4IXAA

Structure of dna-binding domain of the response regulator saer from staphylococcus epidermidis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
102
structure length
102
Chain Sequence
b'MEQLEFDGLVLKNLSKTLTINNIEIPMRIKEFELLWYLASREGEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEKHDFLPYTITTVWGLGYKFERSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Response regulator SaeR
publication title Structure of DNA-binding domain of the response regulator SaeR from Staphylococcus epidermidis
rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription
total genus 31
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ixaA00
2ADUA 4UV9A 3V4GA 3R6SA 2FBHA 4OIQF 3GEZA 5FLXZ 2FU4A 1W7PD 3F22A 1OPCA 1MD0A 3HSEA 3E5QA 1RIOH 1BC8C 2EFOA 4JBAA 5BPIA 3E5UA 1UB9A 1FBQA 1PUEE 1EH7A 1FT9A 3LWFA 2EFPA 2MH2A 1SFXA 2PMHA 3V7SA 2JSCA 4AIJA 2PG4A 5L3BA 1RUOA 4RAYA 1W7PB 4CZZA 4UUVA 3HOSA 2EWNA 3R4KA 3ZMUA 2FMLA 4HBLA 4WXCA 1T39A 5FB2A 3EDPA 1MDMA 1OYYA 4IHTA 3CUQB 4P9FA 1EH8A 1BBYA 2PBIA 5FO5A 1FSEA 3GZ6A 2PN6A 2YU3A 1VTNC 1BM9A 2Q0OA 3PFIA 1FYLA 2HGCA 5J6XA 2ZMEA 1TW2A 3HTUA 4DQ2A 2GIVA 1ZREA 2COMA 2GAUA 2FBIA 1XSXA 3I58A 4FT8A 2YX7A 3O3KA 2XROA 2VBWA 2WWYA 2OU2A 3EYIA 2HFHA 2Y0MA 2DTRA 1QNTA 5EEGA 1F1ZA 2K7LA 2GXGA 4RB2C 3C7JA 3T8RA 4LG0B 3O2PE 4U0WA 3REOA 1G4DA 4L5IA 5D8KB 4M6XA 1I27A 2MLKA 1IXCA 3L9FA 5LRRA 1ZH5A 4HAMA 4IRHA 5ED4A 5E20A 4Q4ZF 3DPLC 5HLGA 3QP5A 2DPUA 1F9NA 2OZUA 3RIRA 1LDJA 1P4AA 5KVRA 4RAZA 5BPDA 2YPRA 1RNLA 2FNAA 1EV7A 5DCFA 5JI6A 4HF2A 4HX4A 3RTRA 3ZMTA 4HA8A 1FBSA 3QU6A 4HQEA 1ZLJA 3RKYA 3C1DA 1Y0UA 4KNYA 2JZYA 5FD6A 4B8XA 2DO7A 3FMQA 2QUFA 3GFMA 1GXQA 3R0JA 1J5YA 1LQ1A 1Z7UA 2KIMA 1ZRDA 3CO6C 4IF4A 1JXSA 2BBYA 4Q47A 2Z9OA 4G6DA 2QENA 3B73A 4MEYF 1P2FA 4M71A 4ESBA 2DPDA 3I53A 4O3MA 3H3UA 2CWEA 4XLNF 1IN5A 5L3GA 4H0EA 1O7FA 5E17F 2AXLA 3HHHA 1G3TA 4L0ZB 3I71A 2JT1A 1FSHA 3DXJF 1IXSB 3SXYA 1R1UA 3P9IA 2PMUA 2YX4A 1IW7F 3C3WA 1GXPA 3VB2A 1TBXA 3E5XA 5L3FA 2XAHA 3L00A 4ASNA 2OA4A 4A2UA 2RKHA 5LHIA 4PDKA 3J81K 2CG4A 2XUBA 1KYWA 2E7XA 4RB0A 3I59B 1K78B 2H27A 3ULQB 2P7CB 4L9VA 5DCMB 2IVMA 4S05A 2VBXA 3C18A 4R79A 3J80K 2W25A 1P6RA 1XB4A 2NS0A 3WGIA 4HV5A 4M72A 2NNYA 1XGOA 1SD7A 3IC7A 3T0YA 1QQIA 3ISPA 2PJPA 3KP5A 4ENMA 4U7BA 2XKOA 4BQAA 4N9HA 4UVCA 4FHTA 5L3DA 5IT3A 3IWZA 3BDDA 2QM3A 3W6KB 2PQ8A 3EYYA 2QQ9A 5FFZA 1IN7A 1S8NA 2VXZA 1RI7A 3ABUA 1S3JA 1B6AA 3HRSA 1ZRCA 1U6GA 2FXAA 5EEHA 4DNCA 2V79A 4I01A 2EV0A 2HDCA 4AD9A 4L0YB 5LEJA 3K2ZA 3GXOA 2NNNA 1FP2A 1O7LA 4CHUA 2JTVA 1GVJA 3TQNA 2Z99A 1LEAA 1UHWA 3ZP5A 4LMYA 3GYHX 2L02A 1TLHB 5LHHA 4N9IA 2O6GE 5LBQA 5D6EA 1V4RA 2P4WA 1O3TA 4XSXF 1YTYA 1QBJA 2H6CA 4HF0A 2ZNYA 3R60A 1E17A 2ESHA 2ZCWA 2VT3A 4L5JA 5HDKA 1FOKA 2XKPA 3N97A 4EM0B 2BEOA 1QZZA 1ZRFA 1U5TA 2EA4A 2XGXA 2EFQA 3DF8A 1G3YA 4EV0A 4XSZF 1YO5C 1ZG5A 2O61A 2DK5A 1G6NA 2QVOA 3CTAA 4ESFA 1U3EM 3K0LA 1QPMA 4HYEA 2ZO4A 5E1WA 2V1DA 3FMSA 2LSOA 3MFKA 2HOEA 5AIQA 3CDHA 3PQKA 4ZYHA 1S29A 2G7UA 4MNUA 2M8EA 4YFXF 3TOAA 1J7KA 2EA2A 4EGZA 4A0ZA 4KYWA 2MA3A 2QWWA 5D5WB 3LA3A 1TW3A 1B59A 1D3YA 3N4MA 3HRMA 2MBFA 5HS8A 1WRJA 2WV0A 2VODA 3FF5A 3U1DA 1PP8F 4I2OA 2E1NA 1JGSA 1FYMA 4OMZA 3FX3A 3RYPA 2ZFWA 4L9NA 1XDUA 1P92A 2RNJA 5ICCA 4G9YA 2IJLA 4BHCA 4ON0A 4PZJA 4OIRF 3TGNA 3HSFA 2L4AA 4LLGF 3RPUA 3F23A 1KU7A 5CJ9A 2IA0A 1BOAA 2D45A 3I5UA 3JSOA 4XLPF 2BYVE 4HDVA 4Y13A 1K7AA 1SMTA 3RDIA 3T5XA 1IN8A 2M87A 2XIGA 1D8JA 3KCCA 2G9WA 3F8BA 3TDUC 2ESNA 3WG9A 1OR7A 4LLLA 2CFXA 1ZLKA 1KU3A 4BXUA 1S6LA 1K6OA 3DQVC 5TJJA 3LFKA 3MAJA 1REPC 5K5QA 4CXFA 1IN4A 5AIPA 2IA1A 3IHUA 5D6FA 4RB3C 1DPUA 2IRFG 1HKTA 3ECHA 3NQOA 1ZARA 2ISYA 2IW5A 1J59A 1FX7A 1R5HA 4HOBA 3HTSB 4NHJA 1TQIA 2RV8A 3LSTA 2W84A 3JAMZ 5ILVA 3KP7A 2MD5A 3F8MA 5DV5A 3WODF 3MZYA 3KP4A 4P96A 1XSDA 4U7DA 4B09A 2A6EF 1I5ZA 1Z6RA 1J0RA 3FXRA 3FMRA 2A68F 5JR3A 1L3LA 1Q1HA 2A07F 3ZN0A 4RB1A 1TQMA 1ODDA 2GQQA 4ESJA 1IF1A 4ENKA 4LK1F 5HOOA 3GUDA 1FNNA 2ZXJA 4G7OF 4UXNA 1KA8A 3BPVA 1FY7A 2XAJA 3ERED 4PGGA 2V1UA 2BE5F 1LDDA 5TRDA 2ZBKA 3S2WA 1MJ9A 3K9TA 1WWXA 2M45A 4L9JA 3F8CA 4KN4X 1DP7P 3RKWA 5HS7A 3WTWC 2GA2A 3ZMZA 3Q9VA 3VODA 4OMYA 2LNBA 1BI2A 1BI1A 3RJPA 1XGNA 2F5EA 4FX0A 4UVAA 4UV8A 3G3ZA 5FGMA 3GLXA 5AONA 1SFEA 2M1BA 2W85A 4I0BA 4OIPF 4BHPA 4WF2A 4GCVA 2XASA 2VOOA 1SFUA 3HHGA 2GA1A 3HRUA 5FD5A 2R3SA 1H9TA 1P4WA 1WQ2A 3T1BA 5A2QK 2OZ6A 2PEXA 3R61A 2VN2A 1CF7A 5IT9Z 2HTSA 5DCMA 4M74A 4HW0A 2ISZA 5E1ZB 2UWMA 3LQQA 3CO7C 2RC4A 2FF4A 3PQJA 3BOQA 1R1VA 3HRTA 2OD5A 3KLNA 4PGHA 2J5OA 1ZGAA 3F8FA 1R1TA 1XCBA 1J9IA 1QO0D 5D5VB 3ZMSA 1R23A 4KT5C 1U5TC 3SZPA 2FBKA 4U88A 2LF7A 4WXHA 3JTHA 2VBZA 1UHMA 1XD7A 3KFWX 4HZFA 1WSUA 5HVQC 2O3FA 4I02A 2ZNZA 1IZ1A 4IRGA 5D5UB 6PAXA 2QBYB 2RN7A 1IAWA 1MDMB 4A0XA 4ZYDA 4O6JA 3GVAA 3E6BA 4A5MA 4D0PA 3GW2A 5BMZA 4EVIA 3E6MA 4WWCA 4I09A 1R22A 2RQPA 3M1EA 3R0AA 4GYGA 1KQ8A 2VONA 5DYMA 2WTEA 2Y48A 4IXAA 2XVCA 2LF8A 5HLHA 1TNTA 3CUQC 5CVRA 2P7VB 3EUHA 4OIOF 2FOKA 3F72A 5CVVA 3H3ZA 4S04A 1B9NA 5K5OA 5H6QA 5K1YA 4WX9A 2B0LA 3V7RA 4AWXB 1XGMA 1YG2A 4BHBA 2STWA 1YFHA 4Q5SF 2AS5F 2FRHA 2DFIA 4MHGA 5H6RA 1QGPA 2P6SA 1UFMA 5DD4A 4BYYA 2XAQA 2K4BA 2FA5A 1I1SA 2K4JA 3BP8A 2FQ3A 3SQNA 4CDGA 1W4MA 1L0OC 4EJVA 4KICA 2J5PA 3O6BB 4Y15A 3WGGA 5F1RA 2EB7A 4MTDA 4IJAA 1YS6A 3W6JB 3AAFA 2DQRA 3TO6A 1XN7A 5ILSA 5FLXK 5H20A 4QLCU 3ECOA 4FX4A 1FZPB 1R7JA 2XV4S 4EJUA 2KJCA 4OU0A 2W57A 1MJBA 1G3SA 3E6DA 3WTYC 4LJZF 1YS7A 5HDGA 4MGRA 3HOTA 1TTYA 4RGXA 1OYWA 2STTA 4EM1A 2R7FA 3GWZA 1HKQA 3COAC 3ZMDA 4TV7A 2DQLA 2W24A 3EQLF 4Y17A 3E6CC 2P5LC 2IT0A 4ZZLA 4YIFA 1RUNA 3QOPA 3WTSC 4HDUA 3ML6A 4ENNA 2YR2A 3TKYA 3MZHA 4GO1A 1T0FA 5E8IA 4RGUA 3D0SA 4IPAA 4HX7A 3WTTC 2IA2A 4MEXF 2DT5A 4LGWA 3DFGA 3G73A 2HEOA 3K1NA 2CYYA 2P5VA 2QQAA 3P7NA 2HYGD 5LLQA 4YFNF 1HSJA 4JK1X 1K79A 2KIUA 2LDUA 2DLLA 1IUYA 2NAZA 3M7GA 3KZYA 5JVTA 5DUKA 2Y75A 1DPRA 1E2XA 3SZTA 1BJAA 1ZG3A 2NRAC 5J8CA 5D4SA 4KA4A 2O8XA 1YW9A 2F5DA 5HLIA 2L01A 4KMFA 3DPTA 5JHUA 1USSA 4G6QA 1FWZA 5F6FA 1XSVA 5CLSA 4YIIA 5ICGA 1JHFA 3V8LA 4LB5A 3VFZA 2PI0A 1SMYF 5LGTA 2R7DA 3ZN1A 1TNSA 3NEUA 1W7PA 2NYXA 2HKOA 3TO9A 1SD5A 2BGCA 1OMIA 1MZBA 3GFJA 3KLOA 1XGSA 2MH9A 1FC3A 3CUQA 3TOBA 2GXBA 1JHHA 5E8GA 1ULYA 1SD4A 1LDKB 1KGSA 3BZ6A 3HIFA 3I0TA 2HZTA 2X0LA 1LJ9A 2VBYA 1SAXA 2MLGA 5HDNA 4KDPA 4EJWA 2X4HA 2VT2A 1KYZA 2XRNA 4BAYA 2QQBA 3MEXA 3JW4A 3WTUC 2O03A 1I6XA 2HQNA 3J81Z 1FLIA 4M9ZA 3J7AO 2F5CA 2L54A 4LG0A 2D1VA 1H9GA 2K27A 3FZVA 3OOPA 2JPCA 5D8LB 4UHTA 1I1GA 5DD8A 2HKXA 3F3XA 3J80Z 2KRFA 1U78A 3WE2A 5E1XA 4A6DA 1LNWA 4WXDA 5BQTA 1XMAA 4RGRA 1W5TA 1ZN2A 2ZKZA 3BROA 1SD6A 3QAHA 2ZJ2A 3M9AA 3GX4X 3QPHA 2GZWA 5LRSA 4HX8A 4EJTA 2JRTA 2QZ8A 1HW1A 5LEKA 2HS5A 1BN5A 3M8EA 3MQ0A 2ACJA 4LLNA 3GFIA 4MQ9F 3Q9SA 4BH9A 2V6CA 2F2EA 4A5NA 4R8HA 1YIOA 1FYKA 1A04A 4CICA 1R5GA 3QU3A 3CJNA 2OQGA 1STZA 1IRGA 3MCZA 4YG2F 4GGGA 4L9TA 3LA2A 1UCRA 2DI3A 5CVIA 1NHAA 2G7HA 2QBYA 1BIBA 2VC1A 1TQPA 1B9MA 2Z5UA 3BJAA 3V7CA 1R00A 4A6EA 4AIKA 1MKMA 2FSWA 3IRQA 1C0WA 2A6HF 5CVUA 3KE2A 5HS9A 1OYIA 2L4MA 2ELHA 2OQRA 2DK8A 4KIFA 1R36A 1AWCA 2A5YB 2QLZA 4UNOA 4M6YA 2EFNA 3WTZA 4P9UA 2VOPA 2PFBA 4M73A 3KZZA 3I64A 1T6SA 5L3CA 2H09A 1Z6TA 4MQVA 1T38A 1ZGJA 2DBBA 4A0YA 1YW7A 1Z05A 3DEUA 3K1MA 3I59A 1PP7U 1K78A 3I4PA 2A69F 2EFWA 2FMYA 3VEPA 3MWMA 3TO7A 5D4RA 4ZZDA 1BI0A 1HSTA 1ONVA 4CGZA 2CGPA 4LB6B 1MGTA 1B4AA 3F6OA 4OOIA 4Z2YA 5BS6A 2JPBA 3KETA 4RS8A 5ERIA 1GHCA 1FP1D 3P9KA 3KEOA 3BJ6A 4L18B 1FBUA 3NRVA 4U0VA 3U2RA 1T98A 4LK0F 3DKWA 3TDZC 2CQKA 2Q8KA 4HQMA 3IKTA 2CW0F 1IRFA 2GWRA 1PDNC 1KU9A 3KP3A 4EM2A 1WI9A 1O57A 1ON1A 1F4KA 1ZYRF 2EV6A 4KUMA 5K5RA 4OINF 2E1CA 3F6VA 2WC2A 5ILUA 3T8TA 3BPXA 3LAJA 3QP6A 2ZMEB 3HYIA 3L2CA 1AOYA 1ON2A 4EJOA 3CUOA 4HV6A 3H92A 1X3UA 2H94A 3K1PA 1WKMA 4ZYGA 2UZKA 4IRIA 2M5WA 3K69A 1H0MA 1YLFA 2KIFA 4RGSA 3HUGA 5F64A 4AVPA 4BNCA 1BIAA 1ZAOA 3VOEA 3WTXC 1FPQA 4P5OA 3ELKA 2E7WA 2O0YA 3KP6A 3BY6A 4HF1A 4HLXA 2KKOA 5DEQA 4CO8A 3RYRA 2IPQX 3L09A 3IKVA 2V1XA 2VE9A 4G8XA 5D5XB 4CYDA 1CF7B 3KEQA 3M8FA 3B02A 3V8KA 2Z33A 4ENJA 4M9SA 2LKPA 4KMUX 1KU2A 2P5KA 3F8NA 3IL2A 4EMSA 4N0BA 4XBFA 2EV5A 5LHGA 4WK8F 2DU9A 4EQQA 3FXQA 3IRRA 3LAPA 3DP7A 1LB2A 3WE3A 2RVCA 4UVBA 1KQ0A 4ETSA 3U9GA 4IVNA 4AIHA 2C6YA 3JAMK 4QWQA 1U8RA 1DUXC 2HQRA 2P8TA 1HW2A 2VE8A 3FXUA 2VC0A 1YW8A 2FEZA 3RI4A 2CSOA 2HTJA 5DUIA 4HLYA 5BOXA 1EH6A 1O3RA 2DAOA 3RPQA 2Z3YA 4LFUA 2QYOA 1KQ9A 2A3SA 2M30A 2IP2A 3GO5A 1YQAA 3V8JA 1F5TA 3FM5A 3QPTA 3Q5FA 4KIBA 3HSRA 1D5VA 4F7ZA 1W5SA 4GYIA 2UXNA 3BJOA 2Q2EA 4O5VA 2XAGA 1R58A 4K2EA 4P55A 2D2WA 4ZH4F 3OV8A 2D1HA 1V3FA 4KIGA 2H6BA 3FWEA 3ZPLA 2A61A 5A2QZ 1S7AA 3D5LA 3ZQ7A 3I54A 1ZG1A 1QZYA 3JSPA 2YSRA 2HWVA 3DV8A 2V9VA 3E97A 4E70A 2DW4A 2EJRA 1MJAA 4M9XA 4ZYEA 5JFRA 1J2XA 4PCQA 3L7WA 1BC7C 4I7HA 3IWFA 5CYVA 3ROUA 2FNPA 5ICEA 1BI3A 4I98B 1P4XA 2K86A 4NQWA 1HW5A 1T2KA 1ZHFA 3E3VA 4MTEA 3WTVC 2EK5A 3LQRA 5IT9K 4NB5A 2RGVA 2PLYA 3SHFA 1O3QA 4JQFA 1HKSA 4U0YA 4EGYA 3WU0A 4LD5A 5LGUA 2XHKA 1Z1DA 4Q48A 4KFCA 1IXRC 3SFZA 5DDGA 3JTGA 1G3WA 2OAZA 1HQCA 1RZ4A 1U2WA 5CVJA 1D8KA 1YYVA 1IN6A 3LA7A 4G7ZF 2OBPA 4GXOA 1J75A 1DDNA 2ETHA 2K02A 2MC3A 1LEBA 3GF2A 3FHZA 4R1HA 2HYFA 3P9CA 3FM3A 1JE8A 1XMKA 1HXDA 4I0AA 2HR3A 5LGNA 1CGPA 5E18F 4G94A 3WU1B 2CO5A 2UXXA 5L3EA 2RDPA 1XCVA 5FFXA 5ICFA 5J8FA 4G7HF 2FE3A 3QRFF 3KP2A 3GFLA 4IHSA 3ABTA 3CLOA 4YFKF 1B1BA 3WGHA 3EETA 2TDXA 1HBXG 4XRFA 1XDSA 2L3DA 1LVAA 1Z91A 1OKRA 3GZ5A 3BWGA 4A12A 4KN7X 2P6TA 2F5FA 3F21A 4WCGA 1Z9CA 2XAFA 3ZMVA 2KJBA 1S7OA 1O3SA 3RKXA 5KK1A 2BV6A 1USTA 1U5TB
chains in the Genus database with same CATH superfamily
4HSRA 5FKOA 2ADUA 1OCTC 4DYQA 2NVXJ 3G1OA 1RRJA 4UV9A 4A3BJ 3V4GA 2X85A 3R6SA 2ME6A 3IH2A 3OYEA 4A3KJ 5HODA 2DA4A 2FBHA 4OIQF 2DMUA 3GEZA 5FLXZ 3KIOA 2FU4A 1ZR4A 3HDDA 2BOLA 3C2BA 4E7SA 1K6YA 1WJ5A 2R7ZJ 3BZKA 1W7PD 3F22A 3OYCA 1OPCA 1MD0A 3LNQA 3HSEA 3E5QA 1RIOH 3JRCA 1BC8C 2EFOA 4JBAA 3DU6A 5BPIA 3E5UA 2KDZA 1UB9A 1FBQA 4AC0A 1ZELA 2NVUB 1PUEE 1Y8RB 2ZXIA 2EZLA 3I4NJ 3W2WA 1EH7A 1FT9A 3LWFA 1JUMA 2DOAA 5E3LA 2B7EA 2EFPA 2MH2A 1SFXA 3IUOA 2R5YB 2E19A 9ANTA 2IS2A 2HZDA 2PMHA 3V7SA 4RA2A 1PJRA 2JSCA 4AIJA 2PG4A 5L3BA 1RUOA 2O9LA 4RAYA 3CCEI 1N78A 1W7PB 3GTGJ 1E3HA 4CZZA 4UUVA 2I10A 1NG6A 1RETA 2R0QC 3HOSA 2EWNA 3R4KA 3ZMUA 2FMLA 4HBLA 4WXCA 1T39A 5GTHC 3EDPA 5F0FA 1OYYA 3FK7A 5FB2A 3CUQB 4P9FA 1MDMA 4IHTA 3FXJA 1EH8A 1I50J 2ZXHA 4BU2A 4D7NA 3PL8A 1BBYA 3HC7A 3ABLH 2PBIA 5FO5A 1FSEA 2DA7A 2NS7A 3GZ6A 1IJWC 3OYDA 2PN6A 2W1OA 2CV1A 2YU3A 2FD5A 1BM9A 2Q0OA 3PFIA 3CF5F 1VTNC 1FYLA 4C3IJ 3IH4A 2HGCA 3KYLA 4IX7A 5J6XA 3L2UA 2ZMEA 1TW2A 3HTUA 4ZC3A 1V54H 1ETWA 2GIVA 4DQ2A 1ZREA 2COMA 2GAUA 4BACA 3Q0VA 2FBIA 2X6WA 1XSXA 3HM5A 3I58A 3N05A 4FT8A 2YX7A 3O3KA 4LG3A 2XSJC 2ELKA 4UUTA 4A3MJ 3A4CA 4BJ6C 4BQOA 2XROA 2VBWA 2CQXA 2WWYA 2OU2A 3EYIA 3CESA 5FROA 2HFHA 3FBNB 2Y0MA 5M3MJ 4DBRA 1OFCX 2DTRA 3CJTB 4F52A 4HNVA 4D9JA 2W7NA 1X4PA 3Q0UA 1QNTA 3HPHA 1F1ZA 5EEGA 2K7LA 3FXOA 4JX5A 2CUZA 2GXGA 4RB2C 2EILH 3C7JA 2H1KA 3T8RA 2LR8A 2L9SA 4LG0B 1D1BA 2FUG2 3O2PE 2R7TA 2XF6A 4U0WA 3PSFA 3REOA 1UG0A 1G4DA 4L5IA 5D8KB 4M6XA 5J47A 1MMAA 1I27A 4I76A 5DM7F 1EA3A 2V9PA 2MLKA 3VYRB 2NVYJ 4C2UA 1T56A 1IXCA 2EBIA 3MN2A 3L9FA 1U9OA 5LRRA 1ZH5A 2VKEA 3CCJI 4IHWA 4HAMA 4D1QA 2DXIA 1TWAJ 2ZJRF 4IRHA 1JUSA 5ED4A 5E20A 4Q4ZF 3DPLC 2W4SA 3DTEA 3QP5A 5GADJ 5HLGA 1F9NA 1B72B 1JKOC 2OZUA 3RIRA 2DPUA 1LDJA 3CCSI 1I3QJ 4XLCA 1P4AA 5KVRA 4RAZA 3H35A 5BPDA 1ERDA 3J7AY 2YPRA 3M07A 2QKLB 1RNLA 2CUJA 2VKVA 2FNAA 5B1AH 3H36A 1A6IA 4XOPA 5DM6F 4U87A 1EV7A 4XICA 5DCFA 3BR3A 5JI6A 2Z16A 4HF2A 4HX4A 3RTRA 3JRGA 4YRVA 2MD0A 2XPWA 3ZMTA 