GTGJ 2EV0A 2K9SA 2RREA 1TT0A 3I9V2 2F4OB 3A02A 3GF2A 1XGSA 3BTJA 3OYHA 3M1CA 4ENNA 3RPQA 2CJJA 3MKZA 2K4BA 2QF7A 4IRGA 4RGSA 5K5QA 4HDVA 3LA7A 3OIPA 2EBIA 1JJ6C 1J5YA 2PFBA 1ETXA 5GADJ 3G4SI 3HGYA 3VWBA 5K7HA 5H2FC 1KA8A 5ICFA 2VUMJ 3H5RA 4IXAA 4RAGA 3M7GA 4QSHA 2IAIA 3DBHB 3IAM2 3M07A 1LB2A 2HKXA 5EGOB 4P5OA 1HKSA 2WAQA 1AA7A 1DU0A 4XLNF 2WC2A 4A3BJ 1JHFA 1LFUP 3J80Z 1ETYA 2WV1A 4B8XA 3CCQI 3RCOA 2WTEA 1TP4A 3EDPA 2HXIA 3TEDA 3DPTA 3OYGA 1BL0A 3LL7A 5E17F 3GBGA 3TL4X 3F23A 2JSCA 3I4NJ 2PMHA 2E71A 4E7ZA 5FRMA 4L0ZB 1BR1A 3P9IA 4F3QA 2R7TA 1YO5C 1FMVA 3T0YA 2V4JC 3HOUJ 3SXYA 3RKWA 5F6FA 2M34A 4Q48A 4C9YA 1K6OA 6PAXA 4KT6A 2LDUA 2IPQX 4KDPA 5K5OA 4DZPA 2BHZA 4KNYA 4UUSB 5E3MA 4ABZA 2HVQA 1GVDA 2HYJA 2AQFA 2GOXB 3HSEA 3ZMVA 2ZO4A 1EH8A 3ZMUA 2CFOA 1BC7C 2Z5UA 1W0UA 3PIOF 4PFPA 3CCMI 4L9TA 3C1DA 4KIGA 2OAZA 2YS9A 2JVHA 2QGUA 2EILH 1NHAA 3FMSA 3F72A 3QPSA 3V7CA 2JT1A 1PUFA 1SEUA 4D0PA 3LWFA 4D9JA 1G4DA 3CF2A 4FE7A 1G3TA 4NUBA 4X0GA 2MH2A 4CO8A 4IVNA 2XAGA 4E7SA 4HLYA 3CCLI 4F92B 2Z99A 4FISA 2OBPA 4PJ0C 3ZP5A 2HTJA 2EB7A 5LHHA 2CV2A 2L54A 4OINF 1XMAA 1UHSA 3KE2A 4BXFA 2YX7A 5IT9K 2XGEA 4HAMA 1LDJA 4IEJA 4S04A 2KJCA 1HW2A 4CCMA 2H6BA 2MW8A 2ZSHB 1KQ9A 4GYGA 1RR7A 1RI7A 3ZQQA 5B66C 1QZYA 1RPWA 4HYEA 5DS9A 2A5WA 2OZ6A 1H89C 5LFAA 1RETA 2L3DA 1MNDA 1GUUA 3CCJI 1K79A 2HOSA 3DFGA 5F27A 1LPQA 4NQWA 5HODA 3K4KA 3LFUA 2HI3A 2VLAA 1KYWA 3K9TA 2HFHA 3R61A 3MFKA 3CJRB 2QBYA 2HDCA 4F91B 4AWXB 3L2CA 4RB1A 4Q47A 4RAFA 3ZPLA 3V42A 2BY3A 3Q5FA 3J7AY 3E3VA 3DXJF 2DO7A 3ZQGA 4IL6C 2DYRH 1FOKA 4PGHA 4M71A 2D45A 4RMNA 1BN5A 5LHGA 3SZPA 3CZ6A 4MIMA 3H5AA 1N77A 3R4KA 1MDMA 1FTZA 2QSHX 2DFIA 5C3EJ 2FU4A 1D8KA 3ERED 3HUGA 4A3FJ 3W2WA 5HDNA 2O9LA 1EH6A 1T0FC 3VYRB 3F9KA 3IRRA 3I58A 4XLFA 5HNHA 1BM9A 1X3WB 4Y13A 1G3SA 4O6JA 3ZQCA 1K78A 1Y6IA 2O3FA 3GMEA 4DZJA 4F7ZA 3LSTA 2XC7A 5D4RA 4CCKA 5TGTA 3K1MA 4HZFA 5GAHJ 2FF4A 1HXDA 1Z21A 4CCNA 2WY8Q 2IW5A 3HKZN 1QVTA 2LD5A 4A5NA 4HBLA 1IN6A 1ZKGA 4PZJA 5CVJA 4RA2A 2E2JJ 3FMQA 4ZYEA 1BOAA 3ROUA 1W36C 1HOMA 2EFPA 2EZLA 3V8LA 2MYSA 4NDLA 3CMYA 3K4LA 4U0WA 5D5UB 2A5YB 1NG7A 4U88A 4A3IJ 1UB9A 4K2EA 4BBRJ 1S29A 4EV0A 3ECOA 2VONA 3HM5A 3OL3A 2P81A 4GRIA 2NS8A 2VXDA 3BP8A 1DPRA 2ESHA 1BR2A 4XL9A 3S3NA 3FXUA 2UXNA 1W5CC 2L7KA 3Q9SA 1U6GA 5D4SA 2PBIA 2VBWA 2KDZA 2B9SA 4I7HA 3HSFA 4LK1F 1R22A 2PN6A 2FMYA 2XV4S 1PUEE 4Z6YA 3M3YJ 1SANA 2K9NA 4ZC3A 3GZNB 1FIAA 5TRDA 1ETWA 4UB8C 1IZ1A 2OD5A 1FLIA 2W7NA 1R49A 1D0YA 2KIUA 3EQLF 3T8TA 2VKHA 5E8IA 3CC4I 2WAEA 1ZYRF 3J80K 1P92A 4KT5C 3BC8A 1XCBA 4JQFA 2JA5J 2KZVA 1B8IA 2CW0F 2XKOA 3VPRA 1AOYA 2NNYA 1MIJA 3HIFA 1YRNB 3PIPF 1ERDA 2Y48A 4DW6A 5E3NA 1RC9A 3IL2A 2E34A 3IAS2 1U8BA 2O6GE 1HW5A 1N25A 3K1PA 3HHGA 1FEXA 4C3IJ 1FYLA 2VODA 1ZK8A 1WJFA 4G94A 2DA6A 2QKLB 1QZZA 3HJEA 2ZXHA 3G1LA 1EF4A 2LLKA 4HV5A 1B1BA 1WI3A 2Z16A 3KZYA 3RTRA 3VB2A 2P4WA 4LLGF 4HF0A 2K9MA 5FLXZ 2STWA 2A3SA 2EIJH 4HA8A 1BA5A 3DU5A 3I55I 3L2WA 1LNWA 2CUFA 2MGQA 2L9NA 2ZBKA 1DQUA 1P4WA 2L9SA 4L9VA 3F8MA 3R6SA 1MBHA 3DEEA 3G73A 2E1MB 3LSMA 1I50J 3HBLA 4MEYF 5DYMA 3VEPA 5IYCJ 4DYQA 2J5PA 2UUZA 5H6RA 2DQLA 3GO5A 2R7FA 5A2QK 3JRDA 4I01A 4X1EA 3CMEI 2HKOA 4ZYAA 2DJIA 2RQQA 5HDGA 4EJUA 4YIIA 4HX7A 1FPQA 3DEWA 3KYDB 1IW7F 1DU6A 2Q0OA 2PJPA 3MKWB 2KQRA 2VIXA 1FOYA 4XORA 4H0EA 3FXLA 1F1ZA 3KEYA 3ZMDA 4XOTA 1B72A 1W0TA 2V1DA 4HNUA 2QSGX 2NS0A 3FM5A 3S3OA 3U9GA 5D5VB 4IQJA 3F0CA 2DA7A 1DGRM 1APLC 2FQ4A 1CQTA 2CH0A 2OZUA 4JX5A 2PLYA 1L3LA 3GTOJ 5HNFA 4BE1A 3GTPJ 5J3LA 3ESWB 2JA7J 5L3EA 1I1SA 2PQ8A 1FNNA 1CF7B 2IJLA 3H5NA 5CQEA 5AONA 3TO9A 3HOXJ 4CA0A 1ZREA 2EZIA 1YLFA 4F52A 3COAC 3CO7C 3HOTA 2HEOA 3QOEA 3KP6A 4YIFA 4FCYA 3ZXSA 4BEHA 1P4AA 3U1KA 4DBRA 3BJOA 3DPLC 4P9UA 3D5SC 3CJQB 2XROA 2LMDA 2DPDA 1B59A 4JYKA 3OIQA 2W1OA 2BXYA 2IXSA 4G9YA 2ELHA 1Y8QB 4CHUA 4HV6A 1LEBA 3WTVC 1J2XA 3TMOA 3U1DA 2PJRB 2CQKA 2HXOA 1TT5B 4BGDA 2DT6A 4KN7X 3H0DA 5EG0A 4DJAA 4AYBA 2V7FA 2A61A 4PUSA 4CYDA 3ELKA 3RZDJ 5LEJA 1U78A 3GCMA 5CJ9A 5J4YA 1SD7A 1TWFJ 4MEXF 2ZXWH 2M8EA 3OL4A 3T8RA 2B63J 3QAHA 3BR1A 1WRJA 2DBBA 1R9TJ 3K70D 1JI8A 2JTVA 1S7EA 1EV7A 5FB2A 4D7NA 2XB5A 1JKOC 3PFIA 1I6XA 5FKLA 5GTIC 5K1YA 1IRFA 1P6RA 3C7JA 1ULYA 1W5TA 2KRFA 2QM3A 2MC4A 3E5UA 3K2ZA 5DV5A 3BJAA 5JLXA 1FTTA 2KRCA 2NNNA 4MLOA 1MBGA 4BE0A 3FKIJ 2E1CA 1P7JA 2FOWA 1BW5A 5IOZA 4ITVA 2Q8KA 2RDPA 3HYIA 4PJNA 3T1BA 1U9NA 4LG0A 3RQ4A 2AXTC 4YIRX 1P9QC 1D1AA 1TWHJ 1R00A 1JTXA 3F8BA 1H8AC 1J75A 1YTYA 3HOWJ 2VI6A 1IV8A 2VQGA 3QU6A 5BPDA 3PM1A 3LSHA 2HR3A 1MBFA 5M5YJ 3E0JB 4JP0A 1JT0A 4LD5A 2EFOA 2YU3A 1YG2A 3BZ6A 1T98A 3M8FA 2VKDA 2X1CA 1SVLA 5M5XJ 2WAFA 4XLPF 1AKHA 5HLTA 1QGPA 3RKXA 5D6FA 1BOBA 1V5EA 2GLOA 2KL4A 2CO5A 2A6TA 1HKTA 1ZGJA 5ERIA 4L5JA 1QHGA 2V1XA 3FMRA 4II2A 5CLSA 5HLGA 4LLNA 5J8CA 1Z67A 2H1KA 2R7UA 2F4MB 3DV8A 4UY8I 2PMZN 3JAMZ 2QYOA 5LGTA 3BR3A 1HC8A 5ILUA 2ELKA 2A05A 3EUHC 2KP6A 2VT3A 3OYFA 1HSTA 3NWSA 3SEZA 3FF5A 4XR6A 1BI0A 3QODA 2Y2ZA 1TC3C 4E7HA 3BDDA 2FJ1A 4M74A 1FBQA 2BW3B 3VODA 1GV2A 1Y56A 2XGDA 1YITI 2FBKA 1R1VA 2A07F 4MQ9F 1TW3A 1IUFA 4QWQA 4B1RA 4Y52J 1FMWA 1XD7A 3AFHA 5FKOA 3WTWC 2BYVE 4IHTA 4NHJA 3PUBA 5J47A 5FLXK 2RN7A 2XPUA 1GVJA 2LTPA 3D0SA 3JRGA 3PNTA 2E35A 1TBXA 4KYWA 1O57A 1JUMA 1LDDA 2EZHA 3JRBA 1R1UA 4CZCA 1FZPB 3LAPA 5K5RA 2DK5A 2A6HF 1POGA 1WFXA 2TRTA 4BUPA 3S1MJ 2R5YA 2JPCA 2JA8J 2R7RA 2JA2A 4HNTA 4LG0B 4EJWA 1ACIA 1BI1A 1MH3A 4B48A 4V19K 1G2HA 1TLHB 5DCMA 2YSRA 1R58A 4LITA 5A2QZ 1ZR4A 2K4JA 1JHHA 4N4OB 1LKXA 1U5TB 4XQFA 2HQRA 2P6TA 4L9JA 5C4JJ 3KP7A 3SJMA 1X1BA 1T33A 1XCVA 4B44A 4PJJA 4XKVA 4MNUA 3HOSA 2LY2A 2JA6J 4P55A 1ZLKA 5C4XJ 1X58A 1ONVA 1USSA 5HLHA 5L3BA 4BKXA 1OFCX 2KIQA 5CYVA 3JAMK 1EA3A 2L7ZA 1AHDP 1V3FA 4ON0A 2ZCWA 3KLNA 4MTEA 2EH3A 2KLOA 4F55A 1YJNI 2CYYA 5DD4A 1FOWA 1YW7A 3ABTA 1F43A 1PJRA 2GQQA 2Y0SN 1X3ZB 4JOMA 5CKTA 2O8XA 2G0EA 3AG3H 3I5UA 2XF5A 2RC4A 4I02A 3VFZA 2LR8A 3ZMTA 4CICA 2IS4A 1ORKA 1HDDC 5L3DA 4BHCA 1WGXA 1F5TA 3JSOA 1OYIA 1WJAA 3LA3A 4XKWA 2LF7A 1SFEA 4ZJZA 1E3OC 4EGYA 2MG4A 2GM4A 2ISZA 1LVAA 1X2MA 1D1CA 3W2AA 1J59A 2N8GA 2AXLA 1E3HA 4BQOA 2FOKA 1VI0A 3H9GA 3CF5F 2Z1DA 5IY5H 5LD2C 1LFBA 1YIJI 1W7PA 3KIOA 1PYVA 1VF9A 2Q2EA 1HLVA 1KU7A 2CGPA 5LLQA 5C44J 2E1OA 3BCBA 2QA4I 3H3VK 5K7FA 3E5QA 3M8EA 2R7XA 1OR7A 3P9KA 1UG0A 2K85A 3PUFA 4TV7A 1Y0UA 1IUYA 5GAEJ 1YFHA 2OPTA 2BBYA 4G7OF 2L9RA 1KU3A 2DCEA 2NVYJ 4M9XA 5DTDA 4BYYA 3K6GA 5E3OA 2XAQA 4LK0F 3B6CA 1OKRA 3BZKA 1B8IB 2Q1ZB 1FSHA 2M2EA 1WH7A 2LK2A 2DDBA 5TJJA 4DYCA 4HNVA 3KX2A 1XDUA 1EKEA 2XF7A 1WPKA 2M7AA 1N75A 2V6CA 3TOBA 4AIHA 1TTYA 2DXIA 3CUOA 2K7LA 3OIOA 4QPOA 3CP2A 3TOAA 3BLYA 2H09A 2WB1N 1FC3A 3C18A 4KUMA 3MCZA 1VQOI 3H3UA 2M0CA 3DKWA 1TQIA 2HOAA 3WHCA 1H88C 1X1AA 3DTIA 4XSXF 2JJ7A 3NQOA 5JHFA 1WJ5A 3FKJA 2F2EA 2IGKA 3I54A 1OCOH 4FTHA 3CCYA 1B4AA 2DA3A 2CMPA 5L3CA 2LKXA 1FJLA 1OCCH 3GFLA 2R5ZA 3LSKA 4IPAA 3ECHA 2MSYA 2JPBA 2QLZA 4GO1A 1SC7A 3MD2A 4Z2YA 3ZRGA 1T0FA 3R0AA 1WZ2A 1N78A 3AG4H 3O8HA 2MFZA 4NNJA 1R5HA 2WAQN 3AG2H 5JFRA 3WTYC 1C0WA 2BZTA 2M1BA 5CVIA 2X6XA 5J8FA 1J09A 3OMYA 2VE9A 1JT6A 4ZYGA 4M6VA 4BNCA 3VSKA 2RVCA 3MWMA 1FBSA 3I0TA 2KMUA 4AVZA 1JTYA 3HPHA 2M45A 4L5IA 2LKSA 1ZQ3P 1I5ZA 4ESJA 2ESNA 1OYWA 1RR8C 3H35A 2ZB9A 4A2UA 3J7AO 3P9CA 1XSDA 3CDIA 1SAUA 2P7VB 3LQQA 5E3LA 2NVXJ 5JHUA 5D5WB 2FX0A 2Q2EB 4RLQA 3HRUA 1NH3A 2XASA 2KISA 5M3MJ 3OR2C 1USTA 3OOPA 2XAHA 1W36D 4B3XA 3S1QJ 1H9GA 1TNTA 2V9VA 3ZR8X 2FMLA 4PDKA 3IC7A 1Z1DA 2P5LC 4XLHA 4AU7A 2IVMA 2LVSA 3H92A 5IYDJ 1K6YA 4ENMA 3Q3SA 2B7EA 2O5RA 3PQKA 1MMNA 1QPMA 5D5XB 5DUIA 3ZQLA 4V2GA 4A3KJ 5DCFA 4A3GJ 2QBYB 3G6EI 1EJ9A 3I53A 2BXZA 3PSFA 3TW6A 3IRQA 3JRFA 5H6QA 2GZWA 4OIRF 4XKCA 2E5ZA 3G1MA 2X1DA 5E1XA 4IO9F 2KDOA 3A0HC 1UG2A 2L02A 3PSIA 3FXRA 5EDNA 2HZDA 2ZNYA 4RGXA 4PGGA 5FKNA 1IGNA 3V8KA 3RPUA 5FJ8J 5JLWA 5FLVA 1VQLI 5BNGA 1R36A 4XLCA 5IP6A 2JVGA 3BPXA 1ZR2A 2WY7Q 3V8JA 4DOZA 4XRSA 3SEQA 3H3ZA 1ENHA 3GTQJ 4CCOA 2X1EA 5JR3A 3IV5A 1CF7A 1L0OC 1WHUA 3E6MA 5HS8A 3OS0A 4BL0B 2LF8A 2MABA 4UVBA 2NVTJ 1ZGAA 3CLOA 1R1TA 2EIMH 5F08A 4ZTJA 2GXAA 1DP3A 2HPIA 5DDGA 3CMAI 4FHTA 2Z3YA 1VQMI 1Z3XA 4N4NB 3FXOA 4UB6C 3KP4A 4MFDA 2WB1A 1X19A 2FBHA 4LOCA 3I56I 4N9HA 3RSNA 5B3SH 3BROA 5EEAA 2DDAA 1S9HA 3K70C 1VTNC 4RAYA 1PVEA 1IRZA 3I3LA 3G2BA 3JTHA 1B9MA 1GXPA 2YUSA 5DD8A 4RAZA 4FQGA 2EINH 1MNEA 4ESBA 1P7IA 1W5SA 3E1SA 1AWCA 2R7OA 2ZJRF 5BOXA 2F6CA 1Q1VA 3KPHA 1ETKA 2HOTA 3S32A 1RRJA 2BHYA 5EEGA 3HHHA 2Y69H 4BJTA 4HQEA 3ZN0A 3W2VA 3GW2A 4R1HA 2VASA 4OOIA 1MMDA 1V5FA 1A31A 4BBSJ 2ZXIA 4UV9A 2A6EF 4DBQA 3RDIA 4OMZA 1D3YA 2VPLA 1YHQI 5LGUA 1BC8C 3QP6A 2VT2A 2O03A 1F36A 5EG0B 1JJ8C 1JKQC 2XAJA 5IP9J 2DA1A 3LA2A 3WTUC 2HZTA 2LNBA 3C2HA 5F04A 2OTJI 4HX8A 2W00A 1GV5A 2I5UA 2LYCA 1W1WE 2NXNB 4PFOA 3WU2C 1GXQA 1JGGA 1ON2A 3ERMA 1V5GA 1XGNA 1D8JA 4HF1A 3BG3A 3Q0WA 2FUG2 2X85A 5GPAA 1Z91A 1TW2A 4B47A 4S05A 1Z9CA 4E7IA 2ADUA 4IX7A 4BY1J 3E5XA 4UHTA 2W24A 2QVOA 4CZZA 2ISYA 3G3ZA 4EM1A 5JI6A 2FA5A 1BBYA 2YR2A 3IH2A 2V26A 5LRSA 3KP3A 4ZZLA 1HCRA 4KMFA 1IRXA 1BJZA 3OYMA 4I0AA 2GIZA 2Y75A 5E79C 5L3FA 4I2OA 2L4MA 3F8NA 2L9VA 1RUOA 1SMYF 2PMUA 5LGNA 4DYRA 2K9QA 4E4HA 1SMTA 2X6YA 2CU7A 4F93B 3A0BC 4NB5A 1G59A 1XGMA 3VYTB 2EFWA 2UZKA 5H20A 3GZ5A 3F6OA 2JWTA 1K7AA 2JSPA 3DWLE 1Z05A 2QQBA 3J7YJ 3FHNA 4RB0A 2R7WA 2ME0A 3ZOBA 1TWAJ 3PO3J 2QQ8A 1HBXG 4HF2A 2CQ7A 2DMNA 2BW3A 5FROA 5F0FA 3I64A 3OYLA 2M3AA 3N97A 3L7WA 5GP9A 4IJAA 3JRHA 4AM3A 3U21A 3FXKA 2OV7A 1AKHB 2F5VA 3KEQA 2IS6A 1LDKB 2XIGA 2YPRA 