4IXJA

The structure of pilj, a type iv pilin from clostridium difficile
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
237
structure length
224
Chain Sequence
RNIEKSKAVTCLSNRENIKTQIVIAMAEESSKDKNEVIKEVLENKDGKYFETEPKCKSGGIYSATFDKVYVTCTKHPDGIEMARDIHQSMKDLIASFAQDPSIIPGASKGNDDFRKYLLDNKYKNGWPTIPDEFKAKYGLSKDTLYIQPYAYNPTKSDATVVVFANNKTGGNWYTSLVYDYDEGRWYKGKNGISVAGRSWDVDTDSVKSVKTEIHSKEGWGPLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fimbrial protein (Pilin)
publication title Structure of Clostridium difficile PilJ Exhibits Unprecedented Divergence from Known Type IV Pilins.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Cell adhesion
total genus 77
structure length 224
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18223 PilJ_C Pili PilJ C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.80 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4ixjA01
3.30.1690.20 Alpha Beta 2-Layer Sandwich TcpA-like pilin TcpA-like pilin 4ixjA02
4IXJA
chains in the Genus database with same CATH superfamily
2A53A 4MUJA 3IODA 3HL6A 2I52A 1ZWTA 4DE5A 1N2IA 3FHUA 4IXJA 2LMEA 4DDMA 3Q10A 3CFAL 3COVA 5HG0A 3IMEA 3VORA 4EFKA 3COZA 5KWVA 3EMOA 1Q5FA 2G2SA 3IMGA 4DDHA 2OGFA 4MUKA 4MUIA 3AG6A 2A54A 1N2EA 4MUGA 2EJCA 3COYA 3IUEA 3LE8A 2A86A 3UK2A 3LF4A 2A50A 1N2GA 3IMCA 3HRVA 3CI0K 2A84A 2G16A 3UY4A 1N2JA 4G5FA 2G5ZA 3ISJA 3COWA 3QTTA 3CFIA 2GR8A 3UA0A 2A7XA 4MUFA 3AG5A 2G3DA 3N8HA 1UFVA 2A88A 1N2OA 3IVGA 1MOPA 3IVXA 3MXTA 1IHOA 2A52A 3MUEA 1V8FA 1N2HA 4DDKA 3IOEA 3CI0I 2GR7A 1N2BA 4EF6A 4G5YA 4MUNA 2GW4A 5G2FA 4MUEA 5EXCA 4BHRA 3IOBA 3IOCA 1OQVA 2RETA 3INNA 3Q12A 3IVCA 4MULA 5BW0B 2A56A 2X3FA 2IECA 4MUHA 3IUBA 4MQ6A 3CFFL 3FHVA 3S0TA 3CFHL 4FZJA
chains in the Genus database with same CATH topology
2A53A 4MUJA 3IODA 3HL6A 1ZWTA 4DE5A 1N2IA 3FHUA 4IXJA 4DDMA 3Q10A 3CFAL 3COVA 5HG0A 3IMEA 3VORA 4EFKA 3COZA 5KWVA 1Q5FA 2G2SA 3IMGA 4DDHA 4MUKA 4MUIA 3AG6A 2A54A 1N2EA 4MUGA 2EJCA 3COYA 3IUEA 3LE8A 2A86A 3UK2A 3LF4A 2A50A 1N2GA 3IMCA 3HRVA 2A84A 2G16A 3UY4A 1N2JA 4G5FA 2G5ZA 3ISJA 3COWA 3QTTA 3UA0A 2A7XA 4MUFA 3AG5A 2G3DA 3N8HA 1UFVA 2A88A 1N2OA 3IVGA 1MOPA 3IVXA 3MXTA 1IHOA 2A52A 3MUEA 1V8FA 1N2HA 4DDKA 3IOEA 1N2BA 4EF6A 4MUNA 4G5YA 5G2FA 2GW4A 4MUEA 5EXCA 4BHRA 3IOBA 3IOCA 1OQVA 3INNA 3Q12A 3IVCA 4MULA 2A56A 2X3FA 4MUHA 3IUBA 4MQ6A 3CFFL 3FHVA 3S0TA 3CFHL 4FZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IXJ A; 
