4IXJA

The structure of pilj, a type iv pilin from clostridium difficile
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
237
structure length
224
Chain Sequence
RNIEKSKAVTCLSNRENIKTQIVIAMAEESSKDKNEVIKEVLENKDGKYFETEPKCKSGGIYSATFDKVYVTCTKHPDGIEMARDIHQSMKDLIASFAQDPSIIPGASKGNDDFRKYLLDNKYKNGWPTIPDEFKAKYGLSKDTLYIQPYAYNPTKSDATVVVFANNKTGGNWYTSLVYDYDEGRWYKGKNGISVAGRSWDVDTDSVKSVKTEIHSKEGWGPLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Clostridium difficile PilJ Exhibits Unprecedented Divergence from Known Type IV Pilins.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Cell adhesion
molecule keywords Fimbrial protein (Pilin)
total genus 77
structure length 224
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18223 PilJ_C Pili PilJ C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.80 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4ixjA01
3.30.1690.20 Alpha Beta 2-Layer Sandwich TcpA-like pilin TcpA-like pilin 4ixjA02
4IXJA
chains in the Genus database with same CATH superfamily
3CFAL 2X3FA 4DE5A 4G5YA 3IMCA 3IOBA 3FHVA 3MXTA 2A84A 2A86A 3COWA 3CFIA 2A53A 3IVXA 4MUHA 4MUIA 3IOEA 3IVGA 3LF4A 4IXJA 3UA0A 2LMEA 2A54A 2G2SA 3HL6A 1N2BA 2IECA 4MUNA 1Q5FA 3CFHL 2I52A 2GW4A 2GR8A 2G5ZA 4MUGA 4DDHA 4G5FA 2G3DA 3N8HA 1V8FA 1OQVA 3COVA 3VORA 3S0TA 5KWVA 4MUKA 2A88A 3IVCA 3IMEA 2EJCA 4MUFA 4MUEA 1N2EA 1N2GA 2OGFA 2RETA 2A50A 4EFKA 3ISJA 3FHUA 3MUEA 3IUEA 3CI0K 3EMOA 5EXCA 3Q12A 3IODA 3Q10A 3QTTA 1N2OA 5BW0B 1MOPA 2A56A 3AG5A 2GR7A 4MUJA 1N2JA 2A7XA 3INNA 3CI0I 4MULA 4EF6A 5G2FA 3HRVA 1N2IA 1UFVA 3IOCA 3UK2A 4FZJA 4MQ6A 3AG6A 4DDMA 4BHRA 1IHOA 2A52A 1ZWTA 3IUBA 3COYA 3COZA 3LE8A 3IMGA 4DDKA 3UY4A 2G16A 5HG0A 3CFFL 1N2HA
chains in the Genus database with same CATH topology
3CFAL 2X3FA 4DE5A 4G5YA 3IMCA 3IOBA 3FHVA 3MXTA 2A84A 2A86A 3COWA 2A53A 3IVXA 4MUHA 4MUIA 3IOEA 3IVGA 3LF4A 4IXJA 3UA0A 2A54A 2G2SA 3HL6A 1N2BA 4MUNA 1Q5FA 3CFHL 2GW4A 2G5ZA 4MUGA 4DDHA 4G5FA 2G3DA 3N8HA 1V8FA 1OQVA 3COVA 3VORA 3S0TA 5KWVA 4MUKA 2A88A 3IVCA 3IMEA 2EJCA 4MUFA 4MUEA 1N2EA 1N2GA 3FHUA 2A50A 4EFKA 3ISJA 3MUEA 3IUEA 5EXCA 3Q12A 3IODA 3Q10A 3QTTA 1N2OA 1MOPA 2A56A 3AG5A 4MUJA 1N2JA 2A7XA 3INNA 4MULA 4EF6A 5G2FA 3HRVA 1N2IA 1UFVA 3IOCA 3UK2A 4FZJA 4MQ6A 3AG6A 4DDMA 4BHRA 1IHOA 2A52A 1ZWTA 3IUBA 3COYA 3COZA 3LE8A 3IMGA 4DDKA 3UY4A 2G16A 5HG0A 3CFFL 1N2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IXJ A; 