4BDZA 2I10A 3ISPA 3KETA 3EUAA 1LEAA 4O5VA 3CD6I 3LQRA 1Z6RA 5D6EA 4U7BA 1BR4A 1QPIA 2IRFG 4PJMA 3EUKL 2D5VA 3VYSB 3AAFA 4XRSG 1IN7A 3DKXA 3EPZA 1Y8RB 1LJ9A 3E6DA 5F1RA 3ZN1A 2K3FA 4S0HB 1E0EA 1DUXC 2K3PA 2DW4A 4NC8A 1W7PB 4HPQA 2L5QA 3SFZA 5KNLA 2GXGA 3WE3A 3J81Z 4MQVA 2DMTA 3CCEI 4QLCU 4FASD 1Y1WJ 2DMQA 4ESFA 2FXAA 3OWTA 3CUQC 4LGWA 1U0JA 2XHKA 3K7AJ 3OSFA 1KGSA 4U7DA 2VQLA 1YX3A 1QHHD 2P5KA 1X1DA 2XRLA 2QSFX 1E3PA 3RYRA 3TP0A 3AL0B 1A6QA 1YE9A 3PFYA 3QPTA 2IA1A 4OAYA 4XSZF 1WJDA 3ASOH 3K10A 4HLXA 2LG4A 4MGRA 2HOEA 1R4MB 1YX5A 2Y0SA 2EFQA 2LRDA 2AQEA 4W97A 1R5ID 2QUFA 2BV6A 1F9NA 2D1HA 4WK8F 3LSPA 1OCTC 3HL2A 2ZSIB 4CDGA 2WA0A 2O61A 2LBFA 1VQ8I 1YQAA 5D8KB 4XICA 2G7UA 4W1UA 4XMYA 2ECBA 1FX7A 1IN8A 3MQ0A 2DA2A 3NARA 4FE4A 3IKTA 2HDDA 1MD0A 2H1LA 1VQ6I 2RNJA 2EPFA 4LG3A 3SDBA 3S14J 2F48A 3KYCB 1KZHA 3OYCA 2GXBA 3PQJA 1SAXA 3IWFA 3WHBA 3E6CC 4PSWA 3OYIA 3ZCOA 3IP4B 2DFEA 3LFKA 4DGWB 1G8XA 3S2DJ 1VNDA 2H6CA 4V2FA 2VBZA 3MMYB 5EJCA 3P7NA 1ZRCA 3GLXA 1WJBA 5JVGF 2HDWA 2M87A 4DIQA 2NS7A 3K4BA 3CC2I 5CVRA 4U0YA 1XDSA 3W6VA 2AS5F 3RZOJ 3LNQA 2G7HA 4G7HF 2MC3A 1T6SA 4Q4ZF 4BQQA 3OY9A 1ZRFA 4CYCB 1HSJA 3DKYA 3V4GA 1ZRDA 1DGWY 1MBJA 2Y31A 1BIAA 3SDGA 5FRNA 4C30A 3TO7A 5DCMB 1T8IA 3FXMA 3HUGB 4G12A 5J6XA 4BJ6C 1SVMA 1XGOA 2EIKH 3HPGA 2O7OA 3CC7I 1S3JA 2QWWA 2ZJQF 2RKHA 1Q1HA 4AIJA 1V4RA 2HTSA 3V7RA 3OS1A 2CG4A 3RKYA 3WTZA 4A3LJ 4G6DA 2ZC2A 3ABMH 1TQMA 1E17A 1RESA 4OMYA 3F6VA 4A0XA 4ZDOA 2K40A 1OR7C 2IEKA 2TDXA 4B4CA 2BVMA 4DNCA 2NYXA 4RB2C 1PDNC 1QBJA 1H9TA 3P5JA 1YRNA 2V79A 2CUEA 3DBLB 4ZDPA 3L1PA 5DM6F 2P5VA 3WTXC 1WSUA 1S8NA 5KAFC 3QOPA 2OQRA 1D0ZA 3ABKH 1G6NA 3KCCA 3GFMA 2M30A 2OA4A 2VB6A 3CLQA 2M0MA 2R5ZB 4UVAA 4C3HJ 4EMSA 4ENKA 2AO9A 3GTJJ 3A1YA 3BR0A 2DMUA 5J1YA 3E7LA 2HQNA
chains in the Genus database with same CATH topology
5E18F 3O2PE 3FZVA 2D1VA 1DPUA 2EA2A 1KU9A 1XB4A 1JXSA 2FNPA 1FYKA 1BIBA 5ILVA 1T39A 2ZNZA 1YS7A 1IXCA 2ZFWA 2DTRA 3CUQA 3E6BA 4MTDA 4WWCA 4L18B 2F5DA 3WGGA 4KICA 3KLOA 5HOOA 1FBUA 2DLLA 5FGMA 4HW0A 1XSXA 4FX4A 1Z7UA 3KZZA 2OU2A 2FNAA 4P9FA 1XSVA 4I98B 2VBYA 4IHSA 2GIVA 5ED4A 4WXDA 2DPUA 3WODF 2K27A 1SD5A 5HS9A 3TO6A 3DF8A 3R0JA 4KIFA 3WG9A 2H94A 1U5TA 2ZKZA 3EUHA 3W6KB 2VC0A 3IWZA 4G8XA 2MA3A 4Q5SF 4A12A 3CO6C 1SD4A 3JSPA 2ETHA 1BI3A 1WI9A 3GVAA 4BHBA 1FSEA 3JW4A 4FT8A 2CWEA 3QP5A 2ZJ2A 3BJ6A 4GGGA 4YFNF 3QPHA 3TQNA 4A5MA 1R5GA 3FWEA 2W85A 1U3EM 4EGZA 4LFUA 1MJBA 2HGCA 2O0YA 2BGCA 3MZHA 4G6QA 5AIQA 3NRVA 2OQGA 4N0BA 5E20A 2VXZA 2COMA 3C3WA 3HRMA 1U5TC 4OIPF 4WXCA 3B02A 4R79A 2ZMEB 5D8LB 4Y15A 4CGZA 4UXNA 1RIOH 1X3UA 4LJZF 2Y0MA 4A6DA 1YW8A 1J0RA 4BHPA 2ACJA 1P2FA 2ZXJA 4BH9A 2X0LA 3O6BB 1IN5A 2EFNA 2XUBA 1HQCA 3R60A 3TGNA 1ZHFA 1EH7A 1FT9A 3GEZA 2DQRA 2MLGA 5FFXA 4KMUX 2QQAA 2LKPA 1T38A 2UWMA 1FP1D 5BQTA 2ZMEA 4A0YA 5CVVA 3J81K 1ZN2A 3HTSB 5LRRA 2FEZA 4RS8A 4ASNA 2DI3A 4HDUA 1MKMA 2EV5A 2GA2A 1HW1A 4EQQA 1REPC 3FX3A 4DQ2A 2UXXA 1XMKA 4KN4X 4JK1X 2P8TA 5JVTA 1WKMA 2PG4A 3JTGA 2F5FA 3EYIA 2J5OA 4N9IA 3T5XA 5E1WA 3IKVA 1ZLJA 2GA1A 1RUNA 2W84A 3N4MA 2W25A 1SFUA 2XVCA 4YG2F 4OU0A 5LBQA 2F5CA 3CTAA 4M6XA 2HWVA 3LAJA 3K69A 4M72A 4E70A 1ON1A 2R7DA 3HTUA 1R23A 5FO5A 4WF2A 2P7CB 2RGVA 1B6AA 1UHWA 1O7LA 2FE3A 1FWZA 3ABUA 1QO0D 3W6JB 3D5LA 4A0ZA 1WWXA 3GWZA 2IA2A 2FSWA 1P4XA 1I27A 2X4HA 4EJVA 4EM0B 3KFWX 5HVQC 4XRFA 2NAZA 3F8CA 4AVPA 4YFKF 1IRGA 4A6EA 1XN7A 1KYZA 1I1GA 2RQPA 3I71A 4OIQF 1ZG5A 5ILSA 2KIMA 3K1NA 4GCVA 1ZARA 4ZYHA 3WGHA 1CGPA 2JRTA 2K02A 3BY6A 3TDUC 2WV0A 2V1UA 1F4KA 4JBAA 4M9ZA 1OMIA 5HDKA 1FP2A 3M9AA 1PP8F 1S7OA 1MDMB 3NEUA 3WTSC 3OV8A 2DK8A 3DEUA 2FBIA 5BS6A 2EJRA 2CFXA 2VN2A 5ICEA 2W57A 1LQ1A 1IXRC 4LB6B 2VOPA 1OPCA 2YX4A 2Z33A 3O3KA 3MAJA 1MZBA 4RB3C 4ENJA 5BMZA 1DDNA 4U0VA 4ETSA 3I4PA 4GYIA 1GHCA 3BWGA 2PI0A 1O7FA 4MHGA 2QQ9A 3F3XA 1WQ2A 3MEXA 3CUQB 5EEHA 3S2WA 4O3MA 2M5WA 4WXHA 4HOBA 3HSRA 2VBXA 3F22A 4M6YA 1U2WA 1TNSA 4L9NA 1QNTA 4EJOA 1K78B 2GAUA 5E8GA 2XAFA 4I0BA 3REOA 3VOEA 1O3TA 4RGRA 2B0LA 1MGTA 5KK1A 3WU1B 1YIOA 3M1EA 1W4MA 5F64A 3KEOA 1UFMA 4ZH4F 5ICGA 1FYMA 4OIOF 1A04A 3FHZA 2MBFA 2MLKA 4R8HA 4XBFA 2R3SA 2QENA 3EYYA 5FFZA 3GFJA 4HQMA 1BI2A 1E2XA 3WE2A 4YFXF 2BE5F 5FD5A 3ULQB 3DQVC 2DT5A 3I59B 4IF4A 3U2RA 1PP7U 3RJPA 5IT9Z 1QQIA 2STTA 4EM2A 3DP7A 4UV8A 2VOOA 3K0LA 1JGSA 3WU0A 4UNOA 3CDHA 3E97A 2EV6A 2E7XA 2E1NA 1FY7A 2FRHA 1UCRA 3QU3A 1KQ8A 1U8RA 5L3GA 2MH9A 1IN4A 1ZAOA 3GYHX 1MJ9A 2RV8A 4I09A 4GXOA 2GWRA 2P6SA 3Q9VA 3GZ6A 2HS5A 4WCGA 2E7WA 3HRSA 2KJBA 2XKPA 3I59A 4AD9A 1ZG1A 3FXQA 4AIKA 4L0YB 3ZMZA 3BPVA 3L00A 2D2WA 2LSOA 3L9FA 4IRHA 5CVUA 4LLLA 3F8FA 4WX9A 2HYFA 1MJAA 3RYPA 1SD6A 4B09A 4EVIA 1G3YA 3CJNA 2NRAC 2DU9A 2DAOA 4M9SA 1YYVA 1ODDA 1W7PD 4ZYDA 1R7JA 4UVCA 1IAWA 3GUDA 3GFIA 3RI4A 4BAYA 1RNLA 3V7SA 5HS7A 2Z9OA 1O3RA 2IP2A 1H0MA 3MZYA 2VC1A 1DP7P 1T2KA 1IXSB 1YW9A 3WTTC 3L09A 3QRFF 3EETA 2VE8A 1S7AA 2IT0A 5HLIA 3SZTA 3TKYA 4KA4A 5AIPA 4FX0A 2G9WA 2IA0A 1RZ4A 1Z6TA 3SHFA 4KFCA 3BOQA 2QZ8A 4ZZDA 5E1ZB 4PCQA 1O3QA 4EJTA 1BJAA 4M73A 5LEKA 4KIBA 5FD6A 3ZMSA 3WGIA 3GX4X 4BQAA 2WWYA 5BPIA 5KVRA 4CXFA 2KIFA 1KU2A 2PEXA 4LB5A 1J7KA 2BEOA 1B9NA 4P96A 1J9IA 1KQ0A 4IRIA 1OYYA 4G7ZF 2F5EA 4UUVA 2K86A 1JE8A 3B73A 3F21A 4HX4A 2KKOA 2A69F 3IHUA 2XGXA 3RIRA 5ICCA 2EA4A 5IT3A 1O3SA 2FQ3A 2L4AA 5LHIA 1STZA 3SQNA 1TQPA 2H27A 3ZQ7A 1UHMA 2JZYA 4RGUA 2A68F 2EK5A 5DUKA 1G3WA 1ZG3A 4LMYA 1IF1A 3FM3A 1YS6A 2CSOA 1D5VA 3KP2A 1S6LA 1SFXA 2HYGD 2XRNA 4Y17A 2EWNA 2C6YA 3GXOA 3ML6A 3KP5A 2MD5A 1ZH5A 3HRTA 4BXUA 1HKQA 2L01A 3TDZC 5DEQA 2EV0A 3GF2A 1XGSA 4ENNA 3RPQA 2K4BA 4RGSA 4IRGA 4HDVA 5K5QA 3LA7A 1J5YA 2PFBA 1KA8A 5ICFA 4IXAA 3M7GA 1LB2A 2HKXA 4P5OA 1HKSA 4XLNF 2WC2A 1JHFA 3J80Z 4B8XA 2WTEA 3EDPA 3DPTA 5E17F 3F23A 2JSCA 2PMHA 4L0ZB 3P9IA 1YO5C 3T0YA 3SXYA 3RKWA 5F6FA 4Q48A 1K6OA 6PAXA 2LDUA 2IPQX 4KDPA 5K5OA 4KNYA 3HSEA 3ZMVA 2ZO4A 1EH8A 3ZMUA 1BC7C 2Z5UA 4L9TA 3C1DA 4KIGA 2OAZA 1NHAA 3FMSA 3F72A 3V7CA 2JT1A 4D0PA 3LWFA 1G4DA 1G3TA 2MH2A 4CO8A 4IVNA 2XAGA 4HLYA 2Z99A 2OBPA 3ZP5A 2HTJA 2EB7A 5LHHA 2L54A 4OINF 1XMAA 3KE2A 2YX7A 5IT9K 4HAMA 1LDJA 4S04A 2KJCA 1HW2A 2H6BA 1KQ9A 4GYGA 1RI7A 1QZYA 4HYEA 2OZ6A 2L3DA 1K79A 3DFGA 4NQWA 1KYWA 3K9TA 2HFHA 3R61A 3MFKA 2QBYA 2HDCA 4AWXB 3L2CA 4RB1A 4Q47A 3ZPLA 3Q5FA 3E3VA 3DXJF 2DO7A 1FOKA 4PGHA 4M71A 2D45A 1BN5A 5LHGA 3SZPA 3R4KA 1MDMA 2DFIA 2FU4A 1D8KA 3ERED 3HUGA 5HDNA 1EH6A 3IRRA 3I58A 1BM9A 4Y13A 1G3SA 4O6JA 1K78A 2O3FA 4F7ZA 3LSTA 5D4RA 3K1MA 4HZFA 2FF4A 1HXDA 2IW5A 4A5NA 4HBLA 1IN6A 4PZJA 5CVJA 3FMQA 4ZYEA 1BOAA 3ROUA 2EFPA 3V8LA 4U0WA 5D5UB 2A5YB 4U88A 1UB9A 4K2EA 1S29A 4EV0A 3ECOA 2VONA 3BP8A 1DPRA 2ESHA 3FXUA 2UXNA 3Q9SA 1U6GA 5D4SA 2PBIA 2VBWA 4I7HA 3HSFA 4LK1F 1R22A 2PN6A 2FMYA 2XV4S 1PUEE 5TRDA 1IZ1A 2OD5A 1FLIA 2KIUA 3EQLF 3T8TA 5E8IA 1ZYRF 3J80K 1P92A 4KT5C 1XCBA 4JQFA 2CW0F 2XKOA 1AOYA 2NNYA 3HIFA 2Y48A 3IL2A 2O6GE 1HW5A 3K1PA 3HHGA 1FYLA 2VODA 4G94A 1QZZA 4HV5A 1B1BA 3KZYA 3RTRA 3VB2A 2P4WA 4LLGF 4HF0A 5FLXZ 2STWA 2A3SA 4HA8A 1LNWA 2ZBKA 1P4WA 4L9VA 3F8MA 3R6SA 3G73A 4MEYF 5DYMA 3VEPA 2J5PA 5H6RA 2DQLA 3GO5A 2R7FA 5A2QK 4I01A 2HKOA 5HDGA 4EJUA 4YIIA 4HX7A 1FPQA 1IW7F 2Q0OA 2PJPA 4H0EA 1F1ZA 3ZMDA 2V1DA 2NS0A 3FM5A 3U9GA 5D5VB 2OZUA 2PLYA 1L3LA 5L3EA 1I1SA 2PQ8A 1FNNA 1CF7B 2IJLA 5AONA 3TO9A 1ZREA 1YLFA 3COAC 3CO7C 3HOTA 2HEOA 3KP6A 4YIFA 1P4AA 3BJOA 3DPLC 4P9UA 2XROA 2DPDA 1B59A 4G9YA 2ELHA 4CHUA 4HV6A 1LEBA 3WTVC 1J2XA 3U1DA 2CQKA 4KN7X 4CYDA 2A61A 3ELKA 5LEJA 1U78A 5CJ9A 1SD7A 4MEXF 2M8EA 3T8RA 3QAHA 1WRJA 2DBBA 2JTVA 1EV7A 5FB2A 3PFIA 1I6XA 5K1YA 1IRFA 1P6RA 3C7JA 1ULYA 1W5TA 2KRFA 2QM3A 3E5UA 3K2ZA 5DV5A 3BJAA 2NNNA 2E1CA 2Q8KA 2RDPA 3HYIA 3T1BA 4LG0A 1R00A 3F8BA 1J75A 1YTYA 5BPDA 3QU6A 2HR3A 4LD5A 2EFOA 2YU3A 1YG2A 3BZ6A 1T98A 3M8FA 4XLPF 1QGPA 3RKXA 5D6FA 1HKTA 2CO5A 1ZGJA 5ERIA 4L5JA 2V1XA 3FMRA 5CLSA 4LLNA 5HLGA 5J8CA 3DV8A 3JAMZ 2QYOA 5LGTA 5ILUA 2VT3A 1HSTA 3FF5A 1BI0A 3BDDA 4M74A 1FBQA 3VODA 2FBKA 1R1VA 2A07F 4MQ9F 1TW3A 4QWQA 1XD7A 4IHTA 4NHJA 3WTWC 2BYVE 5FLXK 2RN7A 1GVJA 3D0SA 1TBXA 4KYWA 1O57A 1LDDA 1R1UA 1FZPB 3LAPA 5K5RA 2DK5A 2A6HF 2JPCA 4LG0B 4EJWA 1BI1A 1TLHB 5DCMA 2YSRA 1R58A 5A2QZ 2K4JA 1JHHA 1U5TB 2HQRA 2P6TA 4L9JA 3KP7A 1XCVA 4MNUA 3HOSA 4P55A 1ZLKA 5HLHA 1ONVA 1USSA 5L3BA 5CYVA 3JAMK 1V3FA 4ON0A 2ZCWA 3KLNA 4MTEA 2CYYA 5DD4A 1YW7A 3ABTA 2GQQA 2O8XA 3I5UA 2RC4A 4I02A 3VFZA 3ZMTA 4CICA 5L3DA 4BHCA 1F5TA 3JSOA 1OYIA 3LA3A 2LF7A 1SFEA 4EGYA 2ISZA 1LVAA 1J59A 2AXLA 2FOKA 1W7PA 2Q2EA 1KU7A 2CGPA 5LLQA 3E5QA 3M8EA 1OR7A 3P9KA 4TV7A 1Y0UA 1IUYA 1YFHA 2BBYA 4G7OF 1KU3A 4M9XA 4BYYA 2XAQA 4LK0F 1OKRA 1FSHA 5TJJA 1XDUA 2V6CA 3TOBA 4AIHA 1TTYA 3CUOA 2K7LA 3TOAA 2H09A 1FC3A 3C18A 4KUMA 3MCZA 3H3UA 3DKWA 1TQIA 4XSXF 3NQOA 2F2EA 3I54A 1B4AA 5L3CA 3GFLA 4IPAA 3ECHA 2JPBA 2QLZA 4GO1A 4Z2YA 1T0FA 3R0AA 1R5HA 5JFRA 3WTYC 1C0WA 2M1BA 5CVIA 5J8FA 2VE9A 4ZYGA 4BNCA 2RVCA 3MWMA 1FBSA 3I0TA 2M45A 4L5IA 1I5ZA 4ESJA 2ESNA 1OYWA 4A2UA 3J7AO 3P9CA 1XSDA 2P7VB 3LQQA 5JHUA 5D5WB 3HRUA 2XASA 1USTA 3OOPA 2XAHA 1H9GA 1TNTA 2V9VA 2FMLA 4PDKA 3IC7A 1Z1DA 2P5LC 2IVMA 3H92A 4ENMA 3PQKA 5DUIA 1QPMA 5D5XB 5DCFA 2QBYB 3I53A 3IRQA 5H6QA 2GZWA 4OIRF 5E1XA 2L02A 3FXRA 2ZNYA 4RGXA 4PGGA 3V8KA 3RPUA 1R36A 3BPXA 3V8JA 3H3ZA 5JR3A 1CF7A 1L0OC 3E6MA 5HS8A 2LF8A 4UVBA 1ZGAA 3CLOA 1R1TA 5DDGA 4FHTA 2Z3YA 3KP4A 2FBHA 4N9HA 3BROA 1VTNC 4RAYA 3JTHA 1B9MA 1GXPA 5DD8A 4RAZA 4ESBA 1W5SA 1AWCA 5BOXA 5EEGA 3HHHA 4HQEA 3ZN0A 3GW2A 4R1HA 4OOIA 