4IXLA

Crystal structure of endo-beta-1,4-xylanase from the alkaliphilic bacillus sp. sn5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
206
structure length
206
Chain Sequence
SQITGNEIGTHDGYDYEFWKDEGGYGSMTLNSGGTFSAEWTDVHNILFRKGQKFDTTQTHQQLGNINIDYGVNYQPNGSSYLAVYGWTTDPLVEFYIVDSWGTWRPPGAESKGTIHVDGGTYEIYETTRVQQPSIEGTATFQQYWSVRTDKRTSGTISVSEHFHAWEAHGMPMGNMYEVALTVEGWQSSGSADVYRNNLTIGGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Analysis of Alkaline xylanase from Alkaliphilic Bacillus sp. SN5 Implications for pH-dependent enzyme activity
rcsb
source organism Bacillus sp
molecule tags Hydrolase
molecule keywords xylanase
total genus 58
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2013-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ixlA00
2QZ3A 1XYOA 1ENXA 1NLRA 1PVXA 2Z79A 1QH6A 1W2UA 4HKWA 3WT3A 2DCJA 2QZ2A 1XNDA 3VZMA 1OLRA 3WP3A 3VGIA 2BWAA 3LGRA 3VL9A 1M4WA 3AMMA 4XQ4A 5HXVA 3AKTA 4NPRA 3AKSA 2NQYA 3VLBB 1KS5A 2VG9A 2BW8A 2B45X 3WQ0A 3RI8A 3AKQA 2DCYA 4S2DA 3VL8A 3ZSEA 2C1FA 1BCXA 3AMNA 5K7PA 1H1AA 3LB9A 2VGDA 3O7OA 1UKRA 1OA3A 3WP4A 3B7MA 1IGOA 1OLQA 2DCZA 2DFCA 3VZNA 3M4FA 1REDA 3B5LB 2BWCA 1H4HA 1XYNA 1UU4A 1C5HA 4S2HA 1QH7A 1XYPA 1F5JA 3EXUA 1XNBA 2D98A 5EJ3A 3RI9A 3WQ1A 1YNAA 1OA2A 1H4GA 2B42B 1H0BA 3MFCA 2NLRA 3VHPA 3WP6A 3HD8B 3VZOA 4XPVA 1H8VA 2B46X 3WR0A 4XQWA 1AXKA 4S2FA 3WQ7A 2BVVA 3AMQA 1XNCA 3VHNA 2JEMA 4HK8A 4S2GA 2VULA 3WY6A 3VZJA 1HIXA 1REFA 3AMPA 3MFAA 1HV1A 4HKLA 3AKRA 4H7MA 3VZLA 2JENA 1REEA 3MF6A 1XNKA 3AMHA 4IXLA 1BVVA 5K9YA 3VHOA 4HK9A 1TE1B 4HKOA 1BK1A 3WP5A 1KS4A 2F6BA 3WX5A 3AKPA 1UU5A 1XXNA 2JICA 4XQDA 2DCKA 3VZKA 2DFBA 3MF9A 2D97A 2VUJA 3WXPA 1T6GC 1HV0A 1UU6A 1C5IA 1OA4A
chains in the Genus database with same CATH superfamily
4QKBA 1QGLA 1H8TC 3KM5A 4H14A 1GOHA 1WD3A 3GJAA 5LB6A 3ZYPA 5AC91 2WO1A 1RXFA 1GV9A 3C8XA 3D3AA 3MO4A 1R093 3U11A 3VD4A 2ZMKA 5FPLA 4XJ9A 1MQTB 1AYM3 4LUMA 1ZZ6A 3H50A 4AGGA 5FPAA 5F6KA 3TEXA 2BGCA 2PHTA 4JGZC 3UYJA 3O1MA 2VAUA 3LIGA 4FOWA 3AZXA 4IV3A 2V4AA 5JVVA 3JZVA 1W9TA 1J3QA 3KQRA 4Q8LA 1ULDA 2AH2A 4BQ2A 4BLJA 