4D7MA 1YHQI 4HA8A 3OIPA 1FBSA 1FTTA 1BR1A 2X6OA 3QU6A 3EUKL 3ZR8X 3PJRA 3PSIA 3PM1A 3RQIA 4BKXA 2CFOA 2VQHA 4HQEA 2X51A 1ZLJA 3BTCA 3RKYA 2NOJB 3CCRI 1MNMC 4XLAA 3C1DA 3HZJA 1Y0UA 2JA5J 2IXSA 2DOFA 4KNYA 2K9SA 3LSJA 3OL4A 4XOTA 3CMAI 2JZYA 5FD6A 4B8XA 2DO7A 3FMQA 2QUFA 3GFMA 1GXQA 3R0JA 3JRFA 1J5YA 2O7OA 1LQ1A 2X48A 2B9SA 1Z3YA 4A3DJ 3TEDA 1Z7UA 4RAFA 2HXOA 2KIMA 3FXLA 2WB1N 3HOVJ 1ZRDA 1WH5A 3CO6C 1QHGA 1WCMJ 2NS8A 4HG2A 4IF4A 4RM3A 1JXSA 1ZTRA 2M8GX 2BBYA 4Q47A 2Z9OA 3BC8A 3OIQA 2QENA 4G6DA 3B73A 4MEYF 1P2FA 2DODA 4M3GA 1U8BA 2LKXA 4BJTA 3IP4B 2PJRB 4M71A 2VKHA 3WHCA 4ESBA 5EGOA 2DPDA 2IGKA 3I53A 4O3MA 1A5JA 3H3UA 3HGGA 2CWEA 5K7ZA 4XLNF 1TT5B 1IN5A 5L3GA 4H0EA 1O7FA 5E17F 5IP7J 1APLC 2KDOA 2AXLA 5GAEJ 3HHHA 1G3TA 4Y7NJ 4L0ZB 4BUPA 2CH0A 3BLYA 3TP3A 2H8WA 3I71A 2JT1A 4CYCB 3VYUB 1FSHA 3DXJF 1IXSB 2AXTC 3SXYA 1R1UA 3P9IA 4E7ZA 2PMUA 4Y33A 3A02A 2YX4A 2ZC2A 4ZTJA 1IW7F 1VQLI 2DMQA 3C3WA 1GXPA 3VB2A 2EIJH 1TBXA 3FISA 3S3NA 3E5XA 5FKMA 4CCNA 5L3FA 1EJ9A 1JTYA 2AHQA 4S0HB 2XAHA 3DCFA 3L00A 2VJJA 4ASNA 2OA4A 1Y6IA 2LY9A 4CZCA 4A2UA 3OYAA 2RKHA 3UR3C 5LHIA 2CMPA 4PDKA 4BGDA 3J81K 2CG4A 2XUBA 2Z2SB 1J09A 4DJAA 1KYWA 2E7XA 4RB0A 2ID3A 5J4VA 4UB8C 4DYCA 2BW3A 2ME0A 2JSPA 3I59B 3C2GA 4HSTA 1K78B 2H27A 3BTLA 3KYCB 2DA3A 1JJ6C 1BW5A 1QRYA 3ULQB 2P7CB 5J4YA 4L9VA 2JA8J 5DCMB 1JKRC 2IVMA 3DU5A 5GAGJ 3LOCA 2ZSHB 4CUGA 4S05A 2VBXA 3C18A 4R79A 3J80K 2CUFA 1LUJB 3CDIA 1OCRH 1QVUA 2W25A 3HGYA 2QSFX 2EQRA 1P6RA 2YU9J 3BQYA 1XB4A 2NS0A 3WGIA 1OR7C 1D0ZA 1A6QA 4HV5A 3RCOA 4M72A 2NNYA 1XGOA 1SD7A 3IC7A 3T0YA 1QQIA 2R92J 3ISPA 2NVTJ 1YJ9I 2PJPA 1VQMI 3GTOJ 3KP5A 4ENMA 1IC8A 4U7BA 2XKOA 4BQAA 4N9HA 4UVCA 4FHTA 2VI6A 1Y0NA 5L3DA 4UUSB 2CS3A 5IT3A 3IWZA 1AA7A 2OPTA 3J7ZI 3BDDA 2QM3A 1RESA 3W6KB 3ZCOA 4PJ0C 3I55I 1ETXA 2PQ8A 3EYYA 4MIMA 1WPKA 2QQ9A 5FFZA 1IN7A 3S2DJ 2GOMA 1S8NA 2VXZA 4DZJA 1RI7A 3NARA 4M3BA 3ABUA 1MMNA 1S3JA 1B6AA 4A69C 1GDTA 3A0HC 3HRSA 2L7FP 2F4OB 2KMUA 1ZRCA 1U6GA 2FXAA 3L2QA 5EEHA 4DNCA 2V79A 4DOZA 2IGNA 5IYBJ 4I01A 1E3OC 2HQ5A 1ETQA 2CQQA 4ZDLA 1LE8A 2EV0A 4M6VA 3BR1A 2HDCA 2M3AA 2A05A 4AD9A 4L0YB 4XKWA 5LEJA 1SFKA 3K2ZA 3AKZA 3GXOA 2NNNA 3RQ4A 1FP2A 4RLFA 2Y9ZA 3GLLA 1O7LA 4CHUA 2JTVA 5KCMA 1GVJA 1IDZA 1IRXA 3Q0WA 2E1MC 2Z99A 3TQNA 1LEAA 2XF5A 2LY1A 1NG7A 1VQ7I 3LSKA 1UHWA 3ZP5A 4LMYA 2L7ZA 1I3AA 2R4GA 3GYHX 2L02A 4NC7A 1TLHB 5LHHA 1T95A 4N9IA 3JCUC 1K4TA 2O6GE 5LBQA 3OR1C 5D6EA 3ZRGA 5E3OA 5JVGF 5F0HA 1V4RA 2P4WA 1B8IA 1E0EA 1MNEA 1O3TA 2DN0A 4XSXF 2K5CA 1MBHA 2VPLA 3HUGB 1YTYA 4A93J 3GMEA 2A6TA 2H6CA 2VASA 5EG0A 4HF0A 1QBJA 2ZNYA 3R60A 4XNFA 1E17A 2ESHA 2ZCWA 2VT3A 4L5JA 2XRLA 4B1RA 3BG3A 2W00A 3KPHA 5HDKA 1FOKA 5DTDA 2I8DA 4AYBA 4QPQA 2XKPA 3OS1A 1UAAA 4RBOA 3N97A 3JRBA 3LSRA 1D5YA 1S7EA 3VYTB 4EM0B 2BEOA 4P1WA 2JA7J 1QZZA 1ZRFA 1U5TA 2VJ4A 2EA4A 1BW6A 2XGXA 2EFQA 2LKSA 2WA0A 3DF8A 1G3YA 3K4CA 2KIQA 4RAGA 5FKLA 4EV0A 1DGWY 4XSZF 1YO5C 1ZG5A 2O61A 2DK5A 1TT0A 1G6NA 2QVOA 3CTAA 4ESFA 1U3EM 1SVOA 3CCQI 3K0LA 4PFOA 1QPMA 4HYEA 3CC2I 2ZO4A 3CJQB 5E1WA 2V1DA 2TCTA 1VNDA 4JP0A 3FMSA 2LSOA 4XM3A 3MFKA 2HOEA 3OIOA 5AIQA 2K9QA 2EIMH 3CDHA 3PQKA 4ZYHA 1S29A 2G7UA 2VB6A 4N4OB 4MNUA 1JKQC 3K4KA 2M8EA 4YFXF 2E5NA 3TOAA 1BJZA 4BDZA 1J7KA 2EA2A 3WG7H 4EGZA 1W0UA 4A0ZA 4KYWA 1FOXA 3OYFA 3I56I 1YRNB 2MA3A 1Y1WJ 3IAS2 2QWWA 1Z67A 3BTIA 3LA3A 3VYSB 5D5WB 1TW3A 1B59A 1D3YA 4B44A 2RNGA 1K4SA 3CP2A 3N4MA 3HRMA 4PJMA 1W36C 2MBFA 5HS8A 1K83J 1WRJA 2OJED 2WV0A 2VODA 3FF5A 1X1DA 3U1DA 1PP8F 3CDLA 5KAIC 4I2OA 2E1NA 5CKTA 1JGSA 2DFEA 1FYMA 2DT7B 4XRSG 4OMZA 3LSIA 3FX3A 1MBEA 1BR2A 4J01A 3RYPA 2KL4A 2ZFWA 3LSPA 4L9NA 2HVRA 5HNHA 2BY1A 3S15J 1XDUA 1P92A 2RNJA 5ICCA 4G9YA 2IJLA 4BHCA 4XQFA 4ON0A 4PZJA 4OIRF 2KP6A 3TGNA 4ZDOA 3HSFA 2L4AA 4LLGF 3RPUA 4LIUA 3F9KA 3F23A 3PNYA 2KZVA 1KU7A 2M7BA 3H9GA 2MYSA 3HPGA 3ZQQA 5CJ9A 2IA0A 4F3QA 1BOAA 2D45A 3I5UA 1X4OA 2KT0A 3JSOA 3OY9A 4XLPF 2R7QA 2BYVE 4HDVA 3C2HA 4Y13A 4HNTA 1K7AA 4G12A 1SMTA 3RDIA 3T5XA 3DEEA 1IN8A 4HNUA 4C2TA 1FMWA 1LFBA 3HB9A 2M87A 2XIGA 1D8JA 2O8KA 3OMYA 3KCCA 1XPXA 2G9WA 1Y1VJ 3F8BA 2TRTA 3TDUC 2ESNA 4XMYA 4B4CA 3WG9A 1OR7A 3DKYA 4LLLA 3S3OA 2CFXA 1ZLKA 3CMEI 1S5LC 2ZB9A 1KU3A 4BXUA 1S6LA 1K6OA 1JTXA 3DQVC 5TJJA 2LBFA 3CJRB 4NUBA 1MBGA 3MD2A 3LFKA 3MAJA 4B3AA 1X1BA 2E35A 2JK3A 1REPC 5K5QA 1Y56A 4CXFA 1IN4A 1AHDP 5AIPA 2IA1A 3IHUA 3K4LA 5D6FA 2DMTA 4RB3C 1DPUA 2IRFG 3GTQJ 3EUAA 4A3CJ 1HKTA 3ECHA 2XGDA 3DBLB 3NQOA 1ZARA 3PIPF 2ISYA 3MMYB 3U1KA 2UUZA 5FRNA 1WJAA 3AL0B 2IW5A 1HDPA 1P9QC 2F5VA 1J59A 1FX7A 4OAYA 2WB1A 1R5HA 4HOBA 1DGRM 2CW7A 3ZQLA 3HTSB 1HLVA 4NHJA 1TQIA 2RV8A 1NK2P 3LSTA 3EUHC 3G1MA 2W84A 2E2JJ 3JAMZ 2IS1A 2EZKA 5ILVA 5IYCJ 3KP7A 1ETYA 2MD5A 1R49A 4W97A 3F8MA 5DV5A 1XX5A 3WODF 1DU0A 3MZYA 3KP4A 1ETVA 4P96A 4FQGA 1IG7A 1XSDA 1ZGWA 1VFCA 1Q1VA 4U7DA 2P0WA 4NC8A 4PK4A 4B09A 2LP0A 2A6EF 3WHBA 1Z77A 4FTHA 1QU3A 4A3EJ 1I5ZA 3AG2H 1Z6RA 4AYBN 1J0RA 3S16J 3FXRA 3FMRA 2A68F 4C30A 1IO2A 5JR3A 1L3LA 1UHSA 1HA8A 1Q1HA 4PFPA 2K9NA 2A07F 3ZN0A 1X58A 4RB1A 1LFPA 2WAQA 4A3FJ 1TQMA 4CH7A 1ODDA 1P7IA 1XG1A 2GQQA 4ESJA 4ENKA 1IF1A 4LK1F 5HOOA 1FNNA 3DPUA 3GUDA 2ZXJA 4G7OF 4UXNA 1KA8A 3BPVA 1FY7A 4Y4RA 3JREA 4I99C 3JR9A 2XAJA 1WZ2A 3ERED 3ZQCA 2V7FA 2MW8A 4PGGA 2V1UA 2NXNB 2BE5F 1LDDA 5TRDA 2ZBKA 3S2WA 3V42A 4IKFA 3G6EI 2OTLI 3K6GA 4D5CA 1MJ9A 3K9TA 2BVMA 4BEHA 3PO3J 1WWXA 4EEFG 2M45A 4L9JA 2F4MB 1WI3A 3F8CA 4KN4X 1DP7P 3PNVA 5IP9J 3RKWA 5HS7A 3WTWC 4A3GJ 2MG4A 4N4NB 2GA2A 1LVKA 3ZMZA 1I6HJ 3Q9VA 2MC4A 3VODA 4OMYA 2LNBA 3CMYA 4C3JJ 1JKPC 1BI2A 1BI1A 3QYEA 3RJPA 1XGNA 2F5EA 1QZEA 3W3CA 3HBLA 2ICWG 4FX0A 4UVAA 1RR7A 5HLTA 3HOWJ 4EATA 3K4BA 4UV8A 3CD6I 3G3ZA 5FGMA 3ABMH 4MO7A 3BCAA 3K10A 3GLXA 5AONA 2XC7A 3S1RJ 1SFEA 1F36A 2XSDC 2M1BA 2QKMB 5EZHA 3VSLA 3LSGA 1OLTA 1LKXA 1BR4A 2W85A 4I0BA 3OYBA 1OJLA 5FJ8J 1VQ4I 1MH3A 4OIPF 4BHPA 3TW7A 4WF2A 3CCYA 4GCVA 2XASA 2JA2A 2VOOA 4C3HJ 2KFDA 4LITA 1SFUA 2BHYA 3HHGA 1X1AA 2GA1A 3HRUA 5FD5A 2R3SA 1H9TA 1P4WA 1WQ2A 2CW8A 3T1BA 2OZ6A 2PEXA 3R61A 2VN2A 5A2QK 1CF7A 5IT9Z 2HTSA 1PUFA 3BQZA 5DCMA 3JRIA 4E7IA 4E7JA 4M74A 2IGMA 4HW0A 3H5NA 2FQ4A 1T0FC 2LY2A 3F0CA 4HEA2 4KT6A 2ISZA 5E1ZB 2M34A 5F27A 2UWMA 1IGNA 1R4NB 3LQQA 3DBHB 3CO7C 2RC4A 3HL2A 2FF4A 3PQJA 4ITVA 3BOQA 3GBGA 1E3PA 2L7MP 2YUSA 3S3MA 4B43A 1R1VA 2QEXI 3HRTA 2H8RA 4FE7A 1D0XA 1OQYA 3ZQHA 2OD5A 5FLVA 2WY7Q 2R7WA 3LFUA 3KLNA 4BBSJ 5EZGA 4PGHA 2FX0A 2J5OA 2EZHA 1ZGAA 3F8FA 1R1TA 2PX9A 1XCBA 2HOSA 1J9IA 3S17J 3ZQIA 3ZQFA 1QA6A 1QO0D 3TBIA 5D5VB 4A3IJ 3JRDA 3ZMSA 1R23A 4KT5C 1U5TC 3SZPA 3QQAA 1Y39A 2FBKA 4U88A 2LF7A 1SVLA 4WXHA 4QSHA 3JTHA 2VBZA 5KAFC 4UB6C 1UHMA 1XD7A 4M3FA 2L9RA 3KEYA 2HDDA 3BG7A 3KFWX 3ONQA 4HZFA 1WSUA 1HC8A 1ZR2A 5HVQC 2O3FA 5EYRA 4I02A 2ZFUA 2ZNZA 1IZ1A 4IRGA 5D5UB 6PAXA 1T08B 4M3EA 4RMNA 5EJCA 1O4XA 2QBYB 2RN7A 1UG2A 4ZTFA 2R7OA 2DCEA 2HDWA 2QF7A 1IAWA 2OCCH 1MDMB 4A0XA 4ZYDA 1TWGJ 4XONA 1RC9A 4O6JA 1HDDC 3I3LA 3GVAA 2PMZN 2QSGX 3I4MJ 2DA5A 3E6BA 4A5MA 4D0PA 1OCPA 4IOCF 4AU7A 3GW2A 2LRDA 2MFZA 5BMZA 4EVIA 3E6MA 4WWCA 3DLLF 2RQQA 4I09A 1R22A 1T33A 3S8PA 4HRIA 3PO2J 3HOXJ 2RQPA 2WAQN 3M1EA 3R0AA 4GYGA 1KQ8A 2VONA 1TWCJ 1V5GA 5DYMA 2IGOA 2WTEA 3UNGC 2Y48A 4IXAA 3SEZA 3MZ8A 2XVCA 1XTAA 3FBIB 2LF8A 4IL6C 5HLHA 1TNTA 3CUQC 5CVRA 2P7VB 2XPVA 4BY7J 3EUHA 1EF4A 2DJNA 2LMDA 3VPRA 4OIOF 2XPUA 5JLXA 2X1EA 4NBQA 2FOKA 3F72A 5CVVA 3RKQA 3K7AJ 3H3ZA 4S04A 1B9NA 5H6QA 5K1YA 5K5OA 3OYGA 4WX9A 2B0LA 3V7RA 3OYMA 4AWXB 1XGMA 2XDVA 3FXKA 4MFEA 3O8HA 3HEFA 1YG2A 4XORA 4FASD 4BHBA 5E79C 4BS9A 4XR6A 1GUUA 1GVDA 2VLAA 2STWA 1YFHA 1G2HA 1N75A 3DTIA 5FRMA 4Q5SF 2AS5F 2FRHA 4PJLA 3ASOH 2DFIA 4MHGA 1VQKI 5H6RA 1QGPA 1TWHJ 3BG5A 2P6SA 1UFMA 1NK3P 5DD4A 5B1BH 4BYYA 2XAQA 2N8GA 1OCCH 4BDYA 2K4BA 2FA5A 1I1SA 2E34A 3PNTA 1MBFA 2K4JA 1RKWA 3E1SA 2JVHA 3BP8A 2FQ3A 3LSHA 2LC2A 2JVGA 1GV2A 3SQNA 3L2RA 4CDGA 1F43A 1W4MA 1L0OC 4EJVA 4QIWN 1FMVA 4KICA 2J5PA 3OSFA 2COBA 3O6BB 4Y15A 4KJZA 4NC6A 4ZDPA 3WGGA 4IHYA 5F1RA 2EB7A 1TZLA 4MTDA 1HF0A 3IAM2 3ZXSA 4IJAA 2BY0A 3U21A 1YS6A 3W6JB 4PSXA 3RSNA 2IEKA 1H89C 3AAFA 3S93A 2DQRA 4NDLA 3TO6A 1XN7A 4GDFA 5ILSA 1IUFA 5FLXK 5H20A 2X1DA 4QLCU 5IOZA 3CCUI 3ECOA 2K3FA 4W1UA 4FX4A 1FZPB 2QQ8A 1R7JA 2XV4S 4EJUA 3LMMA 2GM4A 2ZXWH 2KJCA 4OU0A 2W57A 2O5RA 1MJBA 2LFBA 2VIXA 1G3SA 4BJ5C 3E6DA 3WTYC 4LJZF 2VQGA 2Y2ZA 1YS7A 4ZYAA 3ERMA 1AKHA 3OWTA 5HDGA 4MGRA 4BQNA 3HOTA 1TTYA 4YIRX 4RGXA 1OYWA 1I39A 2STTA 4DW6A 2LD5A 4EM1A 2R7FA 3GWZA 2VL8A 1HKQA 2LTPA 1OISA 2ZJPF 3COAC 3ZMDA 2OUMA 4TV7A 2DQLA 2W24A 3EQLF 4Y17A 3E6CC 2P5LC 2IT0A 1A36A 4ZZLA 3M3YJ 4YIFA 1RUNA 1YI2I 3QOPA 3WTSC 4HDUA 4XL9A 3ML6A 4ENNA 2YR2A 2Z1DA 3QWLA 3TKYA 3MZHA 4GO1A 1T0FA 3HG9A 5E8IA 4RGUA 3MKYB 3D0SA 4IPAA 4HX7A 3WTTC 2IA2A 4MEXF 2DT5A 1JT6A 2VPRA 4LGWA 3SJMA 3DFGA 3G73A 2L9NA 1UJ8A 4JYKA 3K1NA 2HEOA 1TL8A 2CYYA 2P5VA 1VQ8I 3SDGA 3AG1H 2BXYA 1YE9A 2QQAA 3P7NA 2HYGD 5LLQA 2NOGA 1MNDA 5H2FC 4XLEA 4YFNF 2MABA 2VXDA 2IS6A 1HSJA 4JK1X 1DQUA 5K7HA 1K79A 2KIUA 2KPMA 2LDUA 3A01A 2DLLA 4C9YA 1FOWA 1IUYA 5JHFA 3VWBA 1WJCA 4XKCA 2LH9A 5BNGA 2NAZA 2K40A 3SZGA 3M7GA 3KZYA 1WJBA 5JVTA 5DUKA 2Y75A 1DPRA 3PIOF 3A0BC 1E2XA 2H1LA 4IO9F 3SZTA 1BJAA 3H1CA 1ZG3A 2BW3B 2NRAC 5J8CA 2LYCA 4MFDA 5D4SA 4KA4A 5M5YJ 2O8XA 1YW9A 1GT0C 2K9MA 2F5DA 5HLIA 1SAUA 5C44J 2Q1ZB 2VJIA 5E3MA 4BL0B 2L01A 1BA5A 5B5EC 4KMFA 4D5FA 4KITB 3DPTA 1A35A 5EEAA 5JHUA 1D0YA 1MIJA 1USSA 4AM3A 4G6QA 1FWZA 2BY2A 3HXLA 2HOAA 5F6FA 1XSVA 2E5ZA 1MMDA 5CLSA 4C2MJ 4YIIA 5ICGA 3QYBA 4BE1A 1JHFA 3QPSA 4XIDA 3G1LA 3V8LA 1UZCA 5J1YA 4LB5A 3VFZA 3TL4X 4UY8I 4E6KG 2PI0A 1BOBA 2CRGA 1SMYF 5LGTA 1X3ZB 2R7DA 2R5YA 3S1QJ 1IV6A 3FKJA 3ZN1A 2AQFA 1TNSA 3NEUA 2GXAA 1W7PA 1Z0XA 2NYXA 5GAHJ 2HKOA 4H4KC 3TO9A 5DS9A 5M5WJ 1SD5A 2BGCA 1OMIA 1XC5A 1WJEA 5TGTA 1VQPI 1Z7LA 1MZBA 2DT6A 3GFJA 1MMGA 2KQRA 3KLOA 1XGSA 2MH9A 3A1YA 1B72A 1FC3A 3CUQA 3TOBA 4II3A 2GXBA 3W2AA 1JHHA 3IV5A 3M8JA 1YJWI 5E8GA 4BBRJ 1ULYA 2DA2A 3FK6A 3OYKA 1DU6A 2VUMJ 1POGA 1SD4A 1LDKB 3ZGKA 1KGSA 3BZ6A 3HIFA 5F04A 1WH7A 3I0TA 3KZIC 1V55H 2HZTA 4CCMA 1FEXA 3SDBA 2EZIA 2L7KA 2M9HA 2X0LA 1LJ9A 2VBYA 4QTRA 2MLGA 5HDNA 1SAXA 4KDPA 2IAIA 4EJWA 2X4HA 2I5UA 2VT2A 4A3JJ 1KYZA 4FISA 1YX5A 2XRNA 4BAYA 2QQBA 4J00A 3MEXA 5IYDJ 4CA0A 3JW4A 3WTUC 2Q2EB 2O03A 3S2HJ 1I6XA 5C3EJ 1VI0A 2HQNA 3J81Z 1WJDA 1HCRA 3HOZJ 3CP8A 1FLIA 4M9ZA 3BCBA 4BE0A 3J7AO 2F5CA 2LREA 2L54A 4LG0A 2DYRH 2D1VA 4KISA 1ZQ3P 2K9LA 1H9GA 2K27A 3FZVA 3OOPA 2JPCA 1T8IA 5D8LB 4UHTA 1JUPA 1B8IB 2FOWA 1I1GA 2JN6A 2HI3A 2JWTA 3K2AA 5DD8A 1W0TA 2HKXA 3F3XA 3J80Z 2HYJA 3HOUJ 2KRFA 1U78A 3WE2A 2JQ7A 5EG0B 4PSWA 3OYHA 5E1XA 4A6DA 1SEUA 1LNWA 5LFAA 4WXDA 2UV1A 3IH3A 5BQTA 1XMAA 4BY1J 4RGRA 1W5TA 1ZN2A 1N25A 1NTCA 2ZKZA 3BROA 4X6AJ 1SD6A 1R4MB 3QAHA 4LIVA 3BR5A 2Y69H 2ZJ2A 2GOXB 2V6EA 3OS2A 3MKWB 1LFUP 3M9AA 5CQGA 3S1MJ 3GX4X 3QPHA 4JOMA 2WADA 2DMNA 3HOYJ 2Y9YA 4NQWB 4JX6A 2GZWA 4XRSA 5LRSA 3BR6A 5J40A 4HX8A 1BL0A 2JRTA 4X0GA 4EJTA 2QZ8A 4IQ4A 1HW1A 2KISA 5LEKA 2P81A 4QPOA 4B3XA 2HS5A 1BN5A 3I9V2 3GTKJ 3DTKA 3M8EA 3MQ0A 2PMZA 2ACJA 3TP0A 4LLNA 5FKNA 3GFIA 4MQ9F 1YIJI 5C4XJ 1VQ6I 2BZTA 3Q9SA 4BH9A 2V6CA 2OTJI 3BG6A 4DZPA 3GCMA 5F0CA 2F2EA 4A5NA 1UELB 4XN0A 3PUBA 3RZOJ 2GIZA 4R8HA 1YIOA 3B6CA 5FKKA 1FYKA 1WGXA 1A04A 4CICA 1R5GA 5J1RA 1M1EB 3QU3A 3CJNA 1PYVA 2HPMA 2OQGA 1STZA 3RPUD 2DOEA 2F48A 3A2KA 3BR0A 3MCZA 1IRGA 4YG2F 4GGGA 4L9TA 3LA2A 3DKXA 1UCRA 2DI3A 5CVIA 4B47A 1NHAA 2G7HA 1TP4A 1BIBA 2QBYA 1H8AC 2VC1A 1TQPA 1B9MA 4XRMA 2PJRA 3K4MA 2Z5UA 3ZQGA 3P5JA 5KHDA 3BJAA 3V7CA 1R00A 2V4JC 4A6EA 4AIKA 4E7KA 1V5FA 2R7SA 1MKMA 4DGWB 2JUGA 2GLOA 4BQQA 4PUSA 2FSWA 3IRQA 1C0WA 4F91B 3GTPJ 