4UV9A 2A6EF 3RDIA 4OMZA 1D3YA 5LGUA 1BC8C 3QP6A 2VT2A 2O03A 2XAJA 3LA2A 3WTUC 2HZTA 2LNBA 4HX8A 1GXQA 1ON2A 1XGNA 1D8JA 4HF1A 1Z91A 1TW2A 4S05A 1Z9CA 2ADUA 3E5XA 4UHTA 2W24A 2QVOA 4CZZA 2ISYA 3G3ZA 4EM1A 5JI6A 2FA5A 1BBYA 2YR2A 5LRSA 3KP3A 4ZZLA 4KMFA 4I0AA 5L3FA 2Y75A 4I2OA 2L4MA 3F8NA 1RUOA 1SMYF 2PMUA 5LGNA 1SMTA 4NB5A 1XGMA 2EFWA 2UZKA 5H20A 3GZ5A 3F6OA 1K7AA 1Z05A 2QQBA 4RB0A 1HBXG 4HF2A 3I64A 3N97A 3L7WA 4IJAA 3KEQA 1LDKB 2XIGA 2YPRA 3ISPA 3KETA 1LEAA 4O5VA 3LQRA 1Z6RA 5D6EA 4U7BA 2IRFG 3AAFA 1IN7A 1LJ9A 3E6DA 5F1RA 3ZN1A 1DUXC 2DW4A 1W7PB 3SFZA 2GXGA 3WE3A 3J81Z 4MQVA 4QLCU 4ESFA 2FXAA 3CUQC 4LGWA 2XHKA 1KGSA 4U7DA 2P5KA 3RYRA 3QPTA 2IA1A 4XSZF 4HLXA 4MGRA 2HOEA 2EFQA 2QUFA 2BV6A 1F9NA 2D1HA 4WK8F 4CDGA 2O61A 1YQAA 5D8KB 2G7UA 1FX7A 1IN8A 3MQ0A 3IKTA 1MD0A 2RNJA 2GXBA 3PQJA 1SAXA 3IWFA 3E6CC 3LFKA 2H6CA 2VBZA 3P7NA 1ZRCA 3GLXA 2M87A 5CVRA 4U0YA 1XDSA 2AS5F 2G7HA 4G7HF 2MC3A 1T6SA 4Q4ZF 1ZRFA 1HSJA 3V4GA 1ZRDA 1BIAA 3TO7A 5DCMB 5J6XA 1XGOA 1S3JA 2QWWA 2RKHA 1Q1HA 4AIJA 1V4RA 2HTSA 3V7RA 2CG4A 3RKYA 3WTZA 4G6DA 1TQMA 1E17A 4OMYA 3F6VA 4A0XA 1PDNC 2TDXA 4DNCA 4RB2C 1QBJA 2NYXA 1H9TA 2V79A 2P5VA 3WTXC 1WSUA 1S8NA 3QOPA 2OQRA 1G6NA 3KCCA 3GFMA 2M30A 2OA4A 4UVAA 4EMSA 4ENKA 2HQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E18 F;  3O2P E;  3FZV A;  2D1V A;  1DPU A;  2EA2 A;  1KU9 A;  1XB4 A;  1JXS A;  2FNP A;  1FYK A;  1BIB A;  5ILV A;  1T39 A;  2ZNZ A;  1YS7 A;  1IXC A;  2ZFW A;  2DTR A;  3CUQ A;  3E6B A;  4MTD A;  4WWC A;  4L18 B;  2F5D A;  3WGG A;  4KIC A;  3KLO A;  5HOO A;  1FBU A;  2DLL A;  5FGM A;  4HW0 A;  1XSX A;  4FX4 A;  1Z7U A;  3KZZ A;  2OU2 A;  2FNA A;  4P9F A;  1XSV A;  4I98 B;  2VBY A;  4IHS A;  2GIV A;  5ED4 A;  4WXD A;  2DPU A;  3WOD F;  2K27 A;  1SD5 A;  5HS9 A;  3TO6 A;  3DF8 A;  3R0J A;  4KIF A;  3WG9 A;  2H94 A;  1U5T A;  2ZKZ A;  3EUH A;  3W6K B;  2VC0 A;  3IWZ A;  4G8X A;  2MA3 A;  4Q5S F;  4A12 A;  3CO6 C;  1SD4 A;  3JSP A;  2ETH A;  1BI3 A;  1WI9 A;  3GVA A;  4BHB A;  1FSE A;  3JW4 A;  4FT8 A;  2CWE A;  3QP5 A;  2ZJ2 A;  3BJ6 A;  4GGG A;  4YFN F;  3QPH A;  3TQN A;  4A5M A;  1R5G A;  3FWE A;  2W85 A;  1U3E M;  4EGZ A;  4LFU A;  1MJB A;  2HGC A;  2O0Y A;  2BGC A;  3MZH A;  4G6Q A;  5AIQ A;  3NRV A;  2OQG A;  4N0B A;  5E20 A;  2VXZ A;  2COM A;  3C3W A;  3HRM A;  1U5T C;  4OIP F;  4WXC A;  3B02 A;  4R79 A;  2ZME B;  5D8L B;  4Y15 A;  4CGZ A;  4UXN A;  1RIO H;  1X3U A;  4LJZ F;  2Y0M A;  4A6D A;  1YW8 A;  1J0R A;  4BHP A;  2ACJ A;  1P2F A;  2ZXJ A;  4BH9 A;  2X0L A;  3O6B B;  1IN5 A;  2EFN A;  2XUB A;  1HQC A;  3R60 A;  3TGN A;  1ZHF A;  1EH7 A;  1FT9 A;  3GEZ A;  2DQR A;  2MLG A;  5FFX A;  4KMU X;  2QQA A;  2LKP A;  1T38 A;  2UWM A;  1FP1 D;  5BQT A;  2ZME A;  4A0Y A;  5CVV A;  3J81 K;  1ZN2 A;  3HTS B;  5LRR A;  2FEZ A;  4RS8 A;  4ASN A;  2DI3 A;  4HDU A;  1MKM A;  2EV5 A;  2GA2 A;  1HW1 A;  4EQQ A;  1REP C;  3FX3 A;  4DQ2 A;  2UXX A;  1XMK A;  4KN4 X;  4JK1 X;  2P8T A;  5JVT A;  1WKM A;  2PG4 A;  3JTG A;  2F5F A;  3EYI A;  2J5O A;  4N9I A;  3T5X A;  5E1W A;  3IKV A;  1ZLJ A;  2GA1 A;  1RUN A;  2W84 A;  3N4M A;  2W25 A;  1SFU A;  2XVC A;  4YG2 F;  4OU0 A;  5LBQ A;  2F5C A;  3CTA A;  4M6X A;  2HWV A;  3LAJ A;  3K69 A;  4M72 A;  4E70 A;  1ON1 A;  2R7D A;  3HTU A;  1R23 A;  5FO5 A;  4WF2 A;  2P7C B;  2RGV A;  1B6A A;  1UHW A;  1O7L A;  2FE3 A;  1FWZ A;  3ABU A;  1QO0 D;  3W6J B;  3D5L A;  4A0Z A;  1WWX A;  3GWZ A;  2IA2 A;  2FSW A;  1P4X A;  1I27 A;  2X4H A;  4EJV A;  4EM0 B;  3KFW X;  5HVQ C;  4XRF A;  2NAZ A;  3F8C A;  4AVP A;  4YFK F;  1IRG A;  4A6E A;  1XN7 A;  1KYZ A;  1I1G A;  2RQP A;  3I71 A;  4OIQ F;  1ZG5 A;  5ILS A;  2KIM A;  3K1N A;  4GCV A;  1ZAR A;  4ZYH A;  3WGH A;  1CGP A;  2JRT A;  2K02 A;  3BY6 A;  3TDU C;  2WV0 A;  2V1U A;  1F4K A;  4JBA A;  4M9Z A;  1OMI A;  5HDK A;  1FP2 A;  3M9A A;  1PP8 F;  1S7O A;  1MDM B;  3NEU A;  3WTS C;  3OV8 A;  2DK8 A;  3DEU A;  2FBI A;  5BS6 A;  2EJR A;  2CFX A;  2VN2 A;  5ICE A;  2W57 A;  1LQ1 A;  1IXR C;  4LB6 B;  2VOP A;  1OPC A;  2YX4 A;  2Z33 A;  3O3K A;  3MAJ A;  1MZB A;  4RB3 C;  4ENJ A;  5BMZ A;  1DDN A;  4U0V A;  4ETS A;  3I4P A;  4GYI A;  1GHC A;  3BWG A;  2PI0 A;  1O7F A;  4MHG A;  2QQ9 A;  3F3X A;  1WQ2 A;  3MEX A;  3CUQ B;  5EEH A;  3S2W A;  4O3M A;  2M5W A;  4WXH A;  4HOB A;  3HSR A;  2VBX A;  3F22 A;  4M6Y A;  1U2W A;  1TNS A;  4L9N A;  1QNT A;  4EJO A;  1K78 B;  2GAU A;  5E8G A;  2XAF A;  4I0B A;  3REO A;  3VOE A;  1O3T A;  4RGR A;  2B0L A;  1MGT A;  5KK1 A;  3WU1 B;  1YIO A;  3M1E A;  1W4M A;  5F64 A;  3KEO A;  1UFM A;  4ZH4 F;  5ICG A;  1FYM A;  4OIO F;  1A04 A;  3FHZ A;  2MBF A;  2MLK A;  4R8H A;  4XBF A;  2R3S A;  2QEN A;  3EYY A;  5FFZ A;  3GFJ A;  4HQM A;  1BI2 A;  1E2X A;  3WE2 A;  4YFX F;  2BE5 F;  5FD5 A;  3ULQ B;  3DQV C;  2DT5 A;  3I59 B;  4IF4 A;  3U2R A;  1PP7 U;  3RJP A;  5IT9 Z;  1QQI A;  2STT A;  4EM2 A;  3DP7 A;  4UV8 A;  2VOO A;  3K0L A;  1JGS A;  3WU0 A;  4UNO A;  3CDH A;  3E97 A;  2EV6 A;  2E7X A;  2E1N A;  1FY7 A;  2FRH A;  1UCR A;  3QU3 A;  1KQ8 A;  1U8R A;  5L3G A;  2MH9 A;  1IN4 A;  1ZAO A;  3GYH X;  1MJ9 A;  2RV8 A;  4I09 A;  4GXO A;  2GWR A;  2P6S A;  3Q9V A;  3GZ6 A;  2HS5 A;  4WCG A;  2E7W A;  3HRS A;  2KJB A;  2XKP A;  3I59 A;  4AD9 A;  1ZG1 A;  3FXQ A;  4AIK A;  4L0Y B;  3ZMZ A;  3BPV A;  3L00 A;  2D2W A;  2LSO A;  3L9F A;  4IRH A;  5CVU A;  4LLL A;  3F8F A;  4WX9 A;  2HYF A;  1MJA A;  3RYP A;  1SD6 A;  4B09 A;  4EVI A;  1G3Y A;  3CJN A;  2NRA C;  2DU9 A;  2DAO A;  4M9S A;  1YYV A;  1ODD A;  1W7P D;  4ZYD A;  1R7J A;  4UVC A;  1IAW A;  3GUD A;  3GFI A;  3RI4 A;  4BAY A;  1RNL A;  3V7S A;  5HS7 A;  2Z9O A;  1O3R A;  2IP2 A;  1H0M A;  3MZY A;  2VC1 A;  1DP7 P;  1T2K A;  1IXS B;  1YW9 A;  3WTT C;  3L09 A;  3QRF F;  3EET A;  2VE8 A;  1S7A A;  2IT0 A;  5HLI A;  3SZT A;  3TKY A;  4KA4 A;  5AIP A;  4FX0 A;  2G9W A;  2IA0 A;  1RZ4 A;  1Z6T A;  3SHF A;  4KFC A;  3BOQ A;  2QZ8 A;  4ZZD A;  5E1Z B;  4PCQ A;  1O3Q A;  4EJT A;  1BJA A;  4M73 A;  5LEK A;  4KIB A;  5FD6 A;  3ZMS A;  3WGI A;  3GX4 X;  4BQA A;  2WWY A;  5BPI A;  5KVR A;  4CXF A;  2KIF A;  1KU2 A;  2PEX A;  4LB5 A;  1J7K A;  2BEO A;  1B9N A;  4P96 A;  1J9I A;  1KQ0 A;  4IRI A;  1OYY A;  4G7Z F;  2F5E A;  4UUV A;  2K86 A;  1JE8 A;  3B73 A;  3F21 A;  4HX4 A;  2KKO A;  2A69 F;  3IHU A;  2XGX A;  3RIR A;  5ICC A;  2EA4 A;  5IT3 A;  1O3S A;  2FQ3 A;  2L4A A;  5LHI A;  1STZ A;  3SQN A;  1TQP A;  2H27 A;  3ZQ7 A;  1UHM A;  2JZY A;  4RGU A;  2A68 F;  2EK5 A;  5DUK A;  1G3W A;  1ZG3 A;  4LMY A;  1IF1 A;  3FM3 A;  1YS6 A;  2CSO A;  1D5V A;  3KP2 A;  1S6L A;  1SFX A;  2HYG D;  2XRN A;  4Y17 A;  2EWN A;  2C6Y A;  3GXO A;  3ML6 A;  3KP5 A;  2MD5 A;  1ZH5 A;  3HRT A;  4BXU A;  1HKQ A;  2L01 A;  3TDZ C;  5DEQ A;  2EV0 A;  3GF2 A;  1XGS A;  4ENN A;  3RPQ A;  2K4B A;  4RGS A;  4IRG A;  4HDV A;  5K5Q A;  3LA7 A;  1J5Y A;  2PFB A;  1KA8 A;  5ICF A;  4IXA A;  3M7G A;  1LB2 A;  2HKX A;  4P5O A;  1HKS A;  4XLN F;  2WC2 A;  1JHF A;  3J80 Z;  4B8X A;  2WTE A;  3EDP A;  3DPT A;  5E17 F;  3F23 A;  2JSC A;  2PMH A;  4L0Z B;  3P9I A;  1YO5 C;  3T0Y A;  3SXY A;  3RKW A;  5F6F A;  4Q48 A;  1K6O A;  6PAX A;  2LDU A;  2IPQ X;  4KDP A;  5K5O A;  4KNY A;  3HSE A;  3ZMV A;  2ZO4 A;  1EH8 A;  3ZMU A;  1BC7 C;  2Z5U A;  4L9T A;  3C1D A;  4KIG A;  2OAZ A;  1NHA A;  3FMS A;  3F72 A;  3V7C A;  2JT1 A;  4D0P A;  3LWF A;  1G4D A;  1G3T A;  2MH2 A;  4CO8 A;  4IVN A;  2XAG A;  4HLY A;  2Z99 A;  2OBP A;  3ZP5 A;  2HTJ A;  2EB7 A;  5LHH A;  2L54 A;  4OIN F;  1XMA A;  3KE2 A;  2YX7 A;  5IT9 K;  4HAM A;  1LDJ A;  4S04 A;  2KJC A;  1HW2 A;  2H6B A;  1KQ9 A;  4GYG A;  1RI7 A;  1QZY A;  4HYE A;  2OZ6 A;  2L3D A;  1K79 A;  3DFG A;  4NQW A;  1KYW A;  3K9T A;  2HFH A;  3R61 A;  3MFK A;  2QBY A;  2HDC A;  4AWX B;  3L2C A;  4RB1 A;  4Q47 A;  3ZPL A;  3Q5F A;  3E3V A;  3DXJ F;  2DO7 A;  1FOK A;  4PGH A;  4M71 A;  2D45 A;  1BN5 A;  5LHG A;  3SZP A;  3R4K A;  1MDM A;  2DFI A;  2FU4 A;  1D8K A;  3ERE D;  3HUG A;  5HDN A;  1EH6 A;  3IRR A;  3I58 A;  1BM9 A;  4Y13 A;  1G3S A;  4O6J A;  1K78 A;  2O3F A;  4F7Z A;  3LST A;  5D4R A;  3K1M A;  4HZF A;  2FF4 A;  1HXD A;  2IW5 A;  4A5N A;  4HBL A;  1IN6 A;  4PZJ A;  5CVJ A;  3FMQ A;  4ZYE A;  1BOA A;  3ROU A;  2EFP A;  3V8L A;  4U0W A;  5D5U B;  2A5Y B;  4U88 A;  1UB9 A;  4K2E A;  1S29 A;  4EV0 A;  3ECO A;  2VON A;  3BP8 A;  1DPR A;  2ESH A;  3FXU A;  2UXN A;  3Q9S A;  1U6G A;  5D4S A;  2PBI A;  2VBW A;  4I7H A;  3HSF A;  4LK1 F;  1R22 A;  2PN6 A;  2FMY A;  2XV4 S;  1PUE E;  5TRD A;  1IZ1 A;  2OD5 A;  1FLI A;  2KIU A;  3EQL F;  3T8T A;  5E8I A;  1ZYR F;  3J80 K;  1P92 A;  4KT5 C;  1XCB A;  4JQF A;  2CW0 F;  2XKO A;  1AOY A;  2NNY A;  3HIF A;  2Y48 A;  3IL2 A;  2O6G E;  1HW5 A;  3K1P A;  3HHG A;  1FYL A;  2VOD A;  4G94 A;  1QZZ A;  4HV5 A;  1B1B A;  3KZY A;  3RTR A;  3VB2 A;  2P4W A;  4LLG F;  4HF0 A;  5FLX Z;  2STW A;  2A3S A;  4HA8 A;  1LNW A;  2ZBK A;  1P4W A;  4L9V A;  3F8M A;  3R6S A;  3G73 A;  4MEY F;  5DYM A;  3VEP A;  2J5P A;  5H6R A;  2DQL A;  3GO5 A;  2R7F A;  5A2Q K;  4I01 A;  2HKO A;  5HDG A;  4EJU A;  4YII A;  4HX7 A;  1FPQ A;  1IW7 F;  2Q0O A;  2PJP A;  4H0E A;  1F1Z A;  3ZMD A;  2V1D A;  2NS0 A;  3FM5 A;  3U9G A;  5D5V B;  2OZU A;  2PLY A;  1L3L A;  5L3E A;  1I1S A;  2PQ8 A;  1FNN A;  1CF7 B;  2IJL A;  5AON A;  