5HCHA 1DLCA 3AP7A 4NROA 1NAEA 3RI8A 1BYHA 1LOCA 3VDDA 5DAVA 1W2TA 3O0WA 2GH2A 4M01A 5C8CC 1OT5A 1OLMA 2CTVA 2JDPA 4HT1T 3AP4A 4NVPA 5I0RA 1PZ8A 4CEYC 4ZU5A 4NPMA 4QPGB 1VBB3 3JBG3 4JC1A 3RRDA 4C91A 2CY6A 2V72A 3E5UA 3WW2A 1YFUA 2XJTA 3ZFEA 4AEJA 1WW4A 5JOZA 4RFRB 3WF4A 3AMNA 5B4XA 4QHOA 5AFEA 3MW4A 1A3KA 2JG9A 3NNFA 3NMBA 3O7OA 2WN2A 4DXZA 1OLME 4JDNA 1V9U2 4LTAA 3WSOA 1VRH2 1TQ5A 5SV5A 1J1TA 1D4M3 1JXNA 4KQ7A 1PK6B 4XUTA 5T52A 2W95A 1RUNA 5C4WC 1NA1A 3BIWE 4S2HA 3ZFFA 5A33B 2YU1A 1Y4WA 3FC0A 5BYNA 3ZMOA 1BMV1 1MS1A 2VMHA 3OBAA 1W99A 2D98A 3INAA 4LKEA 5HCFA 5LEJA 5DZFA 4QB2A 2YU2A 2HWC1 4Q0QA 5GLUA 1ACCA 3L2YA 5G05L 3HOBA 2WS92 3I3MA 3LDBA 1W6PB 2EIDA 5GZDA 3U1XA 4Q0UA 5EWSA 2GNDA 3WVJA 2HWB3 2UWCA 2X29A 3JQWA 1BHGA 3UESA 3VBUB 1CN1A 3VBSC 3PL0A 3MZHA 2BERA 2EIEA 3B69A 4BK5A 5ANNA 1U12A 2WABA 4ZU4A 3PIGA 4K21A 4CU9A 2XH6A 1HXS3 1Q3EA 4GB33 4IV1B 1HQWA 2VNVA 1W8HA 3RZZA 2D6MA 1ODMA 1KQRA 1PGL1 3SQOA 4N53C 4UW4A 3WHUA 4EQVA 4OVEA 2ARBA 2P3JA 1LOFC 2MEV1 4LOTA 2BV4A 4E2SA 1NZCA 4MGYE 4Y22B 1GLHA 1RUH2 2XOMA 2PELA 4JQRA 5FYMA 1AX1A 5I0DA 4BMBA 3H1YA 3WDXA 4B1MA 5J1XA 1KRIA 1WGPA 1YFXA 2A6YA 1YJKA 2EXIA 1TG7A 3ILRA 4N7UA 1RTVA 1DIWA 3M70A 4QQHA 1UU5A 3FX3A 1UXZA 4XF9A 4NIIA 1UYXA 5I91A 4FPJA 2A7AA 3O1VA 1XQNA 2MEV3 2N7GA 2VW0A 3ZYFA 1ODNA 5CFCA 2WNUA 1VRH3 4AHWA 1ND2B 4FFGA 4LKSA 5DDJ1 1QU0A 2W91A 4ZY9A 2BBVA 1SMVA 2YB7A 4Y1UA 4LIUA 4A7KA 1WMEA 2D6OX 4GWIA 3NKGA 1TME3 3TWIA 4JAAA 3T1MA 4KI5M 2JD9A 1S2EA 2VQTA 2ZBJA 3ORJA 2JX9A 4GMP1 1JZ5A 2PHXA 2Y60A 1XNDA 4J1WA 1OKQA 2R063 4OMCA 4ASKA 5BY5A 4HVRA 5FR3A 4AVAA 3BU7A 2QQKA 4OZXA 2R062 2DCTA 1M4WA 1RITA 3I54A 3VBHC 4A2UA 5FZHA 4AOCA 3TOJA 3J4UH 2W94A 1SEFA 3ACGA 3AKSA 5ISLA 4CCLA 3VLBB 4MADA 4F3JA 3U75A 3M3EA 1YQ6A 3VBRA 5J48A 4ZXEA 2Y6GA 2RHPA 2WR9A 3NAPC 4WM7B 4QHZA 2IXHA 3I3QA 3SEPA 4RQPA 1NLSA 3VD5A 1JW6A 2HWB1 2X10A 4Y1ZA 1BXHA 2O8OA 2QKDA 3MIFA 3WG4A 4RSUA 3BIEA 4GWMA 1W0OA 3CF6E 1CPNA 5KXDA 4CZSA 2VGDA 2BOJA 4NHKA 1SDDB 5FPBA 2C26A 3GZAA 3GHMA 5T5JA 5FPZA 4Z1VA 3IMMA 1W8NA 5FZMA 2ZZJA 5ERLA 3HR9A 1OQDA 5FZ1A 1AVBA 1ENSA 2SLIA 4GULA 