#chains in the Genus database with same CATH topology
 3CFA L;  2X3F A;  4DE5 A;  4G5Y A;  3IMC A;  3IOB A;  3FHV A;  3MXT A;  2A84 A;  2A86 A;  3COW A;  3CFI A;  2A53 A;  3IVX A;  4MUH A;  4MUI A;  3IOE A;  3IVG A;  3LF4 A;  4IXJ A;  3UA0 A;  2LME A;  2A54 A;  2G2S A;  3HL6 A;  1N2B A;  2IEC A;  4MUN A;  1Q5F A;  3CFH L;  2I52 A;  2GW4 A;  2GR8 A;  2G5Z A;  4MUG A;  4DDH A;  4G5F A;  2G3D A;  3N8H A;  1V8F A;  1OQV A;  3COV A;  3VOR A;  3S0T A;  5KWV A;  4MUK A;  2A88 A;  3IVC A;  3IME A;  2EJC A;  4MUF A;  4MUE A;  1N2E A;  1N2G A;  2OGF A;  2RET A;  2A50 A;  4EFK A;  3ISJ A;  3FHU A;  3MUE A;  3IUE A;  3CI0 K;  3EMO A;  5EXC A;  3Q12 A;  3IOD A;  3Q10 A;  3QTT A;  1N2O A;  5BW0 B;  1MOP A;  2A56 A;  3AG5 A;  2GR7 A;  4MUJ A;  1N2J A;  2A7X A;  3INN A;  3CI0 I;  4MUL A;  4EF6 A;  5G2F A;  3HRV A;  1N2I A;  1UFV A;  3IOC A;  3UK2 A;  4FZJ A;  4MQ6 A;  3AG6 A;  4DDM A;  4BHR A;  1IHO A;  2A52 A;  1ZWT A;  3IUB A;  3COY A;  3COZ A;  3LE8 A;  3IMG A;  4DDK A;  3UY4 A;  2G16 A;  5HG0 A;  3CFF L;  1N2H A; 
#chains in the Genus database with same CATH homology
 3CFA L;  2X3F A;  4DE5 A;  4G5Y A;  3IMC A;  3IOB A;  3FHV A;  3MXT A;  2A84 A;  2A86 A;  3COW A;  2A53 A;  3IVX A;  4MUH A;  4MUI A;  3IOE A;  3IVG A;  3LF4 A;  4IXJ A;  3UA0 A;  2A54 A;  2G2S A;  3HL6 A;  1N2B A;  4MUN A;  1Q5F A;  3CFH L;  2GW4 A;  2G5Z A;  4MUG A;  4DDH A;  4G5F A;  2G3D A;  3N8H A;  1V8F A;  1OQV A;  3COV A;  3VOR A;  3S0T A;  5KWV A;  4MUK A;  2A88 A;  3IVC A;  3IME A;  2EJC A;  4MUF A;  4MUE A;  1N2E A;  1N2G A;  3FHU A;  2A50 A;  4EFK A;  3ISJ A;  3MUE A;  3IUE A;  5EXC A;  3Q12 A;  3IOD A;  3Q10 A;  3QTT A;  1N2O A;  1MOP A;  2A56 A;  3AG5 A;  4MUJ A;  1N2J A;  2A7X A;  3INN A;  4MUL A;  4EF6 A;  5G2F A;  3HRV A;  1N2I A;  1UFV A;  3IOC A;  3UK2 A;  4FZJ A;  4MQ6 A;  3AG6 A;  4DDM A;  4BHR A;  1IHO A;  2A52 A;  1ZWT A;  3IUB A;  3COY A;  3COZ A;  3LE8 A;  3IMG A;  4DDK A;  3UY4 A;  2G16 A;  5HG0 A;  3CFF L;  1N2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...