4CYCA 2A6HF 5CVUA 3KE2A 5HS9A 1OYIA 2L4MA 2FJ1A 5GPAA 4ANJA 3OYLA 3L2VA 3G71I 2ELHA 2AO9A 1R9TJ 3ESWB 2OQRA 2ECCA 2DK8A 4KIFA 1YJNI 1R36A 3Q3SA 4IEJA 2R7XA 3CZ6A 3H5RA 2HVSA 1TWFJ 1AWCA 2A5YB 2QLZA 4UNOA 1Z3XA 2ZSIB 2JMWA 4M6YA 2EFNA 3WTZA 4P9UA 2VOPA 5F1JA 3H0GJ 2OC6A 2M4KA 1IV8A 2PFBA 4M73A 3KZZA 5E3NA 3I64A 3ASNH 1T6SA 3VSKA 5L3CA 2H09A 5KNLA 1D1CA 1Z6TA 2CU7A 1QPIA 2E60A 2X6XA 4MQVA 4Y3OA 1T38A 1ZGJA 4AUXA 2DBBA 2R5ZB 4X1EA 1YW7A 1Z05A 3DEUA 3K1MA 4A0YA 3I59A 1PP7U 5EDNA 1K78A 3H9QA 1VQ9I 2ELJA 3I4PA 2A69F 2LBFB 2XB0X 1IDYA 2EFWA 2DJIA 2FMYA 3VEPA 2HOTA 3MWMA 1X19A 3TO7A 4ZZDA 5D4RA 1BI0A 2WV1A 5FLMJ 1XS9A 1HSTA 1X3WB 4IOAF 2CUEA 1ONVA 4CGZA 2XB5A 1MBKA 4RM2A 5EF6A 2VQLA 3E7LA 1TC3C 3WU2C 2CGPA 3NWTA 4IQJA 2DYSH 4G6TB 3FIWA 4LB6B 1JJ8C 1MGTA 4A3LJ 3CCVI 2HXIA 1B4AA 3F6OA 4IHXA 4OOIA 4Z2YA 5BS6A 2JPBA 3KETA 4MLOA 2EINH 4I6ZA 2VKDA 3W2VA 2M0MA 3BTJA 2NVQJ 4RS8A 5ERIA 3CC7I 1GHCA 1FP1D 1RR8C 3P9KA 3KEOA 3BJ6A 1MSEC 4L18B 1FBUA 2E1OA 4UUSA 2X9DA 3NRVA 4U0VA 1Y8QB 3U2RA 2KRHA 1T98A 4LK0F 1K61A 3FHNA 3DKWA 3TDZC 3NWSA 3MKZA 2CQKA 3EPZA 2Q8KA 4HQMA 2DFHA 3IKTA 2CW0F 3SFIA 2IBDA 5M3FJ 3K4JA 1IRFA 2GWRA 1ETKA 4HPQA 1PDNC 3K70D 4FE4A 5M5XJ 3AL0C 1KU9A 2E1MB 3KP3A 2KLOA 4EM2A 2OV7A 4OAZA 1WI9A 3D5RC 3K4NA 2CV0A 1W1WE 1QVTA 1UMQA 1O57A 1ON1A 1F4KA 1ZYRF 2L5QA 3O8GA 3CLQA 2EV6A 3OYIA 2XAUA 4BE2A 4KUMA 4BXXJ 4B48A 5K5RA 4OINF 2Y0SA 1X1CA 2E1CA 2CV2A 3F6VA 1JI8A 2WC2A 5ILUA 3GZNB 2HU9A 2XF7A 2W48A 5GPCA 1AU7A 3T8TA 2XGCA 3BPXA 3CQZJ 3LAJA 4BEHB 3QP6A 2ZMEB 2GBYA 2QGUA 5CQEA 3HYIA 3L2CA 1MBJA 1AOYA 1ON2A 2D5VA 4L5EA 2VQCA 3HKZA 4RLQA 2LK2A 2M2EA 4EJOA 3S14J 3CUOA 4HV6A 3H92A 1X1PA 1H88C 1X3UA 1KONA 2H94A 3K1PA 1WKMA 4ZYGA 2UZKA 4IRIA 2M5WA 3K69A 5C4JJ 1H0MA 1YLFA 2KIFA 1EKEA 4RGSA 2L9VA 3HUGA 5F08A 1RPWA 2BVLA 2HNHA 5F64A 2DDAA 2DTZA 2M4GA 1SVMA 2JUCA 4AVPA 1W5CC 4BNCA 1BIAA 4JX4A 1ZAOA 3VOEA 3ZOBA 1W36D 1ENHA 3WTXC 1P7JA 1FPQA 1U9NA 4P5OA 3ELKA 2E7WA 2O0YA 1FIAA 3KP6A 3BY6A 1FIPA 2LLKA 5K7FA 4HF1A 5J1UA 1N77A 3DBRB 4HLXA 2KKOA 2KRCA 4RDUA 5DEQA 3OYJA 4E4HA 4CO8A 3RYRA 5B66C 2IPQX 3X2QH 2JJ7A 2OCEA 5TISC 3L09A 2WY8Q 2LOOA 3IKVA 3H3VK 2V1XA 4PJNA 2VE9A 3CCMI 3OL3A 2B63J 4G8XA 5D5XB 4CYDA 1CF7B 1PUFB 1ZKGA 3KEQA 3W6VA 3M8FA 3B02A 3V8KA 2A5WA 2WAEA 3FKIJ 2OF7A 3GTJJ 2Z33A 4ENJA 4M9SA 2LKPA 4KMUX 3S32A 1KU2A 2P5KA 2X1CA 3F8NA 3IL2A 2CJJA 1ORKA 4EMSA 4N0BA 4IZZA 4XBFA 2EV5A 5LHGA 1WJFA 3PFYA 4CCJA 1R71A 3H9JA 4WK8F 4OWRB 2DU9A 1U0JA 3QODA 1SC7A 2JRMA 4EQQA 3FXQA 3IRRA 3LAPA 2E71A 3DP7A 1LB2A 3WE3A 2BXZA 1IRZA 1RKTA 3SEQA 1YRNA 3HJEA 2RVCA 4UVBA 1KQ0A 4ETSA 3LSMA 3U9GA 4IVNA 4AIHA 3CF2A 2C6YA 3JAMK 2L2OA 2V9KA 2K3PA 3JRHA 4QWQA 1U8RA 2V26A 1DUXC 2HQRA 2P8TA 1HW2A 2KZGA 2VE8A 3FXUA 1GV5A 2VC0A 1ACIA 4XKBA 1WVRA 3CC4I 3GTMJ 4Y52J 4Z6YA 1YW8A 2BY3A 4E7LA 4CCLA 2FEZA 3RI4A 3OR2C 2CSOA 2HTJA 5DUIA 2DA1A 2E36A 4HLYA 5BOXA 5IY5H 1EH6A 1O3RA 2Y31A 1LPQA 2QA4I 3BG9A 2DAOA 4F93B 4DYRA 3PUFA 3RPQA 2Z3YA 2L0KA 4LFUA 5EGOB 2QYOA 3H5AA 1KQ9A 2A3SA 2M30A 3L2WA 2IP2A 3GO5A 1YQAA 4XK4A 3V8JA 5IP6A 1F5TA 2ECBA 3FM5A 2K85A 2RREA 3QPTA 3Q5FA 4KIBA 3HSRA 3BZCA 4AVZA 1D5VA 2LVSA 4F7ZA 2HPIA 3AG3H 1W5SA 1JGGA 3QPLA 5HNFA 4GYIA 3S1NJ 3H0DA 2UXNA 3BJOA 1GLNA 1VZ0A 2Q2EA 4O5VA 3BT9A 4ZJZA 3MKLA 1VQ5I 2XAGA 4YELA 1R58A 1OCOH 4K2EA 4XLFA 1YOVB 1VQOI 4P55A 2D2WA 2G0EA 4ZH4F 3OV8A 2D1HA 4DBQA 4F92B 1V3FA 4KIGA 3QOEA 3A03A 2H6BA 2XGEA 4YEJA 1YX3A 1XMXA 1MMSA 3FWEA 2M0CA 5CPRB 3ZPLA 2A61A 1D1AA 5A2QZ 1S7AA 3AG4H 3D5LA 2Y0SN 5GP9A 3ZQ7A 1MW7A 1X2MA 3I54A 1ZG1A 1QZYA 1VF9A 3CMMA 1ZK8A 3K70C 3JSPA 2YSRA 2HWVA 3DV8A 3M1CA 2V9VA 5IPAA 2Y30A 4DIQA 2ZMEC 3E97A 4E70A 2X6YA 2DW4A 2EJRA 3G4SI 1MJAA 3HKZN 5LD2C 4M9XA 1SANA 4ZYEA 3BR2A 5JFRA 1J2XA 4PCQA 3KYDB 3L7WA 1BC7C 3J7YJ 4I7HA 1Z21A 2V1NA 3IWFA 5CYVA 2CQNA 3ROUA 2FNPA 5ICEA 1BI3A 4PJJA 2RAEA 2W82A 4XKVA 2MGQA 4I98B 1P4XA 2K86A 1FOYA 4NQWA 4AIDA 3QYFA 1HW5A 2R7VA 3OS0A 1T2KA 1ZHFA 2CQ7A 3E3VA 1DP3A 4MTEA 3WTVC 2E2HJ 1QHHD 2EK5A 3LQRA 4V2FA 5IT9K 3D1NI 2F4IA 4NB5A 2RGVA 3SYTA 2MSYA 2PLYA 3SHFA 1VQNI 1O3QA 3LL7A 1HKSA 4JQFA 4U0YA 4EGYA 4LOCA 3WU0A 2IS4A 2WBMA 2VJ5A 3TMOA 3TW6A 4GRIA 4LD5A 4CSWA 5LGUA 1X2NA 4J19A 1NH3A 2XHKA 4FETA 2JA6J 2YS9A 4CCOA 1Z1DA 3G2BA 4Q48A 4KFCA 2HVQA 2DFFA 1IXRC 2F6CA 1YITI 2AQEA 2ZJQF 1ITYA 3L1PA 3SFZA 5DDGA 3JTGA 4IHVA 1G3WA 5J3LA 2OAZA 1A31A 3ABKH 1HQCA 2E2IJ 3B6AA 1RZ4A 1U2WA 5CVJA 1D8KA 3CCLI 4F55A 2LG4A 3UKGA 2DA6A 1YYVA 1CQTA 1IN6A 3LA7A 3RZDJ 4G7ZF 3VDXA 2OBPA 4M3DA 4GXOA 1J75A 1DDNA 2EH3A 2KHMA 1S9HA 2BHZA 2ETHA 2M7AA 2K02A 2R7RA 4XLHA 2MC3A 1LEBA 3GF2A 4NNJA 1LE8B 5GTIC 2HQAA 3FHZA 1ETOA 4R1HA 1AKHB 3D5SC 4FCYA 2HYFA 3P9CA 3FM3A 1HOMA 2QSHX 1JE8A 3DWLE 1WHUA 1XMKA 1R6RA 2ID6A 3JRAA 5JLWA 2R7UA 3MVPA 1HXDA 4I0AA 2DMPA 2HR3A 1MSFC 4GFBA 1FTZA 1G8XA 5LGNA 1CGPA 5E18F 4G94A 5IOYA 1G59A 3OOUA 2UXXA 2CO5A 3WU1B 5L3EA 4CCKA 2RDPA 2WAFA 1XCVA 5FFXA 5ICFA 5J8FA 3OYNA 1V5EA 4G7HF 4V19K 2FE3A 5B3SH 3QRFF 2DDBA 3KP2A 3GFLA 1WFXA 4XN3A 4IHSA 3ABTA 3DLAA 3M4OJ 3CLOA 4YFKF 1B1BA 3FXMA 1OCZH 3WGHA 3EETA 3NAUA 2EIKH 2TDXA 1HBXG 3OSGA 4XRFA 4II2A 1XDSA 2L3DA 1SFOJ 1PVEA 1LVAA 1Z91A 1OKRA 3AFHA 3GZ5A 3FDYA 1MH4A 3BWGA 2R5ZA 4KN7X 2P6TA 4A12A 1R5ID 2F5FA 1JT0A 3F21A 1KZHA 4WCGA 1Z9CA 2R93J 2XAFA 3ZMVA 3A01B 3KX2A 3DEWA 2KJBA 3GTLJ 1S7OA 2EPFA 4ABZA 4E7HA 1O3SA 3RKXA 5KK1A 2BV6A 1FJLA 1USTA 3E0JB 1S72I 4BXFA 1U5TB 2QCOA 4V2GA
chains in the Genus database with same CATH topology
2ADUA 4UV9A 3V4GA 3R6SA 2FBHA 4OIQF 3GEZA 5FLXZ 2FU4A 1W7PD 3F22A 1OPCA 1MD0A 3HSEA 3E5QA 1RIOH 1BC8C 2EFOA 4JBAA 5BPIA 3E5UA 1UB9A 1FBQA 1PUEE 1EH7A 1FT9A 3LWFA 2EFPA 2MH2A 1SFXA 2PMHA 3V7SA 2JSCA 4AIJA 2PG4A 5L3BA 1RUOA 4RAYA 1W7PB 4CZZA 4UUVA 3HOSA 2EWNA 3R4KA 3ZMUA 2FMLA 4HBLA 4WXCA 1T39A 5FB2A 3EDPA 1MDMA 1OYYA 4IHTA 3CUQB 4P9FA 1EH8A 1BBYA 2PBIA 5FO5A 1FSEA 3GZ6A 2PN6A 2YU3A 1VTNC 1BM9A 2Q0OA 3PFIA 1FYLA 2HGCA 5J6XA 2ZMEA 1TW2A 3HTUA 4DQ2A 2GIVA 1ZREA 2COMA 2GAUA 2FBIA 1XSXA 3I58A 4FT8A 2YX7A 3O3KA 2XROA 2VBWA 2WWYA 2OU2A 3EYIA 2HFHA 2Y0MA 2DTRA 1QNTA 5EEGA 1F1ZA 2K7LA 2GXGA 4RB2C 3C7JA 3T8RA 4LG0B 3O2PE 4U0WA 3REOA 1G4DA 4L5IA 5D8KB 4M6XA 1I27A 2MLKA 1IXCA 3L9FA 5LRRA 1ZH5A 4HAMA 4IRHA 5ED4A 5E20A 4Q4ZF 3DPLC 5HLGA 3QP5A 2DPUA 1F9NA 2OZUA 3RIRA 1LDJA 1P4AA 5KVRA 4RAZA 5BPDA 2YPRA 1RNLA 2FNAA 1EV7A 5DCFA 5JI6A 4HF2A 4HX4A 3RTRA 3ZMTA 4HA8A 1FBSA 3QU6A 4HQEA 1ZLJA 3RKYA 3C1DA 1Y0UA 4KNYA 2JZYA 5FD6A 4B8XA 2DO7A 3FMQA 2QUFA 3GFMA 1GXQA 3R0JA 1J5YA 1LQ1A 1Z7UA 2KIMA 1ZRDA 3CO6C 4IF4A 1JXSA 2BBYA 4Q47A 2Z9OA 4G6DA 2QENA 3B73A 4MEYF 1P2FA 4M71A 4ESBA 2DPDA 3I53A 4O3MA 3H3UA 2CWEA 4XLNF 1IN5A 5L3GA 4H0EA 1O7FA 5E17F 2AXLA 3HHHA 1G3TA 4L0ZB 3I71A 2JT1A 1FSHA 3DXJF 1IXSB 3SXYA 1R1UA 3P9IA 2PMUA 2YX4A 1IW7F 3C3WA 1GXPA 3VB2A 1TBXA 3E5XA 5L3FA 2XAHA 3L00A 4ASNA 2OA4A 4A2UA 2RKHA 5LHIA 4PDKA 3J81K 2CG4A 2XUBA 1KYWA 2E7XA 4RB0A 3I59B 1K78B 2H27A 3ULQB 2P7CB 4L9VA 5DCMB 2IVMA 4S05A 2VBXA 3C18A 4R79A 3J80K 2W25A 1P6RA 1XB4A 2NS0A 3WGIA 4HV5A 4M72A 2NNYA 1XGOA 1SD7A 3IC7A 3T0YA 1QQIA 3ISPA 2PJPA 3KP5A 4ENMA 4U7BA 2XKOA 4BQAA 4N9HA 4UVCA 4FHTA 5L3DA 5IT3A 3IWZA 3BDDA 2QM3A 3W6KB 2PQ8A 3EYYA 2QQ9A 5FFZA 1IN7A 1S8NA 2VXZA 1RI7A 3ABUA 1S3JA 1B6AA 3HRSA 1ZRCA 1U6GA 2FXAA 5EEHA 4DNCA 2V79A 4I01A 2EV0A 2HDCA 4AD9A 4L0YB 5LEJA 3K2ZA 3GXOA 2NNNA 1FP2A 1O7LA 4CHUA 2JTVA 1GVJA 3TQNA 2Z99A 1LEAA 1UHWA 3ZP5A 4LMYA 3GYHX 2L02A 1TLHB 5LHHA 4N9IA 2O6GE 5LBQA 5D6EA 1V4RA 2P4WA 1O3TA 4XSXF 1YTYA 1QBJA 2H6CA 4HF0A 2ZNYA 3R60A 1E17A 2ESHA 2ZCWA 2VT3A 4L5JA 5HDKA 1FOKA 2XKPA 3N97A 4EM0B 2BEOA 1QZZA 1ZRFA 1U5TA 2EA4A 2XGXA 2EFQA 3DF8A 1G3YA 4EV0A 4XSZF 1YO5C 1ZG5A 2O61A 2DK5A 1G6NA 2QVOA 3CTAA 4ESFA 1U3EM 3K0LA 1QPMA 4HYEA 2ZO4A 5E1WA 2V1DA 3FMSA 2LSOA 3MFKA 2HOEA 5AIQA 3CDHA 3PQKA 4ZYHA 1S29A 2G7UA 4MNUA 2M8EA 4YFXF 3TOAA 1J7KA 2EA2A 4EGZA 4A0ZA 4KYWA 2MA3A 2QWWA 5D5WB 3LA3A 1TW3A 1B59A 1D3YA 3N4MA 3HRMA 2MBFA 5HS8A 1WRJA 2WV0A 2VODA 3FF5A 3U1DA 1PP8F 4I2OA 2E1NA 1JGSA 1FYMA 4OMZA 3FX3A 3RYPA 2ZFWA 4L9NA 1XDUA 1P92A 2RNJA 5ICCA 4G9YA 2IJLA 4BHCA 4ON0A 4PZJA 4OIRF 3TGNA 3HSFA 2L4AA 4LLGF 3RPUA 3F23A 1KU7A 5CJ9A 2IA0A 1BOAA 2D45A 3I5UA 3JSOA 4XLPF 2BYVE 4HDVA 4Y13A 1K7AA 1SMTA 3RDIA 3T5XA 1IN8A 2M87A 2XIGA 1D8JA 3KCCA 2G9WA 3F8BA 3TDUC 2ESNA 3WG9A 1OR7A 4LLLA 2CFXA 1ZLKA 1KU3A 4BXUA 1S6LA 1K6OA 3DQVC 5TJJA 3LFKA 3MAJA 1REPC 5K5QA 4CXFA 1IN4A 5AIPA 2IA1A 3IHUA 5D6FA 4RB3C 1DPUA 2IRFG 1HKTA 3ECHA 3NQOA 1ZARA 2ISYA 2IW5A 1J59A 1FX7A 1R5HA 4HOBA 3HTSB 4NHJA 1TQIA 2RV8A 3LSTA 2W84A 3JAMZ 5ILVA 3KP7A 2MD5A 3F8MA 5DV5A 3WODF 3MZYA 3KP4A 4P96A 1XSDA 4U7DA 4B09A 2A6EF 1I5ZA 1Z6RA 1J0RA 3FXRA 3FMRA 2A68F 5JR3A 1L3LA 1Q1HA 2A07F 3ZN0A 4RB1A 1TQMA 1ODDA 2GQQA 4ESJA 1IF1A 4ENKA 4LK1F 5HOOA 3GUDA 1FNNA 2ZXJA 4G7OF 4UXNA 1KA8A 3BPVA 1FY7A 2XAJA 3ERED 4PGGA 2V1UA 2BE5F 1LDDA 5TRDA 2ZBKA 3S2WA 1MJ9A 3K9TA 1WWXA 2M45A 4L9JA 3F8CA 4KN4X 1DP7P 3RKWA 5HS7A 3WTWC 2GA2A 3ZMZA 3Q9VA 3VODA 4OMYA 2LNBA 1BI2A 1BI1A 3RJPA 1XGNA 2F5EA 4FX0A 4UVAA 4UV8A 3G3ZA 5FGMA 3GLXA 5AONA 1SFEA 2M1BA 2W85A 4I0BA 4OIPF 4BHPA 4WF2A 4GCVA 2XASA 2VOOA 1SFUA 3HHGA 2GA1A 3HRUA 5FD5A 2R3SA 1H9TA 1P4WA 1WQ2A 3T1BA 5A2QK 2OZ6A 2PEXA 3R61A 2VN2A 1CF7A 5IT9Z 2HTSA 5DCMA 4M74A 4HW0A 2ISZA 5E1ZB 2UWMA 3LQQA 3CO7C 2RC4A 2FF4A 3PQJA 3BOQA 1R1VA 3HRTA 2OD5A 3KLNA 4PGHA 2J5OA 1ZGAA 3F8FA 1R1TA 1XCBA 1J9IA 1QO0D 5D5VB 3ZMSA 1R23A 4KT5C 1U5TC 3SZPA 2FBKA 4U88A 2LF7A 4WXHA 3JTHA 2VBZA 1UHMA 1XD7A 3KFWX 4HZFA 1WSUA 5HVQC 2O3FA 4I02A 2ZNZA 1IZ1A 4IRGA 5D5UB 6PAXA 2QBYB 2RN7A 1IAWA 1MDMB 4A0XA 4ZYDA 4O6JA 3GVAA 3E6BA 4A5MA 4D0PA 3GW2A 5BMZA 4EVIA 3E6MA 4WWCA 4I09A 1R22A 2RQPA 3M1EA 3R0AA 4GYGA 1KQ8A 2VONA 5DYMA 2WTEA 2Y48A 4IXAA 2XVCA 2LF8A 5HLHA 1TNTA 3CUQC 5CVRA 2P7VB 3EUHA 4OIOF 2FOKA 3F72A 5CVVA 3H3ZA 4S04A 1B9NA 5K5OA 5H6QA 5K1YA 4WX9A 2B0LA 3V7RA 4AWXB 1XGMA 1YG2A 4BHBA 2STWA 1YFHA 4Q5SF 2AS5F 2FRHA 2DFIA 4MHGA 5H6RA 1QGPA 2P6SA 1UFMA 5DD4A 4BYYA 2XAQA 2K4BA 2FA5A 1I1SA 2K4JA 3BP8A 2FQ3A 3SQNA 4CDGA 1W4MA 1L0OC 4EJVA 4KICA 2J5PA 3O6BB 4Y15A 3WGGA 5F1RA 2EB7A 4MTDA 4IJAA 1YS6A 3W6JB 3AAFA 2DQRA 3TO6A 1XN7A 5ILSA 5FLXK 5H20A 4QLCU 3ECOA 4FX4A 1FZPB 1R7JA 2XV4S 4EJUA 2KJCA 4OU0A 2W57A 1MJBA 1G3SA 3E6DA 3WTYC 4LJZF 1YS7A 5HDGA 4MGRA 3HOTA 1TTYA 4RGXA 1OYWA 2STTA 4EM1A 2R7FA 3GWZA 1HKQA 3COAC 3ZMDA 4TV7A 2DQLA 2W24A 3EQLF 4Y17A 3E6CC 2P5LC 2IT0A 4ZZLA 4YIFA 1RUNA 3QOPA 3WTSC 4HDUA 3ML6A 4ENNA 2YR2A 3TKYA 3MZHA 4GO1A 1T0FA 5E8IA 4RGUA 3D0SA 4IPAA 4HX7A 3WTTC 2IA2A 4MEXF 2DT5A 4LGWA 3DFGA 3G73A 2HEOA 3K1NA 2CYYA 2P5VA 2QQAA 3P7NA 2HYGD 5LLQA 4YFNF 1HSJA 4JK1X 1K79A 2KIUA 2LDUA 2DLLA 1IUYA 2NAZA 3M7GA 3KZYA 5JVTA 5DUKA 2Y75A 1DPRA 1E2XA 3SZTA 1BJAA 1ZG3A 2NRAC 5J8CA 5D4SA 4KA4A 2O8XA 1YW9A 2F5DA 5HLIA 2L01A 4KMFA 3DPTA 5JHUA 1USSA 4G6QA 1FWZA 5F6FA 1XSVA 5CLSA 4YIIA 5ICGA 1JHFA 3V8LA 4LB5A 3VFZA 2PI0A 1SMYF 5LGTA 2R7DA 3ZN1A 1TNSA 3NEUA 1W7PA 2NYXA 2HKOA 3TO9A 1SD5A 2BGCA 1OMIA 1MZBA 3GFJA 3KLOA 1XGSA 2MH9A 1FC3A 3CUQA 3TOBA 2GXBA 1JHHA 5E8GA 1ULYA 1SD4A 1LDKB 1KGSA 3BZ6A 3HIFA 3I0TA 2HZTA 2X0LA 1LJ9A 2VBYA 1SAXA 2MLGA 5HDNA 4KDPA 4EJWA 2X4HA 2VT2A 1KYZA 2XRNA 4BAYA 2QQBA 3MEXA 3JW4A 3WTUC 2O03A 1I6XA 2HQNA 3J81Z 1FLIA 4M9ZA 3J7AO 2F5CA 2L54A 4LG0A 2D1VA 1H9GA 2K27A 3FZVA 3OOPA 2JPCA 5D8LB 4UHTA 1I1GA 5DD8A 2HKXA 3F3XA 3J80Z 2KRFA 1U78A 3WE2A 5E1XA 4A6DA 1LNWA 4WXDA 5BQTA 1XMAA 4RGRA 1W5TA 1ZN2A 2ZKZA 3BROA 1SD6A 3QAHA 2ZJ2A 3M9AA 3GX4X 3QPHA 2GZWA 5LRSA 4HX8A 4EJTA 2JRTA 2QZ8A 1HW1A 5LEKA 2HS5A 1BN5A 3M8EA 3MQ0A 2ACJA 4LLNA 3GFIA 4MQ9F 3Q9SA 4BH9A 2V6CA 2F2EA 4A5NA 4R8HA 1YIOA 1FYKA 1A04A 4CICA 1R5GA 3QU3A 3CJNA 