#chains in the Genus database with same CATH topology
 2A53 A;  4MUJ A;  3IOD A;  3HL6 A;  2I52 A;  1ZWT A;  4DE5 A;  1N2I A;  3FHU A;  4IXJ A;  2LME A;  4DDM A;  3Q10 A;  3CFA L;  3COV A;  5HG0 A;  3IME A;  3VOR A;  4EFK A;  3COZ A;  5KWV A;  3EMO A;  1Q5F A;  2G2S A;  3IMG A;  4DDH A;  2OGF A;  4MUK A;  4MUI A;  3AG6 A;  2A54 A;  1N2E A;  4MUG A;  2EJC A;  3COY A;  3IUE A;  3LE8 A;  2A86 A;  3UK2 A;  3LF4 A;  2A50 A;  1N2G A;  3IMC A;  3HRV A;  3CI0 K;  2A84 A;  2G16 A;  3UY4 A;  1N2J A;  4G5F A;  2G5Z A;  3ISJ A;  3COW A;  3QTT A;  3CFI A;  2GR8 A;  3UA0 A;  2A7X A;  4MUF A;  3AG5 A;  2G3D A;  3N8H A;  1UFV A;  2A88 A;  1N2O A;  3IVG A;  1MOP A;  3IVX A;  3MXT A;  1IHO A;  2A52 A;  3MUE A;  1V8F A;  1N2H A;  4DDK A;  3IOE A;  3CI0 I;  2GR7 A;  1N2B A;  4EF6 A;  4G5Y A;  4MUN A;  2GW4 A;  5G2F A;  4MUE A;  5EXC A;  4BHR A;  3IOB A;  3IOC A;  1OQV A;  2RET A;  3INN A;  3Q12 A;  3IVC A;  4MUL A;  5BW0 B;  2A56 A;  2X3F A;  2IEC A;  4MUH A;  3IUB A;  4MQ6 A;  3CFF L;  3FHV A;  3S0T A;  3CFH L;  4FZJ A; 
#chains in the Genus database with same CATH homology
 2A53 A;  4MUJ A;  3IOD A;  3HL6 A;  1ZWT A;  4DE5 A;  1N2I A;  3FHU A;  4IXJ A;  4DDM A;  3Q10 A;  3CFA L;  3COV A;  5HG0 A;  3IME A;  3VOR A;  4EFK A;  3COZ A;  5KWV A;  1Q5F A;  2G2S A;  3IMG A;  4DDH A;  4MUK A;  4MUI A;  3AG6 A;  2A54 A;  1N2E A;  4MUG A;  2EJC A;  3COY A;  3IUE A;  3LE8 A;  2A86 A;  3UK2 A;  3LF4 A;  2A50 A;  1N2G A;  3IMC A;  3HRV A;  2A84 A;  2G16 A;  3UY4 A;  1N2J A;  4G5F A;  2G5Z A;  3ISJ A;  3COW A;  3QTT A;  3UA0 A;  2A7X A;  4MUF A;  3AG5 A;  2G3D A;  3N8H A;  1UFV A;  2A88 A;  1N2O A;  3IVG A;  1MOP A;  3IVX A;  3MXT A;  1IHO A;  2A52 A;  3MUE A;  1V8F A;  1N2H A;  4DDK A;  3IOE A;  1N2B A;  4EF6 A;  4MUN A;  4G5Y A;  5G2F A;  2GW4 A;  4MUE A;  5EXC A;  4BHR A;  3IOB A;  3IOC A;  1OQV A;  3INN A;  3Q12 A;  3IVC A;  4MUL A;  2A56 A;  2X3F A;  4MUH A;  3IUB A;  4MQ6 A;  3CFF L;  3FHV A;  3S0T A;  3CFH L;  4FZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...