3RNSA 3FUQA 5DZEA 3HNYM 5E1RA 1IPKA 5JCTA 1YQ8A 1CAXB 1RUC3 4G9SB 3KLSA 4UWDA 4QDQA 5FMBA 4CCMA 3RZMA 2QVSB 2CWSA 1V6JA 2D6LX 1PZ7A 5FZAA 1XPWA 4LITA 4XUNA 3A7QA 2QDRA 5LA0A 2R0HA 2AR6A 1AL23 4AR2A 3RFRA 1FV3A 1PNFA 3OGJA 4I02A 4UYBA 1MS9A 2IWGB 3NAPB 5FK8A 2G9GA 1NA1B 4XETA 3VBSB 3ZXFA 4CCOA 2DUOA 2IFWA 1PK6A 2BFUS 2NYYA 5DDJ3 1CPMA 3OUIA 1LHNA 4PI2A 5FLHA 3DYPA 1WA4A 1HIXA 3MFAA 1GU3A 1YC61 1PGL2 1X8EA 3RZHA 2I2SA 1O59A 4NIGA 4QMAA 4GIQA 4WM8B 2ARXA 4L8QA 4CXXA 4BA6A 1W2AX 4BYYA 1O7FA 2R061 4ITCA 3ZFEB 5BUVA 5K9YA 3OD4A 1COV3 2J42A 4IEPA 4E4ZA 1Z7S1 3LA3A 2UWBA 5JSRA 3LDKA 2WFPA 3H9AA 1E5RA 2LUWA 2C9AA 3WX5A 5F6LB 3ZKUA 3GZEA 1K5MA 4KWLA 2PHUA 5C5UA 1S0JA 2DCKA 5FWEA 2VBPA 5EYXA 4OI1A 1Q8SA 2RS53 5DAXA 2UYBA 3MW3A 3I2KA 4XDOA 4YGEA 1PMIA 4PLNA 5LCWL 2D40A 2BZDA 1FX5A 4HSJA 5GM0A 2VCBA 3GF6A 4YWAA 4IV3B 4YG6A 3ZFEC 2XUEA 2G9FA 4XF4A 2WNOA 2CYFA 1KD7A 4OI0A 1CX1A 1RUOA 3D82A 2QZ3A 2ARAA 1ENXA 3ZYGA 3A0KA 3FZ3A 2KXLA 5C33A 4PJYA 2ZS6B 1CESA 2Z79A 1K45A 3JUUA 3LOIA 4DRVA 2VZPA 3WV6A 1RUD3 4YG3A 5H9RA 4EYUA 3VDBA 1G7YA 3HQRA 2WUHA 1WCUA 1UY4A 2R16A 2HWC3 3ZFGB 4AVSA 4NPRA 3V0BA 2VECA 3E6DA 5F3EA 4Y1XA 1CONA 2HWF1 4EV0A 2LRPA 5J37A 3S5AA 2R1BA 4QX5A 3MLLA 4XXAA 2W92A 2DVFA 3TAYA 1OPOA 3ZYHA 4Y20B 5GLTA 3RZKA 1G8WA 2A3YA 1K42A 1JZ4A 4FSJA 4EN8B 4D6RA 1ZRFA 1GICA 1AR71 5F5CA 1S0DA 1GUIA 2WNUB 1POV3 1TMF1 3KF5A 3OF1A 2ZPXA 3Q9OA 4URTA 4XURA 5CIRA 2Y8KA 1UY1A 2RV9A 1QF3A 3R0RA 1LEMA 4COYA 2ZHNA 3GXUA 3IDBB 5FXZA 2QCSB 5IJRA 1SZBA 5J3UA 2ADEA 5DMYA 5AC92 1GBGA 1PMJX 3I59B 3JB8A 1UU4A 4IESA 5A32A 5JPMB 4RL7A 1PO23 2XL9A 1MS0A 2J7MA 4AGRA 4IEUA 1F5JA 4B4QA 1UZVA 3BTYA 1YQCA 5KXCA 1XNBA 1VMFA 4AYUA 1CVNA 2IVJA 1J3RA 4RR3A 4FXGB 3N9LA 4Q4V2 1LGNA 1OA2A 3OB8A 5D1IA 1GWLA 3E6CC 2PHWA 4P9XA 2QQVA 1A34A 3ES4A 1FOD1 4Y5TA 2VD7A 2YFUA 1O6UA 1XE8A 2AACA 4RQPB 3FFZA 4XIKA 5CKMA 4HVQA 1YHFA 1R091 2ZA9A 4D7SA 1ASJ1 1MR5A 3POJA 1ZM1A 4JVAA 2A3XA 4YVWC 4COVA 4LE3A 2YGMA 3NNGA 1JYVA 2I07B 1NYWA 1HB4A 2V5DA 3RMYA 1UOGA 5FZ3A 4AI2A 1F35A 1CAUB 3OOXA 3H3ZA 1NXD1 5F7UA 2HWD3 1UZ0A 4BQWA 1WCKA 5L9RA 2YC2A 5GZEA 3ZXJA 