3TO9 A;  1ZRE A;  1YLF A;  3COA C;  3CO7 C;  3HOT A;  2HEO A;  3KP6 A;  4YIF A;  1P4A A;  3BJO A;  3DPL C;  4P9U A;  2XRO A;  2DPD A;  1B59 A;  4G9Y A;  2ELH A;  4CHU A;  4HV6 A;  1LEB A;  3WTV C;  1J2X A;  3U1D A;  2CQK A;  4KN7 X;  4CYD A;  2A61 A;  3ELK A;  5LEJ A;  1U78 A;  5CJ9 A;  1SD7 A;  4MEX F;  2M8E A;  3T8R A;  3QAH A;  1WRJ A;  2DBB A;  2JTV A;  1EV7 A;  5FB2 A;  3PFI A;  1I6X A;  5K1Y A;  1IRF A;  1P6R A;  3C7J A;  1ULY A;  1W5T A;  2KRF A;  2QM3 A;  3E5U A;  3K2Z A;  5DV5 A;  3BJA A;  2NNN A;  2E1C A;  2Q8K A;  2RDP A;  3HYI A;  3T1B A;  4LG0 A;  1R00 A;  3F8B A;  1J75 A;  1YTY A;  5BPD A;  3QU6 A;  2HR3 A;  4LD5 A;  2EFO A;  2YU3 A;  1YG2 A;  3BZ6 A;  1T98 A;  3M8F A;  4XLP F;  1QGP A;  3RKX A;  5D6F A;  1HKT A;  2CO5 A;  1ZGJ A;  5ERI A;  4L5J A;  2V1X A;  3FMR A;  5CLS A;  4LLN A;  5HLG A;  5J8C A;  3DV8 A;  3JAM Z;  2QYO A;  5LGT A;  5ILU A;  2VT3 A;  1HST A;  3FF5 A;  1BI0 A;  3BDD A;  4M74 A;  1FBQ A;  3VOD A;  2FBK A;  1R1V A;  2A07 F;  4MQ9 F;  1TW3 A;  4QWQ A;  1XD7 A;  4IHT A;  4NHJ A;  3WTW C;  2BYV E;  5FLX K;  2RN7 A;  1GVJ A;  3D0S A;  1TBX A;  4KYW A;  1O57 A;  1LDD A;  1R1U A;  1FZP B;  3LAP A;  5K5R A;  2DK5 A;  2A6H F;  2JPC A;  4LG0 B;  4EJW A;  1BI1 A;  1TLH B;  5DCM A;  2YSR A;  1R58 A;  5A2Q Z;  2K4J A;  1JHH A;  1U5T B;  2HQR A;  2P6T A;  4L9J A;  3KP7 A;  1XCV A;  4MNU A;  3HOS A;  4P55 A;  1ZLK A;  5HLH A;  1ONV A;  1USS A;  5L3B A;  5CYV A;  3JAM K;  1V3F A;  4ON0 A;  2ZCW A;  3KLN A;  4MTE A;  2CYY A;  5DD4 A;  1YW7 A;  3ABT A;  2GQQ A;  2O8X A;  3I5U A;  2RC4 A;  4I02 A;  3VFZ A;  3ZMT A;  4CIC A;  5L3D A;  4BHC A;  1F5T A;  3JSO A;  1OYI A;  3LA3 A;  2LF7 A;  1SFE A;  4EGY A;  2ISZ A;  1LVA A;  1J59 A;  2AXL A;  2FOK A;  1W7P A;  2Q2E A;  1KU7 A;  2CGP A;  5LLQ A;  3E5Q A;  3M8E A;  1OR7 A;  3P9K A;  4TV7 A;  1Y0U A;  1IUY A;  1YFH A;  2BBY A;  4G7O F;  1KU3 A;  4M9X A;  4BYY A;  2XAQ A;  4LK0 F;  1OKR A;  1FSH A;  5TJJ A;  1XDU A;  2V6C A;  3TOB A;  4AIH A;  1TTY A;  3CUO A;  2K7L A;  3TOA A;  2H09 A;  1FC3 A;  3C18 A;  4KUM A;  3MCZ A;  3H3U A;  3DKW A;  1TQI A;  4XSX F;  3NQO A;  2F2E A;  3I54 A;  1B4A A;  5L3C A;  3GFL A;  4IPA A;  3ECH A;  2JPB A;  2QLZ A;  4GO1 A;  4Z2Y A;  1T0F A;  3R0A A;  1R5H A;  5JFR A;  3WTY C;  1C0W A;  2M1B A;  5CVI A;  5J8F A;  2VE9 A;  4ZYG A;  4BNC A;  2RVC A;  3MWM A;  1FBS A;  3I0T A;  2M45 A;  4L5I A;  1I5Z A;  4ESJ A;  2ESN A;  1OYW A;  4A2U A;  3J7A O;  3P9C A;  1XSD A;  2P7V B;  3LQQ A;  5JHU A;  5D5W B;  3HRU A;  2XAS A;  1UST A;  3OOP A;  2XAH A;  1H9G A;  1TNT A;  2V9V A;  2FML A;  4PDK A;  3IC7 A;  1Z1D A;  2P5L C;  2IVM A;  3H92 A;  4ENM A;  3PQK A;  5DUI A;  1QPM A;  5D5X B;  5DCF A;  2QBY B;  3I53 A;  3IRQ A;  5H6Q A;  2GZW A;  4OIR F;  5E1X A;  2L02 A;  3FXR A;  2ZNY A;  4RGX A;  4PGG A;  3V8K A;  3RPU A;  1R36 A;  3BPX A;  3V8J A;  3H3Z A;  5JR3 A;  1CF7 A;  1L0O C;  3E6M A;  5HS8 A;  2LF8 A;  4UVB A;  1ZGA A;  3CLO A;  1R1T A;  5DDG A;  4FHT A;  2Z3Y A;  3KP4 A;  2FBH A;  4N9H A;  3BRO A;  1VTN C;  4RAY A;  3JTH A;  1B9M A;  1GXP A;  5DD8 A;  4RAZ A;  4ESB A;  1W5S A;  1AWC A;  5BOX A;  5EEG A;  3HHH A;  4HQE A;  3ZN0 A;  3GW2 A;  4R1H A;  4OOI A;  4UV9 A;  2A6E F;  3RDI A;  4OMZ A;  1D3Y A;  5LGU A;  1BC8 C;  3QP6 A;  2VT2 A;  2O03 A;  2XAJ A;  3LA2 A;  3WTU C;  2HZT A;  2LNB A;  4HX8 A;  1GXQ A;  1ON2 A;  1XGN A;  1D8J A;  4HF1 A;  1Z91 A;  1TW2 A;  4S05 A;  1Z9C A;  2ADU A;  3E5X A;  4UHT A;  2W24 A;  2QVO A;  4CZZ A;  2ISY A;  3G3Z A;  4EM1 A;  5JI6 A;  2FA5 A;  1BBY A;  2YR2 A;  5LRS A;  3KP3 A;  4ZZL A;  4KMF A;  4I0A A;  5L3F A;  2Y75 A;  4I2O A;  2L4M A;  3F8N A;  1RUO A;  1SMY F;  2PMU A;  5LGN A;  1SMT A;  4NB5 A;  1XGM A;  2EFW A;  2UZK A;  5H20 A;  3GZ5 A;  3F6O A;  1K7A A;  1Z05 A;  2QQB A;  4RB0 A;  1HBX G;  4HF2 A;  3I64 A;  3N97 A;  3L7W A;  4IJA A;  3KEQ A;  1LDK B;  2XIG A;  2YPR A;  3ISP A;  3KET A;  1LEA A;  4O5V A;  3LQR A;  1Z6R A;  5D6E A;  4U7B A;  2IRF G;  3AAF A;  1IN7 A;  1LJ9 A;  3E6D A;  5F1R A;  3ZN1 A;  1DUX C;  2DW4 A;  1W7P B;  3SFZ A;  2GXG A;  3WE3 A;  3J81 Z;  4MQV A;  4QLC U;  4ESF A;  2FXA A;  3CUQ C;  4LGW A;  2XHK A;  1KGS A;  4U7D A;  2P5K A;  3RYR A;  3QPT A;  2IA1 A;  4XSZ F;  4HLX A;  4MGR A;  2HOE A;  2EFQ A;  2QUF A;  2BV6 A;  1F9N A;  2D1H A;  4WK8 F;  4CDG A;  2O61 A;  1YQA A;  5D8K B;  2G7U A;  1FX7 A;  1IN8 A;  3MQ0 A;  3IKT A;  1MD0 A;  2RNJ A;  2GXB A;  3PQJ A;  1SAX A;  3IWF A;  3E6C C;  3LFK A;  2H6C A;  2VBZ A;  3P7N A;  1ZRC A;  3GLX A;  2M87 A;  5CVR A;  4U0Y A;  1XDS A;  2AS5 F;  2G7H A;  4G7H F;  2MC3 A;  1T6S A;  4Q4Z F;  1ZRF A;  1HSJ A;  3V4G A;  1ZRD A;  1BIA A;  3TO7 A;  5DCM B;  5J6X A;  1XGO A;  1S3J A;  2QWW A;  2RKH A;  1Q1H A;  4AIJ A;  1V4R A;  2HTS A;  3V7R A;  2CG4 A;  3RKY A;  3WTZ A;  4G6D A;  1TQM A;  1E17 A;  4OMY A;  3F6V A;  4A0X A;  1PDN C;  2TDX A;  4DNC A;  4RB2 C;  1QBJ A;  2NYX A;  1H9T A;  2V79 A;  2P5V A;  3WTX C;  1WSU A;  1S8N A;  3QOP A;  2OQR A;  1G6N A;  3KCC A;  3GFM A;  2M30 A;  2OA4 A;  4UVA A;  4EMS A;  4ENK A;  2HQN A; 
#chains in the Genus database with same CATH topology
 2HNH A;  5E18 F;  3O2P E;  2L2O A;  4AID A;  3FZV A;  2D1V A;  4NC7 A;  4OWR B;  2V1N A;  1DPU A;  2EA2 A;  3PNY A;  1K61 A;  3QYE A;  4MFE A;  1KU9 A;  1XB4 A;  1VQ4 I;  1JXS A;  1AU7 A;  2FNP A;  3K4M A;  2XAU A;  1FYK A;  1BIB A;  1MW7 A;  3S1N J;  2E2I J;  5ILV A;  1T39 A;  1UMQ A;  2ZNZ A;  1YS7 A;  5EYR A;  3BQZ A;  2IS1 A;  1IXC A;  2ZFW A;  3DLL F;  2DTR A;  4IHV A;  3CUQ A;  3L2V A;  1S72 I;  1MMG A;  2X9D A;  2LH9 A;  3E6B A;  1MSF C;  2BY1 A;  3FDY A;  2W48 A;  4MTD A;  4HST A;  4B43 A;  1T56 A;  4WWC A;  4L18 B;  4J00 A;  2F5D A;  2ZME C;  1SFO J;  3WGG A;  4KIC A;  3KLO A;  5HOO A;  1FBU A;  1FOX A;  2DLL A;  1GLN A;  1RKT A;  3CES A;  1T08 B;  4XLA A;  1V55 H;  2CS3 A;  1LE8 B;  2L7M P;  2M7B A;  3FBI B;  3SZG A;  5FGM A;  4HW0 A;  1XSX A;  4FX4 A;  1Z7U A;  4U87 A;  3L2U A;  3HB9 A;  3AG1 H;  1IJW C;  3HC7 A;  2P0W A;  3KZZ A;  2OU2 A;  4J19 A;  2FNA A;  3OOU A;  4P9F A;  1XSV A;  4I98 B;  2VBY A;  4C2T A;  4IHS A;  2XSJ C;  2GIV A;  3BR5 A;  5ED4 A;  4WXD A;  2DPU A;  2YU9 J;  3WOD F;  5FLM J;  2K27 A;  2LP0 A;  1HF0 A;  5EZG A;  1SD5 A;  4PSX A;  4XRM A;  1ITY A;  5KAI C;  1MMS A;  5HS9 A;  3TO6 A;  4Y33 A;  1UEL B;  3DF8 A;  4D5F A;  3L2Q A;  2Z2S B;  3R0J A;  4A3J J;  4XN0 A;  4KIF A;  3WG9 A;  2H94 A;  3KYL A;  3MN2 A;  4BDY A;  1OLT A;  4NQW B;  4JX4 A;  1U5T A;  2ZKZ A;  4BXX J;  5J40 A;  3EUH A;  3W6K B;  2VC0 A;  1JUS A;  3IWZ A;  4G8X A;  2MA3 A;  2DMP A;  5B5E C;  4A69 C;  4Q5S F;  4ZDL A;  2GBY A;  3QYF A;  2NVQ J;  1QU3 A;  4RM3 A;  4A12 A;  3PJR A;  2VL8 A;  3CO6 C;  1SD4 A;  3JSP A;  2ETH A;  1BI3 A;  1WI9 A;  3GVA A;  1MNM C;  4BHB A;  1LVK A;  2DA4 A;  1FSE A;  2NOG A;  3JW4 A;  3QYB A;  5IPA A;  4FT8 A;  2CWE A;  2TCT A;  3QP5 A;  2LFB A;  3S3M A;  2ZJ2 A;  2OCC H;  3BJ6 A;  3HG9 A;  4GGG A;  4YFN F;  3QPH A;  3HKZ A;  3TQN A;  4A5M A;  3HEF A;  2LC2 A;  1R5G A;  3FWE A;  3H0G J;  2V9K A;  1MH4 A;  2W85 A;  3OR1 C;  1U3E M;  4EGZ A;  4C3J J;  4LFU A;  3H36 A;  4A93 J;  1MJB A;  2HGC A;  2O0Y A;  2BGC A;  3MZH A;  2K9L A;  4G6Q A;  2JQ7 A;  5AIQ A;  4PK4 A;  2LY1 A;  3VSL A;  1WJC A;  4KIS A;  2VJJ A;  3NRV A;  2OQG A;  4IHW A;  2XF6 A;  1BW6 A;  1MBE A;  4N0B A;  5E20 A;  2VXZ A;  2COM A;  3C3W A;  5J1R A;  4BE2 A;  3HRM A;  1U5T C;  1K83 J;  4OIP F;  4WXC A;  2KHM A;  3S17 J;  2ME6 A;  3B02 A;  2XPV A;  4R79 A;  2KFD A;  5IP7 J;  1OCZ H;  4NC6 A;  1JKR C;  2ZME B;  1LFP A;  4IQ4 A;  5D8L B;  4Y15 A;  4E7J A;  1GT0 C;  4CGZ A;  2EQR A;  4UXN A;  1RIO H;  1X3U A;  3ASN H;  3G1O A;  2IGM A;  2Y0M A;  4LJZ F;  2NVU B;  1YW8 A;  4A6D A;  2M9H A;  2HQA A;  3OYN A;  1J0R A;  4BHP A;  1OJL A;  5GTH C;  3ONQ A;  1D5Y A;  1UJ8 A;  2ACJ A;  1P2F A;  4YEL A;  2ZXJ A;  4BH9 A;  2X0L A;  3O6B B;  1UAA A;  1IN5 A;  1YJ9 I;  2EFN A;  3NWT A;  1MSE C;  2XUB A;  3PO2 J;  1HQC A;  3R60 A;  3TGN A;  1QVU A;  1ZHF A;  1EH7 A;  1FT9 A;  3DLA A;  2W4S A;  2DOA A;  3GEZ A;  3OS2 A;  2DQR A;  2MLG A;  5FFX A;  3HGG A;  4KMU X;  2QQA A;  1IO2 A;  3OYA A;  1D0X A;  2LKP A;  1T38 A;  2UWM A;  3BCA A;  2WBM A;  1FP1 D;  5BQT A;  4YRV A;  2ZME A;  3JRC A;  2WAD A;  2V9P A;  3I4M J;  1Y0N A;  4A0Y A;  1R71 A;  5CVV A;  1B72 B;  2QCO A;  2R4G A;  3J81 K;  3BG6 A;  5IYB J;  1ZN2 A;  4CCL A;  1IC8 A;  3O8G A;  3HTS B;  4G6T B;  1T95 A;  4HRI A;  4XON A;  1VQN I;  5LRR A;  4E7K A;  1NTC A;  3GTK J;  3FBN B;  2FEZ A;  4RS8 A;  3S93 A;  4ASN A;  2DI3 A;  3H9Q A;  4HDU A;  2HPM A;  1MKM A;  1U9O A;  3OYD A;  2EV5 A;  2GA2 A;  1HW1 A;  4EAT A;  2R7V A;  5J4V A;  4EQQ A;  3ZQH A;  1REP C;  3FX3 A;  3FK7 A;  2DJN A;  4DQ2 A;  1K4S A;  2UXX A;  1XMK A;  2OC6 A;  4KN4 X;  1TWC J;  5FKK A;  2LY9 A;  4JK1 X;  2P8T A;  4ZTF A;  5TIS C;  5JVT A;  1TL8 A;  1WKM A;  2PG4 A;  3SFI A;  5KCM A;  3JTG A;  5F0C A;  2F5F A;  3EYI A;  4Y7N J;  1XS9 A;  2J5O A;  4N9I A;  3T5X A;  3DTE A;  3UR3 C;  3D5R C;  2IGO A;  5E1W A;  3IKV A;  4ANJ A;  4RBO A;  1A35 A;  1ZLJ A;  2GA1 A;  3A01 B;  1RUN A;  2W84 A;  3BZC A;  5DM7 F;  3N4M A;  3W3C A;  1TWG J;  2W25 A;  2M4K A;  4KJZ A;  1SFU A;  2CQN A;  2OUM A;  2XVC A;  4YG2 F;  4OU0 A;  5LBQ A;  2BOL A;  