2OQGA 1STZA 1IRGA 3MCZA 4YG2F 4GGGA 4L9TA 3LA2A 1UCRA 2DI3A 5CVIA 1NHAA 2G7HA 2QBYA 1BIBA 2VC1A 1TQPA 1B9MA 2Z5UA 3BJAA 3V7CA 1R00A 4A6EA 4AIKA 1MKMA 2FSWA 3IRQA 1C0WA 2A6HF 5CVUA 3KE2A 5HS9A 1OYIA 2L4MA 2ELHA 2OQRA 2DK8A 4KIFA 1R36A 1AWCA 2A5YB 2QLZA 4UNOA 4M6YA 2EFNA 3WTZA 4P9UA 2VOPA 2PFBA 4M73A 3KZZA 3I64A 1T6SA 5L3CA 2H09A 1Z6TA 4MQVA 1T38A 1ZGJA 2DBBA 4A0YA 1YW7A 1Z05A 3DEUA 3K1MA 3I59A 1PP7U 1K78A 3I4PA 2A69F 2EFWA 2FMYA 3VEPA 3MWMA 3TO7A 5D4RA 4ZZDA 1BI0A 1HSTA 1ONVA 4CGZA 2CGPA 4LB6B 1MGTA 1B4AA 3F6OA 4OOIA 4Z2YA 5BS6A 2JPBA 3KETA 4RS8A 5ERIA 1GHCA 1FP1D 3P9KA 3KEOA 3BJ6A 4L18B 1FBUA 3NRVA 4U0VA 3U2RA 1T98A 4LK0F 3DKWA 3TDZC 2CQKA 2Q8KA 4HQMA 3IKTA 2CW0F 1IRFA 2GWRA 1PDNC 1KU9A 3KP3A 4EM2A 1WI9A 1O57A 1ON1A 1F4KA 1ZYRF 2EV6A 4KUMA 5K5RA 4OINF 2E1CA 3F6VA 2WC2A 5ILUA 3T8TA 3BPXA 3LAJA 3QP6A 2ZMEB 3HYIA 3L2CA 1AOYA 1ON2A 4EJOA 3CUOA 4HV6A 3H92A 1X3UA 2H94A 3K1PA 1WKMA 4ZYGA 2UZKA 4IRIA 2M5WA 3K69A 1H0MA 1YLFA 2KIFA 4RGSA 3HUGA 5F64A 4AVPA 4BNCA 1BIAA 1ZAOA 3VOEA 3WTXC 1FPQA 4P5OA 3ELKA 2E7WA 2O0YA 3KP6A 3BY6A 4HF1A 4HLXA 2KKOA 5DEQA 4CO8A 3RYRA 2IPQX 3L09A 3IKVA 2V1XA 2VE9A 4G8XA 5D5XB 4CYDA 1CF7B 3KEQA 3M8FA 3B02A 3V8KA 2Z33A 4ENJA 4M9SA 2LKPA 4KMUX 1KU2A 2P5KA 3F8NA 3IL2A 4EMSA 4N0BA 4XBFA 2EV5A 5LHGA 4WK8F 2DU9A 4EQQA 3FXQA 3IRRA 3LAPA 3DP7A 1LB2A 3WE3A 2RVCA 4UVBA 1KQ0A 4ETSA 3U9GA 4IVNA 4AIHA 2C6YA 3JAMK 4QWQA 1U8RA 1DUXC 2HQRA 2P8TA 1HW2A 2VE8A 3FXUA 2VC0A 1YW8A 2FEZA 3RI4A 2CSOA 2HTJA 5DUIA 4HLYA 5BOXA 1EH6A 1O3RA 2DAOA 3RPQA 2Z3YA 4LFUA 2QYOA 1KQ9A 2A3SA 2M30A 2IP2A 3GO5A 1YQAA 3V8JA 1F5TA 3FM5A 3QPTA 3Q5FA 4KIBA 3HSRA 1D5VA 4F7ZA 1W5SA 4GYIA 2UXNA 3BJOA 2Q2EA 4O5VA 2XAGA 1R58A 4K2EA 4P55A 2D2WA 4ZH4F 3OV8A 2D1HA 1V3FA 4KIGA 2H6BA 3FWEA 3ZPLA 2A61A 5A2QZ 1S7AA 3D5LA 3ZQ7A 3I54A 1ZG1A 1QZYA 3JSPA 2YSRA 2HWVA 3DV8A 2V9VA 3E97A 4E70A 2DW4A 2EJRA 1MJAA 4M9XA 4ZYEA 5JFRA 1J2XA 4PCQA 3L7WA 1BC7C 4I7HA 3IWFA 5CYVA 3ROUA 2FNPA 5ICEA 1BI3A 4I98B 1P4XA 2K86A 4NQWA 1HW5A 1T2KA 1ZHFA 3E3VA 4MTEA 3WTVC 2EK5A 3LQRA 5IT9K 4NB5A 2RGVA 2PLYA 3SHFA 1O3QA 4JQFA 1HKSA 4U0YA 4EGYA 3WU0A 4LD5A 5LGUA 2XHKA 1Z1DA 4Q48A 4KFCA 1IXRC 3SFZA 5DDGA 3JTGA 1G3WA 2OAZA 1HQCA 1RZ4A 1U2WA 5CVJA 1D8KA 1YYVA 1IN6A 3LA7A 4G7ZF 2OBPA 4GXOA 1J75A 1DDNA 2ETHA 2K02A 2MC3A 1LEBA 3GF2A 3FHZA 4R1HA 2HYFA 3P9CA 3FM3A 1JE8A 1XMKA 1HXDA 4I0AA 2HR3A 5LGNA 1CGPA 5E18F 4G94A 3WU1B 2CO5A 2UXXA 5L3EA 2RDPA 1XCVA 5FFXA 5ICFA 5J8FA 4G7HF 2FE3A 3QRFF 3KP2A 3GFLA 4IHSA 3ABTA 3CLOA 4YFKF 1B1BA 3WGHA 3EETA 2TDXA 1HBXG 4XRFA 1XDSA 2L3DA 1LVAA 1Z91A 1OKRA 3GZ5A 3BWGA 4A12A 4KN7X 2P6TA 2F5FA 3F21A 4WCGA 1Z9CA 2XAFA 3ZMVA 2KJBA 1S7OA 1O3SA 3RKXA 5KK1A 2BV6A 1USTA 1U5TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADU A;  4UV9 A;  3V4G A;  3R6S A;  2FBH A;  4OIQ F;  3GEZ A;  5FLX Z;  2FU4 A;  1W7P D;  3F22 A;  1OPC A;  1MD0 A;  3HSE A;  3E5Q A;  1RIO H;  1BC8 C;  2EFO A;  4JBA A;  5BPI A;  3E5U A;  1UB9 A;  1FBQ A;  1PUE E;  1EH7 A;  1FT9 A;  3LWF A;  2EFP A;  2MH2 A;  1SFX A;  2PMH A;  3V7S A;  2JSC A;  4AIJ A;  2PG4 A;  5L3B A;  1RUO A;  4RAY A;  1W7P B;  4CZZ A;  4UUV A;  3HOS A;  2EWN A;  3R4K A;  3ZMU A;  2FML A;  4HBL A;  4WXC A;  1T39 A;  5FB2 A;  3EDP A;  1MDM A;  1OYY A;  4IHT A;  3CUQ B;  4P9F A;  1EH8 A;  1BBY A;  2PBI A;  5FO5 A;  1FSE A;  3GZ6 A;  2PN6 A;  2YU3 A;  1VTN C;  1BM9 A;  2Q0O A;  3PFI A;  1FYL A;  2HGC A;  5J6X A;  2ZME A;  1TW2 A;  3HTU A;  4DQ2 A;  2GIV A;  1ZRE A;  2COM A;  2GAU A;  2FBI A;  1XSX A;  3I58 A;  4FT8 A;  2YX7 A;  3O3K A;  2XRO A;  2VBW A;  2WWY A;  2OU2 A;  3EYI A;  2HFH A;  2Y0M A;  2DTR A;  1QNT A;  5EEG A;  1F1Z A;  2K7L A;  2GXG A;  4RB2 C;  3C7J A;  3T8R A;  4LG0 B;  3O2P E;  4U0W A;  3REO A;  1G4D A;  4L5I A;  5D8K B;  4M6X A;  1I27 A;  2MLK A;  1IXC A;  3L9F A;  5LRR A;  1ZH5 A;  4HAM A;  4IRH A;  5ED4 A;  5E20 A;  4Q4Z F;  3DPL C;  5HLG A;  3QP5 A;  2DPU A;  1F9N A;  2OZU A;  3RIR A;  1LDJ A;  1P4A A;  5KVR A;  4RAZ A;  5BPD A;  2YPR A;  1RNL A;  2FNA A;  1EV7 A;  5DCF A;  5JI6 A;  4HF2 A;  4HX4 A;  3RTR A;  3ZMT A;  4HA8 A;  1FBS A;  3QU6 A;  4HQE A;  1ZLJ A;  3RKY A;  3C1D A;  1Y0U A;  4KNY A;  2JZY A;  5FD6 A;  4B8X A;  2DO7 A;  3FMQ A;  2QUF A;  3GFM A;  1GXQ A;  3R0J A;  1J5Y A;  1LQ1 A;  1Z7U A;  2KIM A;  1ZRD A;  3CO6 C;  4IF4 A;  1JXS A;  2BBY A;  4Q47 A;  2Z9O A;  4G6D A;  2QEN A;  3B73 A;  4MEY F;  1P2F A;  4M71 A;  4ESB A;  2DPD A;  3I53 A;  4O3M A;  3H3U A;  2CWE A;  4XLN F;  1IN5 A;  5L3G A;  4H0E A;  1O7F A;  5E17 F;  2AXL A;  3HHH A;  1G3T A;  4L0Z B;  3I71 A;  2JT1 A;  1FSH A;  3DXJ F;  1IXS B;  3SXY A;  1R1U A;  3P9I A;  2PMU A;  2YX4 A;  1IW7 F;  3C3W A;  1GXP A;  3VB2 A;  1TBX A;  3E5X A;  5L3F A;  2XAH A;  3L00 A;  4ASN A;  2OA4 A;  4A2U A;  2RKH A;  5LHI A;  4PDK A;  3J81 K;  2CG4 A;  2XUB A;  1KYW A;  2E7X A;  4RB0 A;  3I59 B;  1K78 B;  2H27 A;  3ULQ B;  2P7C B;  4L9V A;  5DCM B;  2IVM A;  4S05 A;  2VBX A;  3C18 A;  4R79 A;  3J80 K;  2W25 A;  1P6R A;  1XB4 A;  2NS0 A;  3WGI A;  4HV5 A;  4M72 A;  2NNY A;  1XGO A;  1SD7 A;  3IC7 A;  3T0Y A;  1QQI A;  3ISP A;  2PJP A;  3KP5 A;  4ENM A;  4U7B A;  2XKO A;  4BQA A;  4N9H A;  4UVC A;  4FHT A;  5L3D A;  5IT3 A;  3IWZ A;  3BDD A;  2QM3 A;  3W6K B;  2PQ8 A;  3EYY A;  2QQ9 A;  5FFZ A;  1IN7 A;  1S8N A;  2VXZ A;  1RI7 A;  3ABU A;  1S3J A;  1B6A A;  3HRS A;  1ZRC A;  1U6G A;  2FXA A;  5EEH A;  4DNC A;  2V79 A;  4I01 A;  2EV0 A;  2HDC A;  4AD9 A;  4L0Y B;  5LEJ A;  3K2Z A;  3GXO A;  2NNN A;  1FP2 A;  1O7L A;  4CHU A;  2JTV A;  1GVJ A;  3TQN A;  2Z99 A;  1LEA A;  1UHW A;  3ZP5 A;  4LMY A;  3GYH X;  2L02 A;  1TLH B;  5LHH A;  4N9I A;  2O6G E;  5LBQ A;  5D6E A;  1V4R A;  2P4W A;  1O3T A;  4XSX F;  1YTY A;  1QBJ A;  2H6C A;  4HF0 A;  2ZNY A;  3R60 A;  1E17 A;  2ESH A;  2ZCW A;  2VT3 A;  4L5J A;  5HDK A;  1FOK A;  2XKP A;  3N97 A;  4EM0 B;  2BEO A;  1QZZ A;  1ZRF A;  1U5T A;  2EA4 A;  2XGX A;  2EFQ A;  3DF8 A;  1G3Y A;  4EV0 A;  4XSZ F;  1YO5 C;  1ZG5 A;  2O61 A;  2DK5 A;  1G6N A;  2QVO A;  3CTA A;  4ESF A;  1U3E M;  3K0L A;  1QPM A;  4HYE A;  2ZO4 A;  5E1W A;  2V1D A;  3FMS A;  2LSO A;  3MFK A;  2HOE A;  5AIQ A;  3CDH A;  3PQK A;  4ZYH A;  1S29 A;  2G7U A;  4MNU A;  2M8E A;  4YFX F;  3TOA A;  1J7K A;  2EA2 A;  4EGZ A;  4A0Z A;  4KYW A;  2MA3 A;  2QWW A;  5D5W B;  3LA3 A;  1TW3 A;  1B59 A;  1D3Y A;  3N4M A;  3HRM A;  2MBF A;  5HS8 A;  1WRJ A;  2WV0 A;  2VOD A;  3FF5 A;  3U1D A;  1PP8 F;  4I2O A;  2E1N A;  1JGS A;  1FYM A;  4OMZ A;  3FX3 A;  3RYP A;  2ZFW A;  4L9N A;  1XDU A;  1P92 A;  2RNJ A;  5ICC A;  4G9Y A;  2IJL A;  4BHC A;  4ON0 A;  4PZJ A;  4OIR F;  3TGN A;  3HSF A;  2L4A A;  4LLG F;  3RPU A;  3F23 A;  1KU7 A;  5CJ9 A;  2IA0 A;  1BOA A;  2D45 A;  3I5U A;  3JSO A;  4XLP F;  2BYV E;  4HDV A;  4Y13 A;  1K7A A;  1SMT A;  3RDI A;  3T5X A;  1IN8 A;  2M87 A;  2XIG A;  1D8J A;  3KCC A;  2G9W A;  3F8B A;  3TDU C;  2ESN A;  3WG9 A;  1OR7 A;  4LLL A;  2CFX A;  1ZLK A;  1KU3 A;  4BXU A;  1S6L A;  1K6O A;  3DQV C;  5TJJ A;  3LFK A;  3MAJ A;  1REP C;  5K5Q A;  4CXF A;  1IN4 A;  5AIP A;  2IA1 A;  3IHU A;  5D6F A;  4RB3 C;  1DPU A;  2IRF G;  1HKT A;  3ECH A;  3NQO A;  1ZAR A;  2ISY A;  2IW5 A;  1J59 A;  1FX7 A;  1R5H A;  4HOB A;  3HTS B;  4NHJ A;  1TQI A;  2RV8 A;  3LST A;  2W84 A;  3JAM Z;  5ILV A;  3KP7 A;  2MD5 A;  3F8M A;  5DV5 A;  3WOD F;  3MZY A;  3KP4 A;  4P96 A;  1XSD A;  4U7D A;  4B09 A;  2A6E F;  1I5Z A;  1Z6R A;  1J0R A;  3FXR A;  3FMR A;  2A68 F;  5JR3 A;  1L3L A;  1Q1H A;  2A07 F;  3ZN0 A;  4RB1 A;  1TQM A;  1ODD A;  2GQQ A;  4ESJ A;  1IF1 A;  4ENK A;  4LK1 F;  5HOO A;  3GUD A;  1FNN A;  2ZXJ A;  4G7O F;  4UXN A;  1KA8 A;  3BPV A;  1FY7 A;  2XAJ A;  3ERE D;  4PGG A;  2V1U A;  2BE5 F;  1LDD A;  5TRD A;  2ZBK A;  3S2W A;  1MJ9 A;  3K9T A;  1WWX A;  2M45 A;  4L9J A;  3F8C A;  4KN4 X;  1DP7 P;  3RKW A;  5HS7 A;  3WTW C;  2GA2 A;  3ZMZ A;  3Q9V A;  3VOD A;  4OMY A;  2LNB A;  1BI2 A;  1BI1 A;  3RJP A;  1XGN A;  2F5E A;  4FX0 A;  4UVA A;  4UV8 A;  3G3Z A;  5FGM A;  3GLX A;  5AON A;  1SFE A;  2M1B A;  2W85 A;  4I0B A;  4OIP F;  4BHP A;  4WF2 A;  4GCV A;  2XAS A;  2VOO A;  1SFU A;  3HHG A;  2GA1 A;  3HRU A;  5FD5 A;  2R3S A;  1H9T A;  1P4W A;  1WQ2 A;  3T1B A;  5A2Q K;  2OZ6 A;  2PEX A;  3R61 A;  2VN2 A;  1CF7 A;  5IT9 Z;  2HTS A;  5DCM A;  4M74 A;  4HW0 A;  2ISZ A;  5E1Z B;  2UWM A;  3LQQ A;  3CO7 C;  2RC4 A;  2FF4 A;  3PQJ A;  3BOQ A;  1R1V A;  3HRT A;  2OD5 A;  3KLN A;  4PGH A;  2J5O A;  1ZGA A;  3F8F A;  1R1T A;  1XCB A;  1J9I A;  1QO0 D;  5D5V B;  3ZMS A;  1R23 A;  4KT5 C;  1U5T C;  3SZP A;  2FBK A;  4U88 A;  2LF7 A;  4WXH A;  3JTH A;  2VBZ A;  1UHM A;  1XD7 A;  3KFW X;  4HZF A;  1WSU A;  5HVQ C;  2O3F A;  4I02 A;  2ZNZ A;  1IZ1 A;  4IRG A;  5D5U B;  6PAX A;  2QBY B;  2RN7 A;  1IAW A;  1MDM B;  4A0X A;  4ZYD A;  4O6J A;  3GVA A;  3E6B A;  4A5M A;  4D0P A;  3GW2 A;  5BMZ A;  4EVI A;  3E6M A;  4WWC A;  4I09 A;  1R22 A;  2RQP A;  3M1E A;  3R0A A;  4GYG A;  1KQ8 A;  2VON A;  5DYM A;  2WTE A;  2Y48 A;  4IXA A;  2XVC A;  2LF8 A;  5HLH A;  1TNT A;  3CUQ C;  5CVR A;  2P7V B;  3EUH A;  4OIO F;  2FOK A;  3F72 A;  5CVV A;  3H3Z A;  4S04 A;  1B9N A;  5K5O A;  5H6Q A;  5K1Y A;  4WX9 A;  2B0L A;  3V7R A;  4AWX B;  1XGM A;  1YG2 A;  4BHB A;  2STW A;  1YFH A;  4Q5S F;  2AS5 F;  2FRH A;  2DFI A;  4MHG A;  5H6R A;  1QGP A;  2P6S A;  1UFM A;  5DD4 A;  4BYY A;  2XAQ A;  2K4B A;  2FA5 A;  1I1S A;  2K4J A;  3BP8 A;  2FQ3 A;  3SQN A;  4CDG A;  1W4M A;  1L0O C;  4EJV A;  4KIC A;  2J5P A;  3O6B B;  4Y15 A;  3WGG A;  5F1R A;  2EB7 A;  4MTD A;  4IJA A;  1YS6 A;  3W6J B;  3AAF A;  2DQR A;  3TO6 A;  1XN7 A;  5ILS A;  5FLX K;  5H20 A;  4QLC U;  3ECO A;  4FX4 A;  1FZP B;  1R7J A;  2XV4 S;  4EJU A;  2KJC A;  4OU0 A;  2W57 A;  1MJB A;  1G3S A;  3E6D A;  3WTY C;  4LJZ F;  1YS7 A;  5HDG A;  4MGR A;  3HOT A;  1TTY A;  4RGX A;  1OYW A;  2STT A;  4EM1 A;  2R7F A;  3GWZ A;  1HKQ A;  3COA C;  3ZMD A;  4TV7 A;  2DQL A;  2W24 A;  3EQL F;  4Y17 A;  3E6C C;  2P5L C;  2IT0 A;  4ZZL A;  4YIF A;  1RUN A;  3QOP A;  3WTS C;  4HDU A;  3ML6 A;  4ENN A;  2YR2 A;  3TKY A;  3MZH A;  4GO1 A;  1T0F A;  5E8I A;  4RGU A;  3D0S A;  4IPA A;  4HX7 A;  3WTT C;  2IA2 A;  4MEX F;  2DT5 A;  4LGW A;  3DFG A;  3G73 A;  2HEO A;  3K1N A;  2CYY A;  2P5V A;  2QQA A;  3P7N A;  2HYG D;  5LLQ A;  4YFN F;  1HSJ A;  4JK1 X;  1K79 A;  2KIU A;  2LDU A;  2DLL A;  1IUY A;  2NAZ A;  3M7G A;  3KZY A;  5JVT A;  5DUK A;  2Y75 A;  1DPR A;  1E2X A;  3SZT A;  1BJA A;  1ZG3 A;  2NRA C;  5J8C A;  5D4S A;  4KA4 A;  2O8X A;  1YW9 A;  2F5D A;  5HLI A;  2L01 A;  4KMF A;  3DPT A;  5JHU A;  1USS A;  4G6Q A;  1FWZ A;  5F6F A;  1XSV A;  5CLS A;  4YII A;  5ICG A;  1JHF A;  3V8L A;  4LB5 A;  3VFZ A;  2PI0 A;  1SMY F;  5LGT A;  2R7D A;  3ZN1 A;  1TNS A;  3NEU A;  1W7P A;  2NYX A;  2HKO A;  3TO9 A;  1SD5 A;  2BGC A;  1OMI A;  1MZB A;  3GFJ A;  3KLO A;  1XGS A;  2MH9 A;  1FC3 A;  3CUQ A;  3TOB A;  2GXB A;  1JHH A;  5E8G A;  1ULY A;  1SD4 A;  1LDK B;  1KGS A;  3BZ6 A;  3HIF A;  3I0T A;  2HZT A;  2X0L A;  1LJ9 A;  2VBY A;  1SAX A;  2MLG A;  5HDN A;  4KDP A;  4EJW A;  2X4H A;  2VT2 A;  1KYZ A;  2XRN A;  4BAY A;  2QQB A;  3MEX A;  3JW4 A;  3WTU C;  2O03 A;  1I6X A;  2HQN A;  3J81 Z;  1FLI A;  4M9Z A;  3J7A O;  2F5C A;  2L54 A;  4LG0 A;  2D1V A;  1H9G A;  2K27 A;  3FZV A;  3OOP A;  2JPC A;  5D8L B;  4UHT A;  1I1G A;  5DD8 A;  2HKX A;  3F3X A;  3J80 Z;  2KRF A;  1U78 A;  3WE2 A;  5E1X A;  4A6D A;  1LNW A;  4WXD A;  5BQT A;  1XMA A;  4RGR A;  