1RUJ1 1W3XA 3RWKX 5IAXA 3NNMA 1W6NA 1JOPA 3AJYA 1VR3A 2J22A 2OW4A 2YZ4A 3DL3A 2WZR2 4QPGC 5JXJA 1ALYA 2A73B 2F6BA 2LW8A 2WYFA 4HZFA 5FXWA 4QXHA 1YCIA 5T54A 4XQDA 1EY2A 3KMHA 4YW1A 4LBJA 1GZCA 4LIVA 2I74A 5D8AA 1L7QA 5A3MA 1VRBA 1QOOA 1ND2A 2D5FA 5L7OC 4RGGA 3PLQA 4RS5A 4CA9A 5ACA1 5CFCB 5B4NA 1PIV1 3QOPA 2XDVA 2RM22 2GC2A 2JJ6A 1IKPA 1OSGA 2H6BA 3AYDA 1RC6A 3DPRA 4DO0A 4YGCA 2E7TA 5A7OA 3KGZA 2E53A 2C9KA 1L7RA 4MGSA 4O7XA 5JZGC 4BM8A 3CJIC 4MLOA 3ZYJB 2PYTA 3G7DA 2W1QA 2ZKLA 5JUVA 1C57A 1KFXL 1JYIA 1W06A 1TMF3 1VRH1 4KWKA 4XJWA 5BNOB 4SBVA 5F5AA 1ZBA3 3O1PA 5C71A 1J1LA 3Q8EA 5A3WA 1KS5A 1Q43A 5FZOB 5JOXA 3WF0A 5LRSA 1JBCA 2VR4A 4NMIA 2G1MA 4EJRA 4GJZA 4LOSA 3HEIA 3DUIA 3CO2A 2OIIA 4HN0A 2Z5WA 3GM8A 4INDA 2VOWA 4Y33A 1MQTC 5IVYA 5F1RA 1GQGA 4BQ1A 2XJPA 1ZBA1 3S30A 2WJSA 3CJXA 3POGA 5BNOA 2ZGNA 4AAPA 2XJSA 3LB9A 1JZ7A 1W6PA 1G9CA 3RZJA 5K8SA 2ZABA 1CAWA 4QB1A 3H8OA 2RDSA 5JLVA 5A1FA 4AF9A 5L9VA 1LOBA 4LHLA 4U2AA 3RMXA 5JR2A 1RVF1 2XQXA 2Y6JA 4NHMA 1UYYA 4PLOA 4XFFA 1ZRIA 4M3CF 4NAOA 4M3CE 4D69A 1PIV2 1QJX2 2JWPA 2GP5A 2LALA 1EAH1 1WW5A 4WM8C 5CKQA 1OUXA 4ZKTB 4CRQA 4DFSA 3E6BA 3LOBA 1JI6A 2WINB 2VZUA 5L36A 4UBHA 2RE9A 2D6PA 5CNAA 3K2OA 3PVOA 3LKJA 4IEXA 1J58A 5FJKA 3TB0A 2WS93 2VZSA 4DXTA 2ZAHA 3VKNA 1AXKA 1YFYA 2P1BA 3AB0A 5LEKA 3DF0A 4OMDA 2IUWA 4JGZB 2ERFA 3NNLA 2DUQA 4HMZA 3TN93 4HG6B 4N7IA 1W9FA 4QX8A 1V70A 3TN92 2ETEA 5F3GA 4Q4W2 4Y24A 2X5IB 3QBQA 5FYYA 3WDTA 3AMHA 4CTEA 3LPGA 1SFNA 3MV11 5JZGA 4MGZE 3UJOA 3W20A 4E8DA 2W1WA 4NHLA 5FOJB 5FMCA 2RS11 3TN91 3CZUA 4PF5A 2HWF3 3WD5A 2YV8A 4B4RA 1KS4A 1DBNA 1Z78A 2OX0A 2B39A 2HLEA 4WM7A 5A6XA 1IPJA 1HB1A 1ZBE3 2ET7A 3Q8AA 2VZTA 3ZKYA 1CX4A 1O5LA 4BISA 1W8OA 4AVVA 4FPHA 2V73A 3USUB 2PAMA 3WXPA 5FUPA 5FFOC 4IUGA 5IW0A 3HNBM 3P6BA 1B35A 1K5JA 4XAAA 2WFF2 1FV2A 4QU2A 1OA4A 4A6OA 1GOGA 3HQUA 3P1IA 5DUVA 4TTGA 1XC6A 1XSRA 1I3HA 1Z7S3 2VTXA 4BWOA 4JHTA 2WLQA 1PO12 1VE0A 3BYWA 1W2UA 1W90A 3DV8A 2XBO1 4YVWB 1W6NB 2A1XA 3R6SA 4GH4B 2EXKA 1POQA 3HT1A 1HN0A 3J7MA 3WP3A 2BWAA 3ZDVA 2RS51 3CZJA 4E4SA 4HFSA 5JMOA 4XQ4A 1UD1A 3CMGA 5IUQA 4I09A 4NUBA 5CVRA 