4UUT A;  2F5C A;  3CCU I;  3CTA A;  4M6X A;  1ZEL A;  2DFF A;  2HWV A;  2DFH A;  4IOC F;  3LAJ A;  3K69 A;  4M72 A;  4E70 A;  1OIS A;  2QEX I;  1WJE A;  1A6I A;  1ON1 A;  2R7D A;  3HTU A;  1JUP A;  2H8R A;  4KIT B;  1R23 A;  5FO5 A;  5J1U A;  4XID A;  3CCV I;  2R7Z J;  4WF2 A;  2P7C B;  4YEJ A;  5EF6 A;  2RGV A;  1B6A A;  1UHW A;  2CQQ A;  1O7L A;  2R93 J;  1YJW I;  2R0Q C;  3JRA A;  2FE3 A;  3CCS I;  1Z0X A;  4JX6 A;  4LIV A;  1FWZ A;  3OYB A;  2OTL I;  2VQC A;  3ABU A;  4XNF A;  3G71 I;  1A36 A;  3OYE A;  1QO0 D;  3W6J B;  3Q0V A;  1XMX A;  3D5L A;  1WWX A;  1S5L C;  4A0Z A;  3GWZ A;  2DA5 A;  3IH4 A;  3SYT A;  2CW8 A;  2IA2 A;  2XGC A;  2FSW A;  1P4X A;  1I27 A;  2LBF B;  2X4H A;  4EJV A;  4EM0 B;  3KFW X;  5HVQ C;  1TZL A;  4BEH B;  2XPW A;  4XRF A;  3WG7 H;  4IHX A;  3CJT B;  1SVO A;  2NAZ A;  4NBQ A;  3F8C A;  3AL0 C;  4AVP A;  4YFK F;  1IRG A;  4GDF A;  4A6E A;  2IGN A;  1XN7 A;  2DOE A;  1KYZ A;  1I1G A;  1V54 H;  3GLL A;  2RQP A;  4EEF G;  1NG6 A;  3CMM A;  3I71 A;  3IUO A;  3MKL A;  1ETO A;  4A3M J;  1VQ7 I;  2HVS A;  4OIQ F;  1ZG5 A;  1Y39 A;  3DPU A;  5ILS A;  2KIM A;  1Y1V J;  2CQX A;  3K1N A;  4H4K C;  4GCV A;  1ZAR A;  2E19 A;  4ZYH A;  1OCP A;  3WGH A;  4AYB N;  1CGP A;  4XOP A;  2JRT A;  2K02 A;  3OSG A;  2GOM A;  2K5C A;  3BY6 A;  3TDU C;  2WV0 A;  3IH3 A;  4RDU A;  2V1U A;  1K4T A;  1F4K A;  2VJ5 A;  4JBA A;  4M9Z A;  1OMI A;  5HDK A;  1FP2 A;  3M9A A;  1PP8 F;  2AHQ A;  1S7O A;  1YOV B;  1MDM B;  3BG5 A;  1QRY A;  2O8K A;  2R5Y B;  3NEU A;  1IG7 A;  3FIS A;  3WTS C;  5KHD A;  3OV8 A;  2DK8 A;  2Y9Y A;  1OQY A;  3DEU A;  4XKB A;  1SFK A;  1VQ5 I;  2FBI A;  5BS6 A;  2EJR A;  3BR2 A;  2CFX A;  2VN2 A;  5ICE A;  2W57 A;  4XN3 A;  2ELJ A;  4E7L A;  1LQ1 A;  3MVP A;  4Y3O A;  1IXR C;  2L7F P;  4LB6 B;  3DCF A;  2VOP A;  1OPC A;  2BY2 A;  2YX4 A;  2Z33 A;  3M4O J;  1JKP C;  3O3K A;  4IHY A;  3MAJ A;  1MZB A;  4RB3 C;  4ENJ A;  5BMZ A;  2XSD C;  4RLF A;  2KRH A;  1DDN A;  2PJR A;  4RM2 A;  4IOA F;  4C2U A;  4U0V A;  4ETS A;  4XLE A;  3I4P A;  4AC0 A;  3RKQ A;  1MMA A;  1X2N A;  4GYI A;  1LE8 A;  1XTA A;  1GHC A;  1XC5 A;  3L2R A;  3CDL A;  3BWG A;  1WCM J;  1O7F A;  2H8W A;  3BT9 A;  5K7Z A;  2PI0 A;  1NK2 P;  4I76 A;  4MHG A;  2CRG A;  2CV0 A;  4M3F A;  2EZK A;  4CYC A;  3DBR B;  3DTK A;  2QQ9 A;  3OYJ A;  4BS9 A;  3F3X A;  1GDT A;  3QQA A;  1WQ2 A;  2ZJP F;  3BG7 A;  3GTM J;  5IOY A;  1D1B A;  3HOZ J;  2ZFU A;  2R7S A;  3MZ8 A;  3MEX A;  3CUQ B;  5EEH A;  3S2W A;  4O3M A;  2X6W A;  1VQ9 I;  2M5W A;  2CW7 A;  4WXH A;  1ZTR A;  4MO7 A;  2HU9 A;  4HOB A;  2LRE A;  3HSR A;  1I3Q J;  2VBX A;  3F22 A;  4M6Y A;  1U2W A;  3PNV A;  1TNS A;  4L9N A;  1QNT A;  2FD5 A;  1I6H J;  2IS2 A;  1A5J A;  4EJO A;  1K78 B;  2COB A;  3ZQI A;  3AKZ A;  2GAU A;  2F4I A;  2OF7 A;  1VFC A;  5E8G A;  3UNG C;  2QKM B;  4CH7 A;  5F0H A;  2X51 A;  3BR6 A;  2XAF A;  4I0B A;  3REO A;  3VOE A;  1O3T A;  4RGR A;  2B0L A;  2VQH A;  1MGT A;  5KK1 A;  2R92 J;  2ECC A;  3H9J A;  3WU1 B;  4GFB A;  1YIO A;  3M1E A;  1W4M A;  5F64 A;  3KEO A;  1UFM A;  1XG1 A;  3C2G A;  2ID3 A;  4ZH4 F;  5M5W J;  4A3D J;  5ICG A;  1FYM A;  4OIO F;  1A04 A;  3FHZ A;  1FIP A;  1X4O A;  2JK3 A;  2MBF A;  3CQZ J;  2MLK A;  4R8H A;  2VPR A;  4XBF A;  2R3S A;  2QEN A;  3EYY A;  2HQ5 A;  3GFJ A;  5FFZ A;  4HQM A;  5B1B H;  1BI2 A;  2E1M C;  2R7Q A;  1E2X A;  3WE2 A;  4YFX F;  2BE5 F;  5FD5 A;  3VDX A;  4I6Z A;  4HEA 2;  5CPR B;  3ULQ B;  3DQV C;  2DT5 A;  3I59 B;  4IF4 A;  3U2R A;  1PP7 U;  3PL8 A;  3RJP A;  5IT9 Z;  1QQI A;  2STT A;  4EM2 A;  3DP7 A;  4UV8 A;  2VOO A;  3K0L A;  1JGS A;  3WU0 A;  4UNO A;  3CDH A;  3HXL A;  4HSR A;  3E97 A;  4X6A J;  2EV6 A;  4LIU A;  2E7X A;  2E1N A;  3OYK A;  2VKV A;  4QTR A;  1FY7 A;  2FRH A;  2RAE A;  1UCR A;  5FKM A;  4IZZ A;  3QU3 A;  1KQ8 A;  1U8R A;  3JRE A;  3N05 A;  1X1C A;  5L3G A;  2MH9 A;  1IN4 A;  3MKY B;  1ZAO A;  3GYH X;  1MJ9 A;  3M8J A;  4QPQ A;  2RV8 A;  4I09 A;  1Z77 A;  4GXO A;  2GWR A;  2P6S A;  4FET A;  3ZQF A;  3K4N A;  1ETQ A;  3VYU B;  2JMW A;  4CUG A;  1WH5 A;  3Q9V A;  3GZ6 A;  3NAU A;  2HS5 A;  2DT7 B;  4WCG A;  3C2B A;  3JCU C;  3D1N I;  2E7W A;  3HRS A;  4D7M A;  2KJB A;  2L0K A;  2XKP A;  4L5E A;  3I59 A;  4AD9 A;  1ZG1 A;  1XPX A;  3FXQ A;  4AIK A;  4L0Y B;  3ZMZ A;  3BPV A;  2V6E A;  2W82 A;  1OCR H;  2BY0 A;  2M4G A;  3L00 A;  2E36 A;  4E6K G;  2D2W A;  3JRI A;  9ANT A;  2LSO A;  3L9F A;  4IRH A;  5CVU A;  4LLL A;  3F8F A;  4WX9 A;  5GAG J;  2HYF A;  1MJA A;  3RYP A;  3QPL A;  1SD6 A;  2VKE A;  4B09 A;  3S8P A;  4EVI A;  1G3Y A;  1QA6 A;  2DOD A;  3CJN A;  2NRA C;  3S15 J;  2DU9 A;  2DAO A;  2ICW G;  3LSR A;  3RQI A;  4M9S A;  1YYV A;  5CQG A;  2UV1 A;  1ODD A;  1W7P D;  4II3 A;  4ZYD A;  4HG2 A;  3DU6 A;  4BU2 A;  1R7J A;  2CUZ A;  4UVC A;  4A3E J;  1IAW A;  3GUD A;  2BVL A;  3GFI A;  1HA8 A;  3KZI C;  3RI4 A;  2X48 A;  1WVR A;  2OJE D;  4BAY A;  1LUJ B;  3H1C A;  2PX9 A;  3FK6 A;  4P1W A;  1RNL A;  2JRM A;  3V7S A;  5HS7 A;  3TBI A;  3RPU D;  2Z9O A;  1O4X A;  1O3R A;  3FXJ A;  3QWL A;  2IP2 A;  3TW7 A;  3JR9 A;  1H0M A;  3MZY A;  2VC1 A;  1DP7 P;  1T2K A;  1IXS B;  1MBK A;  3ABL H;  5B1A H;  1YW9 A;  3WTT C;  1R4N B;  3L09 A;  4J01 A;  4I99 C;  3EET A;  3QRF F;  1M1E B;  2VE8 A;  3A2K A;  1S7A A;  3Q0U A;  2IT0 A;  4C2M J;  2DOF A;  4M3B A;  1RKW A;  1NK3 P;  1VZ0 A;  5HLI A;  3SZT A;  2XDV A;  3TKY A;  4KA4 A;  1HDP A;  1KON A;  3A01 A;  4D1Q A;  2Y30 A;  1R6R A;  3ZGK A;  4XK4 A;  3X2Q H;  5AIP A;  4FX0 A;  2G9W A;  5F1J A;  2IA0 A;  1RZ4 A;  1Z6T A;  2CUJ A;  3SHF A;  5GPC A;  4KFC A;  3BTL A;  2LOO A;  3B6A A;  3BOQ A;  2QZ8 A;  4ZZD A;  5E1Z B;  1Z3Y A;  1Z7L A;  2M8G X;  4PCQ A;  1O3Q A;  3S2H J;  3A4C A;  4EJT A;  2HVR A;  3BTC A;  1BJA A;  2I8D A;  4M73 A;  3HOV J;  4D5C A;  3LSJ A;  5LEK A;  4A3C J;  3CCR I;  4KIB A;  4AUX A;  4BAC A;  2CV1 A;  5FD6 A;  3ZMS A;  1ETV A;  1VQK I;  3WGI A;  3GX4 X;  3S1R J;  4BQN A;  4CCJ A;  1UZC A;  4BQA A;  2WWY A;  5BPI A;  2X6O A;  5KVR A;  2KIF A;  4CXF A;  1KU2 A;  2PEX A;  4XM3 A;  4LB5 A;  1J7K A;  2BEO A;  1B9N A;  4P96 A;  2VJI A;  2IBD A;  3TP3 A;  4Y4R A;  1J9I A;  5EGO A;  1KQ0 A;  1IV6 A;  4IRI A;  1OYY A;  4G7Z F;  3HOY J;  2JUC A;  2F5E A;  4UUV A;  2ID6 A;  2K86 A;  4IKF A;  1ZGW A;  3J7Z I;  3BTI A;  3B73 A;  3F21 A;  1JE8 A;  2XB0 X;  4PJL A;  4HX4 A;  3BQY A;  2KKO A;  3K4C A;  1IDY A;  2A69 F;  2XGX A;  3IHU A;  3RIR A;  4B3A A;  3K2A A;  5ICC A;  2EA4 A;  5IT3 A;  1O3S A;  2FQ3 A;  2L4A A;  5LHI A;  4M3G A;  2E2H J;  3K4J A;  2NOJ B;  1STZ A;  2PMZ A;  3HDD A;  3SQN A;  3BG9 A;  1TQP A;  4BY7 J;  2H27 A;  3ZQ7 A;  1UHM A;  1I3A A;  2JZY A;  1YI2 I;  4RGU A;  2A68 F;  2RNG A;  2Y9Z A;  2EK5 A;  5EZH A;  4CSW A;  4BJ5 C;  5DUK A;  1G3W A;  1PUF B;  5M3F J;  1ZG3 A;  1X1P A;  4LMY A;  1IF1 A;  2DTZ A;  2E60 A;  4M3D A;  3LSI A;  3FM3 A;  2OCE A;  3S16 J;  1YS6 A;  2CSO A;  1D5V A;  4QIW N;  2DYS H;  1I39 A;  3LMM A;  2JN6 A;  3KP2 A;  1S6L A;  2JUG A;  1SFX A;  3CP8 A;  2HYG D;  3LSG A;  4UUS A;  1VQP I;  2VJ4 A;  2XRN A;  3HZJ A;  2DN0 A;  2KPM A;  4Y17 A;  2EWN A;  2C6Y A;  3GXO A;  3ML6 A;  2MD0 A;  3GTL J;  3KP5 A;  2MD5 A;  1IDZ A;  1ZH5 A;  3UKG A;  3FIW A;  4M3E A;  2KT0 A;  1X4P A;  1QZE A;  2KZG A;  2E5N A;  3HRT A;  3LOC A;  3A03 A;  4BXU A;  1XX5 A;  1HKQ A;  2L01 A;  4OAZ A;  3TDZ C;  5DEQ A;  3GTG J;  2EV0 A;  2K9S A;  2RRE A;  1TT0 A;  3I9V 2;  2F4O B;  3A02 A;  3GF2 A;  1XGS A;  3BTJ A;  3OYH A;  3M1C A;  4ENN A;  3RPQ A;  2CJJ A;  3MKZ A;  2K4B A;  2QF7 A;  4IRG A;  4RGS A;  5K5Q A;  4HDV A;  3LA7 A;  3OIP A;  2EBI A;  1JJ6 C;  1J5Y A;  2PFB A;  1ETX A;  5GAD J;  3G4S I;  3HGY A;  3VWB A;  5K7H A;  5H2F C;  1KA8 A;  5ICF A;  2VUM J;  3H5R A;  4IXA A;  4RAG A;  3M7G A;  4QSH A;  2IAI A;  3DBH B;  3IAM 2;  3M07 A;  1LB2 A;  2HKX A;  5EGO B;  4P5O A;  1HKS A;  2WAQ A;  1AA7 A;  1DU0 A;  4XLN F;  2WC2 A;  4A3B J;  1JHF A;  1LFU P;  3J80 Z;  1ETY A;  2WV1 A;  4B8X A;  3CCQ I;  3RCO A;  2WTE A;  1TP4 A;  3EDP A;  2HXI A;  3TED A;  3DPT A;  3OYG A;  1BL0 A;  3LL7 A;  5E17 F;  3GBG A;  3TL4 X;  3F23 A;  2JSC A;  3I4N J;  2PMH A;  2E71 A;  4E7Z A;  5FRM A;  4L0Z B;  1BR1 A;  3P9I A;  4F3Q A;  2R7T A;  1YO5 C;  1FMV A;  3T0Y A;  2V4J C;  3HOU J;  3SXY A;  3RKW A;  5F6F A;  2M34 A;  4Q48 A;  4C9Y A;  1K6O A;  6PAX A;  4KT6 A;  2LDU A;  2IPQ X;  4KDP A;  5K5O A;  4DZP A;  2BHZ A;  4KNY A;  4UUS B;  5E3M A;  4ABZ A;  2HVQ A;  1GVD A;  2HYJ A;  2AQF A;  2GOX B;  3HSE A;  3ZMV A;  2ZO4 A;  1EH8 A;  3ZMU A;  2CFO A;  1BC7 C;  2Z5U A;  1W0U A;  3PIO F;  4PFP A;  3CCM I;  4L9T A;  3C1D A;  4KIG A;  2OAZ A;  2YS9 A;  2JVH A;  2QGU A;  2EIL H;  1NHA A;  3FMS A;  3F72 A;  3QPS A;  3V7C A;  2JT1 A;  1PUF A;  1SEU A;  4D0P A;  3LWF A;  4D9J A;  1G4D A;  3CF2 A;  4FE7 A;  1G3T A;  4NUB A;  4X0G A;  2MH2 A;  4CO8 A;  4IVN A;  2XAG A;  4E7S A;  4HLY A;  3CCL I;  4F92 B;  2Z99 A;  4FIS A;  2OBP A;  4PJ0 C;  3ZP5 A;  2HTJ A;  2EB7 A;  5LHH A;  2CV2 A;  2L54 A;  4OIN F;  1XMA A;  1UHS A;  3KE2 A;  4BXF A;  2YX7 A;  5IT9 K;  2XGE A;  4HAM A;  1LDJ A;  4IEJ A;  4S04 A;  2KJC A;  1HW2 A;  4CCM A;  2H6B A;  2MW8 A;  2ZSH B;  1KQ9 A;  4GYG A;  1RR7 A;  1RI7 A;  3ZQQ A;  5B66 C;  1QZY A;  1RPW A;  4HYE A;  5DS9 A;  