4IXLA

Crystal structure of endo-beta-1,4-xylanase from the alkaliphilic bacillus sp. sn5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
206
structure length
206
Chain Sequence
SQITGNEIGTHDGYDYEFWKDEGGYGSMTLNSGGTFSAEWTDVHNILFRKGQKFDTTQTHQQLGNINIDYGVNYQPNGSSYLAVYGWTTDPLVEFYIVDSWGTWRPPGAESKGTIHVDGGTYEIYETTRVQQPSIEGTATFQQYWSVRTDKRTSGTISVSEHFHAWEAHGMPMGNMYEVALTVEGWQSSGSADVYRNNLTIGGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase
publication title Structure Analysis of Alkaline xylanase from Alkaliphilic Bacillus sp. SN5 Implications for pH-dependent enzyme activity
rcsb
source organism Bacillus sp
molecule tags Hydrolase
total genus 58
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2013-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ixlA00
2C1FA 1BVVA 1XNDA 4NPRA 1TE1B 2VGDA 2QZ3A 3MFAA 5EJ3A 2D98A 2NQYA 4XQWA 2DFCA 1XYOA 2B45X 2NLRA 5K9YA 3WXPA 2B46X 3VHNA 3WR0A 1XNBA 4H7MA 2DFBA 1HV1A 1UU6A 3LB9A 4S2GA 3RI8A 1H1AA 1C5IA 2JICA 1H4HA 3AKPA 3AKRA 3AKTA 1NLRA 3AMQA 3LGRA 3VZNA 4HKWA 5K7PA 3VL8A 3AKQA 3O7OA 1XNKA 1REFA 1ENXA 1KS5A 2Z79A 3VZLA 3VZOA 3WT3A 4XQDA 3ZSEA 2BWCA 1BCXA 3WQ1A 1W2UA 3WQ0A 4XPVA 4S2DA 3AMPA 1UKRA 2BVVA 3HD8B 1HIXA 1IGOA 1H0BA 3AMNA 2VG9A 3VGIA 1KS4A 1AXKA 1OLQA 1OA2A 2DCJA 2QZ2A 1UU4A 4IXLA 1XYPA 1H4GA 3WQ7A 3RI9A 2JEMA 1T6GC 4S2HA 3WP3A 2DCZA 3MF9A 1OA4A 2DCKA 4HK9A 3AKSA 3WP4A 3VHPA 1BK1A 3M4FA 3B7MA 3WP5A 1HV0A 1QH6A 1XXNA 2VULA 2VUJA 4HKOA 3WX5A 4HKLA 2F6BA 1OLRA 3VHOA 2D97A 1H8VA 3VL9A 3AMHA 1XNCA 1YNAA 3MF6A 3VZKA 1REEA 1UU5A 4HK8A 1PVXA 3AMMA 2B42B 1M4WA 1F5JA 5HXVA 3VLBB 3MFCA 1QH7A 3B5LB 4XQ4A 3VZMA 1C5HA 2BW8A 1OA3A 1REDA 1XYNA 2BWAA 3VZJA 4S2FA 3EXUA 2DCYA 2JENA 3WP6A 3WY6A
chains in the Genus database with same CATH superfamily
3ZXJA 1F4HA 4MXWA 5HCFA 3QOPA 2IXKA 5A3TA 2ES3A 2ZGLA 1U5YA 3ALQA 2ZX1A 4C1WA 4QPWA 1TE1B 3GBFA 1DP0A 2ZTNA 3CQOA 3I7DA 4RA0A 2LUWA 2HWD1 1TEIA 5JZGC 2VZSA 4Z1VA 1MS9A 1NA1B 4UYBA 5F5QA 4AFBA 5FZFA 5EP9A 1JN2P 2AR6A 5LY2A 1ENRA 1PVC3 1VBD2 1YI9A 3G6JB 4XDPA 2XJTA 4HKWA 1C1FA 4LLFA 4IE5A 3O7OA 4RR3B 5KBFA 5JMOA 5T3NA 2W1WA 2ZJCA 3T2TA 2AYHA 4MHUA 1O5UA 1WWYA 5F32A 5FYUA 3V0BB 2EF6A 1FAYA 4CXWA 3SHRA 1NCQC 2EXHA 2VQAA 4MGQA 1I6XA 4PT6A 2DURA 1QY4A 3D0JA 3FHQA 3ECQA 3S6PA 5FMOL 1MZFA 3BOPA 1ZNPA 4RN5A 2QQWA 1OA2A 5FZBA 2QUOA 1MS5A 1XSRA 4WM7B 5T54A 2OKXA 5FYHA 3KMHA 2RDQA 3WZ1A 4DS0A 3AX4A 4XDOA 3VBRC 3MV01 1TME3 2UURA 4LKFA 1UOJA 1G86A 4EV0A 2RR11 4Q0UA 1EPWA 4EJRA 5F9TA 1FATA 1XE8A 5FZHA 3ZMOA 1ENQA 1W39A 4XFIA 4FCAA 5FXWA 2ZEYA 4LIVA 1DZRA 1EV12 1GR3A 2JDNA 2JDUA 2PHTA 3RZZA 4CCOA 4C91A 4EN0A 2Y6FA 3I54A 3TN91 2LTNA 2WFF2 1LR5A 3V0AB 1OSGA 5JCTA 4KBZA 5GLVA 5GZFA 5JXJA 3I3BA 2C5DA 1VIWB 4PLNA 2ZEXA 3OGSA 1DG6A 5JPNB 2ZGRA 3WDVA 4IE6A 3U0ZA 2D5FA 2HWD3 4CPBD 2V4AA 4ZHNA 3RYPA 2XUEA 3JCIA 1ZBA2 3NAPC 4IV3C 1VBB3 3AYCA 1WCQA 1RUOA 5L9RA 2ZHMA 3O5SA 1ST8A 4Q4Y3 3GNEA 3AYEA 1YFWA 1ZZ8A 1SQ4A 1S0IA 3P3PA 3NQHA 3MF6A 2HBTA 4XFFA 4I30A 1J1LA 3O0XA 2XJVA 3AFGA 2W94A 4BM8A 4QKNA 3LEKA 4LHNA 5ACA2 2WQZC 5FYTA 2PXJA 1DDLA 4EE2A 4FTSA 5F7UA 2QBXA 3HQRA 2E31A 1YLLA 4IV1B 3KM5A 3RRDA 5DDJ3 3ZXAC 1UZWA 3ZXLA 5C5TA 3JXSA 4J25A 1BBT3 5CEHA 1V6NA 5A33A 2D40A 1UMIA 4GIQA 3UKTA 2WNVA 2J1EA 4AQTA 1J83A 2BWAA 4M3CE 1NCRB 1I1EA 1A3KA 4HFSA 4RS5B 3VDDC 3LSDA 4XVHA 4QXBA 1DLLA 4BCUA 3EMRA 2E7TA 3T2QA 2C1FA 2BBVA 4GKYA 3OD4A 4ASKA 4Z82A 1ODNA 1GNYA 1LRHA 2VW1A 4Q4X1 2RG4A 4W8JA 4OQ8A 4GB33 2A6XA 2ZX4A 3GYDA 5L9BA 3ZFGB 3M70A 2QZ3A 1ND2A 4QKDA 4YVSB 3NV1A 1C8M1 4MX3A 3M7AA 1W0NA 1XYOA 2P6HA 3OJBA 3OPZA 1X9PA 4UF0B 2DV9A 1QIQA 5A3PA 3VBHA 4G4FA 3MBWA 1LHWA 1NE6A 2QJVA 3OSDA 5FXZA 5K0UC 3C8XA 3QBQA 4O65A 2YFUA 3LCPA 3AKPA 4QQLA 1ZRDA 4Q4V2 1CIYA 1VB4A 2J1AA 1LOFA 2JE7A 3B94A 3KV9A 5GLWA 2CDOA 2WZEA 4WM8B 2BOIA 4EN6B 1H2KA 1O7FA 4NVPA 1YFYA 3WT3A 4A7ZA 4YW5A 1H2LA 2G9ZA 3UETA 4BZ4A 1AYN1 1HJFA 3E5QA 2XPJA 4AI9A 1JYNA 1CAVA 3IKWA 2VUCA 2CL2A 3NRUA 1UKRA 2VMEA 1D4M2 3T08A 1RUC3 3N9LA 4U36A 3WF0A 4AW7A 1OXCA 1G7YA 2B4KA 3E5XA 3O1UA 4LE4A 1NG0A 2Y38A 3LDRA 1V9U2 4LBOA 4FXGB 1KJRA 1DQ5A 2QQVA 1AR81 3VD9A 2JG8B 1IZ3A 1HB1A 2BOJA 2OPWA 5F3GA 5GLUA 3WW2A 3CZJA 1RHI1 5JAXA 1W9SA 2IFWA 4NAMA 1PK6A 5DAVA 4P9LA 3B9CA 3WG4A 4M3CB 2Y6JA 4OZOA 1VLNA 3AVRA 1JI6A 1WW5A 2YU1A 4IEXA 2A6WA 4XF4A 2IWGB 5FJKA 2C24A 3O1TA 3BI3A 3U14A 3JBG1 2K0GA 4W6YA 1RUE1 4W65A 1QJU1 5FMDA 1H8TB 2GMPA 5CADA 4OMCA 2UWBA 1W9WA 3IIAA 2WL1A 4DY5A 1SDDB 1OLMA 4KU8A 3W5MA 3DF0A 1IS4A 5FPZA 1ZRFA 1CQ9A 1R1A2 1ULFA 4QPIA 5IAVA 3T4VA 1FPN3 1IG3A 1VMHA 1CAXA 4D3WA 3U10A 4FAHA 3A23A 1RVF1 3MW4A 3RZMA 2OQ7A 5DZGA 1E5SA 2W2IA 2XLGA 1LOCA 2VAUA 3ZXGA 3DCQA 2IC1A 1FT9A 2VZQA 3AMMA 2R071 2ZGQA 3PDQA 3NV4A 2BQPA 2HWC2 1CX4A 4OUEA 4NAOA 1GBGA 1GWLA 3DPRC 4P5HA 4CE8A 4AGVA 1I5ZA 2JIJA 3HNBM 4AEDB 2JDYA 4UW6A 3VLBB 4HT1T 3TBDA 3W59A 4CTEA 3V65A 1FOD3 3WDTA 5A7SA 3WNNA 3O14A 3POJA 5KHHA 5DG2A 3N3HA 4NWWA 5C4WB 2W3JA 3WSOA 4RYDA 2YMZA 1Y43B 1JOJA 3AZZA 1QJX2 4TLFA 4Q0VA 4DXRA 1JYCA 2WZR2 1X50A 4AEKA 3M2MA 1JODA 2AEYA 2XBO1 5DUUA 2MPFA 5ANQA 4FXKB 3NNGA 2AEZA 3HR9A 5JSRA 2VGDA 