3RYPA 1UIKA 2VPVA 5FBJA 1QHDA 3H3LA 1PM4A 3KQ4B 4QPIA 3TRSB 1HJGA 3LD8A 2WBKA 4I3GA 4I0AA 4Y20A 4ARXA 5JWPA 4GMP3 3WINE 5FTTC 4Q8KA 4BQ5A 3DECA 4UW3A 3N9OA 1GYKA 1BCXA 1H9PA 2Q30A 1Q56A 2DWRA 3FHAA 3K51A 4FCAA 4IE0A 4K9SA 3BPZA 4KU7A 4QPYA 4JRLA 5FPUA 3NW4A 2ES3A 3H8UA 5A7NA 3BOWA 4AQ2A 1RYYA 1GQHA 1NQDA 5LA2A 5DAWA 3ZVXA 1QJX1 5FYTA 4A45A 4O65A 2PLV1 1HRI3 4IEVA 4B4PA 1DQ0A 5CU1A 5J96B 5A1AA 2VOTA 1REDA 4P14A 2RS32 4FPKA 4IV1A 1RVF2 4LR4A 1WBFA 2BWCA 2RG4A 5CG8A 4LBQA 1C5HA 1FPN1 1OBNA 3WG2A 1W9SA 3BODA 5F5IA 1XYPA 1TZOA 1KDMA 4V1PA 1R082 4QX3A 3I49A 2A5ZA 3I2HA 3VBUA 4WVWA 1VB2A 3B02A 1PHMA 5FY9A 1RUF1 4Q26A 3IDCB 1EPWA 4LA3A 4QM9A 2ZZQA 1A8DA 3MFCA 2NLRA 4B7KA 2OZ6A 3O0XA 2EA7A 1DZTA 3G6JB 4BXFA 1W9WA 4Y1YA 3SCGA 4JGZA 3S5QA 4EROA 3WQ7A 4DRRA 5FKCA 1D2QA 2VZQA 1UZZA 4KL1A 2IVIB 4P9WA 1HX6A 4MXWB 1IS6A 1N47A 3VHNA 1FI2A 3CHXA 1OOPA 2ZGOA 4QU1A 2VULA 4D7YA 3VUOA 1CZSA 3HN1A 3I7DA 3J8F1 4WV8A 4JTNA 3MDPA 1BBT2 1W0PA 1APNA 4Q4W1 5C8WA 2JE7A 1O4TA 1OD5A 1LCLA 5SV8A 5FZ8A 1XSQA 4PDWC 4Y5SA 4QXKA 3ZFGA 3P3NA 2VCAA 3MYXA 1C8NA 4CUBA 2E32A 3VHRA 4QT6A 1QXPA 2Q1ZB 2RR12 2XXZA 4GA9A 4OQ9A 4YLZA 4EWEA 4F8AA 1F31A 2JXAA 2XHNA 2WZ8A 4J1XA 1PO11 1ZREA 4MV2A 2WT0A 5JSOA 3VZKA 5FQ0B 4KG8A 5I0SA 1FOD2 3ILNA 4JKMA 4CDWA 5A3TA 5EYYA 4IEWA 5A7QA 1J84A 5FXVA 1IQAA 1QJFA 5EQUA 3WW1A 1UU6A 2OT7A 3K3NA 3IZOA 3R4UA 2R073 5D21A 4CDXB 3N4MA 1GANA 5EFUA 4BQ4A 3AFKA 3N36A 1N1VA 1Q8PA 2YHJA 1CWPA 4TLFA 5LW9A 2P5BA 3GHNA 1AF9A 1QKQA 3KV6A 3UGGA 1JZ6A 3VBOA 1ZZ9A 1I1EA 3CEWA 1X50A 4AFAA 2VNOA 4DEVA 2HYXA 2A70A 2WYSA 1N3PA 4KMQA 2XL7A 1AUYA 1D4VB 1Q8VA 2P17A 5FYZA 2GN7A 4MVTA 1W2NA 1EYBA 4NHXA 4Y26A 2MNGA 4RR3C 5K4LA 5CADA 4H55A 3WQ0A 5FP7A 3AKQA 1AXZA 1IZ3A 1QJU1 1DYPA 1VMJA 1H8TA 3FFQA 3BB6A 3ZR6A 4Q4X1 2GC1A 1CAVB 3QACA 2X09A 5FJHA 3U78A 2VUAA 1LJ7A 3ZYRA 2EIBA 5HV0A 2YBPA 5LWBA 2PHRA 2WQZC 3X29B 3N9PA 3AFGA 1LTEA 4LO4B 1PGW2 2Y38A 1OLQA 1DQ5A 4NJ4A 2DFCA 1NE4A 4FOQA 1MEC3 2MHFA 3KWVA 4LBKA 1CAXA 3ZPYA 2E31A 4H2AA 3H42B 4ET7A 1ZA7A 5I8YA 1QH7A 1RINA 4W6YA 1VB4A 5FZ7A 3EXUA 4FP3A 4Y4YA 4XBLA 4D7TA 2ZGMA 3ZXEA 1BZWA 