2A5W A;  2OZ6 A;  1H89 C;  5LFA A;  1RET A;  2L3D A;  1MND A;  1GUU A;  3CCJ I;  1K79 A;  2HOS A;  3DFG A;  5F27 A;  1LPQ A;  4NQW A;  5HOD A;  3K4K A;  3LFU A;  2HI3 A;  2VLA A;  1KYW A;  3K9T A;  2HFH A;  3R61 A;  3MFK A;  3CJR B;  2QBY A;  2HDC A;  4F91 B;  4AWX B;  3L2C A;  4RB1 A;  4Q47 A;  4RAF A;  3ZPL A;  3V42 A;  2BY3 A;  3Q5F A;  3J7A Y;  3E3V A;  3DXJ F;  2DO7 A;  3ZQG A;  4IL6 C;  2DYR H;  1FOK A;  4PGH A;  4M71 A;  2D45 A;  4RMN A;  1BN5 A;  5LHG A;  3SZP A;  3CZ6 A;  4MIM A;  3H5A A;  1N77 A;  3R4K A;  1MDM A;  1FTZ A;  2QSH X;  2DFI A;  5C3E J;  2FU4 A;  1D8K A;  3ERE D;  3HUG A;  4A3F J;  3W2W A;  5HDN A;  2O9L A;  1EH6 A;  1T0F C;  3VYR B;  3F9K A;  3IRR A;  3I58 A;  4XLF A;  5HNH A;  1BM9 A;  1X3W B;  4Y13 A;  1G3S A;  4O6J A;  3ZQC A;  1K78 A;  1Y6I A;  2O3F A;  3GME A;  4DZJ A;  4F7Z A;  3LST A;  2XC7 A;  5D4R A;  4CCK A;  5TGT A;  3K1M A;  4HZF A;  5GAH J;  2FF4 A;  1HXD A;  1Z21 A;  4CCN A;  2WY8 Q;  2IW5 A;  3HKZ N;  1QVT A;  2LD5 A;  4A5N A;  4HBL A;  1IN6 A;  1ZKG A;  4PZJ A;  5CVJ A;  4RA2 A;  2E2J J;  3FMQ A;  4ZYE A;  1BOA A;  3ROU A;  1W36 C;  1HOM A;  2EFP A;  2EZL A;  3V8L A;  2MYS A;  4NDL A;  3CMY A;  3K4L A;  4U0W A;  5D5U B;  2A5Y B;  1NG7 A;  4U88 A;  4A3I J;  1UB9 A;  4K2E A;  4BBR J;  1S29 A;  4EV0 A;  3ECO A;  2VON A;  3HM5 A;  3OL3 A;  2P81 A;  4GRI A;  2NS8 A;  2VXD A;  3BP8 A;  1DPR A;  2ESH A;  1BR2 A;  4XL9 A;  3S3N A;  3FXU A;  2UXN A;  1W5C C;  2L7K A;  3Q9S A;  1U6G A;  5D4S A;  2PBI A;  2VBW A;  2KDZ A;  2B9S A;  4I7H A;  3HSF A;  4LK1 F;  1R22 A;  2PN6 A;  2FMY A;  2XV4 S;  1PUE E;  4Z6Y A;  3M3Y J;  1SAN A;  2K9N A;  4ZC3 A;  3GZN B;  1FIA A;  5TRD A;  1ETW A;  4UB8 C;  1IZ1 A;  2OD5 A;  1FLI A;  2W7N A;  1R49 A;  1D0Y A;  2KIU A;  3EQL F;  3T8T A;  2VKH A;  5E8I A;  3CC4 I;  2WAE A;  1ZYR F;  3J80 K;  1P92 A;  4KT5 C;  3BC8 A;  1XCB A;  4JQF A;  2JA5 J;  2KZV A;  1B8I A;  2CW0 F;  2XKO A;  3VPR A;  1AOY A;  2NNY A;  1MIJ A;  3HIF A;  1YRN B;  3PIP F;  1ERD A;  2Y48 A;  4DW6 A;  5E3N A;  1RC9 A;  3IL2 A;  2E34 A;  3IAS 2;  1U8B A;  2O6G E;  1HW5 A;  1N25 A;  3K1P A;  3HHG A;  1FEX A;  4C3I J;  1FYL A;  2VOD A;  1ZK8 A;  1WJF A;  4G94 A;  2DA6 A;  2QKL B;  1QZZ A;  3HJE A;  2ZXH A;  3G1L A;  1EF4 A;  2LLK A;  4HV5 A;  1B1B A;  1WI3 A;  2Z16 A;  3KZY A;  3RTR A;  3VB2 A;  2P4W A;  4LLG F;  4HF0 A;  2K9M A;  5FLX Z;  2STW A;  2A3S A;  2EIJ H;  4HA8 A;  1BA5 A;  3DU5 A;  3I55 I;  3L2W A;  1LNW A;  2CUF A;  2MGQ A;  2L9N A;  2ZBK A;  1DQU A;  1P4W A;  2L9S A;  4L9V A;  3F8M A;  3R6S A;  1MBH A;  3DEE A;  3G73 A;  2E1M B;  3LSM A;  1I50 J;  3HBL A;  4MEY F;  5DYM A;  3VEP A;  5IYC J;  4DYQ A;  2J5P A;  2UUZ A;  5H6R A;  2DQL A;  3GO5 A;  2R7F A;  5A2Q K;  3JRD A;  4I01 A;  4X1E A;  3CME I;  2HKO A;  4ZYA A;  2DJI A;  2RQQ A;  5HDG A;  4EJU A;  4YII A;  4HX7 A;  1FPQ A;  3DEW A;  3KYD B;  1IW7 F;  1DU6 A;  2Q0O A;  2PJP A;  3MKW B;  2KQR A;  2VIX A;  1FOY A;  4XOR A;  4H0E A;  3FXL A;  1F1Z A;  3KEY A;  3ZMD A;  4XOT A;  1B72 A;  1W0T A;  2V1D A;  4HNU A;  2QSG X;  2NS0 A;  3FM5 A;  3S3O A;  3U9G A;  5D5V B;  4IQJ A;  3F0C A;  2DA7 A;  1DGR M;  1APL C;  2FQ4 A;  1CQT A;  2CH0 A;  2OZU A;  4JX5 A;  2PLY A;  1L3L A;  3GTO J;  5HNF A;  4BE1 A;  3GTP J;  5J3L A;  3ESW B;  2JA7 J;  5L3E A;  1I1S A;  2PQ8 A;  1FNN A;  1CF7 B;  2IJL A;  3H5N A;  5CQE A;  5AON A;  3TO9 A;  3HOX J;  4CA0 A;  1ZRE A;  2EZI A;  1YLF A;  4F52 A;  3COA C;  3CO7 C;  3HOT A;  2HEO A;  3QOE A;  3KP6 A;  4YIF A;  4FCY A;  3ZXS A;  4BEH A;  1P4A A;  3U1K A;  4DBR A;  3BJO A;  3DPL C;  4P9U A;  3D5S C;  3CJQ B;  2XRO A;  2LMD A;  2DPD A;  1B59 A;  4JYK A;  3OIQ A;  2W1O A;  2BXY A;  2IXS A;  4G9Y A;  2ELH A;  1Y8Q B;  4CHU A;  4HV6 A;  1LEB A;  3WTV C;  1J2X A;  3TMO A;  3U1D A;  2PJR B;  2CQK A;  2HXO A;  1TT5 B;  4BGD A;  2DT6 A;  4KN7 X;  3H0D A;  5EG0 A;  4DJA A;  4AYB A;  2V7F A;  2A61 A;  4PUS A;  4CYD A;  3ELK A;  3RZD J;  5LEJ A;  1U78 A;  3GCM A;  5CJ9 A;  5J4Y A;  1SD7 A;  1TWF J;  4MEX F;  2ZXW H;  2M8E A;  3OL4 A;  3T8R A;  2B63 J;  3QAH A;  3BR1 A;  1WRJ A;  2DBB A;  1R9T J;  3K70 D;  1JI8 A;  2JTV A;  1S7E A;  1EV7 A;  5FB2 A;  4D7N A;  2XB5 A;  1JKO C;  3PFI A;  1I6X A;  5FKL A;  5GTI C;  5K1Y A;  1IRF A;  1P6R A;  3C7J A;  1ULY A;  1W5T A;  2KRF A;  2QM3 A;  2MC4 A;  3E5U A;  3K2Z A;  5DV5 A;  3BJA A;  5JLX A;  1FTT A;  2KRC A;  2NNN A;  4MLO A;  1MBG A;  4BE0 A;  3FKI J;  2E1C A;  1P7J A;  2FOW A;  1BW5 A;  5IOZ A;  4ITV A;  2Q8K A;  2RDP A;  3HYI A;  4PJN A;  3T1B A;  1U9N A;  4LG0 A;  3RQ4 A;  2AXT C;  4YIR X;  1P9Q C;  1D1A A;  1TWH J;  1R00 A;  1JTX A;  3F8B A;  1H8A C;  1J75 A;  1YTY A;  3HOW J;  2VI6 A;  1IV8 A;  2VQG A;  3QU6 A;  5BPD A;  3PM1 A;  3LSH A;  2HR3 A;  1MBF A;  5M5Y J;  3E0J B;  4JP0 A;  1JT0 A;  4LD5 A;  2EFO A;  2YU3 A;  1YG2 A;  3BZ6 A;  1T98 A;  3M8F A;  2VKD A;  2X1C A;  1SVL A;  5M5X J;  2WAF A;  4XLP F;  1AKH A;  5HLT A;  1QGP A;  3RKX A;  5D6F A;  1BOB A;  1V5E A;  2GLO A;  2KL4 A;  2CO5 A;  2A6T A;  1HKT A;  1ZGJ A;  5ERI A;  4L5J A;  1QHG A;  2V1X A;  3FMR A;  4II2 A;  5CLS A;  5HLG A;  4LLN A;  5J8C A;  1Z67 A;  2H1K A;  2R7U A;  2F4M B;  3DV8 A;  4UY8 I;  2PMZ N;  3JAM Z;  2QYO A;  5LGT A;  3BR3 A;  1HC8 A;  5ILU A;  2ELK A;  2A05 A;  3EUH C;  2KP6 A;  2VT3 A;  3OYF A;  1HST A;  3NWS A;  3SEZ A;  3FF5 A;  4XR6 A;  1BI0 A;  3QOD A;  2Y2Z A;  1TC3 C;  4E7H A;  3BDD A;  2FJ1 A;  4M74 A;  1FBQ A;  2BW3 B;  3VOD A;  1GV2 A;  1Y56 A;  2XGD A;  1YIT I;  2FBK A;  1R1V A;  2A07 F;  4MQ9 F;  1TW3 A;  1IUF A;  4QWQ A;  4B1R A;  4Y52 J;  1FMW A;  1XD7 A;  3AFH A;  5FKO A;  3WTW C;  2BYV E;  4IHT A;  4NHJ A;  3PUB A;  5J47 A;  5FLX K;  2RN7 A;  2XPU A;  1GVJ A;  2LTP A;  3D0S A;  3JRG A;  3PNT A;  2E35 A;  1TBX A;  4KYW A;  1O57 A;  1JUM A;  1LDD A;  2EZH A;  3JRB A;  1R1U A;  4CZC A;  1FZP B;  3LAP A;  5K5R A;  2DK5 A;  2A6H F;  1POG A;  1WFX A;  2TRT A;  4BUP A;  3S1M J;  2R5Y A;  2JPC A;  2JA8 J;  2R7R A;  2JA2 A;  4HNT A;  4LG0 B;  4EJW A;  1ACI A;  1BI1 A;  1MH3 A;  4B48 A;  4V19 K;  1G2H A;  1TLH B;  5DCM A;  2YSR A;  1R58 A;  4LIT A;  5A2Q Z;  1ZR4 A;  2K4J A;  1JHH A;  4N4O B;  1LKX A;  1U5T B;  4XQF A;  2HQR A;  2P6T A;  4L9J A;  5C4J J;  3KP7 A;  3SJM A;  1X1B A;  1T33 A;  1XCV A;  4B44 A;  4PJJ A;  4XKV A;  4MNU A;  3HOS A;  2LY2 A;  2JA6 J;  4P55 A;  1ZLK A;  5C4X J;  1X58 A;  1ONV A;  1USS A;  5HLH A;  5L3B A;  4BKX A;  1OFC X;  2KIQ A;  5CYV A;  3JAM K;  1EA3 A;  2L7Z A;  1AHD P;  1V3F A;  4ON0 A;  2ZCW A;  3KLN A;  4MTE A;  2EH3 A;  2KLO A;  4F55 A;  1YJN I;  2CYY A;  5DD4 A;  1FOW A;  1YW7 A;  3ABT A;  1F43 A;  1PJR A;  2GQQ A;  2Y0S N;  1X3Z B;  4JOM A;  5CKT A;  2O8X A;  2G0E A;  3AG3 H;  3I5U A;  2XF5 A;  2RC4 A;  4I02 A;  3VFZ A;  2LR8 A;  3ZMT A;  4CIC A;  2IS4 A;  1ORK A;  1HDD C;  5L3D A;  4BHC A;  1WGX A;  1F5T A;  3JSO A;  1OYI A;  1WJA A;  3LA3 A;  4XKW A;  2LF7 A;  1SFE A;  4ZJZ A;  1E3O C;  4EGY A;  2MG4 A;  2GM4 A;  2ISZ A;  1LVA A;  1X2M A;  1D1C A;  3W2A A;  1J59 A;  2N8G A;  2AXL A;  1E3H A;  4BQO A;  2FOK A;  1VI0 A;  3H9G A;  3CF5 F;  2Z1D A;  5IY5 H;  5LD2 C;  1LFB A;  1YIJ I;  1W7P A;  3KIO A;  1PYV A;  1VF9 A;  2Q2E A;  1HLV A;  1KU7 A;  2CGP A;  5LLQ A;  5C44 J;  2E1O A;  3BCB A;  2QA4 I;  3H3V K;  5K7F A;  3E5Q A;  3M8E A;  2R7X A;  1OR7 A;  3P9K A;  1UG0 A;  2K85 A;  3PUF A;  4TV7 A;  1Y0U A;  1IUY A;  5GAE J;  1YFH A;  2OPT A;  2BBY A;  4G7O F;  2L9R A;  1KU3 A;  2DCE A;  2NVY J;  4M9X A;  5DTD A;  4BYY A;  3K6G A;  5E3O A;  2XAQ A;  4LK0 F;  3B6C A;  1OKR A;  3BZK A;  1B8I B;  2Q1Z B;  1FSH A;  2M2E A;  1WH7 A;  2LK2 A;  2DDB A;  5TJJ A;  4DYC A;  4HNV A;  3KX2 A;  1XDU A;  1EKE A;  2XF7 A;  1WPK A;  2M7A A;  1N75 A;  2V6C A;  3TOB A;  4AIH A;  1TTY A;  2DXI A;  3CUO A;  2K7L A;  3OIO A;  4QPO A;  3CP2 A;  3TOA A;  3BLY A;  2H09 A;  2WB1 N;  1FC3 A;  3C18 A;  4KUM A;  3MCZ A;  1VQO I;  3H3U A;  2M0C A;  3DKW A;  1TQI A;  2HOA A;  3WHC A;  1H88 C;  1X1A A;  3DTI A;  4XSX F;  2JJ7 A;  3NQO A;  5JHF A;  1WJ5 A;  3FKJ A;  2F2E A;  2IGK A;  3I54 A;  1OCO H;  4FTH A;  3CCY A;  1B4A A;  2DA3 A;  2CMP A;  5L3C A;  2LKX A;  1FJL A;  1OCC H;  3GFL A;  2R5Z A;  3LSK A;  4IPA A;  3ECH A;  2MSY A;  2JPB A;  2QLZ A;  4GO1 A;  1SC7 A;  3MD2 A;  4Z2Y A;  3ZRG A;  1T0F A;  3R0A A;  1WZ2 A;  1N78 A;  3AG4 H;  3O8H A;  2MFZ A;  4NNJ A;  1R5H A;  2WAQ N;  3AG2 H;  5JFR A;  3WTY C;  1C0W A;  2BZT A;  2M1B A;  5CVI A;  2X6X A;  5J8F A;  1J09 A;  3OMY A;  2VE9 A;  1JT6 A;  4ZYG A;  4M6V A;  4BNC A;  3VSK A;  2RVC A;  3MWM A;  1FBS A;  3I0T A;  2KMU A;  4AVZ A;  1JTY A;  3HPH A;  2M45 A;  4L5I A;  2LKS A;  1ZQ3 P;  1I5Z A;  4ESJ A;  2ESN A;  1OYW A;  1RR8 C;  3H35 A;  2ZB9 A;  4A2U A;  3J7A O;  3P9C A;  1XSD A;  3CDI A;  1SAU A;  2P7V B;  3LQQ A;  5E3L A;  2NVX J;  5JHU A;  5D5W B;  2FX0 A;  2Q2E B;  4RLQ A;  3HRU A;  1NH3 A;  2XAS A;  2KIS A;  5M3M J;  3OR2 C;  1UST A;  3OOP A;  2XAH A;  1W36 D;  4B3X A;  3S1Q J;  1H9G A;  1TNT A;  2V9V A;  3ZR8 X;  2FML A;  4PDK A;  3IC7 A;  1Z1D A;  2P5L C;  4XLH A;  4AU7 A;  2IVM A;  2LVS A;  3H92 A;  5IYD J;  1K6Y A;  4ENM A;  3Q3S A;  2B7E A;  2O5R A;  3PQK A;  1MMN A;  1QPM A;  5D5X B;  5DUI A;  3ZQL A;  4V2G A;  4A3K J;  5DCF A;  4A3G J;  2QBY B;  3G6E I;  1EJ9 A;  3I53 A;  