1N47A 2ZHLA 1UYZA 3AZVA 4NWVA 1IPSA 3N7JA 4YVWB 5FZ6A 4NIDA 4FVVA 5ABJA 4GKXA 4Y20B 1UO9A 1QJY2 1HV1A 1TMF2 2V72A 1O6UA 3H8RA 4XF0A 1YXWA 2KD7A 4TYSA 4F3JA 1FV3A 2GSYA 3POEA 1K5MB 1HRI1 2WBKA 4Y22A 4EN9B 3DYMA 5IVEA 3P1IA 2AACA 2Y0IA 1VBD1 3VL8A 3UGFA 2XB6C 4Q1PA 1GYKA 1GQPA 5L7OC 1P8JA 1QQP2 3VZOA 1VAKA 4CDWA 3GCXA 2VZ1A 3O0WA 1JZ6A 1K45A 2DVBA 3FJSA 3LZZA 4BU2A 1K5JA 2PMWB 5LA0A 3RWNA 5IVCA 2A70A 2DVDA 2Q1FA 3K77A 2C26A 3VKNA 3MYXA 3WDUA 2H0VA 5LA1A 2P3KA 5EV7A 1MEC2 4P9XA 4KG8A 2QZ2A 3A7QA 2WNUA 4FPJA 1UY2A 1F4AA 3I3DA 3LAGA 4BXFA 3PU3A 2HJIA 1AL23 4OHZA 1OFSA 1UY1A 2HWE3 4NPLA 4BDVB 5DZFA 1AXZA 5H9PA 3PUHA 3SH3A 1V6JA 3WDWA 1BEV3 1UY4A 4CPBA 3VKMA 1OA4A 1QOTA 1UY3A 5IK8A 1PNFA 3VBSC 5JMCA 2Y6HA 3TOJA 3ENRA 1PNGA 1EV11 5FP9A 4Y1YA 1RUJ2 4BJ0A 1DYPA 1TNRA 5EFUA 3SEPA 4Y5SA 3NJYA 2W08A 4QX7A 2WR9A 4FP2A 1AHSA 1WCKA 1WA4A 4B7EA 1GP6A 1WA6X 2EXIA 4EZ4A 4UFLA 4LBNA 3RPQA 3VL9A 4KI5M 3U07A 3ZYGA 2ZACA 2OUHA 2VMCA 2BNNA 4GXLA 4UW4A 4AOCA 4D94A 5JZGB 3VD4A 1QNYA 4FQ4A 3A0KA 1QMJA 1G9DA 2W95A 2WWSA 5HCBA 4I09A 3VBUC 5A6ZA 3NV2A 1S55A 3ZYFA 4OI2A 1J1TA 4ZU5A 3VBOC 1RTVA 3WDYA 5A7OA 1W9TA 2C0ZA 2N7GA 1UL9A 4FBFA 5BNNB 5C5UA 2RDNA 2HWB2 1W8UA 2GNMA 2A7AA 3UJOA 1HQWA 4A42A 1UIKA 1A8DA 2EAAA 2QQOA 2WC2A 3NJZA 4QD2A 1NXD1 2E7QA 2WO1A 2VE1A 1NCQB 4IERA 3A21A 2YU2A 3H3LA 1SMVA 3ZKUA 2GN7A 4YG6A 2V73A 3T30A 3AP9A 1NXMA 2MEV3 1NA1A 5D8AB 2QCSB 4NMIA 4PHZA 2R49A 4DMIA 1PGL2 3P5BA 4RGAA 3I59B 1UOBA 1ASJ3 1RUI2 2RDRA 4LLOA 5DXDA 4CDUC 2QFEA 5F6LB 5L73A 1H30A 4NHLA 1IKQA 4CP0A 3GJAA 4XBQA 4PQQA 4NJ4A 5KHJA 2ZGPA 3KGZA 5FZ9A 4RR3A 4N7UA 1W6MB 4FOYA 2A3XA 1MVQA 3NV3A 1DYKA 4L9BA 2WS92 3V0BA 2PAKA 2BRTA 2DVGA 5IJRA 4FOWA 2X10A 3SXWA 1YJKA 4LO8A 3RDIA 1NY71 2WFF3 5CVRA 4AXOA 2YFZA 1NLRA 2RS32 4KU7A 5I0DA 1OKOA 2X29A 1MACA 4RQPB 4XFCA 2VVEA 1JH5A 4WM7A 3T2PA 1R091 3S7IA 1KS5A 2QQKA 4W50A 5E88A 4Z07A 4P9GA 3VZLA 2B8MA 4CVUA 1ZBA3 4GA9A 4MGKE 4WV8A 2OS2A 3BYWA 1XPWA 2HEVF 4DUVA 2R1BA 5C6CA 3KF5A 2A3YA 4OUSA 2TNFA 3WD5A 1PGW2 1Z7S1 3AMNA 5FP4A 4K40A 3BTAA 4UT5A 5C3PA 1KEXA 5ACA3 3UK9A 1JYIA 4AQ6A 4KL1A 3T3YA 1D2QA 2ET1A 1V9U1 1Q43A 2BFUS 3V0AA 1HRV2 3LPGA 4BMBA 1W8ZA 1OLME 3I2IA 4FPEA 5IVVA 4YW2A 2ERFA 1SLBA 5FXVA 4E27A 2CTVA 5IW0A 5GKAC 3KF3A 4R9AA 4XIKA 3SMHA 5GZCA 1PO23 4O9GA 3CNAA 4TN7A 1KDMA 4V2VA 2HBUA 5CZKA 1O8PA 3NSTA 2XJPA 3E5UA 3VDDB 2WINB 4AEMA 2VVDA 5DUWA 3RSJA 2ZABA 4IEOA 1B35C 1AYM3 1RJ7A 3IB3A 4JKLA 4MV2A 4NIIA 4AVTA 3M4FA 2PAEA 2V5DA 1CAUB 3FLPA 4QPGC 1XXNA 1JS9A 1QWRA 2JX9A 3AZWA 2EXKA 5FOJB 1YEWA 3HNYM 4LHKA 3MZHA 4MZUA 5SV5A 1C3HA 4IV1A 4WBBA 5FPUA 4AAPA 3HT1A 1C1LA 1KQRA 2RR12 4Q27A 2JIGA 5FZMA 3ZPYA 1O3RA 2AH2A 1SHWB 4MGIE 5C9AB 3CHXA 1REEA 4U2AA 5FP8A 3WHTA 1ODMA 2R32A 1NCRA 4XJ8A 5I8YA 1W28A 4Y24A 1GQGA 1UY0A 4Q4V3 4RS5A 1CN1A 2V4VA 4XIOA 2FDHA 5A1AA 3CJIC 4UWDA 1S2KA 2BEOA 4LNVA 2X09A 3MLJA 3ZFFC 4XZUG 4AI3A 1RUG2 1VPHA 3ZFGA 2CV6A 3FX3A 4YVSA 1AR62 1D4M3 4FPOB 4FPKA 4UF0A 3KCXA 3EXUA 3OY8B 4PDWB 4CDXB 4JGZB 4CEWC 5AC93 5BNPC 5FPLA 2PHLA 2ILMA 1G9FA 1QJX1 1VR3A 4HXCA 3HIFA 4HONA 4K7JA 4DB5A 1F9KA 5FKBA 4JC1A 5HBAA 1I3HA 3LWCA 4NPRA 4LQRA 3TEXA 5IHRA 1O5LA 4D6QA 3T0DA 4WM8A 4XQWA 2DFCA 5IFPA 2NLRA 5K9YA 4AK3A 5KC5A 2YC4A 2DCTA 1OKQA 2PHUA 4Z2WA 4ZU7A 1JZ8A 4N9HA 3ZDSA 3S0MA 2WNOA 3WNOA 1GZTA 2IVJA 3RI8A 3VDAA 3O12A 1QJY1 1TMF1 5EJ1B 3MIDA 1IQAA 3VD3A 2WKKA 1G9AA 4QX8A 3H3ZA 3W5NA 4AG4A 3MIEA 5IUQA 1OPMA 5LBCA 2ENRA 1LB2A 4JKKA 2QDNA 1CAWB 5A3NA 2P2KA 2OPKA 2X8KA 1ULGA 5A3UA 3OBTA 5FO8B 5CA6A 2JG8A 1QQP1 1QXJA 1W2UA 2UU8A 1QOSA 1R1A3 2WA3A 1O4YA 5FY7A 3RJ2X 1UYXA 2VCMA 5CFCB 1PGSA 2P37A 2BGCA 3PTYA 4N53B 4L99A 1U5IA 2BBAA 1VBA1 5FY4A 2XQRA 1KS4A 2JXAA 3DEMA 3FC0A 3KV6A 3PNAA 4OYUA 2VC9A 4M3CA 4BWOA 2W68A 1UXZA 5EYXA 1W0PA 4F8AA 3LQCA 4MUVA 4IUGA 4FOVA 1MEC1 2HWC3 4CUBA 3KB5A 2YC0A 4YRDA 5GALA 4AFAA 1COV2 1OOPC 1H8TA 1WMDA 3GGLA 5JR2A 3RZGA 3RI9A 3HEIA 4CU9A 4DNYA 1RMU2 4P08A 5GM0A 3Q8AA 3LFIA 3EYPA 4TWTA 4D7TA 4JGYB 1AYN2 5FJHA 5LWBA 3I3QA 5DAXA 3G7DA 1KITA 5FY0A 4EWDA 4JRAA 1GWMA 1HX6A 2RS51 3C7EA 4O61A 3MUY1 3ZLIA 2W46A 2WZR3 3VDCA 1LEDA 4KGQA 2EA7A 1Y3TA 3IMMA 3WP5A 4YZ5A 1RUJ1 2CU5A 2DTWA 2JE9A 3IDEA 4K20A 4F83A 2HLEA 3I3EA 1LTEA 3HMYA 2E53A 3AZYA 4ITCA 4WVMB 5FZ7A 4B3NA 1RUF2 1ZZBA 1GKBA 3Q8CA 1Y4WA 4MGSA 5FCCA 2NMNA 2RDSA 1RHI2 1NE4A 1S0BA 1N3PA 2ADDA 2Q1ZB 4AEDA 2RJLA 1J58A 1LHNA 2J1RA 1RUD3 5C4WA 1PVXA 2Y34A 4YM2A 4LT5A 3X29B 3PJQA 5CBLA 2OZ6A 4LOSA 1Q3EA 4RGGA 1NLQA 3AXDA 1U5XA 4BISA 3D5OA 4H2AA 1RJ8A 2HWB1 3NJVA 5C3OA 2E32A 2KR2A 2W1QA 4XEZA 5C3RA 1OA3A 4BQ5A 2Y26A 5IFTA 4LIUA 5IWFA 1C57A 4YVWA 2EIBA 4ARYA 1RVF2 1UF2C 4GH4C 1MVEA 4Y20A 4CP2A 1FNYA 1S0JA 2VBDA 3KZ4C 3BKZA 2ADEA 2ZX2A 5F2WA 1K5MA 2XKOA 1OH3A 4E2QA 1OVPA 4MGYE 5LBFA 1LAJA 1PGL1 1OUSA 2RJKA 3KS7A 4XMIA 4NIGA 1RUI1 1AX1A 3NNFA 2XHKA 2FHRA 2D6PA 1S2BA 2H6BA 4XTMA 4UBGA 3L2HA 3B02A 3H9AA 4P00B 1HQNA 3WXPA 4HOOA 3R0RA 4XJUA 4NHMA 3RZLA 2ZBJA 2IZWA 2K9ZA 4AZZA 5FY5A 1Q5OA 1AX2A 3AYDA 3MPBA 3VBSB 5GZEA 1N3QA 2WS91 3PIJA 5A80A 4BH9A 4HL0A 4KWKA 1D0GA 3AMQA 2VMFA 3RGBA 5EYYA 1U5ZA 2XL7A 2YPDA 2ZAHA 1RL3A 