1W5T A;  1ZN2 A;  2ZKZ A;  3BRO A;  1SD6 A;  3QAH A;  2ZJ2 A;  3M9A A;  3GX4 X;  3QPH A;  2GZW A;  5LRS A;  4HX8 A;  4EJT A;  2JRT A;  2QZ8 A;  1HW1 A;  5LEK A;  2HS5 A;  1BN5 A;  3M8E A;  3MQ0 A;  2ACJ A;  4LLN A;  3GFI A;  4MQ9 F;  3Q9S A;  4BH9 A;  2V6C A;  2F2E A;  4A5N A;  4R8H A;  1YIO A;  1FYK A;  1A04 A;  4CIC A;  1R5G A;  3QU3 A;  3CJN A;  2OQG A;  1STZ A;  1IRG A;  3MCZ A;  4YG2 F;  4GGG A;  4L9T A;  3LA2 A;  1UCR A;  2DI3 A;  5CVI A;  1NHA A;  2G7H A;  2QBY A;  1BIB A;  2VC1 A;  1TQP A;  1B9M A;  2Z5U A;  3BJA A;  3V7C A;  1R00 A;  4A6E A;  4AIK A;  1MKM A;  2FSW A;  3IRQ A;  1C0W A;  2A6H F;  5CVU A;  3KE2 A;  5HS9 A;  1OYI A;  2L4M A;  2ELH A;  2OQR A;  2DK8 A;  4KIF A;  1R36 A;  1AWC A;  2A5Y B;  2QLZ A;  4UNO A;  4M6Y A;  2EFN A;  3WTZ A;  4P9U A;  2VOP A;  2PFB A;  4M73 A;  3KZZ A;  3I64 A;  1T6S A;  5L3C A;  2H09 A;  1Z6T A;  4MQV A;  1T38 A;  1ZGJ A;  2DBB A;  4A0Y A;  1YW7 A;  1Z05 A;  3DEU A;  3K1M A;  3I59 A;  1PP7 U;  1K78 A;  3I4P A;  2A69 F;  2EFW A;  2FMY A;  3VEP A;  3MWM A;  3TO7 A;  5D4R A;  4ZZD A;  1BI0 A;  1HST A;  1ONV A;  4CGZ A;  2CGP A;  4LB6 B;  1MGT A;  1B4A A;  3F6O A;  4OOI A;  4Z2Y A;  5BS6 A;  2JPB A;  3KET A;  4RS8 A;  5ERI A;  1GHC A;  1FP1 D;  3P9K A;  3KEO A;  3BJ6 A;  4L18 B;  1FBU A;  3NRV A;  4U0V A;  3U2R A;  1T98 A;  4LK0 F;  3DKW A;  3TDZ C;  2CQK A;  2Q8K A;  4HQM A;  3IKT A;  2CW0 F;  1IRF A;  2GWR A;  1PDN C;  1KU9 A;  3KP3 A;  4EM2 A;  1WI9 A;  1O57 A;  1ON1 A;  1F4K A;  1ZYR F;  2EV6 A;  4KUM A;  5K5R A;  4OIN F;  2E1C A;  3F6V A;  2WC2 A;  5ILU A;  3T8T A;  3BPX A;  3LAJ A;  3QP6 A;  2ZME B;  3HYI A;  3L2C A;  1AOY A;  1ON2 A;  4EJO A;  3CUO A;  4HV6 A;  3H92 A;  1X3U A;  2H94 A;  3K1P A;  1WKM A;  4ZYG A;  2UZK A;  4IRI A;  2M5W A;  3K69 A;  1H0M A;  1YLF A;  2KIF A;  4RGS A;  3HUG A;  5F64 A;  4AVP A;  4BNC A;  1BIA A;  1ZAO A;  3VOE A;  3WTX C;  1FPQ A;  4P5O A;  3ELK A;  2E7W A;  2O0Y A;  3KP6 A;  3BY6 A;  4HF1 A;  4HLX A;  2KKO A;  5DEQ A;  4CO8 A;  3RYR A;  2IPQ X;  3L09 A;  3IKV A;  2V1X A;  2VE9 A;  4G8X A;  5D5X B;  4CYD A;  1CF7 B;  3KEQ A;  3M8F A;  3B02 A;  3V8K A;  2Z33 A;  4ENJ A;  4M9S A;  2LKP A;  4KMU X;  1KU2 A;  2P5K A;  3F8N A;  3IL2 A;  4EMS A;  4N0B A;  4XBF A;  2EV5 A;  5LHG A;  4WK8 F;  2DU9 A;  4EQQ A;  3FXQ A;  3IRR A;  3LAP A;  3DP7 A;  1LB2 A;  3WE3 A;  2RVC A;  4UVB A;  1KQ0 A;  4ETS A;  3U9G A;  4IVN A;  4AIH A;  2C6Y A;  3JAM K;  4QWQ A;  1U8R A;  1DUX C;  2HQR A;  2P8T A;  1HW2 A;  2VE8 A;  3FXU A;  2VC0 A;  1YW8 A;  2FEZ A;  3RI4 A;  2CSO A;  2HTJ A;  5DUI A;  4HLY A;  5BOX A;  1EH6 A;  1O3R A;  2DAO A;  3RPQ A;  2Z3Y A;  4LFU A;  2QYO A;  1KQ9 A;  2A3S A;  2M30 A;  2IP2 A;  3GO5 A;  1YQA A;  3V8J A;  1F5T A;  3FM5 A;  3QPT A;  3Q5F A;  4KIB A;  3HSR A;  1D5V A;  4F7Z A;  1W5S A;  4GYI A;  2UXN A;  3BJO A;  2Q2E A;  4O5V A;  2XAG A;  1R58 A;  4K2E A;  4P55 A;  2D2W A;  4ZH4 F;  3OV8 A;  2D1H A;  1V3F A;  4KIG A;  2H6B A;  3FWE A;  3ZPL A;  2A61 A;  5A2Q Z;  1S7A A;  3D5L A;  3ZQ7 A;  3I54 A;  1ZG1 A;  1QZY A;  3JSP A;  2YSR A;  2HWV A;  3DV8 A;  2V9V A;  3E97 A;  4E70 A;  2DW4 A;  2EJR A;  1MJA A;  4M9X A;  4ZYE A;  5JFR A;  1J2X A;  4PCQ A;  3L7W A;  1BC7 C;  4I7H A;  3IWF A;  5CYV A;  3ROU A;  2FNP A;  5ICE A;  1BI3 A;  4I98 B;  1P4X A;  2K86 A;  4NQW A;  1HW5 A;  1T2K A;  1ZHF A;  3E3V A;  4MTE A;  3WTV C;  2EK5 A;  3LQR A;  5IT9 K;  4NB5 A;  2RGV A;  2PLY A;  3SHF A;  1O3Q A;  4JQF A;  1HKS A;  4U0Y A;  4EGY A;  3WU0 A;  4LD5 A;  5LGU A;  2XHK A;  1Z1D A;  4Q48 A;  4KFC A;  1IXR C;  3SFZ A;  5DDG A;  3JTG A;  1G3W A;  2OAZ A;  1HQC A;  1RZ4 A;  1U2W A;  5CVJ A;  1D8K A;  1YYV A;  1IN6 A;  3LA7 A;  4G7Z F;  2OBP A;  4GXO A;  1J75 A;  1DDN A;  2ETH A;  2K02 A;  2MC3 A;  1LEB A;  3GF2 A;  3FHZ A;  4R1H A;  2HYF A;  3P9C A;  3FM3 A;  1JE8 A;  1XMK A;  1HXD A;  4I0A A;  2HR3 A;  5LGN A;  1CGP A;  5E18 F;  4G94 A;  3WU1 B;  2CO5 A;  2UXX A;  5L3E A;  2RDP A;  1XCV A;  5FFX A;  5ICF A;  5J8F A;  4G7H F;  2FE3 A;  3QRF F;  3KP2 A;  3GFL A;  4IHS A;  3ABT A;  3CLO A;  4YFK F;  1B1B A;  3WGH A;  3EET A;  2TDX A;  1HBX G;  4XRF A;  1XDS A;  2L3D A;  1LVA A;  1Z91 A;  1OKR A;  3GZ5 A;  3BWG A;  4A12 A;  4KN7 X;  2P6T A;  2F5F A;  3F21 A;  4WCG A;  1Z9C A;  2XAF A;  3ZMV A;  2KJB A;  1S7O A;  1O3S A;  3RKX A;  5KK1 A;  2BV6 A;  1UST A;  1U5T B; 
#chains in the Genus database with same CATH topology
 4HSR A;  5FKO A;  2ADU A;  1OCT C;  4DYQ A;  2NVX J;  3G1O A;  1RRJ A;  4UV9 A;  4A3B J;  3V4G A;  2X85 A;  3R6S A;  2ME6 A;  3IH2 A;  3OYE A;  4A3K J;  5HOD A;  2DA4 A;  2FBH A;  4OIQ F;  2DMU A;  3GEZ A;  5FLX Z;  3KIO A;  2FU4 A;  1ZR4 A;  3HDD A;  2BOL A;  3C2B A;  4E7S A;  1K6Y A;  1WJ5 A;  2R7Z J;  3BZK A;  1W7P D;  3F22 A;  3OYC A;  1OPC A;  1MD0 A;  3LNQ A;  3HSE A;  3E5Q A;  1RIO H;  3JRC A;  1BC8 C;  2EFO A;  4JBA A;  3DU6 A;  5BPI A;  3E5U A;  2KDZ A;  1UB9 A;  1FBQ A;  4AC0 A;  1ZEL A;  2NVU B;  1PUE E;  1Y8R B;  2ZXI A;  2EZL A;  3I4N J;  3W2W A;  1EH7 A;  1FT9 A;  3LWF A;  1JUM A;  2DOA A;  5E3L A;  2B7E A;  2EFP A;  2MH2 A;  1SFX A;  3IUO A;  2R5Y B;  2E19 A;  9ANT A;  2IS2 A;  2HZD A;  2PMH A;  3V7S A;  4RA2 A;  1PJR A;  2JSC A;  4AIJ A;  2PG4 A;  5L3B A;  1RUO A;  2O9L A;  4RAY A;  3CCE I;  1N78 A;  1W7P B;  3GTG J;  1E3H A;  4CZZ A;  4UUV A;  2I10 A;  1NG6 A;  1RET A;  2R0Q C;  3HOS A;  2EWN A;  3R4K A;  3ZMU A;  2FML A;  4HBL A;  4WXC A;  1T39 A;  5GTH C;  3EDP A;  5F0F A;  1OYY A;  3FK7 A;  5FB2 A;  3CUQ B;  4P9F A;  1MDM A;  4IHT A;  3FXJ A;  1EH8 A;  1I50 J;  2ZXH A;  4BU2 A;  4D7N A;  3PL8 A;  1BBY A;  3HC7 A;  3ABL H;  2PBI A;  5FO5 A;  1FSE A;  2DA7 A;  2NS7 A;  3GZ6 A;  1IJW C;  3OYD A;  2PN6 A;  2W1O A;  2CV1 A;  2YU3 A;  2FD5 A;  1BM9 A;  2Q0O A;  3PFI A;  3CF5 F;  1VTN C;  1FYL A;  4C3I J;  3IH4 A;  2HGC A;  3KYL A;  4IX7 A;  5J6X A;  3L2U A;  2ZME A;  1TW2 A;  3HTU A;  4ZC3 A;  1V54 H;  1ETW A;  2GIV A;  4DQ2 A;  1ZRE A;  2COM A;  2GAU A;  4BAC A;  3Q0V A;  2FBI A;  2X6W A;  1XSX A;  3HM5 A;  3I58 A;  3N05 A;  4FT8 A;  2YX7 A;  3O3K A;  4LG3 A;  2XSJ C;  2ELK A;  4UUT A;  4A3M J;  3A4C A;  4BJ6 C;  4BQO A;  2XRO A;  2VBW A;  2CQX A;  2WWY A;  2OU2 A;  3EYI A;  3CES A;  5FRO A;  2HFH A;  3FBN B;  2Y0M A;  5M3M J;  4DBR A;  1OFC X;  2DTR A;  3CJT B;  4F52 A;  4HNV A;  4D9J A;  2W7N A;  1X4P A;  3Q0U A;  1QNT A;  3HPH A;  1F1Z A;  5EEG A;  2K7L A;  3FXO A;  4JX5 A;  2CUZ A;  2GXG A;  4RB2 C;  2EIL H;  3C7J A;  2H1K A;  3T8R A;  2LR8 A;  2L9S A;  4LG0 B;  1D1B A;  2FUG 2;  3O2P E;  2R7T A;  2XF6 A;  4U0W A;  3PSF A;  3REO A;  1UG0 A;  1G4D A;  4L5I A;  5D8K B;  4M6X A;  5J47 A;  1MMA A;  1I27 A;  4I76 A;  5DM7 F;  1EA3 A;  2V9P A;  2MLK A;  3VYR B;  2NVY J;  4C2U A;  1T56 A;  1IXC A;  2EBI A;  3MN2 A;  3L9F A;  1U9O A;  5LRR A;  1ZH5 A;  2VKE A;  3CCJ I;  4IHW A;  4HAM A;  4D1Q A;  2DXI A;  1TWA J;  2ZJR F;  4IRH A;  1JUS A;  5ED4 A;  5E20 A;  4Q4Z F;  3DPL C;  2W4S A;  3DTE A;  3QP5 A;  5GAD J;  5HLG A;  1F9N A;  1B72 B;  1JKO C;  2OZU A;  3RIR A;  2DPU A;  1LDJ A;  3CCS I;  1I3Q J;  4XLC A;  1P4A A;  5KVR A;  4RAZ A;  3H35 A;  5BPD A;  1ERD A;  3J7A Y;  2YPR A;  3M07 A;  2QKL B;  1RNL A;  2CUJ A;  2VKV A;  2FNA A;  5B1A H;  3H36 A;  1A6I A;  4XOP A;  5DM6 F;  4U87 A;  1EV7 A;  4XIC A;  5DCF A;  3BR3 A;  5JI6 A;  2Z16 A;  4HF2 A;  4HX4 A;  3RTR A;  3JRG A;  4YRV A;  2MD0 A;  2XPW A;  3ZMT A;  4D7M A;  1YHQ I;  4HA8 A;  3OIP A;  1FBS A;  1FTT A;  1BR1 A;  2X6O A;  3QU6 A;  3EUK L;  3ZR8 X;  3PJR A;  3PSI A;  3PM1 A;  3RQI A;  4BKX A;  2CFO A;  2VQH A;  4HQE A;  2X51 A;  1ZLJ A;  3BTC A;  3RKY A;  2NOJ B;  3CCR I;  1MNM C;  4XLA A;  3C1D A;  3HZJ A;  1Y0U A;  2JA5 J;  2IXS A;  2DOF A;  4KNY A;  2K9S A;  3LSJ A;  3OL4 A;  4XOT A;  3CMA I;  2JZY A;  5FD6 A;  4B8X A;  2DO7 A;  3FMQ A;  2QUF A;  3GFM A;  1GXQ A;  3R0J A;  3JRF A;  1J5Y A;  2O7O A;  1LQ1 A;  2X48 A;  2B9S A;  1Z3Y A;  4A3D J;  3TED A;  1Z7U A;  4RAF A;  2HXO A;  2KIM A;  3FXL A;  2WB1 N;  3HOV J;  1ZRD A;  1WH5 A;  3CO6 C;  1QHG A;  1WCM J;  2NS8 A;  4HG2 A;  4IF4 A;  4RM3 A;  1JXS A;  1ZTR A;  2M8G X;  2BBY A;  4Q47 A;  2Z9O A;  3BC8 A;  3OIQ A;  2QEN A;  4G6D A;  3B73 A;  4MEY F;  1P2F A;  2DOD A;  4M3G A;  1U8B A;  2LKX A;  4BJT A;  3IP4 B;  2PJR B;  4M71 A;  2VKH A;  3WHC A;  4ESB A;  5EGO A;  2DPD A;  2IGK A;  3I53 A;  4O3M A;  1A5J A;  3H3U A;  3HGG A;  2CWE A;  5K7Z A;  4XLN F;  1TT5 B;  1IN5 A;  5L3G A;  4H0E A;  1O7F A;  5E17 F;  5IP7 J;  1APL C;  2KDO A;  2AXL A;  5GAE J;  3HHH A;  1G3T A;  4Y7N J;  4L0Z B;  4BUP A;  2CH0 A;  3BLY A;  3TP3 A;  2H8W A;  3I71 A;  2JT1 A;  4CYC B;  3VYU B;  1FSH A;  3DXJ F;  1IXS B;  2AXT C;  3SXY A;  1R1U A;  3P9I A;  4E7Z A;  2PMU A;  4Y33 A;  3A02 A;  2YX4 A;  2ZC2 A;  4ZTJ A;  1IW7 F;  1VQL I;  2DMQ A;  3C3W A;  1GXP A;  3VB2 A;  2EIJ H;  1TBX A;  3FIS A;  3S3N A;  3E5X A;  5FKM A;  4CCN A;  5L3F A;  1EJ9 A;  1JTY A;  2AHQ A;  4S0H B;  2XAH A;  3DCF A;  3L00 A;  2VJJ A;  4ASN A;  2OA4 A;  1Y6I A;  2LY9 A;  4CZC A;  4A2U A;  3OYA A;  2RKH A;  3UR3 C;  5LHI A;  2CMP A;  4PDK A;  4BGD A;  3J81 K;  2CG4 A;  2XUB A;  2Z2S B;  1J09 A;  4DJA A;  1KYW A;  2E7X A;  4RB0 A;  2ID3 A;  5J4V A;  4UB8 C;  4DYC A;  2BW3 A;  2ME0 A;  2JSP A;  3I59 B;  3C2G A;  4HST A;  1K78 B;  2H27 A;  3BTL A;  3KYC B;  2DA3 A;  1JJ6 C;  1BW5 A;  1QRY A;  3ULQ B;  2P7C B;  5J4Y A;  4L9V A;  2JA8 J;  5DCM B;  1JKR C;  2IVM A;  3DU5 A;  5GAG J;  3LOC A;  2ZSH B;  4CUG A;  4S05 A;  2VBX A;  3C18 A;  4R79 A;  3J80 K;  2CUF A;  1LUJ B;  3CDI A;  1OCR H;  1QVU A;  2W25 A;  3HGY A;  2QSF X;  2EQR A;  1P6R A;  2YU9 J;  3BQY A;  1XB4 A;  2NS0 A;  3WGI A;  1OR7 C;  1D0Z A;  1A6Q A;  4HV5 A;  3RCO A;  4M72 A;  2NNY A;  1XGO A;  1SD7 A;  3IC7 A;  3T0Y A;  1QQI A;  2R92 J;  3ISP A;  2NVT J;  1YJ9 I;  2PJP A;  1VQM I;  3GTO J;  3KP5 A;  4ENM A;  1IC8 A;  4U7B A;  2XKO A;  4BQA A;  4N9H A;  4UVC A;  4FHT A;  2VI6 A;  1Y0N A;  5L3D A;  4UUS B;  2CS3 A;  5IT3 A;  3IWZ A;  1AA7 A;  2OPT A;  3J7Z I;  3BDD A;  2QM3 A;  1RES A;  3W6K B;  3ZCO A;  4PJ0 C;  3I55 I;  1ETX A;  2PQ8 A;  3EYY A;  4MIM A;  1WPK A;  2QQ9 A;  5FFZ A;  1IN7 A;  3S2D J;  2GOM A;  1S8N A;  2VXZ A;  4DZJ A;  1RI7 A;  3NAR A;  4M3B A;  3ABU A;  1MMN A;  1S3J A;  1B6A A;  4A69 C;  1GDT A;  3A0H C;  3HRS A;  2L7F P;  2F4O B;  2KMU A;  1ZRC A;  1U6G A;  2FXA A;  3L2Q A;  5EEH A;  4DNC A;  2V79 A;  4DOZ A;  2IGN A;  5IYB J;  4I01 A;  1E3O C;  2HQ5 A;  1ETQ A;  2CQQ A;  4ZDL A;  1LE8 A;  2EV0 A;  4M6V A;  3BR1 A;  2HDC A;  2M3A A;  2A05 A;  4AD9 A;  4L0Y B;  4XKW A;  5LEJ A;  1SFK A;  3K2Z A;  3AKZ A;  3GXO A;  2NNN A;  3RQ4 A;  1FP2 A;  4RLF A;  2Y9Z A;  3GLL A;  1O7L A;  4CHU A;  2JTV A;  5KCM A;  1GVJ A;  1IDZ A;  1IRX A;  3Q0W A;  2E1M C;  2Z99 A;  3TQN A;  1LEA A;  2XF5 A;  2LY1 A;  1NG7 A;  1VQ7 I;  3LSK A;  1UHW A;  3ZP5 A;  4LMY A;  2L7Z A;  1I3A A;  2R4G A;  3GYH X;  2L02 A;  4NC7 A;  1TLH B;  5LHH A;  1T95 A;  4N9I A;  3JCU C;  1K4T A;  2O6G E;  5LBQ A;  3OR1 C;  5D6E A;  3ZRG A;  5E3O A;  5JVG F;  5F0H A;  1V4R A;  2P4W A;  1B8I A;  1E0E A;  1MNE A;  1O3T A;  2DN0 A;  4XSX F;  2K5C A;  1MBH A;  2VPL A;  3HUG B;  1YTY A;  4A93 J;  3GME A;  2A6T A;  2H6C A;  2VAS A;  5EG0 A;  4HF0 A;  1QBJ A;  2ZNY A;  3R60 A;  4XNF A;  1E17 A;  2ESH A;  2ZCW A;  2VT3 A;  4L5J A;  2XRL A;  4B1R A;  3BG3 A;  2W00 A;  3KPH A;  5HDK A;  1FOK A;  5DTD A;  2I8D A;  4AYB A;  4QPQ A;  2XKP A;  