4FFFA 3T08A 1DQ4A 2VZRA 2DF7A 3FWEA 3WQ1A 1LRHA 4N53B 3HAGA 5GJ6A 5A7SA 4EZHA 4AI1A 1YXWA 2J1RA 3PDQA 4QQLA 4YNIA 4AVCA 1QMJA 3ZDSA 1W0NA 3CNAA 1U5XA 4RHV1 4QQOA 3HD8B 1PO21 1PX4A 1H8VA 4XPVA 1C28A 4W65A 4DB5A 4RQPC 4FQZA 5ABJB 2LROA 3HN3A 2HWF2 4XVHA 1UX7A 2LS6A 1UYPA 4NO4A 3ZXGA 3THCA 5DZGA 4DQAA 3ZIWA 2PHLA 2VNRA 2GNTA 2NMOA 3WHTA 1HV1A 3PUAA 4AEKA 5BNOC 2Q5TA 2DV9A 5JI9A 4ASMB 4TSVA 2GZWA 1S1AA 3WQBA 3MF6A 2EXJA 2JG8B 3KB5A 1XRUA 1ASJ2 1X8MA 4BPZA 2JKXA 4KWUA 4AWDA 1ASJ3 2CL2A 3FMGA 4HKOA 3ZSLA 3FLTA 4QKFA 4B29A 2XWJB 1QQP3 3B94A 3NJVA 1Q8OA 2GMEA 2BYVE 3H7JA 1W8TA 1E5IA 4MYEA 3VKLA 2ZX1A 2L9LA 4H3WA 3GZTB 1SHWB 5DAQA 1MS3A 2WS91 4R4ZA 4BQ3A 4FO9A 5L7OB 4FTBA 3BKZA 1LGBA 1OH3A 4IE6A 2ZJCA 2HWE1 2ZHMA 1DG6A 1OPMA 2OKXA 4BCUA 2DU1A 3AJZA 3OEBA 1C1LA 4QX1A 4YM2A 4AEDC 1RL3A 3PU3A 4P08A 5AC93 1UY3A 1RB8G 2XUMA 5ANQA 2YBKA 2R0FA 1CQ9A 1QQP1 1AYN1 2VMDA 3LIHA 3OPTA 1RHI1 4UFIA 2FZ1A 3ZFFB 4A42A 5A3NA 1NXMA 2MPFA 3QCWA 4YPJA 4XTPA 2IXCA 1QJU3 3SEEA 1HB3A 3MGUA 3DYOA 3KT4A 2D5HA 2YPDA 5DXDA 3ACIA 5LZ6A 2P37A 4JQTA 1FMD1 4Y22A 2HWE3 1UOJA 4XBNA 2TEPA 3VL9A 1YUDA 4Q29A 4AEDB 1QDOA 3ZO0B 2RMU2 4K20A 3JCIA 4XE9A 1OQEA 4MX3A 3PJQA 4QQPA 1VJ2A 3D0SA 4N90A 3T2OA 4X8NA 1AR93 2QQNA 5FZIA 1V6NA 4L9BA 1AR92 2VY0A 2VO5A 2DU0A 1NE6A 3AK0A 2QTWB 2HBTA 2R7EB 2B9UA 1L3JA 2TBVA 1F15A 1LGCA 2ZX2A 3ETPA 1JUHA 1G86A 3DPRC 1VBC3 2ADDA 5F5QA 2ZEZA 3N7MA 4LJHA 1EUUA 1MZ5A 1R64A 2R041 4DUVA 3AYAA 3KD4A 4UW5A 5JR7B 2WAAA 2DCZA 5TSWA 5BNPA 3ACFA 3I2OA 2FDHA 2A3WA 1K5MB 1ND2C 5FY4A 3O5SA 1VPHA 4BB3A 5D8AC 2FDGA 1RMU2 5KHJA 1GNZA 1GP4A 1HJFA 4G4FA 4AGVA 4E9KA 1MVQA 2LTNA 4IERA 1MZEA 4FTEA 1COV1 5LRRA 3J7LA 4AZZA 1LKNA 1AL22 1VBA2 2EF6A 1NCRA 3H3UA 1S0GA 3LZZA 4BMEA 3PVEA 1ULPA 1O5UA 3AZVA 1QNWA 4LO8A 1L7LA 1QJX3 1UKGA 2CNAA 2ZMNA 3IMNA 4R9DA 3FJSA 1JYCA 3FBMA 3KGLA 5A70A 5GLWA 5FUIA 3WP6A 2Y0IA 2VBDA 4FPCA 5GKAC 1G9FA 1DGWA 1NCRB 4NWVA 4TLGA 5LBBA 4EE2A 5KWRA 5JDBA 4NWWA 1GZTA 2VVEA 5FZKA 4MXWA 1CAVA 3P3PA 1YRZA 1FPN3 2VOXA 1UW8A 3N35A 5BV6A 4KH9A 5FO9B 1H6YA 4LEJA 3VV1A 2HKXA 2OPWA 1EV13 4XJUA 3VZJA 4Z82A 4KGQA 3D6EA 