3AM2A 1XBFA 2RM22 2RS31 1V6OA 4JDMA 4K8RB 3B93A 4M01A 4G9SB 4CCCA 3S5QA 5IYYA 4JTOA 2W1SA 4X8PA 3H7JA 3LPFA 4LK7A 4XZPA 4Y1XA 5IVYA 1EAH1 2D6MA 4ZXEA 3C7GA 5FY8A 5CISA 1UXXX 2BVVA 2ZPXA 1HIXA 1IGOA 3A0NA 1POQA 1UPIA 1XSQA 2PLV2 4IE4A 4OLLA 5JUVA 3VBUB 1PO12 1JHNA 4AQSA 1AJKA 2XH6A 3FBYA 4ZS2A 1PGW1 2W91A 3IDAA 4JV4A 3ZXDA 1HRI2 3OGVA 3ZYIB 5CIRA 3GCWA 1WUVA 5JXGA 3HPNA 3WNLA 4KNCA 4NROA 1YI7A 3RFRA 1HRV1 1AR72 3B69A 3EQEA 4KQ7A 1W03A 1MQTB 1MS0A 4BYYA 1YYNA 5F2SA 2HKXA 4EYUA 4WVVA 2GH8A 1IHMA 4B29A 1W90A 4QX3A 5JZGA 2PHRA 1T2XA 1O91A 3JD71 2WABA 3ES4A 1V70A 1DGLA 2HH9A 2VZUA 3OGGA 5DQ0A 4CEYC 2IVIB 4NO4A 2YUEA 3BOWA 3ZYBA 3ZYPA 1PX4A 3ES1A 3H50A 5A7QA 2D97A 2G9FA 5BNNA 4IETA 2CNAA 4Q5OA 1CZSA 1FMD1 1VAVA 3ILNA 1BQPA 3CBNA 4D6SA 2A1XA 1G9BA 1KFUL 4RFT0 3AVSA 3IZOA 4LJHA 3JU9A 4ZXKA 5FR3A 4UFIA 1RUH2 4B1LA 1MZ5A 2VVFA 1X36A 3SISA 5IVBA 4H3WA 4H55A 1NCQA 1JW6A 3LDBA 2ZA9A 3FLRA 4X8NA 4B4PA 2DWRA 2C9KA 1DBNA 1WZXA 4QDSA 1R083 1YO8A 3KLSA 4XJ9A 2VNGA 4BB3A 2AENA 3W21A 2WLPA 5D8AA 3LE0A 1LODA 2D43A 1NT0A 3I59A 2WIIB 3H1WA 1AR91 1SBDA 1FX5A 4L11A 1OF3A 3KD4A 3N7MA 4RSUA 3B5LB 3W58A 5B2GB 2YYOA 5LATA 4EN8B 3TEYA 5AVAA 1FYUA 4YYOA 1C28A 3ACHA 2BERA 2R6QA 3ELNA 3TB0A 3WF1A 1RUG1 1W6MA 3ACGA 1RITA 1Z0HA 1SLLA 4S2FA 5FZ8A 1AR61 2JENA 1J59A 1OQ1A 1YQ2A 5G04L 2XOMA 3H0OA 1ZYBA 2R061 1WMFA 1Y9QA 2A6YA 2JDKA 4AR2A 2WSVA 5JXIA 4BQWA 4AVBA 3LSEA 3OF1A 5I0UA 4HG6B 4JVAA 1R1ZA 3N9NA 4RQPA 3ZDVA 4IW3A 1CPMA 1JYXA 5AFEA 2A5ZA 3H1YA 3IAPA 4ORFA 1XNBA 3IWZA 2QVSB 1KJLA 1L3JA 2NPIA 1DFQA 1NAEA 2CAVA 3HN3A 3OGJA 4Q4W2 3J7NA 4UI9L 4XETA 3RJRA 1O59A 3MHZA 2YHJA 4AHXA 4XURA 3GHNA 4A6OA 4TTGA 2ZAAA 1UD1A 5BYNA 1XNKA 2GU9A 2VNVA 3QH7A 4YGCA 4MXVA 1ULPA 3WQ0A 3DKWA 3GM8A 1Y7BA 2J1SA 4LKSA 4GMP0 5EIYB 2NYYA 2RR13 2QTWB 2ZMKA 1J3RA 2IXIA 3FFZA 1XJAA 4L8QA 4RHV2 1H0BA 4CZSA 1PMHX 4MYEA 4W6XA 5F37A 1KD7A 2BV4A 3DUIA 1ZBE2 4QQHA 2LM3A 2ORZA 1ND2C 3MW3A 4Y1VA 4ES9A 3TN93 3VDDA 1QJEA 2DCJA 1NY72 1WLDA 3CJIB 4AVCA 1W3VA 1W6OB 4LBLA 5HPOA 3C3VA 4X6RB 2AC1A 3J8F1 5FMBA 3ZFFB 2ZX0A 1CAUA 4YZ1A 3E6CC 5KXDA 3N4MA 4URTA 5T52A 1R092 2WAOA 5FZ0A 3SITA 1T6GC 2LRPA 3IMNA 1COV1 4PIZA 4OZXA 4QX0A 4PQ9A 2Y0OA 3E1F1 1W2TA 1PIV2 1RMU1 4V2WA 4ATEA 2V5YA 1ZRRA 1GLHA 4N43B 5DN2A 1W06A 4GMP1 5HV4A 4DXSA 5FFOC 5KR7A 5BNPB 1E5HA 3FL7A 5C9AA 1Z7S2 3FBMA 3U4SA 3VBFC 4URAA 5JOZA 2WUHA 3B7MA 3I49A 2VULA 1H6YA 3ACLA 4LA2A 4QHBA 3C7FA 3N9QA 4Q2FA 2D6KA 1JU4A 4MVTA 2A3WA 3AJZA 3ROUA 2B5HA 4R4ZA 5FP3A 1LOBA 1H2NA 4DIQA 1RUF1 1JYWA 4YG3A 3HVDA 4MSVA 1TG7A 5HCAA 4QQPA 3M8LA 2W47A 4HK8A 2GALA 3ZN6B 1HDKA 3OY8A 1UCXA 4PDWA 4JGZA 4CDXA 4D7YA 3I97A 4UFKA 2PHFA 4LEJA 5LEJA 4AGRA 4YWAA 1PK6C 5HXMA 2BNMA 1VBC2 2CHHA 4IDZA 4Q4X3 1ONAA 3WEZA 1WGPA 2D3SA 4KBBA 3SKJE 3O1SA 5E8AA 1POV0 5I91A 4EWEA 1YIPA 3QLQA 1C8M3 4XQ4A 2BU9A 3R4DB 5C8CC 2R042 1GSLA 3JUUA 3N7LA 3ZIXA 3M1HA 3TRSB 1LCLA 1VE0A 1UX7A 2PQSA 3ZSJA 3PVNA 3ZYJB 1H9WA 4QPIC 2PHXA 1BVVA 4J1WA 5ANNA 2PHWA 2VPVA 5JXHA 5ISLA 4YM3A 5FAXA 4B1MA 4HVOA 5FPVA 1OOPB 1PZ9A 2A75A 2HWF1 1YFXA 4AYUA 2FDFA 2VJXA 5C71A 4EN7B 1RMU3 1SDWA 1CAWA 3MGUA 2PHDA 3UJQA 1AYN3 2F17A 3WW4A 4A7YA 1UU6A 1POV1 5IVJA 4MO3M 4NIHA 5BNOB 2P1BA 5CFCA 2BNOA 2JICA 3CO2A 3POWA 3VV1A 1ZVFA 2R0HA 3VKLA 4N53A 1A8MA 2UY9A 5T5PA 5J36A 5K7PA 1QF3A 2QQUA 1VMFA 5L19A 2Y60A 4KG0A 4M00A 3H3UA 1AR83 3BB6A 4HPKB 1RUF3 1DCSA 3GZUC 2RM21 4TLGA 3S7EA 3SC7X 1E57A 1S0CA 2PQQA 2WYSA 4BA6A 3AL6A 2J7MA 4BQ4A 1QKQA 3OPWA 1RHI3 4Y26A 3WVJA 1QJFA 2FDGA 3BPSA 2Y64A 2FZ1A 2ZGOA 1W6NB 2QQIA 2PYTA 3IBMA 4A3XA 2GC2A 3HD8B 4CU8A 1JU3A 3WUCA 1SPPB 4JGYA 4E8DA 1V0AA 3DECA 4IEWA 2PLV1 5JOWA 1A34A 1ZREA 4PI0A 4OFGA 1NOVA 1PO11 4XFBA 3JQXA 5AVPA 5FXXA 1YWKA 1S4CA 2D5HA 4WZFA 5ABJC 3JBG3 4D0QA 4UXAA 1RUE3 2JB4A 3NO8A 1QJU3 2YGLA 5LW9A 2B9UA 2FBEA 2ZMLA 5FZAA 1WLTA 3N9MA 4A6SA 1BLZA 3H7YA 4FO9A 4WVMA 4LORA 3ILFA 3E97A 1AR71 2EXJA 4XJZA 1WD4A 3FN9A 3PTRB 4FPGA 1RVF3 5FWEA 3I4IA 3GJBA 4CDWC 1CWPA 2FCVA 4ATFA 2DU0A 1VBA2 1S0EA 1BK1A 1VP6A 5FUPA 1CVNA 1CD3G 2P34A 2QQLA 1HV0A 2R073 4CDQC 5J37A 5FZ1A 2VUJA 3FLTA 2IUWA 1UYPA 3ZYHA 4YG0A 2JG9B 2F6BA 1X33A 1Z78A 5A3WA 1UAIA 3J26N 1YHFA 1XOYA 1TVGA 4ISQA 4QM8A 3AMHA 2WNUC 4JCKA 5DAWA 4W4ZA 2ID4A 5DZEA 4IL7A 3DL3A 3MIHA 3PUIA 1RUH1 4KH9A 3DYOA 3MIBA 3K46A 4XF1A 4XXPA 3B9IA 4GAZA 2RS52 2VNOA 1NZCA 1VB2A 4R9BA 4IEUA 1JMUB 3F2ZA 3LIGA 4JZRA 4W6WA 2PFWA 3FFQA 2XBO3 4D69A 2NZ9A 3M3QA 4QAWA 5A6YA 3OUIA 4IGQA 5FO7B 5J09A 1XYNA 5A7PA 5JSPA 4UW5A 2BFUL 2VTFA 1PO13 3WV6A 3AFKA 4P9WA 5FYBA 1YQ5A 2XVGA 3VBSA 5FK7A 1HRI3 2C9AA 3OEAA 1LHVA 1GP4A 5FZCA 1VBE2 2ZXQA 1VBD3 3T1LA 2L9LA 2VQUA 4ET7A 2Q8EA 1EP0A 2O8QA 2VW0A 2W9XA 2RS12 2X5IC 2A6ZA 5KWRA 2B9VA 3EHKA 5F3EA 5FYCA 4BE3A 1IOAA 2WFPA 1BHGA 4H7MA 2NMOA 2D44A 4HN1A 4DFSA 4YFZA 4ASLA 1EUUA 4K8FA 5FZ3A 4MLOA 1RXFA 4FP3A 2YPJA 3AKTA 4Q4W1 4M3CF 5F3IA 3VBUA 2OQ6A 3ZMNA 4CEYB 1HB2A 2WNEA 3MEPA 4CCEA 3SH5A 5J3UA 4FFGA 1PHMA 2BWCA 4UFMA 3GHMA 1NA1C 5I8SA 3AZXA 3VBRB 4FSJA 5JI9A 5LBEA 3K75B 1PVC2 4ZONA 3ZOIA 1MQTA 2C4XA 5LA9A 3CKHA 2XGXA 1PM4A 4NHYA 2DBNA 4RHV1 1JTZX 1N3OA 4HZFA 2FD8A 