3OS1 A;  1UAA A;  4RBO A;  3N97 A;  3JRB A;  3LSR A;  1D5Y A;  1S7E A;  3VYT B;  4EM0 B;  2BEO A;  4P1W A;  2JA7 J;  1QZZ A;  1ZRF A;  1U5T A;  2VJ4 A;  2EA4 A;  1BW6 A;  2XGX A;  2EFQ A;  2LKS A;  2WA0 A;  3DF8 A;  1G3Y A;  3K4C A;  2KIQ A;  4RAG A;  5FKL A;  4EV0 A;  1DGW Y;  4XSZ F;  1YO5 C;  1ZG5 A;  2O61 A;  2DK5 A;  1TT0 A;  1G6N A;  2QVO A;  3CTA A;  4ESF A;  1U3E M;  1SVO A;  3CCQ I;  3K0L A;  4PFO A;  1QPM A;  4HYE A;  3CC2 I;  2ZO4 A;  3CJQ B;  5E1W A;  2V1D A;  2TCT A;  1VND A;  4JP0 A;  3FMS A;  2LSO A;  4XM3 A;  3MFK A;  2HOE A;  3OIO A;  5AIQ A;  2K9Q A;  2EIM H;  3CDH A;  3PQK A;  4ZYH A;  1S29 A;  2G7U A;  2VB6 A;  4N4O B;  4MNU A;  1JKQ C;  3K4K A;  2M8E A;  4YFX F;  2E5N A;  3TOA A;  1BJZ A;  4BDZ A;  1J7K A;  2EA2 A;  3WG7 H;  4EGZ A;  1W0U A;  4A0Z A;  4KYW A;  1FOX A;  3OYF A;  3I56 I;  1YRN B;  2MA3 A;  1Y1W J;  3IAS 2;  2QWW A;  1Z67 A;  3BTI A;  3LA3 A;  3VYS B;  5D5W B;  1TW3 A;  1B59 A;  1D3Y A;  4B44 A;  2RNG A;  1K4S A;  3CP2 A;  3N4M A;  3HRM A;  4PJM A;  1W36 C;  2MBF A;  5HS8 A;  1K83 J;  1WRJ A;  2OJE D;  2WV0 A;  2VOD A;  3FF5 A;  1X1D A;  3U1D A;  1PP8 F;  3CDL A;  5KAI C;  4I2O A;  2E1N A;  5CKT A;  1JGS A;  2DFE A;  1FYM A;  2DT7 B;  4XRS G;  4OMZ A;  3LSI A;  3FX3 A;  1MBE A;  1BR2 A;  4J01 A;  3RYP A;  2KL4 A;  2ZFW A;  3LSP A;  4L9N A;  2HVR A;  5HNH A;  2BY1 A;  3S15 J;  1XDU A;  1P92 A;  2RNJ A;  5ICC A;  4G9Y A;  2IJL A;  4BHC A;  4XQF A;  4ON0 A;  4PZJ A;  4OIR F;  2KP6 A;  3TGN A;  4ZDO A;  3HSF A;  2L4A A;  4LLG F;  3RPU A;  4LIU A;  3F9K A;  3F23 A;  3PNY A;  2KZV A;  1KU7 A;  2M7B A;  3H9G A;  2MYS A;  3HPG A;  3ZQQ A;  5CJ9 A;  2IA0 A;  4F3Q A;  1BOA A;  2D45 A;  3I5U A;  1X4O A;  2KT0 A;  3JSO A;  3OY9 A;  4XLP F;  2R7Q A;  2BYV E;  4HDV A;  3C2H A;  4Y13 A;  4HNT A;  1K7A A;  4G12 A;  1SMT A;  3RDI A;  3T5X A;  3DEE A;  1IN8 A;  4HNU A;  4C2T A;  1FMW A;  1LFB A;  3HB9 A;  2M87 A;  2XIG A;  1D8J A;  2O8K A;  3OMY A;  3KCC A;  1XPX A;  2G9W A;  1Y1V J;  3F8B A;  2TRT A;  3TDU C;  2ESN A;  4XMY A;  4B4C A;  3WG9 A;  1OR7 A;  3DKY A;  4LLL A;  3S3O A;  2CFX A;  1ZLK A;  3CME I;  1S5L C;  2ZB9 A;  1KU3 A;  4BXU A;  1S6L A;  1K6O A;  1JTX A;  3DQV C;  5TJJ A;  2LBF A;  3CJR B;  4NUB A;  1MBG A;  3MD2 A;  3LFK A;  3MAJ A;  4B3A A;  1X1B A;  2E35 A;  2JK3 A;  1REP C;  5K5Q A;  1Y56 A;  4CXF A;  1IN4 A;  1AHD P;  5AIP A;  2IA1 A;  3IHU A;  3K4L A;  5D6F A;  2DMT A;  4RB3 C;  1DPU A;  2IRF G;  3GTQ J;  3EUA A;  4A3C J;  1HKT A;  3ECH A;  2XGD A;  3DBL B;  3NQO A;  1ZAR A;  3PIP F;  2ISY A;  3MMY B;  3U1K A;  2UUZ A;  5FRN A;  1WJA A;  3AL0 B;  2IW5 A;  1HDP A;  1P9Q C;  2F5V A;  1J59 A;  1FX7 A;  4OAY A;  2WB1 A;  1R5H A;  4HOB A;  1DGR M;  2CW7 A;  3ZQL A;  3HTS B;  1HLV A;  4NHJ A;  1TQI A;  2RV8 A;  1NK2 P;  3LST A;  3EUH C;  3G1M A;  2W84 A;  2E2J J;  3JAM Z;  2IS1 A;  2EZK A;  5ILV A;  5IYC J;  3KP7 A;  1ETY A;  2MD5 A;  1R49 A;  4W97 A;  3F8M A;  5DV5 A;  1XX5 A;  3WOD F;  1DU0 A;  3MZY A;  3KP4 A;  1ETV A;  4P96 A;  4FQG A;  1IG7 A;  1XSD A;  1ZGW A;  1VFC A;  1Q1V A;  4U7D A;  2P0W A;  4NC8 A;  4PK4 A;  4B09 A;  2LP0 A;  2A6E F;  3WHB A;  1Z77 A;  4FTH A;  1QU3 A;  4A3E J;  1I5Z A;  3AG2 H;  1Z6R A;  4AYB N;  1J0R A;  3S16 J;  3FXR A;  3FMR A;  2A68 F;  4C30 A;  1IO2 A;  5JR3 A;  1L3L A;  1UHS A;  1HA8 A;  1Q1H A;  4PFP A;  2K9N A;  2A07 F;  3ZN0 A;  1X58 A;  4RB1 A;  1LFP A;  2WAQ A;  4A3F J;  1TQM A;  4CH7 A;  1ODD A;  1P7I A;  1XG1 A;  2GQQ A;  4ESJ A;  4ENK A;  1IF1 A;  4LK1 F;  5HOO A;  1FNN A;  3DPU A;  3GUD A;  2ZXJ A;  4G7O F;  4UXN A;  1KA8 A;  3BPV A;  1FY7 A;  4Y4R A;  3JRE A;  4I99 C;  3JR9 A;  2XAJ A;  1WZ2 A;  3ERE D;  3ZQC A;  2V7F A;  2MW8 A;  4PGG A;  2V1U A;  2NXN B;  2BE5 F;  1LDD A;  5TRD A;  2ZBK A;  3S2W A;  3V42 A;  4IKF A;  3G6E I;  2OTL I;  3K6G A;  4D5C A;  1MJ9 A;  3K9T A;  2BVM A;  4BEH A;  3PO3 J;  1WWX A;  4EEF G;  2M45 A;  4L9J A;  2F4M B;  1WI3 A;  3F8C A;  4KN4 X;  1DP7 P;  3PNV A;  5IP9 J;  3RKW A;  5HS7 A;  3WTW C;  4A3G J;  2MG4 A;  4N4N B;  2GA2 A;  1LVK A;  3ZMZ A;  1I6H J;  3Q9V A;  2MC4 A;  3VOD A;  4OMY A;  2LNB A;  3CMY A;  4C3J J;  1JKP C;  1BI2 A;  1BI1 A;  3QYE A;  3RJP A;  1XGN A;  2F5E A;  1QZE A;  3W3C A;  3HBL A;  2ICW G;  4FX0 A;  4UVA A;  1RR7 A;  5HLT A;  3HOW J;  4EAT A;  3K4B A;  4UV8 A;  3CD6 I;  3G3Z A;  5FGM A;  3ABM H;  4MO7 A;  3BCA A;  3K10 A;  3GLX A;  5AON A;  2XC7 A;  3S1R J;  1SFE A;  1F36 A;  2XSD C;  2M1B A;  2QKM B;  5EZH A;  3VSL A;  3LSG A;  1OLT A;  1LKX A;  1BR4 A;  2W85 A;  4I0B A;  3OYB A;  1OJL A;  5FJ8 J;  1VQ4 I;  1MH3 A;  4OIP F;  4BHP A;  3TW7 A;  4WF2 A;  3CCY A;  4GCV A;  2XAS A;  2JA2 A;  2VOO A;  4C3H J;  2KFD A;  4LIT A;  1SFU A;  2BHY A;  3HHG A;  1X1A A;  2GA1 A;  3HRU A;  5FD5 A;  2R3S A;  1H9T A;  1P4W A;  1WQ2 A;  2CW8 A;  3T1B A;  2OZ6 A;  2PEX A;  3R61 A;  2VN2 A;  5A2Q K;  1CF7 A;  5IT9 Z;  2HTS A;  1PUF A;  3BQZ A;  5DCM A;  3JRI A;  4E7I A;  4E7J A;  4M74 A;  2IGM A;  4HW0 A;  3H5N A;  2FQ4 A;  1T0F C;  2LY2 A;  3F0C A;  4HEA 2;  4KT6 A;  2ISZ A;  5E1Z B;  2M34 A;  5F27 A;  2UWM A;  1IGN A;  1R4N B;  3LQQ A;  3DBH B;  3CO7 C;  2RC4 A;  3HL2 A;  2FF4 A;  3PQJ A;  4ITV A;  3BOQ A;  3GBG A;  1E3P A;  2L7M P;  2YUS A;  3S3M A;  4B43 A;  1R1V A;  2QEX I;  3HRT A;  2H8R A;  4FE7 A;  1D0X A;  1OQY A;  3ZQH A;  2OD5 A;  5FLV A;  2WY7 Q;  2R7W A;  3LFU A;  3KLN A;  4BBS J;  5EZG A;  4PGH A;  2FX0 A;  2J5O A;  2EZH A;  1ZGA A;  3F8F A;  1R1T A;  2PX9 A;  1XCB A;  2HOS A;  1J9I A;  3S17 J;  3ZQI A;  3ZQF A;  1QA6 A;  1QO0 D;  3TBI A;  5D5V B;  4A3I J;  3JRD A;  3ZMS A;  1R23 A;  4KT5 C;  1U5T C;  3SZP A;  3QQA A;  1Y39 A;  2FBK A;  4U88 A;  2LF7 A;  1SVL A;  4WXH A;  4QSH A;  3JTH A;  2VBZ A;  5KAF C;  4UB6 C;  1UHM A;  1XD7 A;  4M3F A;  2L9R A;  3KEY A;  2HDD A;  3BG7 A;  3KFW X;  3ONQ A;  4HZF A;  1WSU A;  1HC8 A;  1ZR2 A;  5HVQ C;  2O3F A;  5EYR A;  4I02 A;  2ZFU A;  2ZNZ A;  1IZ1 A;  4IRG A;  5D5U B;  6PAX A;  1T08 B;  4M3E A;  4RMN A;  5EJC A;  1O4X A;  2QBY B;  2RN7 A;  1UG2 A;  4ZTF A;  2R7O A;  2DCE A;  2HDW A;  2QF7 A;  1IAW A;  2OCC H;  1MDM B;  4A0X A;  4ZYD A;  1TWG J;  4XON A;  1RC9 A;  4O6J A;  1HDD C;  3I3L A;  3GVA A;  2PMZ N;  2QSG X;  3I4M J;  2DA5 A;  3E6B A;  4A5M A;  4D0P A;  1OCP A;  4IOC F;  4AU7 A;  3GW2 A;  2LRD A;  2MFZ A;  5BMZ A;  4EVI A;  3E6M A;  4WWC A;  3DLL F;  2RQQ A;  4I09 A;  1R22 A;  1T33 A;  3S8P A;  4HRI A;  3PO2 J;  3HOX J;  2RQP A;  2WAQ N;  3M1E A;  3R0A A;  4GYG A;  1KQ8 A;  2VON A;  1TWC J;  1V5G A;  5DYM A;  2IGO A;  2WTE A;  3UNG C;  2Y48 A;  4IXA A;  3SEZ A;  3MZ8 A;  2XVC A;  1XTA A;  3FBI B;  2LF8 A;  4IL6 C;  5HLH A;  1TNT A;  3CUQ C;  5CVR A;  2P7V B;  2XPV A;  4BY7 J;  3EUH A;  1EF4 A;  2DJN A;  2LMD A;  3VPR A;  4OIO F;  2XPU A;  5JLX A;  2X1E A;  4NBQ A;  2FOK A;  3F72 A;  5CVV A;  3RKQ A;  3K7A J;  3H3Z A;  4S04 A;  1B9N A;  5H6Q A;  5K1Y A;  5K5O A;  3OYG A;  4WX9 A;  2B0L A;  3V7R A;  3OYM A;  4AWX B;  1XGM A;  2XDV A;  3FXK A;  4MFE A;  3O8H A;  3HEF A;  1YG2 A;  4XOR A;  4FAS D;  4BHB A;  5E79 C;  4BS9 A;  4XR6 A;  1GUU A;  1GVD A;  2VLA A;  2STW A;  1YFH A;  1G2H A;  1N75 A;  3DTI A;  5FRM A;  4Q5S F;  2AS5 F;  2FRH A;  4PJL A;  3ASO H;  2DFI A;  4MHG A;  1VQK I;  5H6R A;  1QGP A;  1TWH J;  3BG5 A;  2P6S A;  1UFM A;  1NK3 P;  5DD4 A;  5B1B H;  4BYY A;  2XAQ A;  2N8G A;  1OCC H;  4BDY A;  2K4B A;  2FA5 A;  1I1S A;  2E34 A;  3PNT A;  1MBF A;  2K4J A;  1RKW A;  3E1S A;  2JVH A;  3BP8 A;  2FQ3 A;  3LSH A;  2LC2 A;  2JVG A;  1GV2 A;  3SQN A;  3L2R A;  4CDG A;  1F43 A;  1W4M A;  1L0O C;  4EJV A;  4QIW N;  1FMV A;  4KIC A;  2J5P A;  3OSF A;  2COB A;  3O6B B;  4Y15 A;  4KJZ A;  4NC6 A;  4ZDP A;  3WGG A;  4IHY A;  5F1R A;  2EB7 A;  1TZL A;  4MTD A;  1HF0 A;  3IAM 2;  3ZXS A;  4IJA A;  2BY0 A;  3U21 A;  1YS6 A;  3W6J B;  4PSX A;  3RSN A;  2IEK A;  1H89 C;  3AAF A;  3S93 A;  2DQR A;  4NDL A;  3TO6 A;  1XN7 A;  4GDF A;  5ILS A;  1IUF A;  5FLX K;  5H20 A;  2X1D A;  4QLC U;  5IOZ A;  3CCU I;  3ECO A;  2K3F A;  4W1U A;  4FX4 A;  1FZP B;  2QQ8 A;  1R7J A;  2XV4 S;  4EJU A;  3LMM A;  2GM4 A;  2ZXW H;  2KJC A;  4OU0 A;  2W57 A;  2O5R A;  1MJB A;  2LFB A;  2VIX A;  1G3S A;  4BJ5 C;  3E6D A;  3WTY C;  4LJZ F;  2VQG A;  2Y2Z A;  1YS7 A;  4ZYA A;  3ERM A;  1AKH A;  3OWT A;  5HDG A;  4MGR A;  4BQN A;  3HOT A;  1TTY A;  4YIR X;  4RGX A;  1OYW A;  1I39 A;  2STT A;  4DW6 A;  2LD5 A;  4EM1 A;  2R7F A;  3GWZ A;  2VL8 A;  1HKQ A;  2LTP A;  1OIS A;  2ZJP F;  3COA C;  3ZMD A;  2OUM A;  4TV7 A;  2DQL A;  2W24 A;  3EQL F;  4Y17 A;  3E6C C;  2P5L C;  2IT0 A;  1A36 A;  4ZZL A;  3M3Y J;  4YIF A;  1RUN A;  1YI2 I;  3QOP A;  3WTS C;  4HDU A;  4XL9 A;  3ML6 A;  4ENN A;  2YR2 A;  2Z1D A;  3QWL A;  3TKY A;  3MZH A;  4GO1 A;  1T0F A;  3HG9 A;  5E8I A;  4RGU A;  3MKY B;  3D0S A;  4IPA A;  4HX7 A;  3WTT C;  2IA2 A;  4MEX F;  2DT5 A;  1JT6 A;  2VPR A;  4LGW A;  3SJM A;  3DFG A;  3G73 A;  2L9N A;  1UJ8 A;  4JYK A;  3K1N A;  2HEO A;  1TL8 A;  2CYY A;  2P5V A;  1VQ8 I;  3SDG A;  3AG1 H;  2BXY A;  1YE9 A;  2QQA A;  3P7N A;  2HYG D;  5LLQ A;  2NOG A;  1MND A;  5H2F C;  4XLE A;  4YFN F;  2MAB A;  2VXD A;  2IS6 A;  1HSJ A;  4JK1 X;  1DQU A;  5K7H A;  1K79 A;  2KIU A;  2KPM A;  2LDU A;  3A01 A;  2DLL A;  4C9Y A;  1FOW A;  1IUY A;  5JHF A;  3VWB A;  1WJC A;  4XKC A;  2LH9 A;  5BNG A;  2NAZ A;  2K40 A;  3SZG A;  3M7G A;  3KZY A;  1WJB A;  5JVT A;  5DUK A;  2Y75 A;  1DPR A;  3PIO F;  3A0B C;  1E2X A;  2H1L A;  4IO9 F;  3SZT A;  1BJA A;  3H1C A;  1ZG3 A;  2BW3 B;  2NRA C;  5J8C A;  2LYC A;  4MFD A;  5D4S A;  4KA4 A;  5M5Y J;  2O8X A;  1YW9 A;  1GT0 C;  2K9M A;  2F5D A;  5HLI A;  1SAU A;  5C44 J;  2Q1Z B;  2VJI A;  5E3M A;  4BL0 B;  2L01 A;  1BA5 A;  5B5E C;  4KMF A;  4D5F A;  4KIT B;  3DPT A;  1A35 A;  5EEA A;  5JHU A;  1D0Y A;  1MIJ A;  1USS A;  4AM3 A;  4G6Q A;  1FWZ A;  2BY2 A;  3HXL A;  2HOA A;  5F6F A;  1XSV A;  2E5Z A;  1MMD A;  5CLS A;  4C2M J;  4YII A;  5ICG A;  3QYB A;  4BE1 A;  1JHF A;  3QPS A;  4XID A;  3G1L A;  3V8L A;  1UZC A;  5J1Y A;  4LB5 A;  3VFZ A;  3TL4 X;  4UY8 I;  4E6K G;  2PI0 A;  1BOB A;  2CRG A;  1SMY F;  5LGT A;  1X3Z B;  2R7D A;  2R5Y A;  3S1Q J;  1IV6 A;  3FKJ A;  3ZN1 A;  2AQF A;  1TNS A;  3NEU A;  2GXA A;  1W7P A;  1Z0X A;  2NYX A;  5GAH J;  2HKO A;  4H4K C;  3TO9 A;  5DS9 A;  5M5W J;  1SD5 A;  2BGC A;  1OMI A;  1XC5 A;  1WJE A;  5TGT A;  1VQP I;  1Z7L A;  1MZB A;  2DT6 A;  3GFJ A;  1MMG A;  2KQR A;  3KLO A;  1XGS A;  2MH9 A;  3A1Y A;  1B72 A;  1FC3 A;  3CUQ A;  3TOB A;  4II3 A;  2GXB A;  3W2A A;  1JHH A;  3IV5 A;  3M8J A;  1YJW I;  5E8G A;  4BBR J;  1ULY A;  2DA2 A;  3FK6 A;  3OYK A;  1DU6 A;  2VUM J;  1POG A;  1SD4 A;  1LDK B;  3ZGK A;  1KGS A;  3BZ6 A;  3HIF A;  5F04 A;  1WH7 A;  3I0T A;  3KZI C;  1V55 H;  2HZT A;  4CCM A;  1FEX A;  3SDB A;  2EZI A;  2L7K A;  2M9H A;  2X0L A;  1LJ9 A;  2VBY A;  4QTR A;  2MLG A;  5HDN A;  1SAX A;  4KDP A;  2IAI A;  4EJW A;  2X4H A;  2I5U A;  2VT2 A;  4A3J J;  1KYZ A;  4FIS A;  1YX5 A;  2XRN A;  4BAY A;  2QQB A;  4J00 A;  3MEX A;  5IYD J;  4CA0 A;  3JW4 A;  3WTU C;  2Q2E B;  2O03 A;  3S2H J;  1I6X A;  5C3E J;  1VI0 A;  2HQN A;  3J81 Z;  1WJD A;  1HCR A;  3HOZ J;  3CP8 A;  1FLI A;  4M9Z A;  3BCB A;  4BE0 A;  3J7A O;  2F5C A;  2LRE A;  2L54 A;  4LG0 A;  2DYR H;  2D1V A;  4KIS A;  1ZQ3 P;  2K9L A;  1H9G A;  2K27 A;  3FZV A;  3OOP A;  2JPC A;  1T8I A;  5D8L B;  4UHT A;  1JUP A;  1B8I B;  2FOW A;  1I1G A;  2JN6 