4QXBA 3M8LA 1EV12 2EAKA 1FOD3 1XOYA 1CAWB 3LF7A 1W8FA 1CZTA 1XE0A 2FCTA 3P5BA 2WNUC 3E97A 2FDFA 4A44A 1VBD3 1H2KA 1QJEA 2EAAA 3KV4A 4JCKA 4MHUA 5FO8B 3SKVA 2JE8A 4YW6A 1JYWA 1EV11 2WO2A 4FP2A 5H9SA 2RJKA 2VMFA 1X9PA 4IE7A 3RZLA 1D4M1 2BRTA 1OVSA 2FDJA 3RDIA 2XJUA 1XJAA 3BU0A 1XXNA 5A3LA 4W6WA 5JXGA 1GR3A 3AZZA 3AZWA 4FXKB 4RD7A 3JD73 3VBOC 2EALA 1AR73 1HRI1 3U4XA 1RMU3 1HV0A 1POV1 4QGNA 5C9AC 5F2SA 2BP6A 1U5YA 2XJQA 3KV9A 4XUPA 5HPOA 1ZBE1 4WZCA 4DS0A 2VE1A 2RDNA 5KHGA 4UFJA 2VCCA 3IB3A 5JSPA 1FXZA 3DPRB 1TEIA 5GALA 2D6KA 1OKOA 2WWJA 4XYXA 4AFCA 1CIWA 1AR62 2DCJA 4FPFA 4XFCA 5AVAA 5I0TA 1BVP1 1DYKA 2UURA 2JDNA 1RMU1 1DQ1A 3MI8A 1WCSA 1IS3A 5HXVA 2GMMA 1W28A 1JN2P 1Y43B 4K1ZA 4BIFA 3ROUA 5LY1A 2QNKA 4IW3A 1Y9QA 3NL1A 4YVWA 2Y6FA 2WA4A 3ZLIA 5FZ6A 1V6KA 2XR4A 1A8MA 4C1WA 3WW3A 4HOOA 4XAEA 4R9BA 2KM2A 2Z42A 2X53S 3WDUA 3WOGA 1PM7A 1W9YA 4YYOA 1LOGA 4BXSV 3M2MA 4V2VA 1H2LA 2ATFA 1N3QA 4V2WA 1IPSA 3NJXA 5J09A 2HBUA 1PO22 2RDRA 4LHNA 5EZWA 2XVGA 4RHV2 4L99A 5JI7A 3SLIA 3ZXLA 2Y6KA 4CCKA 4EZ4A 1WBLA 3IAPA 4E4HA 5IK5A 1BMV2 1DGLA 3IWZA 1XNTA 3B00A 4Z2AA 3DKQA 2Y6LA 3GYDA 3POBA 1V9U1 3H8RA 1UXXX 5L9BA 1S0BA 3JU9A 2H0VA 1YIPA 4LBMA 3L2HA 4PQ9A 1NY72 2VZVA 2GDFA 5KHKA 5EJ3A 1O8PA 4CEYB 4CCNA 2J1EA 4DXRA 3ZXDA 3MPPG 4CP2A 2X5IC 4HL0A 1X33A 5FZ0A 2YY1A 1O8SA 2JDZA 2CV6A 3LSDA 3RS6A 3KS7A 4FFIA 2VW2A 1DGRA 4LBQD 4W50A 2FDIA 3LA7A 3UKVA 4COUA 1EAH3 3GGLA 3PHMA 1W6QB 4AFBA 1YEWA 3DXUA 4N43B 1F5FA 4EN6B 2BVVA 4DY5A 2EIGA 2B8MA 2PAEA 3K4AA 1WLDA 4IGQA 5LBCA 3WLUA 3ZN6A 2MEV2 4FPEA 4PF1A 1HRV3 3H0OA 2Z69A 3J9SA 3U07A 2GP3A 1LOAA 1JYTA 5FV3A 5FUNA 4P02B 1VBA3 3KT7A 2JG8C 4UI9L 3J8F2 2IZWA 4FI9A 1Q8QA 3POWA 1QXRA 3S0MA 4OZOA 1ENRA 2IFRA 4GH4A 2WKKA 1DGRN 3M3CA 1LB2A 1GFF2 1H8TB 5FOBB 3WDYA 5C3PA 3PIJA 2J1UA 2HWE2 2CHHA 1RUE2 2AEYA 4FPGA 4NIDA 4RHV3 1UCXA 4JTOA 4K1YA 4AI3A 4AW7A 5KC5A 1WW7A 3CKHA 4QM8A 2D97A 3E5QA 2QQOA 4KGGA 4Q4Y3 2VZOA 1H2MA 2B4KA 3E1F1 1VIWB 1QDCA 1W03A 5F39A 3W58A 1C5IA 3SCHA 3BOPA 2QBXA 3C7GA 3F95A 2WNEA 1SFPA 4TXWA 4J6GA 1UPSA 3ZSJA 4W8JA 2O1QA 3I4IA 5DG1A 1RVF3 5LK7B 5A3PA 2R1DA 