2PN5A 1EV13 1ZBE1 1UU4A 3POGA 3OG2A 4E2GA 1XE0A 4QB6A 2P3YA 4E4SA 2ARCA 3WLUA 3KHBA 3H8OA 1YRZA 2WT1A 4FFFA 2RE9A 2D3RA 2DUQA 4CA9A 5L9VA 2FDJA 1N1VA 4ONUA 5FLIA 5IK7A 3JZVA 3MIGA 4BQ3A 4NOTA 3WCRA 2VECA 1BJQA 1D7PM 4OHYA 1EAH2 3NAPB 1W8OA 4IV3B 1MZ6A 1SACA 5E89A 3RWKX 2BJSA 1PIV1 3PMSA 2J1UA 4HMZA 1WCUA 5LASA 4PF5A 3ZVXA 4BIOA 1Q56A 4I3GA 4YGDA 5BY5A 1UWWA 1TME2 3LEGA 1O8SA 3RYRA 3THTA 3EBRA 5APAA 2GP3A 2GN3A 3PUSA 2VZOA 1WMXA 1GOGA 3MO4A 1GNZA 2ZHKA 1ULCA 1G9CA 1UNBA 1WW6A 1RIRA 5B4XA 4DEQA 1NYWA 2VZVA 5I8TA 1CJDA 4WVWA 2WJSA 4QX5A 3PL0A 3VUOA 4MADA 4Q4W3 4AI8A 1HW5A 1U0AA 1YC61 5HCHA 3RNSA 4EROA 3E6BA 1UYYA 2VTXJ 1F15A 1GQHA 3JD72 2P6CA 4ZZ8A 1OFNA 5KHGA 3NNJA 3O1OA 5FLJA 4DUXA 2WO3A 2WRAA 5IK5A 1VBB2 3KGLA 1HB4A 2DDUA 4I0AA 4Y4YA 4IGPA 1FV2A 4XFHA 3ZSKA 3MFCA 1LECA 1VBC1 3KWVA 1DIWA 3TYJA 1C5HA 1FMD2 3CZUA 1YUDA 2F4PA 3OD0A 2OYZA 3B01A 2LALA 2QQMA 1MS4A 4I01A 3C7OA 2I74A 4FPHA 1ZBE3 3J7MA 1O4ZA 2R041 2R30A 3H8UA 1MPXA 3HNMA 4JQTA 3WY6A 5L36A 1AJOA 1JYTA 5DDJ2 5C7GA 5K0UB 3IAQA 3LA2A 5CYYA 1B35A 1BBT2 2VOTA 1DQ6A 3D6EA 3U4XA 2FCUA 3GZTB 2CGOA 2E51A 1ZRIA 3THCA 1X8EA 3LF7A 1R093 4QKBA 4Q0PA 1NCRC 1AR92 2TBVA 3KT4A 3P6BA 2HEWF 3R05A 3BUCA 3AJYA 2B46X 3LD8A 4RS5C 1H2MA 3I2OA 4QU1A 2IFRA 2Z4FA 4E9KA 1KFXL 1FNZA 3BTYA 1ND3C 3OYWB 3USUB 1XB9A 1SZBA 4JDOA 4S2GA 2Q30A 4AFDA 3VBFB 1Z7S3 3EB7A 5GZDA 4R9CA 5EXOA 5BPXA 5A7WB 3UKNA 3ZFGC 3UV9A 2R062 5J1XA 3AKQA 4BOWA 2GNTA 4LHSA 4GWIA 3WNXA 3ABZA 3BN6A 1V9U3 3CJIA 2ZEWA 2WA4A 1W0OA 1W6OA 1LOGA 2G9GA 3FE5A 5D2AA 1I9RA 1US3A 3ZFFA 3N7KA 2BYVE 2JB8A 3QD6A 2P5BA 3A4UA 1S0GA 3MI8A 2ET7A 4Q8KA 4AI2A 3ZN4A 2OXBA 2WT2A 3RG0A 3VN4A 4L97A 2BGOA 5JOXA 4RGKA 4E2SA 3DYPA 3ZFEC 3L2YA 1HQLA 2V09A 3IDBB 3JQWA 3SLIA 4YM0A 2VZRA 2BVBA 1OLQA 2GDFA 4N43A 4WM8C 3FZ3A 5J98B 2UY8A 5BNPA 4Q8LA 3OEBA 4Q29A 4IXLA 4LO4B 4A41A 1M06G 5J96B 3ORJA 1H4GA 4RFRB 3WW3A 4QGMA 1YQ8A 4XAAA 1N1YA 1W04A 4HVQA 2ARXA 2Z5WA 4S2HA 4JX0A 2B7YA 4YW6A 5C8CB 3QACA 3SCFA 5T5OA 2I45A 2R043 1EPZA 3OBZA 1GZWB 3IIIA 5J7MA 1NX9A 3WG3A 3BU0A 5LA2A 4DRVA 1BYHA 5LRRA 2XXZA 2CSGA 3VHPA 2JG8C 4AHWA 3R4SA 4P14A 3ZN6A 1HN1A 2VCBA 5DAPA 3THPA 3U75A 1YQ6A 4HKLA 3H8XA 2VZTA 3J8F2 3U1XA 2EALA 2XL9A 4AHZA 1HXS1 3DPRB 5FYIA 4A4AA 1V6IA 3AP5A 3IDCB 4YFWA 5IT6A 5H9QA 3PUAA 4Z8BA 2DTYA 5DABA 2W5FA 2WO2A 3M3OA 1XNAA 5E16A 4COYA 5CFDC 1B09A 3B3QE 3NNLA 1SLIA 5KHKA 4IEYA 4LBKA 4YPJA 1QJX3 2XLFA 1LGBA 1DQ0A 1NQJA 1X82A 3WW1A 3ZXFA 1FPN2 3KCYA 3ZIWA 2VOVA 2Q5TA 4BK5A 1OOPA 2Y6LA 1UOGA 1W2NA 2BW8A 1RC6A 4LHLA 2VNRA 3K3OA 4NUBA 4QHZA 5M0TA 2IXHA 3HBZA 2TUNA 2RMU1 3LA3A 5EHDA 1ZX5A 1DGRA 5LZ6A 5BNOA 1QJY3 2KXLA 1TMF3 4Y1UA 5LK7B 2VXJA 4PIXA 3D4KA 1JOPA 1OD5A 4AEDC 1YCIA 1FOD2 1GANA 1OD3A 1XNDA 4MGTA 1VRH1 1W6QB 4PBPA 1CESA 5EJ3A 1VBE1 3OBAA 5JI7A 1W8HA 3RZJA 4HPKA 5L7OB 2FCTA 3WR0A 1DLCA 1QQP3 3LEMA 1LHOA 2RS11 1RINA 2JE8A 3AC0A 1DGWA 5FPBA 2DFBA 1QJZA 2EVXA 1BZWA 4PBOA 2JECA 1W6NA 3I8TA 2QQPA 1SLTA 3BGAA 1VBA3 1DU3D 1SPPA 1Y9GA 4UAPA 3VZNA 1RUNA 2YGMA 3OOXA 4CDQB 5FZDA 5JIUA 4ARXA 1W8TA 1MEC3 1ENXA 2RJ2A 4YVWC 1QDCA 3MLKA 2K46A 1UN1A 5EJZB 3ZSEA 3MIFA 2WWJA 1JZ2A 2HWF2 2XMLA 1TNFA 3IPVB 1LEMA 1T6BX 3AP6A 3OUHA 2VXRA 3RMXA 5T5JA 2VUDA 4HETA 1H1IA 4WVZA 3WF4A 3WNMA 2KA3A 1I5PA 1FI2A 1PVC1 3AP7A 4YW1A 1CX1A 2G4IA 4AVSA 2RS53 3NKGA 4PLMA 1HN0A 1NUKA 2A73B 1W8FA 1GOHA 3LEIA 4IE0A 4YM1A 1GOFA 3P3NA 3SCHA 5C70A 2VMHA 1RUJ3 1IKPA 2ZZJA 4UBHA 5GLTA 2GC3A 2JEMA 2JG9A 3ZM8A 3I2FA 2LS6A 1ULDA 2GMMA 1J3QA 3PJYA 3MF9A 2OX0A 4JHZA 4J1XA 1QU0A 4XUPA 5T5LA 1QXPA 2A71A 1V6LA 2J42A 4HK9A 4AGGA 5DAQA 1SCRA 1V6KA 5CB7A 2YB7A 4AHYA 4QB2A 2HWE2 1UOFA 3ACIA 4XOGA 4N7IA 1LGCA 1VBE3 1TME1 1YIFA 3ME2A 1WLCA 2P17A 1BEV2 3VBOB 4YNIA 3S30A 3VHOA 5FO9B 2GNBA 3I2JA 2X5IB 3T0BA 2OUJA 2HWB3 1TQ5A 3ZR5A 2XVLA 3DN7A 5F5AA 5K8SA 1PM7A 1UW8A 2EIDA 2UYAA 1PMIA 4QGLA 1GMMA 3C7HA 1ZZCA 3TEZA 1H9PA 4FT8A 4ZKTB 4MH0E 3M3EA 3M3CA 4ASMB 4J6GA 4NE9A 1G6NA 5AFBA 1LHUA 2ZCWA 2SBAA 4CDUB 1VBB1 1RUI3 5FWJA 3UGGA 3URFA 2Z42A 1DGWX 4Q4Y1 4NN0A 3WDXA 3QH6A 4X6QB 2XDVA 4LR4A 3T09A 2YZ4A 3PURA 3O1VA 1HJGA 4PLOA 5FUNA 3U11A 1OMIA 1SCSA 2OA2A 4GULA 4EZHA 4ZZ5A 5I0RA 1QDOA 1W9YA 2JJ6A 3BU7A 4OUMA 4OMDA 3UL2A 4AF9A 1UZYA 4FI9A 1OVSA 3PMEA 5BNNC 5LB6A 4CCNA 4DUWA 1K42A 2WS93 1UMZA 3UESA 4A3ZA 3MLLA 5DDJ1 4OI0A 3APBA 1BXHA 1BBT1 4N9IA 4AQ2A 4CEYA 2RS33 1SFNA 2WZ8A 4R4XA 4QXCA 2NQYA 2ATFA 4GQ7A 3MPPG 4PF1A 2R1DA 3FUOA 3LOIA 2MEV2 2XJQA 1ZA4A 1SLAA 2D6NA 5D8AC 5LRSA 1EAH3 3GALA 5FPXA 1W99A 3VBRA 1ASJ2 3Q8FA 5T50A 2DUOA 3AL5A 4QM9A 5CG9A 4XBNA 4LA3A 4CP9B 1A78A 2UYBA 5CU1A 2YV8A 2YC2A 3RZHA 5FOBB 1EUTA 4GB31 1ZM1A 3WNPA 2E33A 4KWUA 1REFA 2WT0A 1DQ2A 3DGTA 5FTTC 5FYYA 5FZOB 4CUCA 3O1RA 2I2SA 4NPMA 2R7EB 2VM9A 1LESA 4XPVA 2VL4A 4Y3OA 1SFYA 1HRV3 4D7SA 1SFPA 1OT5A 1QHDA 2O8OA 2XJSA 4GZ9A 3USSA 3KV5A 1PZ7A 3BIEA 5EPAA 2XR4A 5T55A 1AVBA 2XJUA 4L0PA 2X05A 4B4RA 2JD9A 2Q1MA 2UWCA 2VG9A 3VGIA 1DQ1A 4RQPC 5F8PA 4HVRA 3NAPA 4IV3A 3VKOA 1S0DA 1JOBA 3ETQA 2E9QA 3PVOA 3WUDA 2DVAA 3JD73 2PAMA 5FYSA 4F7ZA 1HLCA 4LPLA 1W8NA 1B35B 1HB3A 2WQ4A 4MG2A 2BP6A 1W6PB 5E6HA 2K2SA 2R16A 