A;  2HI3 A;  2JWT A;  3K2A A;  5DD8 A;  1W0T A;  2HKX A;  3F3X A;  3J80 Z;  2HYJ A;  3HOU J;  2KRF A;  1U78 A;  3WE2 A;  2JQ7 A;  5EG0 B;  4PSW A;  3OYH A;  5E1X A;  4A6D A;  1SEU A;  1LNW A;  5LFA A;  4WXD A;  2UV1 A;  3IH3 A;  5BQT A;  1XMA A;  4BY1 J;  4RGR A;  1W5T A;  1ZN2 A;  1N25 A;  1NTC A;  2ZKZ A;  3BRO A;  4X6A J;  1SD6 A;  1R4M B;  3QAH A;  4LIV A;  3BR5 A;  2Y69 H;  2ZJ2 A;  2GOX B;  2V6E A;  3OS2 A;  3MKW B;  1LFU P;  3M9A A;  5CQG A;  3S1M J;  3GX4 X;  3QPH A;  4JOM A;  2WAD A;  2DMN A;  3HOY J;  2Y9Y A;  4NQW B;  4JX6 A;  2GZW A;  4XRS A;  5LRS A;  3BR6 A;  5J40 A;  4HX8 A;  1BL0 A;  2JRT A;  4X0G A;  4EJT A;  2QZ8 A;  4IQ4 A;  1HW1 A;  2KIS A;  5LEK A;  2P81 A;  4QPO A;  4B3X A;  2HS5 A;  1BN5 A;  3I9V 2;  3GTK J;  3DTK A;  3M8E A;  3MQ0 A;  2PMZ A;  2ACJ A;  3TP0 A;  4LLN A;  5FKN A;  3GFI A;  4MQ9 F;  1YIJ I;  5C4X J;  1VQ6 I;  2BZT A;  3Q9S A;  4BH9 A;  2V6C A;  2OTJ I;  3BG6 A;  4DZP A;  3GCM A;  5F0C A;  2F2E A;  4A5N A;  1UEL B;  4XN0 A;  3PUB A;  3RZO J;  2GIZ A;  4R8H A;  1YIO A;  3B6C A;  5FKK A;  1FYK A;  1WGX A;  1A04 A;  4CIC A;  1R5G A;  5J1R A;  1M1E B;  3QU3 A;  3CJN A;  1PYV A;  2HPM A;  2OQG A;  1STZ A;  3RPU D;  2DOE A;  2F48 A;  3A2K A;  3BR0 A;  3MCZ A;  1IRG A;  4YG2 F;  4GGG A;  4L9T A;  3LA2 A;  3DKX A;  1UCR A;  2DI3 A;  5CVI A;  4B47 A;  1NHA A;  2G7H A;  1TP4 A;  1BIB A;  2QBY A;  1H8A C;  2VC1 A;  1TQP A;  1B9M A;  4XRM A;  2PJR A;  3K4M A;  2Z5U A;  3ZQG A;  3P5J A;  5KHD A;  3BJA A;  3V7C A;  1R00 A;  2V4J C;  4A6E A;  4AIK A;  4E7K A;  1V5F A;  2R7S A;  1MKM A;  4DGW B;  2JUG A;  2GLO A;  4BQQ A;  4PUS A;  2FSW A;  3IRQ A;  1C0W A;  4F91 B;  3GTP J;  4CYC A;  2A6H F;  5CVU A;  3KE2 A;  5HS9 A;  1OYI A;  2L4M A;  2FJ1 A;  5GPA A;  4ANJ A;  3OYL A;  3L2V A;  3G71 I;  2ELH A;  2AO9 A;  1R9T J;  3ESW B;  2OQR A;  2ECC A;  2DK8 A;  4KIF A;  1YJN I;  1R36 A;  3Q3S A;  4IEJ A;  2R7X A;  3CZ6 A;  3H5R A;  2HVS A;  1TWF J;  1AWC A;  2A5Y B;  2QLZ A;  4UNO A;  1Z3X A;  2ZSI B;  2JMW A;  4M6Y A;  2EFN A;  3WTZ A;  4P9U A;  2VOP A;  5F1J A;  3H0G J;  2OC6 A;  2M4K A;  1IV8 A;  2PFB A;  4M73 A;  3KZZ A;  5E3N A;  3I64 A;  3ASN H;  1T6S A;  3VSK A;  5L3C A;  2H09 A;  5KNL A;  1D1C A;  1Z6T A;  2CU7 A;  1QPI A;  2E60 A;  2X6X A;  4MQV A;  4Y3O A;  1T38 A;  1ZGJ A;  4AUX A;  2DBB A;  2R5Z B;  4X1E A;  1YW7 A;  1Z05 A;  3DEU A;  3K1M A;  4A0Y A;  3I59 A;  1PP7 U;  5EDN A;  1K78 A;  3H9Q A;  1VQ9 I;  2ELJ A;  3I4P A;  2A69 F;  2LBF B;  2XB0 X;  1IDY A;  2EFW A;  2DJI A;  2FMY A;  3VEP A;  2HOT A;  3MWM A;  1X19 A;  3TO7 A;  4ZZD A;  5D4R A;  1BI0 A;  2WV1 A;  5FLM J;  1XS9 A;  1HST A;  1X3W B;  4IOA F;  2CUE A;  1ONV A;  4CGZ A;  2XB5 A;  1MBK A;  4RM2 A;  5EF6 A;  2VQL A;  3E7L A;  1TC3 C;  3WU2 C;  2CGP A;  3NWT A;  4IQJ A;  2DYS H;  4G6T B;  3FIW A;  4LB6 B;  1JJ8 C;  1MGT A;  4A3L J;  3CCV I;  2HXI A;  1B4A A;  3F6O A;  4IHX A;  4OOI A;  4Z2Y A;  5BS6 A;  2JPB A;  3KET A;  4MLO A;  2EIN H;  4I6Z A;  2VKD A;  3W2V A;  2M0M A;  3BTJ A;  2NVQ J;  4RS8 A;  5ERI A;  3CC7 I;  1GHC A;  1FP1 D;  1RR8 C;  3P9K A;  3KEO A;  3BJ6 A;  1MSE C;  4L18 B;  1FBU A;  2E1O A;  4UUS A;  2X9D A;  3NRV A;  4U0V A;  1Y8Q B;  3U2R A;  2KRH A;  1T98 A;  4LK0 F;  1K61 A;  3FHN A;  3DKW A;  3TDZ C;  3NWS A;  3MKZ A;  2CQK A;  3EPZ A;  2Q8K A;  4HQM A;  2DFH A;  3IKT A;  2CW0 F;  3SFI A;  2IBD A;  5M3F J;  3K4J A;  1IRF A;  2GWR A;  1ETK A;  4HPQ A;  1PDN C;  3K70 D;  4FE4 A;  5M5X J;  3AL0 C;  1KU9 A;  2E1M B;  3KP3 A;  2KLO A;  4EM2 A;  2OV7 A;  4OAZ A;  1WI9 A;  3D5R C;  3K4N A;  2CV0 A;  1W1W E;  1QVT A;  1UMQ A;  1O57 A;  1ON1 A;  1F4K A;  1ZYR F;  2L5Q A;  3O8G A;  3CLQ A;  2EV6 A;  3OYI A;  2XAU A;  4BE2 A;  4KUM A;  4BXX J;  4B48 A;  5K5R A;  4OIN F;  2Y0S A;  1X1C A;  2E1C A;  2CV2 A;  3F6V A;  1JI8 A;  2WC2 A;  5ILU A;  3GZN B;  2HU9 A;  2XF7 A;  2W48 A;  5GPC A;  1AU7 A;  3T8T A;  2XGC A;  3BPX A;  3CQZ J;  3LAJ A;  4BEH B;  3QP6 A;  2ZME B;  2GBY A;  2QGU A;  5CQE A;  3HYI A;  3L2C A;  1MBJ A;  1AOY A;  1ON2 A;  2D5V A;  4L5E A;  2VQC A;  3HKZ A;  4RLQ A;  2LK2 A;  2M2E A;  4EJO A;  3S14 J;  3CUO A;  4HV6 A;  3H92 A;  1X1P A;  1H88 C;  1X3U A;  1KON A;  2H94 A;  3K1P A;  1WKM A;  4ZYG A;  2UZK A;  4IRI A;  2M5W A;  3K69 A;  5C4J J;  1H0M A;  1YLF A;  2KIF A;  1EKE A;  4RGS A;  2L9V A;  3HUG A;  5F08 A;  1RPW A;  2BVL A;  2HNH A;  5F64 A;  2DDA A;  2DTZ A;  2M4G A;  1SVM A;  2JUC A;  4AVP A;  1W5C C;  4BNC A;  1BIA A;  4JX4 A;  1ZAO A;  3VOE A;  3ZOB A;  1W36 D;  1ENH A;  3WTX C;  1P7J A;  1FPQ A;  1U9N A;  4P5O A;  3ELK A;  2E7W A;  2O0Y A;  1FIA A;  3KP6 A;  3BY6 A;  1FIP A;  2LLK A;  5K7F A;  4HF1 A;  5J1U A;  1N77 A;  3DBR B;  4HLX A;  2KKO A;  2KRC A;  4RDU A;  5DEQ A;  3OYJ A;  4E4H A;  4CO8 A;  3RYR A;  5B66 C;  2IPQ X;  3X2Q H;  2JJ7 A;  2OCE A;  5TIS C;  3L09 A;  2WY8 Q;  2LOO A;  3IKV A;  3H3V K;  2V1X A;  4PJN A;  2VE9 A;  3CCM I;  3OL3 A;  2B63 J;  4G8X A;  5D5X B;  4CYD A;  1CF7 B;  1PUF B;  1ZKG A;  3KEQ A;  3W6V A;  3M8F A;  3B02 A;  3V8K A;  2A5W A;  2WAE A;  3FKI J;  2OF7 A;  3GTJ J;  2Z33 A;  4ENJ A;  4M9S A;  2LKP A;  4KMU X;  3S32 A;  1KU2 A;  2P5K A;  2X1C A;  3F8N A;  3IL2 A;  2CJJ A;  1ORK A;  4EMS A;  4N0B A;  4IZZ A;  4XBF A;  2EV5 A;  5LHG A;  1WJF A;  3PFY A;  4CCJ A;  1R71 A;  3H9J A;  4WK8 F;  4OWR B;  2DU9 A;  1U0J A;  3QOD A;  1SC7 A;  2JRM A;  4EQQ A;  3FXQ A;  3IRR A;  3LAP A;  2E71 A;  3DP7 A;  1LB2 A;  3WE3 A;  2BXZ A;  1IRZ A;  1RKT A;  3SEQ A;  1YRN A;  3HJE A;  2RVC A;  4UVB A;  1KQ0 A;  4ETS A;  3LSM A;  3U9G A;  4IVN A;  4AIH A;  3CF2 A;  2C6Y A;  3JAM K;  2L2O A;  2V9K A;  2K3P A;  3JRH A;  4QWQ A;  1U8R A;  2V26 A;  1DUX C;  2HQR A;  2P8T A;  1HW2 A;  2KZG A;  2VE8 A;  3FXU A;  1GV5 A;  2VC0 A;  1ACI A;  4XKB A;  1WVR A;  3CC4 I;  3GTM J;  4Y52 J;  4Z6Y A;  1YW8 A;  2BY3 A;  4E7L A;  4CCL A;  2FEZ A;  3RI4 A;  3OR2 C;  2CSO A;  2HTJ A;  5DUI A;  2DA1 A;  2E36 A;  4HLY A;  5BOX A;  5IY5 H;  1EH6 A;  1O3R A;  2Y31 A;  1LPQ A;  2QA4 I;  3BG9 A;  2DAO A;  4F93 B;  4DYR A;  3PUF A;  3RPQ A;  2Z3Y A;  2L0K A;  4LFU A;  5EGO B;  2QYO A;  3H5A A;  1KQ9 A;  2A3S A;  2M30 A;  3L2W A;  2IP2 A;  3GO5 A;  1YQA A;  4XK4 A;  3V8J A;  5IP6 A;  1F5T A;  2ECB A;  3FM5 A;  2K85 A;  2RRE A;  3QPT A;  3Q5F A;  4KIB A;  3HSR A;  3BZC A;  4AVZ A;  1D5V A;  2LVS A;  4F7Z A;  2HPI A;  3AG3 H;  1W5S A;  1JGG A;  3QPL A;  5HNF A;  4GYI A;  3S1N J;  3H0D A;  2UXN A;  3BJO A;  1GLN A;  1VZ0 A;  2Q2E A;  4O5V A;  3BT9 A;  4ZJZ A;  3MKL A;  1VQ5 I;  2XAG A;  4YEL A;  1R58 A;  1OCO H;  4K2E A;  4XLF A;  1YOV B;  1VQO I;  4P55 A;  2D2W A;  2G0E A;  4ZH4 F;  3OV8 A;  2D1H A;  4DBQ A;  4F92 B;  1V3F A;  4KIG A;  3QOE A;  3A03 A;  2H6B A;  2XGE A;  4YEJ A;  1YX3 A;  1XMX A;  1MMS A;  3FWE A;  2M0C A;  5CPR B;  3ZPL A;  2A61 A;  1D1A A;  5A2Q Z;  1S7A A;  3AG4 H;  3D5L A;  2Y0S N;  5GP9 A;  3ZQ7 A;  1MW7 A;  1X2M A;  3I54 A;  1ZG1 A;  1QZY A;  1VF9 A;  3CMM A;  1ZK8 A;  3K70 C;  3JSP A;  2YSR A;  2HWV A;  3DV8 A;  3M1C A;  2V9V A;  5IPA A;  2Y30 A;  4DIQ A;  2ZME C;  3E97 A;  4E70 A;  2X6Y A;  2DW4 A;  2EJR A;  3G4S I;  1MJA A;  3HKZ N;  5LD2 C;  4M9X A;  1SAN A;  4ZYE A;  3BR2 A;  5JFR A;  1J2X A;  4PCQ A;  3KYD B;  3L7W A;  1BC7 C;  3J7Y J;  4I7H A;  1Z21 A;  2V1N A;  3IWF A;  5CYV A;  2CQN A;  3ROU A;  2FNP A;  5ICE A;  1BI3 A;  4PJJ A;  2RAE A;  2W82 A;  4XKV A;  2MGQ A;  4I98 B;  1P4X A;  2K86 A;  1FOY A;  4NQW A;  4AID A;  3QYF A;  1HW5 A;  2R7V A;  3OS0 A;  1T2K A;  1ZHF A;  2CQ7 A;  3E3V A;  1DP3 A;  4MTE A;  3WTV C;  2E2H J;  1QHH D;  2EK5 A;  3LQR A;  4V2F A;  5IT9 K;  3D1N I;  2F4I A;  4NB5 A;  2RGV A;  3SYT A;  2MSY A;  2PLY A;  3SHF A;  1VQN I;  1O3Q A;  3LL7 A;  1HKS A;  4JQF A;  4U0Y A;  4EGY A;  4LOC A;  3WU0 A;  2IS4 A;  2WBM A;  2VJ5 A;  3TMO A;  3TW6 A;  4GRI A;  4LD5 A;  4CSW A;  5LGU A;  1X2N A;  4J19 A;  1NH3 A;  2XHK A;  4FET A;  2JA6 J;  2YS9 A;  4CCO A;  1Z1D A;  3G2B A;  4Q48 A;  4KFC A;  2HVQ A;  2DFF A;  1IXR C;  2F6C A;  1YIT I;  2AQE A;  2ZJQ F;  1ITY A;  3L1P A;  3SFZ A;  5DDG A;  3JTG A;  4IHV A;  1G3W A;  5J3L A;  2OAZ A;  1A31 A;  3ABK H;  1HQC A;  2E2I J;  3B6A A;  1RZ4 A;  1U2W A;  5CVJ A;  1D8K A;  3CCL I;  4F55 A;  2LG4 A;  3UKG A;  2DA6 A;  1YYV A;  1CQT A;  1IN6 A;  3LA7 A;  3RZD J;  4G7Z F;  3VDX A;  2OBP A;  4M3D A;  4GXO A;  1J75 A;  1DDN A;  2EH3 A;  2KHM A;  1S9H A;  2BHZ A;  2ETH A;  2M7A A;  2K02 A;  2R7R A;  4XLH A;  2MC3 A;  1LEB A;  3GF2 A;  4NNJ A;  1LE8 B;  5GTI C;  2HQA A;  3FHZ A;  1ETO A;  4R1H A;  1AKH B;  3D5S C;  4FCY A;  2HYF A;  3P9C A;  3FM3 A;  1HOM A;  2QSH X;  1JE8 A;  3DWL E;  1WHU A;  1XMK A;  1R6R A;  2ID6 A;  3JRA A;  5JLW A;  2R7U A;  3MVP A;  1HXD A;  4I0A A;  2DMP A;  2HR3 A;  1MSF C;  4GFB A;  1FTZ A;  1G8X A;  5LGN A;  1CGP A;  5E18 F;  4G94 A;  5IOY A;  1G59 A;  3OOU A;  2UXX A;  2CO5 A;  3WU1 B;  5L3E A;  4CCK A;  2RDP A;  2WAF A;  1XCV A;  5FFX A;  5ICF A;  5J8F A;  3OYN A;  1V5E A;  4G7H F;  4V19 K;  2FE3 A;  5B3S H;  3QRF F;  2DDB A;  3KP2 A;  3GFL A;  1WFX A;  4XN3 A;  4IHS A;  3ABT A;  3DLA A;  3M4O J;  3CLO A;  4YFK F;  1B1B A;  3FXM A;  1OCZ H;  3WGH A;  3EET A;  3NAU A;  2EIK H;  2TDX A;  1HBX G;  3OSG A;  4XRF A;  4II2 A;  1XDS A;  2L3D A;  1SFO J;  1PVE A;  1LVA A;  1Z91 A;  1OKR A;  3AFH A;  3GZ5 A;  3FDY A;  1MH4 A;  3BWG A;  2R5Z A;  4KN7 X;  2P6T A;  4A12 A;  1R5I D;  2F5F A;  1JT0 A;  3F21 A;  1KZH A;  4WCG A;  1Z9C A;  2R93 J;  2XAF A;  3ZMV A;  3A01 B;  3KX2 A;  3DEW A;  2KJB A;  3GTL J;  1S7O A;  2EPF A;  4ABZ A;  4E7H A;  1O3S A;  3RKX A;  5KK1 A;  2BV6 A;  1FJL A;  1UST A;  3E0J B;  1S72 I;  4BXF A;  1U5T B;  2QCO A;  4V2G A; 
#chains in the Genus database with same CATH homology