2BXZ A;  3PSF A;  3TW6 A;  3IRQ A;  3JRF A;  5H6Q A;  2GZW A;  4OIR F;  4XKC A;  2E5Z A;  3G1M A;  2X1D A;  5E1X A;  4IO9 F;  2KDO A;  3A0H C;  1UG2 A;  2L02 A;  3PSI A;  3FXR A;  5EDN A;  2HZD A;  2ZNY A;  4RGX A;  4PGG A;  5FKN A;  1IGN A;  3V8K A;  3RPU A;  5FJ8 J;  5JLW A;  5FLV A;  1VQL I;  5BNG A;  1R36 A;  4XLC A;  5IP6 A;  2JVG A;  3BPX A;  1ZR2 A;  2WY7 Q;  3V8J A;  4DOZ A;  4XRS A;  3SEQ A;  3H3Z A;  1ENH A;  3GTQ J;  4CCO A;  2X1E A;  5JR3 A;  3IV5 A;  1CF7 A;  1L0O C;  1WHU A;  3E6M A;  5HS8 A;  3OS0 A;  4BL0 B;  2LF8 A;  2MAB A;  4UVB A;  2NVT J;  1ZGA A;  3CLO A;  1R1T A;  2EIM H;  5F08 A;  4ZTJ A;  2GXA A;  1DP3 A;  2HPI A;  5DDG A;  3CMA I;  4FHT A;  2Z3Y A;  1VQM I;  1Z3X A;  4N4N B;  3FXO A;  4UB6 C;  3KP4 A;  4MFD A;  2WB1 A;  1X19 A;  2FBH A;  4LOC A;  3I56 I;  4N9H A;  3RSN A;  5B3S H;  3BRO A;  5EEA A;  2DDA A;  1S9H A;  3K70 C;  1VTN C;  4RAY A;  1PVE A;  1IRZ A;  3I3L A;  3G2B A;  3JTH A;  1B9M A;  1GXP A;  2YUS A;  5DD8 A;  4RAZ A;  4FQG A;  2EIN H;  1MNE A;  4ESB A;  1P7I A;  1W5S A;  3E1S A;  1AWC A;  2R7O A;  2ZJR F;  5BOX A;  2F6C A;  1Q1V A;  3KPH A;  1ETK A;  2HOT A;  3S32 A;  1RRJ A;  2BHY A;  5EEG A;  3HHH A;  2Y69 H;  4BJT A;  4HQE A;  3ZN0 A;  3W2V A;  3GW2 A;  4R1H A;  2VAS A;  4OOI A;  1MMD A;  1V5F A;  1A31 A;  4BBS J;  2ZXI A;  4UV9 A;  2A6E F;  4DBQ A;  3RDI A;  4OMZ A;  1D3Y A;  2VPL A;  1YHQ I;  5LGU A;  1BC8 C;  3QP6 A;  2VT2 A;  2O03 A;  1F36 A;  5EG0 B;  1JJ8 C;  1JKQ C;  2XAJ A;  5IP9 J;  2DA1 A;  3LA2 A;  3WTU C;  2HZT A;  2LNB A;  3C2H A;  5F04 A;  2OTJ I;  4HX8 A;  2W00 A;  1GV5 A;  2I5U A;  2LYC A;  1W1W E;  2NXN B;  4PFO A;  3WU2 C;  1GXQ A;  1JGG A;  1ON2 A;  3ERM A;  1V5G A;  1XGN A;  1D8J A;  4HF1 A;  3BG3 A;  3Q0W A;  2FUG 2;  2X85 A;  5GPA A;  1Z91 A;  1TW2 A;  4B47 A;  4S05 A;  1Z9C A;  4E7I A;  2ADU A;  4IX7 A;  4BY1 J;  3E5X A;  4UHT A;  2W24 A;  2QVO A;  4CZZ A;  2ISY A;  3G3Z A;  4EM1 A;  5JI6 A;  2FA5 A;  1BBY A;  2YR2 A;  3IH2 A;  2V26 A;  5LRS A;  3KP3 A;  4ZZL A;  1HCR A;  4KMF A;  1IRX A;  1BJZ A;  3OYM A;  4I0A A;  2GIZ A;  2Y75 A;  5E79 C;  5L3F A;  4I2O A;  2L4M A;  3F8N A;  2L9V A;  1RUO A;  1SMY F;  2PMU A;  5LGN A;  4DYR A;  2K9Q A;  4E4H A;  1SMT A;  2X6Y A;  2CU7 A;  4F93 B;  3A0B C;  4NB5 A;  1G59 A;  1XGM A;  3VYT B;  2EFW A;  2UZK A;  5H20 A;  3GZ5 A;  3F6O A;  2JWT A;  1K7A A;  2JSP A;  3DWL E;  1Z05 A;  2QQB A;  3J7Y J;  3FHN A;  4RB0 A;  2R7W A;  2ME0 A;  3ZOB A;  1TWA J;  3PO3 J;  2QQ8 A;  1HBX G;  4HF2 A;  2CQ7 A;  2DMN A;  2BW3 A;  5FRO A;  5F0F A;  3I64 A;  3OYL A;  2M3A A;  3N97 A;  3L7W A;  5GP9 A;  4IJA A;  3JRH A;  4AM3 A;  3U21 A;  3FXK A;  2OV7 A;  1AKH B;  2F5V A;  3KEQ A;  2IS6 A;  1LDK B;  2XIG A;  2YPR A;  4BDZ A;  2I10 A;  3ISP A;  3KET A;  3EUA A;  1LEA A;  4O5V A;  3CD6 I;  3LQR A;  1Z6R A;  5D6E A;  4U7B A;  1BR4 A;  1QPI A;  2IRF G;  4PJM A;  3EUK L;  2D5V A;  3VYS B;  3AAF A;  4XRS G;  1IN7 A;  3DKX A;  3EPZ A;  1Y8R B;  1LJ9 A;  3E6D A;  5F1R A;  3ZN1 A;  2K3F A;  4S0H B;  1E0E A;  1DUX C;  2K3P A;  2DW4 A;  4NC8 A;  1W7P B;  4HPQ A;  2L5Q A;  3SFZ A;  5KNL A;  2GXG A;  3WE3 A;  3J81 Z;  4MQV A;  2DMT A;  3CCE I;  4QLC U;  4FAS D;  1Y1W J;  2DMQ A;  4ESF A;  2FXA A;  3OWT A;  3CUQ C;  4LGW A;  1U0J A;  2XHK A;  3K7A J;  3OSF A;  1KGS A;  4U7D A;  2VQL A;  1YX3 A;  1QHH D;  2P5K A;  1X1D A;  2XRL A;  2QSF X;  1E3P A;  3RYR A;  3TP0 A;  3AL0 B;  1A6Q A;  1YE9 A;  3PFY A;  3QPT A;  2IA1 A;  4OAY A;  4XSZ F;  1WJD A;  3ASO H;  3K10 A;  4HLX A;  2LG4 A;  4MGR A;  2HOE A;  1R4M B;  1YX5 A;  2Y0S A;  2EFQ A;  2LRD A;  2AQE A;  4W97 A;  1R5I D;  2QUF A;  2BV6 A;  1F9N A;  2D1H A;  4WK8 F;  3LSP A;  1OCT C;  3HL2 A;  2ZSI B;  4CDG A;  2WA0 A;  2O61 A;  2LBF A;  1VQ8 I;  1YQA A;  5D8K B;  4XIC A;  2G7U A;  4W1U A;  4XMY A;  2ECB A;  1FX7 A;  1IN8 A;  3MQ0 A;  2DA2 A;  3NAR A;  4FE4 A;  3IKT A;  2HDD A;  1MD0 A;  2H1L A;  1VQ6 I;  2RNJ A;  2EPF A;  4LG3 A;  3SDB A;  3S14 J;  2F48 A;  3KYC B;  1KZH A;  3OYC A;  2GXB A;  3PQJ A;  1SAX A;  3IWF A;  3WHB A;  3E6C C;  4PSW A;  3OYI A;  3ZCO A;  3IP4 B;  2DFE A;  3LFK A;  4DGW B;  1G8X A;  3S2D J;  1VND A;  2H6C A;  4V2F A;  2VBZ A;  3MMY B;  5EJC A;  3P7N A;  1ZRC A;  3GLX A;  1WJB A;  5JVG F;  2HDW A;  2M87 A;  4DIQ A;  2NS7 A;  3K4B A;  3CC2 I;  5CVR A;  4U0Y A;  1XDS A;  3W6V A;  2AS5 F;  3RZO J;  3LNQ A;  2G7H A;  4G7H F;  2MC3 A;  1T6S A;  4Q4Z F;  4BQQ A;  3OY9 A;  1ZRF A;  4CYC B;  1HSJ A;  3DKY A;  3V4G A;  1ZRD A;  1DGW Y;  1MBJ A;  2Y31 A;  1BIA A;  3SDG A;  5FRN A;  4C30 A;  3TO7 A;  5DCM B;  1T8I A;  3FXM A;  3HUG B;  4G12 A;  5J6X A;  4BJ6 C;  1SVM A;  1XGO A;  2EIK H;  3HPG A;  2O7O A;  3CC7 I;  1S3J A;  2QWW A;  2ZJQ F;  2RKH A;  1Q1H A;  4AIJ A;  1V4R A;  2HTS A;  3V7R A;  3OS1 A;  2CG4 A;  3RKY A;  3WTZ A;  4A3L J;  4G6D A;  2ZC2 A;  3ABM H;  1TQM A;  1E17 A;  1RES A;  4OMY A;  3F6V A;  4A0X A;  4ZDO A;  2K40 A;  1OR7 C;  2IEK A;  2TDX A;  4B4C A;  2BVM A;  4DNC A;  2NYX A;  4RB2 C;  1PDN C;  1QBJ A;  1H9T A;  3P5J A;  1YRN A;  2V79 A;  2CUE A;  3DBL B;  4ZDP A;  3L1P A;  5DM6 F;  2P5V A;  3WTX C;  1WSU A;  1S8N A;  5KAF C;  3QOP A;  2OQR A;  1D0Z A;  3ABK H;  1G6N A;  3KCC A;  3GFM A;  2M30 A;  2OA4 A;  2VB6 A;  3CLQ A;  2M0M A;  2R5Z B;  4UVA A;  4C3H J;  4EMS A;  4ENK A;  2AO9 A;  3GTJ J;  3A1Y A;  3BR0 A;  2DMU A;  5J1Y A;  3E7L A;  2HQN A; 
#chains in the Genus database with same CATH homology
 5E18 F;  3O2P E;  3FZV A;  2D1V A;  1DPU A;  2EA2 A;  1KU9 A;  1XB4 A;  1JXS A;  2FNP A;  1FYK A;  1BIB A;  5ILV A;  1T39 A;  2ZNZ A;  1YS7 A;  1IXC A;  2ZFW A;  2DTR A;  3CUQ A;  3E6B A;  4MTD A;  4WWC A;  4L18 B;  2F5D A;  3WGG A;  4KIC A;  3KLO A;  5HOO A;  1FBU A;  2DLL A;  5FGM A;  4HW0 A;  1XSX A;  4FX4 A;  1Z7U A;  3KZZ A;  2OU2 A;  2FNA A;  4P9F A;  1XSV A;  4I98 B;  2VBY A;  4IHS A;  2GIV A;  5ED4 A;  4WXD A;  2DPU A;  3WOD F;  2K27 A;  1SD5 A;  5HS9 A;  3TO6 A;  3DF8 A;  3R0J A;  4KIF A;  3WG9 A;  2H94 A;  1U5T A;  2ZKZ A;  3EUH A;  3W6K B;  2VC0 A;  3IWZ A;  4G8X A;  2MA3 A;  4Q5S F;  4A12 A;  3CO6 C;  1SD4 A;  3JSP A;  2ETH A;  1BI3 A;  1WI9 A;  3GVA A;  4BHB A;  1FSE A;  3JW4 A;  4FT8 A;  2CWE A;  3QP5 A;  2ZJ2 A;  3BJ6 A;  4GGG A;  4YFN F;  3QPH A;  3TQN A;  4A5M A;  1R5G A;  3FWE A;  2W85 A;  1U3E M;  4EGZ A;  4LFU A;  1MJB A;  2HGC A;  2O0Y A;  2BGC A;  3MZH A;  4G6Q A;  5AIQ A;  3NRV A;  2OQG A;  4N0B A;  5E20 A;  2VXZ A;  2COM A;  3C3W A;  3HRM A;  1U5T C;  4OIP F;  4WXC A;  3B02 A;  4R79 A;  2ZME B;  5D8L B;  4Y15 A;  4CGZ A;  4UXN A;  1RIO H;  1X3U A;  4LJZ F;  2Y0M A;  4A6D A;  1YW8 A;  1J0R A;  4BHP A;  2ACJ A;  1P2F A;  2ZXJ A;  4BH9 A;  2X0L A;  3O6B B;  1IN5 A;  2EFN A;  2XUB A;  1HQC A;  3R60 A;  3TGN A;  1ZHF A;  1EH7 A;  1FT9 A;  3GEZ A;  2DQR A;  2MLG A;  5FFX A;  4KMU X;  2QQA A;  2LKP A;  1T38 A;  2UWM A;  1FP1 D;  5BQT A;  2ZME A;  4A0Y A;  5CVV A;  3J81 K;  1ZN2 A;  3HTS B;  5LRR A;  2FEZ A;  4RS8 A;  4ASN A;  2DI3 A;  4HDU A;  1MKM A;  2EV5 A;  2GA2 A;  1HW1 A;  4EQQ A;  1REP C;  3FX3 A;  4DQ2 A;  2UXX A;  1XMK A;  4KN4 X;  4JK1 X;  2P8T A;  5JVT A;  1WKM A;  2PG4 A;  3JTG A;  2F5F A;  3EYI A;  2J5O A;  4N9I A;  3T5X A;  5E1W A;  3IKV A;  1ZLJ A;  2GA1 A;  1RUN A;  2W84 A;  3N4M A;  2W25 A;  1SFU A;  2XVC A;  4YG2 F;  4OU0 A;  5LBQ A;  2F5C A;  3CTA A;  4M6X A;  2HWV A;  3LAJ A;  3K69 A;  4M72 A;  4E70 A;  1ON1 A;  2R7D A;  3HTU A;  1R23 A;  5FO5 A;  4WF2 A;  2P7C B;  2RGV A;  1B6A A;  1UHW A;  1O7L A;  2FE3 A;  1FWZ A;  3ABU A;  1QO0 D;  3W6J B;  3D5L A;  4A0Z A;  1WWX A;  3GWZ A;  2IA2 A;  2FSW A;  1P4X A;  1I27 A;  2X4H A;  4EJV A;  4EM0 B;  3KFW X;  5HVQ C;  4XRF A;  2NAZ A;  3F8C A;  4AVP A;  4YFK F;  1IRG A;  4A6E A;  1XN7 A;  1KYZ A;  1I1G A;  2RQP A;  3I71 A;  4OIQ F;  1ZG5 A;  5ILS A;  2KIM A;  3K1N A;  4GCV A;  1ZAR A;  4ZYH A;  3WGH A;  1CGP A;  2JRT A;  2K02 A;  3BY6 A;  3TDU C;  2WV0 A;  2V1U A;  1F4K A;  4JBA A;  4M9Z A;  1OMI A;  5HDK A;  1FP2 A;  3M9A A;  1PP8 F;  1S7O A;  1MDM B;  3NEU A;  3WTS C;  3OV8 A;  2DK8 A;  3DEU A;  2FBI A;  5BS6 A;  2EJR A;  2CFX A;  2VN2 A;  5ICE A;  2W57 A;  1LQ1 A;  1IXR C;  4LB6 B;  2VOP A;  1OPC A;  2YX4 A;  2Z33 A;  3O3K A;  3MAJ A;  1MZB A;  4RB3 C;  4ENJ A;  5BMZ A;  1DDN A;  4U0V A;  4ETS A;  3I4P A;  4GYI A;  1GHC A;  3BWG A;  2PI0 A;  1O7F A;  4MHG A;  2QQ9 A;  3F3X A;  1WQ2 A;  3MEX A;  3CUQ B;  5EEH A;  3S2W A;  4O3M A;  2M5W A;  4WXH A;  4HOB A;  3HSR A;  2VBX A;  3F22 A;  4M6Y A;  1U2W A;  1TNS A;  4L9N A;  1QNT A;  4EJO A;  1K78 B;  2GAU A;  5E8G A;  2XAF A;  4I0B A;  3REO A;  3VOE A;  1O3T A;  4RGR A;  2B0L A;  1MGT A;  5KK1 A;  3WU1 B;  1YIO A;  3M1E A;  1W4M A;  5F64 A;  3KEO A;  1UFM A;  4ZH4 F;  5ICG A;  1FYM A;  4OIO F;  1A04 A;  3FHZ A;  2MBF A;  2MLK A;  4R8H A;  4XBF A;  2R3S A;  2QEN A;  3EYY A;  5FFZ A;  3GFJ A;  4HQM A;  1BI2 A;  1E2X A;  3WE2 A;  4YFX F;  2BE5 F;  5FD5 A;  3ULQ B;  3DQV C;  2DT5 A;  3I59 B;  4IF4 A;  3U2R A;  1PP7 U;  3RJP A;  5IT9 Z;  1QQI A;  2STT A;  4EM2 A;  3DP7 A;  4UV8 A;  2VOO A;  3K0L A;  1JGS A;  3WU0 A;  4UNO A;  3CDH A;  3E97 A;  2EV6 A;  2E7X A;  2E1N A;  1FY7 A;  2FRH A;  1UCR A;  3QU3 A;  1KQ8 A;  1U8R A;  5L3G A;  2MH9 A;  1IN4 A;  1ZAO A;  3GYH X;  1MJ9 A;  2RV8 A;  4I09 A;  4GXO A;  2GWR