2HEYF 2WNVC 4QPGB 5DPNA 5GJ6A 3RZKA 4XYXA 3WCSA 2P3JA 1F8VA 1OH4A 4TXWA 4INDA 4XHXA 3MV11 1FMD3 3HAGA 1RUC1 3RVHA 2XWJB 3BTXA 2DYCA 2GMEA 2XONA 3KT7A 4XJWA 1UZZA 4FPFA 3NWKA 1OC1A 1K12A 1OQEA 3NL1A 3WP4A 5CKMA 2CWMA 1O3SA 2W87A 2XG3A 5FDBA 1QNWA 2D6OX 4JAAA 3N36A 4CCLA 5FQ0B 1OF4A 1QH6A 1OURA 5DG1A 3N35A 3KT1A 4QXKA 5KXCA 2W1UA 3UT0A 1UQXA 2FQPA 2XJRA 1PO22 2FMYA 4Y4RA 4P02B 1AR93 3TAYA 4EWAA 3S57A 1V6MA 3VBHC 3SNMA 4DINB 3V56A 1AUYA 2DUPA 3Q8BA 1AYM2 4XDQA 1ND3B 1L7QA 1MS3A 4Z2AA 3K2OA 4IEVA 3QCWA 1GWKA 1RUG3 2CAUA 3LIHA 1AR63 4OHXA 1LOFC 1J84A 3I2KA 1MZEA 1G8WA 1URXA 2R063 3H1MA 4I0WB 2LW8A 4BHPA 1IS3A 1CPNA 1CIWA 2B42B 4LO5B 1CJPA 4CEWB 5K0UA 1ULEA 3POIA 5FMOS 4YZ2A 1LULA 2FZ2A 4RD7A 4E4ZA 5BV6A 3WF3A 4G3YC 5HXVA 1PMJX 5I0TA 1FPN1 1YFUA 2WSUA 3ZXKA 4AFMA 5ERLA 5C9AC 1D0HA 1REDA 4NIAA 1UKGA 1Q8PA 4QMAA 3ZFEB 4TSVA 5LEKA 3SKVA 4AFCA 1CONA 4XW3A 3WP6A 4LITA 4AVVA 4DO0A 3BPZA 4OULA 3OYWA 1JHJA 4LBQB 3USUA 4DOUA 1LENA 1RB8G 5JLVA 5A3MA 3KSCA 4JKMA 4NR1A 4SBVA 4XBLA 3VBFA 5IVFA 2OT7A 3WQBA 4I2OA 4CU6A 5A7WA 5LK5A 5JDBA 4Z92B 2OZJA 2ZGUA 1FOD1 5A6QA 1DZTA 2GNDA 3K4ZA 4WZCA 4E4DX 1WD3A 2RHPA 3GDBA 4JGZC 4PDWC 4CDXC 2AGSA 4TZDA 4QGNA 5AC92 4O7XA 3HJRA 2ORXA 1LU2A 4M4RA 3T0AA 3INAA 3LB9A 1VAMA 5FLHA 1R64A 4HN0A 3UYJA 1C5IA 2W92A 1JZ7A 1E5IA 1F2NA 1O4TA 3SCGA 1NQDA 3LGRA 3LKJA 1UZ0A 3ZPOA 3M3IA 2ZGKA 1VRBA 2O0OA 3L9JT 4LBJA 4FAGA 1WW7A 2VCCA 2Z79A 2EIEA 1WLWA 4K3UA 5FZEA 3J8F3 4V1PA 4XQDA 2NP0A 3ZR6A 2GZWA 3DKQA 4CUAA 4S2DA 3ASIA 4QU2A 2GAUA 1MS8A 3AMPA 3TEWA 1COV3 4XJAA 4XFGA 4META 4D8MA 3FWEA 2BGPA 3O1MA 5C8CA 2PA7A 4GMP3 2SLIA 5FBJA 1UZVA 5CFDB 1BMV1 1GZWA 4EQVA 5JIAA 5KXEA 1ACCA 2WZPP 1RGSA 5FZ4A 3LFMA 4Q0SA 4FFIA 1K3IA 4LE3A 4BIFA 5DMYA 5LY1A 2CGPA 3WQ7A 4A2UA 2J1VA 3RYKA 5CFCC 2G19A 2EAKA 4YGBA 1GNHA 4N53C 1GUIA 2E26A 2CWSA 2JD4A 5FZLA 2YBKA 1A6CA 1GV9A 1N1SA 1LU1A 4PJYA 4QPYA 3R6SA 3SEEA 3DPRA 1CZTA 4IEZA 4XABA 2JDHA 1MS1A 5FP7A 3VKFC 3NW4A 1OHFA 3GBGA 3C2UA 4OI4A 3T1MA 1GFF2 3CDZB 1VMJA 1AL21 2MNGA 5FREA 3K51A 3D3AA 5C8WA 5F5IA 2HWE1 1AZDA 3AYAA 4HKOA 3V64A 1ZZ6A 2P4EA 3PHMA 4JGYC 3DV8A 4ZPIA 1H8VA 3ZSLA 2XQXA 1BEV1 4K1ZA 4A7KA 2ARBA 5GLZA 1QOOA 3OPTA 1X7NA 1XNCA 3THDA 5A7NA 2LROA 4A44A 1DGRN 1XU2A 2ARAA 4DZGA 2YDEA 3N9OA 4DY3A 4ES8A 5LBBA 1JUHA 4GH4B 5A32A 2FDKA 4FTBA 3DXUA 5FYMA 1EYBA 1JXNA 1W2AX 4AE2A 1M4WA 4CXXA 2CGNA 1Q8QA 2MHFA 1QXRA 3CMGA 2BUKA 2HWF3 4KMQA 5I93A 3K4AA 4AEJA 4BLJA 3NMBA 1SG3A 1RUD2 1W6QA 3VZMA 5DUXA 3NJXA 1GZCA 1APNA 3HBKA 1HXS2 4YARA 4CCDA 3J7LA 5L7OA 4LUMA 3F95A 4HSJA 4N90A 5FYZA 3K4DA 3KCCA 4ZY9A 4LBQD 1POV3 2VZPA 3ZN5A 4QQOA 1WKYA 1W9FA 2AREA 2VW2A 4M0NA 4QX1A 4UW3A 5HI0A 3WG2A 3TNPB 4HBNA 4GJZA 4SLIA 3ATGA 4C0HA 2B39A 2IXJA 3WNKA 3OBRA 4D6RA 4OI1A 3CEWA 4CDQA 1XE7A 4JRLA 2RM23 1H1MA 4C0BA 3VHNA 1BKZA 1GP5A 4C8DA 4QQ2A 2FMDA 3IPVA 4P9YA 4QXHA 2DU1A 1W8WA 2MEV1 2YBSA 4CCMA 4MXWB 1H1AA 1JZ5A 4YW3A 2Q0AA 4K9SA 4QHOA 4FOQA 1WMEA 4IGOA 2VUAA 4LKDA 1ASJ1 2ZMNA 2RMU2 4BXSV 2PLV3 1SLCA 2Q8DA 2EIGA 4FPYA 3ZO0B 5KXBA 4AWDA 4XE9A 2VBBA 1OBNA 1STMA 3TNQA 2W0XA 3POFA 1LNSA 3NNMA 4Q0QA 1BCXA 1FXZA 1VRH2 3ST7A 4COZA 1LOAA 4K1YA 4JTNA 4MHRA 5JOYA 4OCTA 5FY9A 3T4HB 2Y6GA 1AR73 2WFF1 3J9SA 3CJXA 4PIYA 2BZDA 3UKVA 1NLSA 1WCSA 2QE3A 5FUIA 3CLPA 3RS6A 4UFHA 4Q26A 2ZHNA 3CIHA 4DEVA 1ZBA1 2Y8KA 5FMCA 3ACFA 4BPZA 1S1AA 5CKQA 1E5RA 4DXTA 2VO5A 3VBOA 5DUVA 3UGHA 2X5IA 3LA7A 2VR4A 1XC6A 2DCKA 4OHWA 1HKDA 2AUYA 4CYDA 1L7RA 5ACA1 2P3IA 4CUGA 1RUH3 4B8EA 3PUQA 1OI6A 4XHBA 1SBEA 3VDBA 2BPA2 3J7HA 2WLQA 3D82A 5IK4A 2R0FA 4RR3C 5F1RA 1LKNA 4Y1ZA 1MQTC 4BQ2A 1OLRA 4CDUA 4CXYA 1PO21 3KHCA 3A22A 1DQ4A 3I2GA 4Y5TA 2O1QA 2YG0A 4IQPA 4R8HA 3AK0A 3VZKA 5HV0A 1AYM1 2XVKA 4HSLA 2E63A 2ZGTA 3LOBA 3SH4A 3RQ0A 3Q9OA 2H6CA 3O0VA 2WN3A 1JBCA 4WM7C 3PU8A 3ZX7A 1O3QA 2HYXA 2WO7A 1JZ4A 1JYVA 1OPOA 1TZOA 5D21A 1CGPA 2Z69A 5EZWA 4CU7A 5BNQA 4H7LA 4XCAA 2VH9A 4DRRA 1WBLA 1X9TA 1AF9A 2CY6A 2D3PA 4K6BA 5H9RA 3FMGA 3ILRA 1LJ7A 5FIXA 4E8CA 1S2EA 2I07B 1R082 5FZKA 4CCKA 3VZJA 3BVCA 3U37A 2QNKA 1QGLA 1AXYA 2DCYA 4KWJA 4Q4V1 2D93A 4B4QA 4ZU4A 5KHIA 4XXAA 2Q4SA 2NM1A 3EO6A 4YSFA 3OUJA 4LKEA 5CKNA 3PVBB 1XU1A 1S0FA 4CP9A 3MDPA 5A33B 1IS6A 3KQ4B 1F35A 3OGRA 4FPLA 3POYA 5A6XA 3WOGA 3BCWA 2WNVB 2HWD2 4LK6A 4XAEA 2D98A 4GWJA 4GJYA 4H14A 4XF3A 1EY2A 5E1RA 5FZOA 5H9SA 3U78A 4DXZA 3BTZA 1ZA7A 3K3NA 3VHRA 1D4M1 4Q4Y2 2J22A 4CP1A 4P9IA 2ZX3A 4KGGA 4XTPA 3MUZ1 4YW7A 2VMIA 4BLIA 5AC91 5IATA 1D4VB 4LTAA 5A1LA 1H4HA 1LOEA 2HYKA 3AKRA 1NZIA 4RHV3 3OB8A 2XKPA 2RV9A 2GC1A 3EJKA 1ND2B 2YXSA 5CNAA 1XQNA 4IV1C 4ZS3A 1GZ9A 2JKBA 3FUQA 2GC0A 4XUNA 2VMGA 5FKCA 3VBHB 1W6PA 3CL1A 2ZS6B 2DF7A 4L92A 2FDIA 4QPGA 3W9AA 5C33A 1JZ3A 4COUA 1IPJA 3PLQA 3POBA 4I3PA 4XF9A 4AI0A 3NVCA 1UIJA 4LOTA 1J3PA 1Q8SA 5FY1A 2XWBB 1PIV3 2VBPA 3GZEA 2PTMA 4L2NA 2VOXA 4COWA 1GU3A 3CU7A 1ALYA 5JVVA 3WINE 4IESA 2VCAA 4XUTA 1XYPA 2AZ5A 4CRQA 4R52A 3OTFA 4GB32 5JPMB 4I0BA 3IT8A 5FQ0A 1R1A1 1CAVB 4YVSC 2E7AA 3D8CA 5A1FA 2KM2A 5KC6A 3WP3A 5FYVA 4AL9A 3TN92 4GD4A 4NRQA 1UPSA 3GF6A 4XUQA 5SV8A 3KV4A 4YW4A 4YGEA 5A70A 3AP4A 1ND3A 2TEPA 3AKSA 3MW2A 5CAZA 