 2ADU A;  4UV9 A;  3V4G A;  3R6S A;  2FBH A;  4OIQ F;  3GEZ A;  5FLX Z;  2FU4 A;  1W7P D;  3F22 A;  1OPC A;  1MD0 A;  3HSE A;  3E5Q A;  1RIO H;  1BC8 C;  2EFO A;  4JBA A;  5BPI A;  3E5U A;  1UB9 A;  1FBQ A;  1PUE E;  1EH7 A;  1FT9 A;  3LWF A;  2EFP A;  2MH2 A;  1SFX A;  2PMH A;  3V7S A;  2JSC A;  4AIJ A;  2PG4 A;  5L3B A;  1RUO A;  4RAY A;  1W7P B;  4CZZ A;  4UUV A;  3HOS A;  2EWN A;  3R4K A;  3ZMU A;  2FML A;  4HBL A;  4WXC A;  1T39 A;  5FB2 A;  3EDP A;  1MDM A;  1OYY A;  4IHT A;  3CUQ B;  4P9F A;  1EH8 A;  1BBY A;  2PBI A;  5FO5 A;  1FSE A;  3GZ6 A;  2PN6 A;  2YU3 A;  1VTN C;  1BM9 A;  2Q0O A;  3PFI A;  1FYL A;  2HGC A;  5J6X A;  2ZME A;  1TW2 A;  3HTU A;  4DQ2 A;  2GIV A;  1ZRE A;  2COM A;  2GAU A;  2FBI A;  1XSX A;  3I58 A;  4FT8 A;  2YX7 A;  3O3K A;  2XRO A;  2VBW A;  2WWY A;  2OU2 A;  3EYI A;  2HFH A;  2Y0M A;  2DTR A;  1QNT A;  5EEG A;  1F1Z A;  2K7L A;  2GXG A;  4RB2 C;  3C7J A;  3T8R A;  4LG0 B;  3O2P E;  4U0W A;  3REO A;  1G4D A;  4L5I A;  5D8K B;  4M6X A;  1I27 A;  2MLK A;  1IXC A;  3L9F A;  5LRR A;  1ZH5 A;  4HAM A;  4IRH A;  5ED4 A;  5E20 A;  4Q4Z F;  3DPL C;  5HLG A;  3QP5 A;  2DPU A;  1F9N A;  2OZU A;  3RIR A;  1LDJ A;  1P4A A;  5KVR A;  4RAZ A;  5BPD A;  2YPR A;  1RNL A;  2FNA A;  1EV7 A;  5DCF A;  5JI6 A;  4HF2 A;  4HX4 A;  3RTR A;  3ZMT A;  4HA8 A;  1FBS A;  3QU6 A;  4HQE A;  1ZLJ A;  3RKY A;  3C1D A;  1Y0U A;  4KNY A;  2JZY A;  5FD6 A;  4B8X A;  2DO7 A;  3FMQ A;  2QUF A;  3GFM A;  1GXQ A;  3R0J A;  1J5Y A;  1LQ1 A;  1Z7U A;  2KIM A;  1ZRD A;  3CO6 C;  4IF4 A;  1JXS A;  2BBY A;  4Q47 A;  2Z9O A;  4G6D A;  2QEN A;  3B73 A;  4MEY F;  1P2F A;  4M71 A;  4ESB A;  2DPD A;  3I53 A;  4O3M A;  3H3U A;  2CWE A;  4XLN F;  1IN5 A;  5L3G A;  4H0E A;  1O7F A;  5E17 F;  2AXL A;  3HHH A;  1G3T A;  4L0Z B;  3I71 A;  2JT1 A;  1FSH A;  3DXJ F;  1IXS B;  3SXY A;  1R1U A;  3P9I A;  2PMU A;  2YX4 A;  1IW7 F;  3C3W A;  1GXP A;  3VB2 A;  1TBX A;  3E5X A;  5L3F A;  2XAH A;  3L00 A;  4ASN A;  2OA4 A;  4A2U A;  2RKH A;  5LHI A;  4PDK A;  3J81 K;  2CG4 A;  2XUB A;  1KYW A;  2E7X A;  4RB0 A;  3I59 B;  1K78 B;  2H27 A;  3ULQ B;  2P7C B;  4L9V A;  5DCM B;  2IVM A;  4S05 A;  2VBX A;  3C18 A;  4R79 A;  3J80 K;  2W25 A;  1P6R A;  1XB4 A;  2NS0 A;  3WGI A;  4HV5 A;  4M72 A;  2NNY A;  1XGO A;  1SD7 A;  3IC7 A;  3T0Y A;  1QQI A;  3ISP A;  2PJP A;  3KP5 A;  4ENM A;  4U7B A;  2XKO A;  4BQA A;  4N9H A;  4UVC A;  4FHT A;  5L3D A;  5IT3 A;  3IWZ A;  3BDD A;  2QM3 A;  3W6K B;  2PQ8 A;  3EYY A;  2QQ9 A;  5FFZ A;  1IN7 A;  1S8N A;  2VXZ A;  1RI7 A;  3ABU A;  1S3J A;  1B6A A;  3HRS A;  1ZRC A;  1U6G A;  2FXA A;  5EEH A;  4DNC A;  2V79 A;  4I01 A;  2EV0 A;  2HDC A;  4AD9 A;  4L0Y B;  5LEJ A;  3K2Z A;  3GXO A;  2NNN A;  1FP2 A;  1O7L A;  4CHU A;  2JTV A;  1GVJ A;  3TQN A;  2Z99 A;  1LEA A;  1UHW A;  3ZP5 A;  4LMY A;  3GYH X;  2L02 A;  1TLH B;  5LHH A;  4N9I A;  2O6G E;  5LBQ A;  5D6E A;  1V4R A;  2P4W A;  1O3T A;  4XSX F;  1YTY A;  1QBJ A;  2H6C A;  4HF0 A;  2ZNY A;  3R60 A;  1E17 A;  2ESH A;  2ZCW A;  2VT3 A;  4L5J A;  5HDK A;  1FOK A;  2XKP A;  3N97 A;  4EM0 B;  2BEO A;  1QZZ A;  1ZRF A;  1U5T A;  2EA4 A;  2XGX A;  2EFQ A;  3DF8 A;  1G3Y A;  4EV0 A;  4XSZ F;  1YO5 C;  1ZG5 A;  2O61 A;  2DK5 A;  1G6N A;  2QVO A;  3CTA A;  4ESF A;  1U3E M;  3K0L A;  1QPM A;  4HYE A;  2ZO4 A;  5E1W A;  2V1D A;  3FMS A;  2LSO A;  3MFK A;  2HOE A;  5AIQ A;  3CDH A;  3PQK A;  4ZYH A;  1S29 A;  2G7U A;  4MNU A;  2M8E A;  4YFX F;  3TOA A;  1J7K A;  2EA2 A;  4EGZ A;  4A0Z A;  4KYW A;  2MA3 A;  2QWW A;  5D5W B;  3LA3 A;  1TW3 A;  1B59 A;  1D3Y A;  3N4M A;  3HRM A;  2MBF A;  5HS8 A;  1WRJ A;  2WV0 A;  2VOD A;  3FF5 A;  3U1D A;  1PP8 F;  4I2O A;  2E1N A;  1JGS A;  1FYM A;  4OMZ A;  3FX3 A;  3RYP A;  2ZFW A;  4L9N A;  1XDU A;  1P92 A;  2RNJ A;  5ICC A;  4G9Y A;  2IJL A;  4BHC A;  4ON0 A;  4PZJ A;  4OIR F;  3TGN A;  3HSF A;  2L4A A;  4LLG F;  3RPU A;  3F23 A;  1KU7 A;  5CJ9 A;  2IA0 A;  1BOA A;  2D45 A;  3I5U A;  3JSO A;  4XLP F;  2BYV E;  4HDV A;  4Y13 A;  1K7A A;  1SMT A;  3RDI A;  3T5X A;  1IN8 A;  2M87 A;  2XIG A;  1D8J A;  3KCC A;  2G9W A;  3F8B A;  3TDU C;  2ESN A;  3WG9 A;  1OR7 A;  4LLL A;  2CFX A;  1ZLK A;  1KU3 A;  4BXU A;  1S6L A;  1K6O A;  3DQV C;  5TJJ A;  3LFK A;  3MAJ A;  1REP C;  5K5Q A;  4CXF A;  1IN4 A;  5AIP A;  2IA1 A;  3IHU A;  5D6F A;  4RB3 C;  1DPU A;  2IRF G;  1HKT A;  3ECH A;  3NQO A;  1ZAR A;  2ISY A;  2IW5 A;  1J59 A;  1FX7 A;  1R5H A;  4HOB A;  3HTS B;  4NHJ A;  1TQI A;  2RV8 A;  3LST A;  2W84 A;  3JAM Z;  5ILV A;  3KP7 A;  2MD5 A;  3F8M A;  5DV5 A;  3WOD F;  3MZY A;  3KP4 A;  4P96 A;  1XSD A;  4U7D A;  4B09 A;  2A6E F;  1I5Z A;  1Z6R A;  1J0R A;  3FXR A;  3FMR A;  2A68 F;  5JR3 A;  1L3L A;  1Q1H A;  2A07 F;  3ZN0 A;  4RB1 A;  1TQM A;  1ODD A;  2GQQ A;  4ESJ A;  1IF1 A;  4ENK A;  4LK1 F;  5HOO A;  3GUD A;  1FNN A;  2ZXJ A;  4G7O F;  4UXN A;  1KA8 A;  3BPV A;  1FY7 A;  2XAJ A;  3ERE D;  4PGG A;  2V1U A;  2BE5 F;  1LDD A;  5TRD A;  2ZBK A;  3S2W A;  1MJ9 A;  3K9T A;  1WWX A;  2M45 A;  4L9J A;  3F8C A;  4KN4 X;  1DP7 P;  3RKW A;  5HS7 A;  3WTW C;  2GA2 A;  3ZMZ A;  3Q9V A;  3VOD A;  4OMY A;  2LNB A;  1BI2 A;  1BI1 A;  3RJP A;  1XGN A;  2F5E A;  4FX0 A;  4UVA A;  4UV8 A;  3G3Z A;  5FGM A;  3GLX A;  5AON A;  1SFE A;  2M1B A;  2W85 A;  4I0B A;  4OIP F;  4BHP A;  4WF2 A;  4GCV A;  2XAS A;  2VOO A;  1SFU A;  3HHG A;  2GA1 A;  3HRU A;  5FD5 A;  2R3S A;  1H9T A;  1P4W A;  1WQ2 A;  3T1B A;  5A2Q K;  2OZ6 A;  2PEX A;  3R61 A;  2VN2 A;  1CF7 A;  5IT9 Z;  2HTS A;  5DCM A;  4M74 A;  4HW0 A;  2ISZ A;  5E1Z B;  2UWM A;  3LQQ A;  3CO7 C;  2RC4 A;  2FF4 A;  3PQJ A;  3BOQ A;  1R1V A;  3HRT A;  2OD5 A;  3KLN A;  4PGH A;  2J5O A;  1ZGA A;  3F8F A;  1R1T A;  1XCB A;  1J9I A;  1QO0 D;  5D5V B;  3ZMS A;  1R23 A;  4KT5 C;  1U5T C;  3SZP A;  2FBK A;  4U88 A;  2LF7 A;  4WXH A;  3JTH A;  2VBZ A;  1UHM A;  1XD7 A;  3KFW X;  4HZF A;  1WSU A;  5HVQ C;  2O3F A;  4I02 A;  2ZNZ A;  1IZ1 A;  4IRG A;  5D5U B;  6PAX A;  2QBY B;  2RN7 A;  1IAW A;  1MDM B;  4A0X A;  4ZYD A;  4O6J A;  3GVA A;  3E6B A;  4A5M A;  4D0P A;  3GW2 A;  5BMZ A;  4EVI A;  3E6M A;  4WWC A;  4I09 A;  1R22 A;  2RQP A;  3M1E A;  3R0A A;  4GYG A;  1KQ8 A;  2VON A;  5DYM A;  2WTE A;  2Y48 A;  4IXA A;  2XVC A;  2LF8 A;  5HLH A;  1TNT A;  3CUQ C;  5CVR A;  2P7V B;  3EUH A;  4OIO F;  2FOK A;  3F72 A;  5CVV A;  3H3Z A;  4S04 A;  1B9N A;  5K5O A;  5H6Q A;  5K1Y A;  4WX9 A;  2B0L A;  3V7R A;  4AWX B;  1XGM A;  1YG2 A;  4BHB A;  2STW A;  1YFH A;  4Q5S F;  2AS5 F;  2FRH A;  2DFI A;  4MHG A;  5H6R A;  1QGP A;  2P6S A;  1UFM A;  5DD4 A;  4BYY A;  2XAQ A;  2K4B A;  2FA5 A;  1I1S A;  2K4J A;  3BP8 A;  2FQ3 A;  3SQN A;  4CDG A;  1W4M A;  1L0O C;  4EJV A;  4KIC A;  2J5P A;  3O6B B;  4Y15 A;  3WGG A;  5F1R A;  2EB7 A;  4MTD A;  4IJA A;  1YS6 A;  3W6J B;  3AAF A;  2DQR A;  3TO6 A;  1XN7 A;  5ILS A;  5FLX K;  5H20 A;  4QLC U;  3ECO A;  4FX4 A;  1FZP B;  1R7J A;  2XV4 S;  4EJU A;  2KJC A;  4OU0 A;  2W57 A;  1MJB A;  1G3S A;  3E6D A;  3WTY C;  4LJZ F;  1YS7 A;  5HDG A;  4MGR A;  3HOT A;  1TTY A;  4RGX A;  1OYW A;  2STT A;  4EM1 A;  2R7F A;  3GWZ A;  1HKQ A;  3COA C;  3ZMD A;  4TV7 A;  2DQL A;  2W24 A;  3EQL F;  4Y17 A;  3E6C C;  2P5L C;  2IT0 A;  4ZZL A;  4YIF A;  1RUN A;  3QOP A;  3WTS C;  4HDU A;  3ML6 A;  4ENN A;  2YR2 A;  3TKY A;  3MZH A;  4GO1 A;  1T0F A;  5E8I A;  4RGU A;  3D0S A;  4IPA A;  4HX7 A;  3WTT C;  2IA2 A;  4MEX F;  2DT5 A;  4LGW A;  3DFG A;  3G73 A;  2HEO A;  3K1N A;  2CYY A;  2P5V A;  2QQA A;  3P7N A;  2HYG D;  5LLQ A;  4YFN F;  1HSJ A;  4JK1 X;  1K79 A;  2KIU A;  2LDU A;  2DLL A;  1IUY A;  2NAZ A;  3M7G A;  3KZY A;  5JVT A;  5DUK A;  2Y75 A;  1DPR A;  1E2X A;  3SZT A;  1BJA A;  1ZG3 A;  2NRA C;  5J8C A;  5D4S A;  4KA4 A;  2O8X A;  1YW9 A;  2F5D A;  5HLI A;  2L01 A;  4KMF A;  3DPT A;  5JHU A;  1USS A;  4G6Q A;  1FWZ A;  5F6F A;  1XSV A;  5CLS A;  4YII A;  5ICG A;  1JHF A;  3V8L A;  4LB5 A;  3VFZ A;  2PI0 A;  1SMY F;  5LGT A;  2R7D A;  3ZN1 A;  1TNS A;  3NEU A;  1W7P A;  2NYX A;  2HKO A;  3TO9 A;  1SD5 A;  2BGC A;  1OMI A;  1MZB A;  3GFJ A;  3KLO A;  1XGS A;  2MH9 A;  1FC3 A;  3CUQ A;  3TOB A;  2GXB A;  1JHH A;  5E8G A;  1ULY A;  1SD4 A;  1LDK B;  1KGS A;  3BZ6 A;  3HIF A;  3I0T A;  2HZT A;  2X0L A;  1LJ9 A;  2VBY A;  1SAX A;  2MLG A;  5HDN A;  4KDP A;  4EJW A;  2X4H A;  2VT2 A;  1KYZ A;  2XRN A;  4BAY A;  2QQB A;  3MEX A;  3JW4 A;  3WTU C;  2O03 A;  1I6X A;  2HQN A;  3J81 Z;  1FLI A;  4M9Z A;  3J7A O;  2F5C A;  2L54 A;  4LG0 A;  2D1V A;  1H9G A;  2K27 A;  3FZV A;  3OOP A;  2JPC A;  5D8L B;  4UHT A;  1I1G A;  5DD8 A;  2HKX A;  3F3X A;  3J80 Z;  2KRF A;  1U78 A;  3WE2 A;  5E1X A;  4A6D A;  1LNW A;  4WXD A;  5BQT A;  1XMA A;  4RGR A;  1W5T A;  1ZN2 A;  2ZKZ A;  3BRO A;  1SD6 A;  3QAH A;  2ZJ2 A;  3M9A A;  3GX4 X;  3QPH A;  2GZW A;  5LRS A;  4HX8 A;  4EJT A;  2JRT A;  2QZ8 A;  1HW1 A;  5LEK A;  2HS5 A;  1BN5 A;  3M8E A;  3MQ0 A;  2ACJ A;  4LLN A;  3GFI A;  4MQ9 F;  3Q9S A;  4BH9 A;  2V6C A;  2F2E A;  4A5N A;  4R8H A;  1YIO A;  1FYK A;  1A04 A;  4CIC A;  1R5G A;  3QU3 A;  3CJN A;  2OQG A;  1STZ A;  1IRG A;  3MCZ A;  4YG2 F;  4GGG A;  4L9T A;  3LA2 A;  1UCR A;  2DI3 A;  5CVI A;  1NHA A;  2G7H A;  2QBY A;  1BIB A;  2VC1 A;  1TQP A;  1B9M A;  2Z5U A;  3BJA A;  3V7C A;  1R00 A;  4A6E A;  4AIK A;  1MKM A;  2FSW A;  3IRQ A;  1C0W A;  2A6H F;  5CVU A;  3KE2 A;  5HS9 A;  1OYI A;  2L4M A;  2ELH A;  2OQR A;  2DK8 A;  4KIF A;  1R36 A;  1AWC A;  2A5Y B;  2QLZ A;  4UNO A;  4M6Y A;  2EFN A;  3WTZ A;  4P9U A;  2VOP A;  2PFB A;  4M73 A;  3KZZ A;  3I64 A;  1T6S A;  5L3C A;  2H09 A;  1Z6T A;  4MQV A;  1T38 A;  1ZGJ A;  2DBB A;  4A0Y A;  1YW7 A;  1Z05 A;  3DEU A;  3K1M A;  3I59 A;  1PP7 U;  1K78 A;  3I4P A;  2A69 F;  2EFW A;  2FMY A;  3VEP A;  3MWM A;  3TO7 A;  5D4R A;  4ZZD A;  1BI0 A;  1HST A;  1ONV A;  4CGZ A;  2CGP A;  4LB6 B;  1MGT A;  1B4A A;  3F6O A;  4OOI A;  4Z2Y A;  5BS6 A;  2JPB A;  3KET A;  4RS8 A;  5ERI A;  1GHC A;  1FP1 D;  3P9K A;  3KEO A;  3BJ6 A;  4L18 B;  1FBU A;  3NRV A;  4U0V A;  3U2R A;  1T98 A;  4LK0 F;  3DKW A;  3TDZ C;  2CQK A;  2Q8K A;  4HQM A;  3IKT A;  2CW0 F;  1IRF A;  2GWR A;  1PDN C;  1KU9 A;  3KP3 A;  4EM2 A;  1WI9 A;  1O57 A;  1ON1 A;  1F4K A;  1ZYR F;  2EV6 A;  4KUM A;  5K5R A;  4OIN F;  2E1C A;  3F6V A;  2WC2 A;  5ILU A;  3T8T A;  3BPX A;  3LAJ A;  3QP6 A;  2ZME B;  3HYI A;  3L2C A;  1AOY A;  1ON2 A;  4EJO A;  3CUO A;  4HV6 A;  3H92 A;  1X3U A;  2H94 A;  3K1P A;  1WKM A;  4ZYG A;  2UZK A;  4IRI A;  2M5W A;  3K69 A;  1H0M A;  1YLF A;  2KIF A;  4RGS A;  3HUG A;  5F64 A;  4AVP A;  4BNC A;  1BIA A;  1ZAO A;  3VOE A;  3WTX C;  1FPQ A;  4P5O A;  3ELK A;  2E7W A;  2O0Y A;  3KP6 A;  3BY6 A;  4HF1 A;  4HLX A;  2KKO A;  5DEQ A;  4CO8 A;  3RYR A;  2IPQ X;  3L09 A;  3IKV A;  2V1X A;  2VE9 A;  4G8X A;  5D5X B;  4CYD A;  1CF7 B;  3KEQ A;  3M8F A;  3B02 A;  3V8K A;  2Z33 A;  4ENJ A;  4M9S A;  2LKP A;  4KMU X;  1KU2 A;  2P5K A;  3F8N A;  3IL2 A;  4EMS A;  4N0B A;  4XBF A;  2EV5 A;  5LHG A;  4WK8 F;  2DU9 A;  4EQQ A;  3FXQ A;  3IRR A;  3LAP A;  3DP7 A;  1LB2 A;  3WE3 A;  2RVC A;  4UVB A;  1KQ0 A;  4ETS A;  3U9G A;  4IVN A;  4AIH A;  2C6Y A;  3JAM K;  4QWQ A;  1U8R A;  1DUX C;  2HQR A;  2P8T A;  1HW2 A;  2VE8 A;  3FXU A;  2VC0 A;  1YW8 A;  2FEZ A;  3RI4 A;  2CSO A;  2HTJ A;  5DUI A;  4HLY A;  5BOX A;  1EH6 A;  1O3R A;  2DAO A;  3RPQ A;  2Z3Y A;  4LFU A;  2QYO A;  1KQ9 A;  2A3S A;  2M30 A;  2IP2 A;  3GO5 A;  1YQA A;  3V8J A;  1F5T A;  3FM5 A;  3QPT A;  3Q5F A;  4KIB A;  3HSR A;  1D5V A;  4F7Z A;  1W5S A;  4GYI A;  2UXN A;  3BJO A;  2Q2E A;  4O5V A;  2XAG A;  1R58 A;  4K2E A;  4P55 A;  2D2W A;  4ZH4 F;  3OV8 A;  2D1H A;  1V3F A;  4KIG A;  2H6B A;  3FWE A;  3ZPL A;  2A61 A;  5A2Q Z;  1S7A A;  3D5L A;  3ZQ7 A;  3I54 A;  1ZG1 A;  1QZY A;  3JSP A;  2YSR A;  2HWV A;  3DV8 A;  2V9V A;  3E97 A;  4E70 A;  2DW4 A;  2EJR A;  1MJA A;  4M9X A;  4ZYE A;  5JFR A;  1J2X A;  4PCQ A;  3L7W A;  1BC7 C;  4I7H A;  3IWF A;  5CYV A;  3ROU A;  2FNP A;  5ICE A;  1BI3 A;  4I98 B;  1P4X A;  2K86 A;  4NQW A;  1HW5 A;  1T2K A;  1ZHF A;  3E3V A;  4MTE A;  3WTV C;  2EK5 A;  3LQR A;  5IT9 K;  4NB5 A;  2RGV A;  2PLY A;  3SHF A;  1O3Q A;  4JQF A;  1HKS A;  4U0Y A;  4EGY A;  3WU0 A;  4LD5 A;  5LGU A;  2XHK A;  1Z1D A;  4Q48 A;  4KFC A;  1IXR C;  3SFZ A;  5DDG A;  3JTG A;  1G3W A;  2OAZ A;  1HQC A;  1RZ4 A;  1U2W A;  5CVJ A;  1D8K A;  1YYV A;  1IN6 A;  3LA7 A;  4G7Z F;  2OBP A;  4GXO A;  1J75 A;  1DDN A;  2ETH A;  2K02 A;  2MC3 A;  1LEB A;  3GF2 A;  3FHZ A;  4R1H A;  2HYF A;  3P9C A;  3FM3 A;  1JE8 A;  1XMK A;  1HXD A;  4I0A A;  2HR3 A;  5LGN A;  1CGP A;  5E18 F;  4G94 A;  3WU1 B;  2CO5 A;  2UXX A;  5L3E A;  2RDP A;  1XCV A;  5FFX A;  5ICF A;  5J8F A;  4G7H F;  2FE3 A;  3QRF F;  3KP2 A;  3GFL A;  4IHS A;  3ABT A;  3CLO A;  4YFK F;  1B1B A;  3WGH A;  3EET A;  2TDX A;  1HBX G;  4XRF A;  1XDS A;  2L3D A;  1LVA A;  1Z91 A;  1OKR A;  3GZ5 A;  3BWG A;  4A12 A;  4KN7 X;  2P6T A;  2F5F A;  3F21 A;  4WCG A;  1Z9C A;  2XAF A;  3ZMV A;  2KJB A;  1S7O A;  1O3S A;  3RKX A;  5KK1 A;  2BV6 A;  1UST A;  1U5T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...