A;  2P6S A;  3Q9V A;  3GZ6 A;  2HS5 A;  4WCG A;  2E7W A;  3HRS A;  2KJB A;  2XKP A;  3I59 A;  4AD9 A;  1ZG1 A;  3FXQ A;  4AIK A;  4L0Y B;  3ZMZ A;  3BPV A;  3L00 A;  2D2W A;  2LSO A;  3L9F A;  4IRH A;  5CVU A;  4LLL A;  3F8F A;  4WX9 A;  2HYF A;  1MJA A;  3RYP A;  1SD6 A;  4B09 A;  4EVI A;  1G3Y A;  3CJN A;  2NRA C;  2DU9 A;  2DAO A;  4M9S A;  1YYV A;  1ODD A;  1W7P D;  4ZYD A;  1R7J A;  4UVC A;  1IAW A;  3GUD A;  3GFI A;  3RI4 A;  4BAY A;  1RNL A;  3V7S A;  5HS7 A;  2Z9O A;  1O3R A;  2IP2 A;  1H0M A;  3MZY A;  2VC1 A;  1DP7 P;  1T2K A;  1IXS B;  1YW9 A;  3WTT C;  3L09 A;  3QRF F;  3EET A;  2VE8 A;  1S7A A;  2IT0 A;  5HLI A;  3SZT A;  3TKY A;  4KA4 A;  5AIP A;  4FX0 A;  2G9W A;  2IA0 A;  1RZ4 A;  1Z6T A;  3SHF A;  4KFC A;  3BOQ A;  2QZ8 A;  4ZZD A;  5E1Z B;  4PCQ A;  1O3Q A;  4EJT A;  1BJA A;  4M73 A;  5LEK A;  4KIB A;  5FD6 A;  3ZMS A;  3WGI A;  3GX4 X;  4BQA A;  2WWY A;  5BPI A;  5KVR A;  4CXF A;  2KIF A;  1KU2 A;  2PEX A;  4LB5 A;  1J7K A;  2BEO A;  1B9N A;  4P96 A;  1J9I A;  1KQ0 A;  4IRI A;  1OYY A;  4G7Z F;  2F5E A;  4UUV A;  2K86 A;  1JE8 A;  3B73 A;  3F21 A;  4HX4 A;  2KKO A;  2A69 F;  3IHU A;  2XGX A;  3RIR A;  5ICC A;  2EA4 A;  5IT3 A;  1O3S A;  2FQ3 A;  2L4A A;  5LHI A;  1STZ A;  3SQN A;  1TQP A;  2H27 A;  3ZQ7 A;  1UHM A;  2JZY A;  4RGU A;  2A68 F;  2EK5 A;  5DUK A;  1G3W A;  1ZG3 A;  4LMY A;  1IF1 A;  3FM3 A;  1YS6 A;  2CSO A;  1D5V A;  3KP2 A;  1S6L A;  1SFX A;  2HYG D;  2XRN A;  4Y17 A;  2EWN A;  2C6Y A;  3GXO A;  3ML6 A;  3KP5 A;  2MD5 A;  1ZH5 A;  3HRT A;  4BXU A;  1HKQ A;  2L01 A;  3TDZ C;  5DEQ A;  2EV0 A;  3GF2 A;  1XGS A;  4ENN A;  3RPQ A;  2K4B A;  4RGS A;  4IRG A;  4HDV A;  5K5Q A;  3LA7 A;  1J5Y A;  2PFB A;  1KA8 A;  5ICF A;  4IXA A;  3M7G A;  1LB2 A;  2HKX A;  4P5O A;  1HKS A;  4XLN F;  2WC2 A;  1JHF A;  3J80 Z;  4B8X A;  2WTE A;  3EDP A;  3DPT A;  5E17 F;  3F23 A;  2JSC A;  2PMH A;  4L0Z B;  3P9I A;  1YO5 C;  3T0Y A;  3SXY A;  3RKW A;  5F6F A;  4Q48 A;  1K6O A;  6PAX A;  2LDU A;  2IPQ X;  4KDP A;  5K5O A;  4KNY A;  3HSE A;  3ZMV A;  2ZO4 A;  1EH8 A;  3ZMU A;  1BC7 C;  2Z5U A;  4L9T A;  3C1D A;  4KIG A;  2OAZ A;  1NHA A;  3FMS A;  3F72 A;  3V7C A;  2JT1 A;  4D0P A;  3LWF A;  1G4D A;  1G3T A;  2MH2 A;  4CO8 A;  4IVN A;  2XAG A;  4HLY A;  2Z99 A;  2OBP A;  3ZP5 A;  2HTJ A;  2EB7 A;  5LHH A;  2L54 A;  4OIN F;  1XMA A;  3KE2 A;  2YX7 A;  5IT9 K;  4HAM A;  1LDJ A;  4S04 A;  2KJC A;  1HW2 A;  2H6B A;  1KQ9 A;  4GYG A;  1RI7 A;  1QZY A;  4HYE A;  2OZ6 A;  2L3D A;  1K79 A;  3DFG A;  4NQW A;  1KYW A;  3K9T A;  2HFH A;  3R61 A;  3MFK A;  2QBY A;  2HDC A;  4AWX B;  3L2C A;  4RB1 A;  4Q47 A;  3ZPL A;  3Q5F A;  3E3V A;  3DXJ F;  2DO7 A;  1FOK A;  4PGH A;  4M71 A;  2D45 A;  1BN5 A;  5LHG A;  3SZP A;  3R4K A;  1MDM A;  2DFI A;  2FU4 A;  1D8K A;  3ERE D;  3HUG A;  5HDN A;  1EH6 A;  3IRR A;  3I58 A;  1BM9 A;  4Y13 A;  1G3S A;  4O6J A;  1K78 A;  2O3F A;  4F7Z A;  3LST A;  5D4R A;  3K1M A;  4HZF A;  2FF4 A;  1HXD A;  2IW5 A;  4A5N A;  4HBL A;  1IN6 A;  4PZJ A;  5CVJ A;  3FMQ A;  4ZYE A;  1BOA A;  3ROU A;  2EFP A;  3V8L A;  4U0W A;  5D5U B;  2A5Y B;  4U88 A;  1UB9 A;  4K2E A;  1S29 A;  4EV0 A;  3ECO A;  2VON A;  3BP8 A;  1DPR A;  2ESH A;  3FXU A;  2UXN A;  3Q9S A;  1U6G A;  5D4S A;  2PBI A;  2VBW A;  4I7H A;  3HSF A;  4LK1 F;  1R22 A;  2PN6 A;  2FMY A;  2XV4 S;  1PUE E;  5TRD A;  1IZ1 A;  2OD5 A;  1FLI A;  2KIU A;  3EQL F;  3T8T A;  5E8I A;  1ZYR F;  3J80 K;  1P92 A;  4KT5 C;  1XCB A;  4JQF A;  2CW0 F;  2XKO A;  1AOY A;  2NNY A;  3HIF A;  2Y48 A;  3IL2 A;  2O6G E;  1HW5 A;  3K1P A;  3HHG A;  1FYL A;  2VOD A;  4G94 A;  1QZZ A;  4HV5 A;  1B1B A;  3KZY A;  3RTR A;  3VB2 A;  2P4W A;  4LLG F;  4HF0 A;  5FLX Z;  2STW A;  2A3S A;  4HA8 A;  1LNW A;  2ZBK A;  1P4W A;  4L9V A;  3F8M A;  3R6S A;  3G73 A;  4MEY F;  5DYM A;  3VEP A;  2J5P A;  5H6R A;  2DQL A;  3GO5 A;  2R7F A;  5A2Q K;  4I01 A;  2HKO A;  5HDG A;  4EJU A;  4YII A;  4HX7 A;  1FPQ A;  1IW7 F;  2Q0O A;  2PJP A;  4H0E A;  1F1Z A;  3ZMD A;  2V1D A;  2NS0 A;  3FM5 A;  3U9G A;  5D5V B;  2OZU A;  2PLY A;  1L3L A;  5L3E A;  1I1S A;  2PQ8 A;  1FNN A;  1CF7 B;  2IJL A;  5AON A;  3TO9 A;  1ZRE A;  1YLF A;  3COA C;  3CO7 C;  3HOT A;  2HEO A;  3KP6 A;  4YIF A;  1P4A A;  3BJO A;  3DPL C;  4P9U A;  2XRO A;  2DPD A;  1B59 A;  4G9Y A;  2ELH A;  4CHU A;  4HV6 A;  1LEB A;  3WTV C;  1J2X A;  3U1D A;  2CQK A;  4KN7 X;  4CYD A;  2A61 A;  3ELK A;  5LEJ A;  1U78 A;  5CJ9 A;  1SD7 A;  4MEX F;  2M8E A;  3T8R A;  3QAH A;  1WRJ A;  2DBB A;  2JTV A;  1EV7 A;  5FB2 A;  3PFI A;  1I6X A;  5K1Y A;  1IRF A;  1P6R A;  3C7J A;  1ULY A;  1W5T A;  2KRF A;  2QM3 A;  3E5U A;  3K2Z A;  5DV5 A;  3BJA A;  2NNN A;  2E1C A;  2Q8K A;  2RDP A;  3HYI A;  3T1B A;  4LG0 A;  1R00 A;  3F8B A;  1J75 A;  1YTY A;  5BPD A;  3QU6 A;  2HR3 A;  4LD5 A;  2EFO A;  2YU3 A;  1YG2 A;  3BZ6 A;  1T98 A;  3M8F A;  4XLP F;  1QGP A;  3RKX A;  5D6F A;  1HKT A;  2CO5 A;  1ZGJ A;  5ERI A;  4L5J A;  2V1X A;  3FMR A;  5CLS A;  4LLN A;  5HLG A;  5J8C A;  3DV8 A;  3JAM Z;  2QYO A;  5LGT A;  5ILU A;  2VT3 A;  1HST A;  3FF5 A;  1BI0 A;  3BDD A;  4M74 A;  1FBQ A;  3VOD A;  2FBK A;  1R1V A;  2A07 F;  4MQ9 F;  1TW3 A;  4QWQ A;  1XD7 A;  4IHT A;  4NHJ A;  3WTW C;  2BYV E;  5FLX K;  2RN7 A;  1GVJ A;  3D0S A;  1TBX A;  4KYW A;  1O57 A;  1LDD A;  1R1U A;  1FZP B;  3LAP A;  5K5R A;  2DK5 A;  2A6H F;  2JPC A;  4LG0 B;  4EJW A;  1BI1 A;  1TLH B;  5DCM A;  2YSR A;  1R58 A;  5A2Q Z;  2K4J A;  1JHH A;  1U5T B;  2HQR A;  2P6T A;  4L9J A;  3KP7 A;  1XCV A;  4MNU A;  3HOS A;  4P55 A;  1ZLK A;  5HLH A;  1ONV A;  1USS A;  5L3B A;  5CYV A;  3JAM K;  1V3F A;  4ON0 A;  2ZCW A;  3KLN A;  4MTE A;  2CYY A;  5DD4 A;  1YW7 A;  3ABT A;  2GQQ A;  2O8X A;  3I5U A;  2RC4 A;  4I02 A;  3VFZ A;  3ZMT A;  4CIC A;  5L3D A;  4BHC A;  1F5T A;  3JSO A;  1OYI A;  3LA3 A;  2LF7 A;  1SFE A;  4EGY A;  2ISZ A;  1LVA A;  1J59 A;  2AXL A;  2FOK A;  1W7P A;  2Q2E A;  1KU7 A;  2CGP A;  5LLQ A;  3E5Q A;  3M8E A;  1OR7 A;  3P9K A;  4TV7 A;  1Y0U A;  1IUY A;  1YFH A;  2BBY A;  4G7O F;  1KU3 A;  4M9X A;  4BYY A;  2XAQ A;  4LK0 F;  1OKR A;  1FSH A;  5TJJ A;  1XDU A;  2V6C A;  3TOB A;  4AIH A;  1TTY A;  3CUO A;  2K7L A;  3TOA A;  2H09 A;  1FC3 A;  3C18 A;  4KUM A;  3MCZ A;  3H3U A;  3DKW A;  1TQI A;  4XSX F;  3NQO A;  2F2E A;  3I54 A;  1B4A A;  5L3C A;  3GFL A;  4IPA A;  3ECH A;  2JPB A;  2QLZ A;  4GO1 A;  4Z2Y A;  1T0F A;  3R0A A;  1R5H A;  5JFR A;  3WTY C;  1C0W A;  2M1B A;  5CVI A;  5J8F A;  2VE9 A;  4ZYG A;  4BNC A;  2RVC A;  3MWM A;  1FBS A;  3I0T A;  2M45 A;  4L5I A;  1I5Z A;  4ESJ A;  2ESN A;  1OYW A;  4A2U A;  3J7A O;  3P9C A;  1XSD A;  2P7V B;  3LQQ A;  5JHU A;  5D5W B;  3HRU A;  2XAS A;  1UST A;  3OOP A;  2XAH A;  1H9G A;  1TNT A;  2V9V A;  2FML A;  4PDK A;  3IC7 A;  1Z1D A;  2P5L C;  2IVM A;  3H92 A;  4ENM A;  3PQK A;  5DUI A;  1QPM A;  5D5X B;  5DCF A;  2QBY B;  3I53 A;  3IRQ A;  5H6Q A;  2GZW A;  4OIR F;  5E1X A;  2L02 A;  3FXR A;  2ZNY A;  4RGX A;  4PGG A;  3V8K A;  3RPU A;  1R36 A;  3BPX A;  3V8J A;  3H3Z A;  5JR3 A;  1CF7 A;  1L0O C;  3E6M A;  5HS8 A;  2LF8 A;  4UVB A;  1ZGA A;  3CLO A;  1R1T A;  5DDG A;  4FHT A;  2Z3Y A;  3KP4 A;  2FBH A;  4N9H A;  3BRO A;  1VTN C;  4RAY A;  3JTH A;  1B9M A;  1GXP A;  5DD8 A;  4RAZ A;  4ESB A;  1W5S A;  1AWC A;  5BOX A;  5EEG A;  3HHH A;  4HQE A;  3ZN0 A;  3GW2 A;  4R1H A;  4OOI A;  4UV9 A;  2A6E F;  3RDI A;  4OMZ A;  1D3Y A;  5LGU A;  1BC8 C;  3QP6 A;  2VT2 A;  2O03 A;  2XAJ A;  3LA2 A;  3WTU C;  2HZT A;  2LNB A;  4HX8 A;  1GXQ A;  1ON2 A;  1XGN A;  1D8J A;  4HF1 A;  1Z91 A;  1TW2 A;  4S05 A;  1Z9C A;  2ADU A;  3E5X A;  4UHT A;  2W24 A;  2QVO A;  4CZZ A;  2ISY A;  3G3Z A;  4EM1 A;  5JI6 A;  2FA5 A;  1BBY A;  2YR2 A;  5LRS A;  3KP3 A;  4ZZL A;  4KMF A;  4I0A A;  5L3F A;  2Y75 A;  4I2O A;  2L4M A;  3F8N A;  1RUO A;  1SMY F;  2PMU A;  5LGN A;  1SMT A;  4NB5 A;  1XGM A;  2EFW A;  2UZK A;  5H20 A;  3GZ5 A;  3F6O A;  1K7A A;  1Z05 A;  2QQB A;  4RB0 A;  1HBX G;  4HF2 A;  3I64 A;  3N97 A;  3L7W A;  4IJA A;  3KEQ A;  1LDK B;  2XIG A;  2YPR A;  3ISP A;  3KET A;  1LEA A;  4O5V A;  3LQR A;  1Z6R A;  5D6E A;  4U7B A;  2IRF G;  3AAF A;  1IN7 A;  1LJ9 A;  3E6D A;  5F1R A;  3ZN1 A;  1DUX C;  2DW4 A;  1W7P B;  3SFZ A;  2GXG A;  3WE3 A;  3J81 Z;  4MQV A;  4QLC U;  4ESF A;  2FXA A;  3CUQ C;  4LGW A;  2XHK A;  1KGS A;  4U7D A;  2P5K A;  3RYR A;  3QPT A;  2IA1 A;  4XSZ F;  4HLX A;  4MGR A;  2HOE A;  2EFQ A;  2QUF A;  2BV6 A;  1F9N A;  2D1H A;  4WK8 F;  4CDG A;  2O61 A;  1YQA A;  5D8K B;  2G7U A;  1FX7 A;  1IN8 A;  3MQ0 A;  3IKT A;  1MD0 A;  2RNJ A;  2GXB A;  3PQJ A;  1SAX A;  3IWF A;  3E6C C;  3LFK A;  2H6C A;  2VBZ A;  3P7N A;  1ZRC A;  3GLX A;  2M87 A;  5CVR A;  4U0Y A;  1XDS A;  2AS5 F;  2G7H A;  4G7H F;  2MC3 A;  1T6S A;  4Q4Z F;  1ZRF A;  1HSJ A;  3V4G A;  1ZRD A;  1BIA A;  3TO7 A;  5DCM B;  5J6X A;  1XGO A;  1S3J A;  2QWW A;  2RKH A;  1Q1H A;  4AIJ A;  1V4R A;  2HTS A;  3V7R A;  2CG4 A;  3RKY A;  3WTZ A;  4G6D A;  1TQM A;  1E17 A;  4OMY A;  3F6V A;  4A0X A;  1PDN C;  2TDX A;  4DNC A;  4RB2 C;  1QBJ A;  2NYX A;  1H9T A;  2V79 A;  2P5V A;  3WTX C;  1WSU A;  1S8N A;  3QOP A;  2OQR A;  1G6N A;  3KCC A;  3GFM A;  2M30 A;  2OA4 A;  4UVA A;  4EMS A;  4ENK A;  2HQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...