2ZZQA 2YY1A 1RYYA 4N8MA 2QKDA 2HWC1 4QX2A 3VD7A 4PCRA 5FZIA 2D7FA 3MICA 2ZKNA 2JDMA 3I2HA 4QB1A 5A3OA 5K4LA 4BMEA 3ETPA 4YZ3A 4CEWA 2X53S 3RMYA 4NRPA 1OUXA 1H6XA 1PK6B 1W3XA 2BDRA 2OVUA 4FFHA 4NHXA 3BIWE 3HQUA 1Q8VA 4LO7A 4N43C 1W05A 1IQDC 1VBC3 4UOJA 4GWNA 4BK4A 5CG8A 3KVBA 2DBIA 3T2OA 5FBZA 4AAXA 3K48A 2ZEZA 1RUC2 1SEFA 2YROA 1UU5A 2WZR1 4LULA 3GZAA 4NHKA 3S5AA 1C4RA 3ZFEA 4BQ1A 2UWAA 1IG0A 3DXTA 1IPKA 2WN2A 4ISRA 4P5YA 3JB4C 3KVAA 3I3MA 2F4LA 2VY0A 2Z2SB 4A45A 3WHUA 2VD7A 4C90A 3UNPA 4XACA 2XLAA 3N9PA 4LBQA 5FZGA 5J48A 1DHKB 1ULOA 2VOKA 1PX3A 4DQAA 1Y9MA 3E6DA 4QPIB 2ZGMA 1AX0A 1CAXB 1QH7A 3SQOA 2W39A 4KWLA 3Q8EA 2ZOEB 1ZRCA 1RUD1 4R9DA 3NKTA 1W2OA 1WCDJ 4C1XA 3POSA 1UX6A 5JSOA 1PZ8A 1SBFA 4LBMA 1NKGA 1WBFA 4COVA 4M4PA 4Q4X2 2IXCA 2H0BA 4LXLA 2VMDA 2A6VA 5F3CA 5JWPA 1RXGA 2VTXA 2VQTA 3HN1A 2VQ0A 3HWJA 1KXGA 2E6VA 4CSWA 5C3SA 1H8TC 1C8M2 4LUKA 4YZ4A 1BVP1 5A3LA 3HOBA 5IAXA 3MFAA 1BK0A 4IEQA 5FPAA 4MGZE 2Y33A 4QWNA 3TWIA 3W20A 2B45X 5BXXA 1V00A 1DF0A 3ITQA 2CYFA 1ZZ7A 4LO6B 2Q8CA 4HANA 3BALA 2JDAA 3GBWA 2GH2A 2EICA 4HLTA 2VOWA 4JHTA 5FRAA 1KDKA 2WQ8A 3ZKYA 2XHNA 4M0HA 3WG1A 3ZSMA 4XCBA 5CFDA 4AVAA 2DVFA 5EWSA 2JWPA 3KQRA 1D2SA 2PELA 2VZ3A 4XUOA 2WYFA 2ZKLA 5A32B 1OQDA 2NN8A 1IS5A 2ETEA 4OVEA 1DZQA 4XILA 5ABJB 3WQ1A 4PI2A 1VALA 1YJLA 5BNOC 4BQXA 3HT2A 4NRMA 5C3QA 3FHIB 2QDRA 4BQYA 2VU9A 5B4NA 3IM0A 4Y22B 3D0SA 5C4WC 4FTEA 1GICA 1L7LA 2YBPA 4JQRA 3J4UH 1AXKA 2G1MA 3IN9A 3I2DA 3AB0A 2GP5A 1AR82 2XUMA 5G05L 1F31A 3HQXA 3R4UA 1WW4A 4CDWB 3BODA 4QKFA 1ZZ9A 1U12A 3H42B 1N1TA 4QT6A 1YQCA 2J1TA 4MOAA 1KGYA 4FPCA 1HXS3 2DCZA 1C8NA 2Y6KA 1US2A 4GALA 4OHVA 3GXUA 2IXLA 2O14A 3PVEA 1AL0G 4LMFA 4AI1A 2WNUB 3JBG2 1KRIA 1RUE2 1QJU2 1K5MC 2QQNA 4K21A 2D6LX 5JR7B 1VJ2A 4Y33A 4Y5Z0 1BMV2 3PIGA 5LCWL 2WWUA 3O1PA 3CF6E 4QDRA 3OCPA 5F5CA 3JB8A 4GH4A 1Q8OA 2OW4A 5F39A 2OIIA 3WX5A 1O3TA 5D1IA 4YLZA 3ON7A 5TSWA 4Q1RA 3ZXEA 4XC9A 5FV3A 3LDKA 2C6SA 1LGNA 1QEXA 1YNAA 3FHAA 4IE7A 1MR5A 2ZGNA 1JUIA 3WF2A 2W52A 3VD5A 5BUVA 2R072 4XMAA 4UFJA 5EQUA 2JDPA 3AXEA 3ZYRA 4I02A 2RMU3 1DYOA 4P9JA 1XRUA 2JG9C 3B00A 4QDQA 2CDPA 4DPNA 5FK8A 2JDZA 2WDBA 1F5JA 1XNTA 4E4HA 2WAAA 1AL22 2ZGSA 2BTVC 4IEPA 4RL7A 1UMHA 5I0SA 1X8MA 2Q8OA 1VRH3 4JDNA 3VB9A 2QQJA 5F6KA 4B7KA 1F5FA 1CR7A 4FQZA 4GWMA 4XFAA 4CCJA 2JKXA 2RS13 2RVAA 5GZGA 4O9EA 4OQ9A 1R081 1CZVA 1ENSA 2XBO2
chains in the Genus database with same CATH topology
3ZXJA 4MXWA 5HCFA 3QOPA 2IXKA 2ES3A 2ZGLA 1U5YA 3ALQA 2ZX1A 4C1WA 1TE1B 3GBFA 2ZTNA 3I7DA 4RA0A 2LUWA 2HWD1 1TEIA 5JZGC 4Z1VA 1MS9A 1NA1B 5F5QA 4AFBA 1JN2P 2AR6A 1ENRA 1PVC3 1VBD2 1YI9A 3G6JB 2XJTA 4HKWA 1C1FA 4LLFA 4RR3B 3O7OA 5KBFA 5T3NA 2ZJCA 3T2TA 2AYHA 1O5UA 3V0BB 2EF6A 1FAYA 3SHRA 1NCQC 2EXHA 2VQAA 1I6XA 2DURA 1QY4A 3D0JA 3ECQA 3S6PA 5FMOL 1MZFA 3BOPA 1ZNPA 1OA2A 2QUOA 1MS5A 4WM7B 5T54A 3KMHA 3WZ1A 4DS0A 3AX4A 3VBRC 1TME3 2UURA 1G86A 4EV0A 2RR11 4Q0UA 1EPWA 4EJRA 5F9TA 1FATA 1XE8A 3ZMOA 1ENQA 1W39A 4XFIA 4FCAA 4C91A 1DZRA 1EV12 1GR3A 2PHTA 3RZZA 4EN0A 2NP0A 3TN91 3I54A 2LTNA 2WFF2 1LR5A 3V0AB 1OSGA 5JCTA 5GLVA 5GZFA 2C5DA 1VIWB 4PLNA 1DG6A 5JPNB 2ZGRA 3WDVA 3U0ZA 2D5FA 2HWD3 3RYPA 3JCIA 3NAPC 1ZBA2 4IV3C 1VBB3 3AYCA 1RUOA 2ZHMA 3O5SA 4Q4Y3 3GNEA 3AYEA 1YFWA 1ZZ8A 1SQ4A 1S0IA 3P3PA 3MF6A 4XFFA 4I30A 1J1LA 3O0XA 2XJVA 3AFGA 4BM8A 4LHNA 5ACA2 2WQZC 1DDLA 4FTSA 1YLLA 4IV1B 3KM5A 3RRDA 5DDJ3 3ZXAC 3ZXLA 1BBT3 1V6NA 5A33A 2D40A 4GIQA 3UKTA 2WNVA 4AQTA 2BWAA 4M3CE 1NCRB 1I1EA 1A3KA 4HFSA 4RS5B 3VDDC 3LSDA 1DLLA 4BCUA 2E7TA 2C1FA 2BBVA 4GKYA 3OD4A 4Z82A 1LRHA 2VW1A 4Q4X1 4GB33 2A6XA 2ZX4A 3GYDA 3ZFGB 3M70A 2QZ3A 1ND2A 4YVSB 3NV1A 1C8M1 4MX3A 3M7AA 1XYOA 3OJBA 3OPZA 2DV9A 3VBHA 4G4FA 1LHWA 1NE6A 2QJVA 5K0UC 3QBQA 3LCPA 3AKPA 4QQLA 1ZRDA 4Q4V2 1VB4A 3B94A 1LOFA 2JE7A 5GLWA 4WM8B 4EN6B 1H2KA 1O7FA 4NVPA 1YFYA 3WT3A 4A7ZA 4YW5A 1H2LA 4BZ4A 2XPJA 1AYN1 3E5QA 1CAVA 3IKWA 2CL2A 1UKRA 1D4M2 1RUC3 4U36A 4AW7A 1G7YA 3E5XA 4LE4A 1NG0A 2Y38A 1V9U2 4LBOA 4FXGB 1KJRA 1DQ5A 1AR81 2JG8B 1IZ3A 3WW2A 5GLUA 1RHI1 5JAXA 2IFWA 1PK6A 4P9LA 3B9CA 3WG4A 4M3CB 1VLNA 1WW5A 4IEXA 2A6WA 4XF4A 2IWGB 3JBG1 2K0GA 4W6YA 1RUE1 4W65A 1QJU1 1H8TB 2GMPA 5CADA 2UWBA 3IIAA 2WL1A 4DY5A 4KU8A 3DF0A 1IS4A 5FPZA 1ZRFA 1CQ9A 1R1A2 1ULFA 4QPIA 1FPN3 4D3WA 1CAXA 3U10A 4FAHA 1RVF1 3MW4A 5DZGA 2XLGA 1LOCA 3ZXGA 2IC1A 1FT9A 3AMMA 2R071 2ZGQA 3NV4A 2BQPA 2HWC2 1CX4A 1GBGA 3DPRC 4P5HA 4AGVA 1I5ZA 4AEDB 3VLBB 4UW6A 4HT1T 3TBDA 3W59A 4CTEA 3V65A 1FOD3 3WDTA 3O14A 5KHHA 5DG2A 3N3HA 4NWWA 5C4WB 2YMZA 1Y43B 1JOJA 3AZZA 1QJX2 4TLFA 4Q0VA 1JYCA 2WZR2 1X50A 4AEKA 3M2MA 2XBO1 5DUUA 2MPFA 4FXKB 3HR9A 5JSRA 2VGDA 1N47A 2ZHLA 3AZVA 4NWVA 3N7JA 4YVWB 4FVVA 5ABJA 4GKXA 4Y20B 1QJY2 1HV1A 1TMF2 4XF0A 1YXWA 4TYSA 4F3JA 1FV3A 2GSYA 1K5MB 1HRI1 4Y22A 4EN9B 2Y0IA 3VL8A 1VBD1 2XB6C 4Q1PA 1GYKA 5L7OC 1QQP2 3VZOA 1VAKA 4CDWA 3O0WA 2DVBA 3FJSA 3LZZA 3RWNA 2A70A 2DVDA 3VKNA 3MYXA 3WDUA 2H0VA 2P3KA 5EV7A 1MEC2 4P9XA 4KG8A 2QZ2A 2WNUA 4FPJA 3LAGA 2HJIA 1AL23 4OHZA 1OFSA 2HWE3 5DZFA 1AXZA 5H9PA 3SH3A 3WDWA 1V6JA 1BEV3 3VKMA 1OA4A 1QOTA 5IK8A 1PNFA 3VBSC 5JMCA 3TOJA 3ENRA 1PNGA 1EV11 4Y1YA 1RUJ2 1DYPA 1TNRA 5EFUA 2W08A 4FP2A 1AHSA 1WCKA 1WA4A 4B7EA 2EXIA 4LBNA 3RPQA 3VL9A 3U07A 3ZYGA 2ZACA 2OUHA 4GXLA 2BNNA 4UW4A 4D94A 5JZGB 1QNYA 4FQ4A 3A0KA 1QMJA 1G9DA 2WWSA 5HCBA 4I09A 3VBUC 3NV2A 1S55A 4OI2A 1J1TA 4ZU5A 3VBOC 1RTVA 3WDYA 4FBFA 2N7GA 2C0ZA 1UL9A 5BNNB 2HWB2 2GNMA 2A7AA 3UJOA 1HQWA 1UIKA 1A8DA 2EAAA 2WC2A 3NJZA 4QD2A 1NXD1 2E7QA 1NCQB 4IERA 1SMVA 2GN7A 4YG6A 2V73A 3AP9A 1NXMA 2MEV3 1NA1A 5D8AB 2QCSB 2R49A 4DMIA 1PGL2 4RGAA 3I59B 1ASJ3 1RUI2 5DXDA 4LLOA 4CDUC 2QFEA 5F6LB 5L73A 1H30A 4NHLA 1IKQA 4CP0A 4XBQA 5KHJA 2ZGPA 3KGZA 4RR3A 4N7UA 1W6MB 4FOYA 2A3XA 1MVQA 3NV3A 1DYKA 4L9BA 2WS92 3V0BA 2PAKA 2DVGA 4FOWA 3SXWA 1YJKA 4LO8A 3RDIA 1NY71 2WFF3 5CVRA 4AXOA 1NLRA 2RS32 4KU7A 2X29A 1MACA 4RQPB 4XFCA 2VVEA 1JH5A 4WM7A 1R091 3S7IA 1KS5A 3VZLA 5E88A 4Z07A 4P9GA 2B8MA 1ZBA3 4GA9A 4MGKE 4WV8A 2HEVF 2R1BA 5C6CA 2A3YA 4OUSA 2TNFA 3WD5A 1PGW2 1Z7S1 3AMNA 4K40A 3BTAA 5ACA3 3UK9A 1JYIA 4AQ6A 4KL1A 1D2QA 2ET1A 1V9U1 1Q43A 2BFUS 3V0AA 1HRV2 4BMBA 4FPEA 4YW2A 2ERFA 1SLBA 4E27A 2CTVA 5GKAC 4R9AA 4XIKA 3SMHA 5GZCA 1PO23 4O9GA 3CNAA 1KDMA 3NSTA 3VDDB 2XJPA 3E5UA 2WINB 4AEMA 2VVDA 5DUWA 3RSJA 2ZABA 4IEOA 1B35C 1AYM3 1RJ7A 4MV2A 4AVTA 3M4FA 2PAEA 1CAUB 3FLPA 4QPGC 1XXNA 2JX9A 1QWRA 3AZWA 2EXKA 5FOJB 4LHKA 3MZHA 4MZUA 5SV5A 1C3HA 4IV1A 4WBBA 3HT1A 1C1LA 1KQRA 2RR12 4Q27A 3ZPYA 1O3RA 2AH2A 4MGIE 5C9AB 3WHTA 1REEA 4U2AA 4XJ8A 2R32A 1NCRA 5I8YA 4Y24A 1GQGA 4Q4V3 4RS5A 1CN1A 4XIOA 3CJIC 1S2KA 2BEOA 4LNVA 3MLJA 3ZFFC 4AI3A 1RUG2 3ZFGA 2CV6A 3FX3A 4YVSA 1AR62 1D4M3 4FPOB 4FPKA 3KCXA 3EXUA 3OY8B 4PDWB 4CDXB 4JGZB 4CEWC 5AC93 5BNPC 2PHLA 2ILMA 1G9FA 1QJX1 1VR3A 3HIFA 4K7JA 4DB5A 1F9KA 4JC1A 5HBAA 1I3HA 3LWCA 4NPRA 1O5LA 4WM8A 4XQWA 2DFCA 2NLRA 5K9YA 4AK3A 5KC5A 4ZU7A 2DCTA 1OKQA 2PHUA 4Z2WA 4N9HA 3ZDSA 3S0MA 3RI8A 3O12A 1QJY1 1TMF1 3MIDA 1IQAA 2WKKA 1G9AA 3H3ZA 4AG4A 3MIEA 5IUQA 1OPMA 2ENRA 1LB2A 2QDNA 1CAWB 2P2KA 2OPKA 2X8KA 1ULGA 3OBTA 5FO8B 5CA6A 2JG8A 1QQP1 1QXJA 1W2UA 2UU8A 1QOSA 1R1A3 2WA3A 1O4YA 3RJ2X 5CFCB 1PGSA 2P37A 2BGCA 3PTYA 4N53B 4L99A 1U5IA 1VBA1 1KS4A 2JXAA 3FC0A 3PNAA 4M3CA 4BWOA 2W68A 5EYXA 1W0PA 4F8AA 4MUVA 4FOVA 1MEC1 2HWC3 3KB5A 2YC0A 4YRDA 5GALA 4AFAA 1COV2 1OOPC 1H8TA 1WMDA 3RI9A 4DNYA 1RMU2 5GM0A 4TWTA 4D7TA 4JGYB 1AYN2 3G7DA 1KITA 4EWDA 4JRAA 1HX6A 2RS51 2WZR3 1LEDA 4KGQA 2EA7A 1Y3TA 3WP5A 4YZ5A 1RUJ1 2DTWA 2JE9A 3IDEA 4K20A 4F83A 4WVMB 4B3NA 1LTEA 3HMYA 2E53A 3AZYA 4ITCA 1RUF2 1ZZBA 1GKBA 5FCCA 2NMNA 1RHI2 1NE4A 1S0BA 1N3PA 4AEDA 2Q1ZB 2RJLA 1J58A 1LHNA 1RUD3 5C4WA 1PVXA 4YM2A 4LT5A 3X29B 3PJQA 5CBLA 2OZ6A 1Q3EA 4RGGA 3AXDA 1U5XA 3D5OA 1RJ8A 2HWB1 4XEZA 1OA3A 2Y26A 1C57A 4YVWA 1RVF2 1UF2C 4GH4C 1MVEA 4Y20A 4CP2A 1FNYA 1S0JA 3KZ4C 2ZX2A 1K5MA 2XKOA 4E2QA 4MGYE 1PGL1 2RJKA 4XMIA 3KS7A 1RUI1 1AX1A 2XHKA 2FHRA 2D6PA 1S2BA 2H6BA 4XTMA 4UBGA 3L2HA 3B02A 3H9AA 1HQNA 3WXPA 3R0RA 4XJUA 4NHMA 2ZBJA 2IZWA 2K9ZA 1Q5OA 1AX2A 3AYDA 3MPBA 3VBSB 5GZEA 1N3QA 2WS91 4BH9A 4HL0A 4KWKA 1D0GA 3AMQA 5EYYA 1U5ZA 2XL7A 2ZAHA 1RL3A 3AM2A 4JDMA 2RM22 2RS31 1V6OA 3B93A 4M01A 4G9SB 4JTOA 4X8PA 3H7JA 4XZPA 4Y1XA 1EAH1 2D6MA 2BVVA 2ZPXA 1HIXA 1IGOA 3A0NA 1UPIA 2PLV2 4OLLA 3VBUB 1PO12 1JHNA 4AQSA 1AJKA 2XH6A 3FBYA 1PGW1 4JV4A 3ZXDA 1HRI2 3ZYIB 5CIRA 1WUVA 4KNCA 1YI7A 1HRV1 1AR72 3B69A 3EQEA 4KQ7A 1MQTB 1MS0A 4BYYA 1YYNA 2HKXA 4WVVA 2GH8A 1IHMA 4B29A 5JZGA 2PHRA 1O91A 3JD71 3ES4A 1V70A 1DGLA 3OGGA 4CEYC 4NO4A 2YUEA 3BOWA 3ZYPA 3H50A 3ES1A 5BNNA 2D97A 2G9FA 4IETA 2CNAA 1FMD1 1VAVA 3ILNA 1G9BA 1BQPA 1KFUL 4RFT0 4ZXKA 3JU9A 1RUH2 1MZ5A 2VVFA 1X36A 3SISA 4H3WA 4H55A 1NCQA 1JW6A 4X8NA 2ZA9A 3FLRA 4B4PA 2DWRA 1DBNA 1R083 1YO8A 3KLSA 4XJ9A 2VNGA 2AENA 2WLPA 5D8AA 1LODA 2D43A 3I59A 2WIIB 3H1WA 1AR91 1SBDA 1FX5A 4L11A 3KD4A 3N7MA 4RSUA 5B2GB 3B5LB 3W58A 2YYOA 4EN8B 5AVAA 1FYUA 4YYOA 1C28A 4ZKTB 2R6QA 3ELNA 3TB0A 1RUG1 1W6MA 1RITA 1Z0HA 1SLLA 4S2FA 1AR61 2JENA 1J59A 1OQ1A 3H0OA 1ZYBA 2R061 1WMFA 1Y9QA 2A6YA 2WSVA 4AVBA 3LSEA 3OF1A 5I0UA 4JVAA 1R1ZA 4RQPA 1CPMA 5AFEA 2A5ZA 3H1YA 4ORFA 1XNBA 3IWZA 2QVSB 1KJLA 1L3JA 2NPIA 1DFQA 2CAVA 3OGJA 4Q4W2 4XETA 3RJRA 2YHJA 4AHXA 3GHNA 2ZAAA 1UD1A 5BYNA 1XNKA 2GU9A 3QH7A 4YGCA 4MXVA 3WQ0A 3DKWA 1Y7BA 4GMP0 2NYYA 2RR13 2ZMKA 1J3RA 2IXIA 3FFZA 4L8QA 4RHV2 1H0BA 4CZSA 4MYEA 4W6XA 1KD7A 4QQHA 3DUIA 1ZBE2 2LM3A 3MW3A 1ND2C 4Y1VA 4ES9A 3TN93 3VDDA 2DCJA 1NY72 1WLDA 3CJIB 4AVCA 1W6OB 4LBLA 3C3VA 4X6RB 3J8F1 4YZ1A 3ZFFB 3E6CC 2ZX0A 1CAUA 5KXDA 3N4MA 4URTA 5T52A 1R092 3SITA 1T6GC 3IMNA 4PIZA 1COV1 4OZXA 4PQ9A 2Y0OA 1PIV2 1RMU1 4ATEA 2V5YA 1ZRRA 1GLHA 4N43B 4GMP1 5FFOC 5BNPB 5C9AA 1Z7S2 3FBMA 3VBFC 5JOZA 3B7MA 2VULA 3ACLA 4LA2A 4QHBA 4Q2FA 2D6KA 3ROUA 4MVTA 2A3WA 3AJZA 2B5HA 4R4ZA 1LOBA 1H2NA 1RUF1 4YG3A 4MSVA 5HCAA 4QQPA 3M8LA 4HK8A 2GALA 3ZN6B 1HDKA 3OY8A 1UCXA 4PDWA 4JGZA 4CDXA 4D7YA 2PHFA 4LEJA 5LEJA 4AGRA 1PK6C 2BNMA 1VBC2 4Q4X3 1ONAA 1WGPA 2D3SA 4KBBA 5E8AA 1POV0 5I91A 4EWEA 1YIPA 3QLQA 1C8M3 4XQ4A 3R4DB 5C8CC 2R042 1GSLA 3JUUA 3N7LA 3ZIXA 3M1HA 3TRSB 1LCLA 3ZSJA 3PVNA 3ZYJB 1H9WA 4QPIC 2PHXA 1BVVA 4J1WA 2PHWA 2VPVA 4YM3A 5FAXA 4HVOA 1OOPB 1PZ9A 2A75A 2HWF1 1YFXA 4AYUA 4EN7B 1RMU3 1SDWA 1CAWA 3MGUA 2PHDA 3UJQA 1AYN3 3WW4A 4A7YA 1UU6A 1POV1 5BNOB 5CFCA 2BNOA 2JICA 3CO2A 3POWA 3VV1A 1ZVFA 2R0HA 3VKLA 4N53A 1A8MA 2UY9A 5T5PA 5J36A 5K7PA 1QF3A 5L19A 4KG0A 4M00A 3H3UA 1AR83 3BB6A 4HPKB 1RUF3 3GZUC 3S7EA 2RM21 4BA6A 5BY5A 1E57A 1S0CA 2PQQA 1QKQA 4Y26A 1RHI3 3WVJA 2ZGOA 2FZ1A 1W6NB 2PYTA 3IBMA 4A3XA 2GC2A 3HD8B 3WUCA 4JGYA 4IEWA 5JOWA 2PLV1 1ZREA 4OFGA 1NOVA 1PO11 4XFBA 3JQXA 5AVPA 1YWKA 2D5HA 4WZFA 5ABJC 3JBG3 4UXAA 1RUE3 3NO8A 1QJU3 2YGLA 2B9UA 2FBEA 2ZMLA 1WLTA 3H7YA 4FO9A 4WVMA 3ILFA 3E97A 1AR71 2EXJA 4XJZA 1WD4A 4FPGA 1RVF3 3I4IA 4CDWC 4ATFA 2DU0A 1VBA2 1S0EA 1BK1A 1VP6A 1CVNA 1CD3G 2P34A 2R073 1HV0A 4CDQC 5J37A 2VUJA 3FLTA 4YG0A 2JG9B 2F6BA 1X33A 1Z78A 1UAIA 3J26N 1YHFA 4ISQA 4QM8A 3AMHA 2WNUC 4JCKA 5DZEA 4IL7A 3DL3A 3MIHA 1RUH1 4KH9A 3MIBA 4XF1A 4XXPA 3B9IA 2RS52 2VNOA 1NZCA 1VB2A 4R9BA 4IEUA 4W6WA 2PFWA 3FFQA 2XBO3 4D69A 2NZ9A 3M3QA 5FO7B 5J09A 1XYNA 5JSPA 4UW5A 2BFUL 3WV6A 1PO13 3AFKA 4P9WA 2XVGA 3VBSA 1HRI3 2C9AA 1LHVA 1VBE2 1VBD3 3T1LA 1EP0A 2O8QA 2VW0A 2RS12 2X5IC 2A6ZA 5KWRA 3EHKA 4BE3A 1IOAA 2WFPA 4H7MA 2NMOA 2D44A 4HN1A 4DFSA 4YFZA 4ASLA 4K8FA 4MLOA 4FP3A 2YPJA 3AKTA 4Q4W1 4M3CF 3VBUA 3ZMNA 4CEYB 2WNEA 3MEPA 3SH5A 5J3UA 1PHMA 2BWCA 3GHMA 1NA1C 5I8SA 3AZXA 3VBRB 4FSJA 5JI9A 1PVC2 1MQTA 2XGXA 4RHV1 1JTZX 1N3OA 4HZFA 2PN5A 1EV13 1ZBE1 1UU4A 4E2GA 4E4SA 3WLUA 1YRZA 2WT1A 2RE9A 2D3RA 2DUQA 1N1VA 4ONUA 5FLIA 5IK7A 3JZVA 3MIGA 4NOTA 3WCRA 2VECA 1BJQA 4OHYA 1EAH2 3NAPB 4IV3B 1MZ6A 1SACA 5E89A 1PIV1 3PMSA 4HMZA 4PF5A 3ZVXA 4BIOA 1Q56A 4I3GA 4YGDA 1TME2 3THTA 3RYRA 3EBRA 2GN3A 1GNZA 2ZHKA 1ULCA 1G9CA 1WW6A 1RIRA 1NYWA 5I8TA 1CJDA 4WVWA 2WJSA 4QX5A 3VUOA 4Q4W3 4AI8A 1HW5A 1U0AA 3RNSA 4EROA 3E6BA 5KHGA 3JD72 1GQHA 1OFNA 5FLJA 5IK5A 1VBB2 3KGLA 4I0AA 4Y4YA 1FV2A 4XFHA 3ZSKA 3MFCA 1LECA 1VBC1 1DIWA 3TYJA 1C5HA 1FMD2 1YUDA 2F4PA 3OD0A 2OYZA 3B01A 2LALA 1MS4A 4I01A 4FPHA 2I74A 1ZBE3 1O4ZA 2R041 2R30A 3H8UA 3WY6A 5L36A 1AJOA 5DDJ2 5K0UB 3LA2A 1B35A 1BBT2 1DQ6A 3D6EA 3U4XA 3GZTB 2CGOA 2E51A 1X8EA 1R093 4Q0PA 1NCRC 1AR92 2TBVA 3KT4A 3R05A 2HEWF 3AJYA 2B46X 4RS5C 1H2MA 2IFRA 4E9KA 1KFXL 1FNZA 1ND3C 3OYWB 3USUB 4S2GA 4JDOA 2Q30A 4AFDA 3VBFB 1Z7S3 5GZDA 4R9CA 5EXOA 5BPXA 3ZFGC 3UKNA 3UV9A 2R062 3AKQA 4BOWA 2GNTA 3WNXA 1V9U3 3CJIA 2WA4A 1W0OA 1W6OA 1LOGA 2G9GA 3FE5A 1I9RA 3ZFFA 4BQ1A 3N7KA 2BYVE 3QD6A 3A4UA 1S0GA 3MI8A 2ET7A 4Q8KA 4AI2A 3ZN4A 2WT2A 3RG0A 3VN4A 4L97A 5JOXA 4E2SA 3ZFEC 3L2YA 1HQLA 2V09A 3IDBB 3JQWA 3SLIA 4YM0A 2BVBA 1OLQA 2GDFA 4N43A 4WM8C 3FZ3A 5J98B 2UY8A 5BNPA 4Q8LA 4Q29A 4IXLA 4LO4B 1M06G 5J96B 1H4GA 3WW3A 4QGMA 1N1YA 4HVQA 2ARXA 2Z5WA 4S2HA 2B7YA 5C8CB 3QACA 3SCFA 5T5OA 2I45A 2R043 1EPZA 1GZWB 5J7MA 3WG3A 4DRVA 1BYHA 5LRRA 3VHPA 2JG8C 4AHWA 3R4SA 4P14A 3ZN6A 3THPA 4HKLA 3J8F2 2EALA 2XL9A 4AHZA 1HXS1 3DPRB 1V6IA 3AP5A 3IDCB 4YFWA 5IT6A 5H9QA 4Z8BA 2DTYA 3M3OA 5E16A 4COYA 5CFDC 1B09A 3B3QE 1SLIA 5KHKA 4IEYA 4LBKA 1QJX3 2XLFA 1LGBA 1DQ0A 1NQJA 1X82A 3WW1A 3ZXFA 1FPN2 3KCYA 3ZIWA 2VOVA 2Q5TA 1OOPA 2BW8A 1RC6A 4LHLA 2VNRA 2IXHA 3HBZA 2TUNA 2RMU1 3LA3A 1ZX5A 1DGRA 5BNOA 1QJY3 2KXLA 1TMF3 4Y1UA 5LK7B 4PIXA 3D4KA 1OD5A 4AEDC 1YCIA 1FOD2 1GANA 1XNDA 1VRH1 1W6QB 4PBPA 1CESA 5EJ3A 1VBE1 5JI7A 4HPKA 5L7OB 3WR0A 1QQP3 1LHOA 2RS11 1RINA 1DGWA 2DFBA 1QJZA 2EVXA 1BZWA 4PBOA 2JECA 1W6NA 3I8TA 2QQPA 1SLTA 1VBA3 1DU3D 1RUNA 3VZNA 2YGMA 4CDQB 5JIUA 1MEC3 1ENXA 4YVWC 1QDCA 3MLKA 1UN1A 3ZSEA 3MIFA 2HWF2 1TNFA 3IPVB 1LEMA 3AP6A 2VXRA 3RMXA 5T5JA 4HETA 1H1IA 4WVZA 2KA3A 1PVC1 1FI2A 3AP7A 4YW1A 2G4IA 4AVSA 2RS53 3NKGA 4PLMA 2A73B 3SCHA 4YM1A 3P3NA 2VMHA 1RUJ3 1IKPA 2ZZJA 4UBHA 5GLTA 2GC3A 2JEMA 2JG9A 1ULDA 2GMMA 1J3QA 3PJYA 3MF9A 4J1XA 1QU0A 5T5LA 1QXPA 2A71A 1V6LA 4HK9A 4AGGA 1SCRA 1V6KA 5CB7A 4AHYA 2HWE2 4XOGA 4N7IA 1LGCA 1VBE3 1TME1 1YIFA 3ME2A 1WLCA 2P17A 1BEV2 3VBOB 4YNIA 3S30A 3VHOA 5FO9B 2GNBA 2X5IB 2OUJA 2HWB3 1TQ5A 2XVLA 3DN7A 5K8SA 1PM7A 1UW8A 2UYAA 1PMIA 4QGLA 1ZZCA 1H9PA 4FT8A 4MH0E 3M3EA 3M3CA 4ASMB 4J6GA 1G6NA 5AFBA 1LHUA 2ZCWA 2SBAA 4CDUB 1VBB1 1RUI3 3URFA 2Z42A 1DGWX 4Q4Y1 4NN0A 3WDXA 3QH6A 4X6QB 4LR4A 2YZ4A 4PLOA 3U11A 1OMIA 1SCSA 2OA2A 4GULA 5I0RA 1QDOA 3BU7A 2JJ6A 4OUMA 3UL2A 4AF9A 1UZYA 5BNNC 3PMEA 2WS93 1UMZA 3MLLA 5DDJ1 4OI0A 3APBA 1BXHA 1BBT1 4N9IA 4AQ2A 4CEYA 2RS33 1SFNA 4R4XA 2NQYA 2ATFA 4GQ7A 3MPPG 2R1DA 3FUOA 3LOIA 2MEV2 2XJQA 1ZA4A 1SLAA 2D6NA 5D8AC 5LRSA 1EAH3 3GALA 5FPXA 3VBRA 1ASJ2 5T50A 2DUOA 4QM9A 5CG9A 4XBNA 4LA3A 1A78A 2UYBA 5CU1A 2YV8A 5FOBB 4GB31 1ZM1A 1REFA 2WT0A 1DQ2A 3DGTA 5FTTC 2I2SA 1LESA 4XPVA 4D7SA 1SFYA 1HRV3 1QHDA 2O8OA 2XJSA 3USSA 1PZ7A 5T55A 4B4RA 1AVBA 2XJUA 2Q1MA 2UWCA 2VG9A 3VGIA 1DQ1A 4RQPC 3VKOA 4HVRA 3NAPA 4IV3A 3WUDA 1S0DA 3ETQA 2E9QA 3PVOA 2DVAA 3JD73 2PAMA 4F7ZA 1HLCA 1B35B 2WQ4A 1W6PB 2K2SA 2R16A 2HEYF 2WNVC 4QPGB 5GJ6A 4XYXA 3WCSA 2P3JA 1F8VA 4XHXA 4INDA 1FMD3 3HAGA 1RUC1 2XWJB 2DYCA 2GMEA 3KT7A 4XJWA 1UZZA 4FPFA 3NWKA 1OQEA 3NL1A 3WP4A 2CWMA 1O3SA 2XG3A 5FDBA 1QNWA 2D6OX 4JAAA 3N36A 5FQ0B 1QH6A 5DG1A 3N35A 3KT1A 4QXKA 5KXCA 2XJRA 2FQPA 3TAYA 1PO22 2FMYA 1AR93 4EWAA 1V6M