3LFIA 4QWNA 5F37A 1JYXA 4YGBA 2QZ2A 4TYSA 1AX2A 1LNSA 5T3NA 1UF2C 1RUH1 2BVBA 2X8KA 3VGIA 3LGRA 3OD0A 2B7YA 3VBRC 1LOEA 1ZVFA 5FYIA 4C0HA 1U5ZA 3OGRA 1PGW1 4K8FA 4MXVA 1SBFA 2D93A 1G9DA 4LT5A 5IWFA 1IOAA 1MQTA 1BBT1 3KSCA 5KHHA 2RJ2A 5T5PA 2VC9A 2BTVC 4OYUA 4I30A 2P3KA 1IHMA 5F3CA 3M3OA 2BPA2 5CBLA 1PZ9A 5C3SA 5JAXA 2XLGA 5K7PA 2F4LA 1K3IA 4YZ2A 4E2GA 4WZFA 1UKRA 2AUYA 4HSLA 4ZZ8A 1UMHA 2CDPA 3KCXA 2K46A 4X6RB 4NIHA 2QQJA 1JZ3A 1FMD3 3M4FA 3RJ2X 3CJIA 3MW2A 3I3EA 3POYA 5DUWA 4DPNA 1LR5A 3BTXA 5D2AA 2ZGLA 1QIQA 1V6IA 1XU1A 1XYNA 3VBSA 1R1A3 4D6SA 3PTRB 3APBA 3T3YA 4XFGA 1O3RA 4YARA 3EB7A 2OA2A 3NV3A 4OHXA 4QKDA 3B9IA 4UOJA 3RVHA 3WG1A 4JKLA 1VP6A 4PIYA 4FTSA 1DZQA 2WO3A 1NCQC 2JB8A 1F8VA 3OBRA 3C7EA 4XC9A 5L7OA 1D2SA 3TEWA 1H0BA 1LOFA 2W1UA 4AQTA 4K8RB 1SLLA 2JECA 3W21A 4OHVA 3UK9A 3ZFFC 5FREA 2W9XA 2Z2SB 5FMDA 3RPQA 2WNVB 1DZRA 2BNOA 4YG0A 2QQUA 4BJ0A 2ID4A 4ZZ5A 3AMQA 3BPSA 2OZJA 3MIHA 4LXLA 2E9QA 2PQQA 4QXCA 1RUI1 2ZX3A 3FUOA 4LA2A 2CAVA 4BQYA 4BIOA 5JMCA 2W52A 5DUUA 4ATFA 3ON7A 4TN7A 3POSA 4F83A 4NIAA 4CDWC 3HVDA 2WIIB 1LU2A 2VM9A 3WDVA 4Q4Y1 3DXTA 3Q8FA 2ARCA 4CEYA 1DDLA 4CDXC 4KBBA 3UETA 2XQRA 3MBWA 2E26A 5A80A 2LM3A 1UPIA 4HVOA 2OVUA 4OHWA 2BGPA 1AJKA 2A6WA 4Q27A 4YFZA 2DDUA 2BNMA 2W46A 2IXLA 2E33A 3AVRA 3H8XA 1EPZA 2R49A 4EWDA 3FLPA 3VN4A 3SH3A 4M0HA 2WT2A 3VBRB 3ZIXA 3PU8A 4OFGA 5C3RA 1D7PM 2B5HA 1IKQA 2DFBA 1UOBA 5A7PA 1QQP2 4YZ5A 3VB9A 2R043 3AC0A 1VAVA 4XFAA 2PMWB 3OUJA 1Y7BA 4RS5B 1S4CA 2ZAAA 1ULOA 1JODA 3AM2A 3ENRA 4P9YA 3LPFA 1PO13 1GZWA 1UIJA 4YFWA 4CU6A 5IK7A 5KXEA 1UAIA 1C8M1 1HDKA 1RUF2 3PMEA 3MLJA 4AG4A 3K4ZA 5JXHA 2DTWA 1T2XA 3FN9A 1IQDC 1YLLA 3OG2A 3U0ZA 4RGAA 3DKWA 2D43A 3R05A 2ZEWA 4EWAA 1SFYA 1WA6X 4IDZA 1VBE1 1URXA 1VBD1 4FVVA 4HLTA 1GZWB 1YWKA 4ES8A 3LSEA 1J3PA 1H1IA 4FAHA 3J26N 3TNPB 4EN9B 3AX4A 2PA7A 2RS31 2AEZA 4JKKA 3LEIA 5FLIA 2CSGA 3USUA 4IQPA 4Z8BA 1LECA 2FQPA 1JMUB 3VBFA 2ZACA 1RUG3 2AC1A 2ZGTA 4QPGA 3KCYA 4O61A 4CCJA 2QE3A 3IPVA 4MG2A 2DCYA 3VL8A 1RUJ3 2VCMA 4UFHA 5A7WB 1NOVA 3ITQA 3WUDA 2BQPA 4FFHA 3WG3A 4LK6A 3KCCA 3O12A 3FHIB 1ND3C 4GKYA 4DEQA 1IS4A 3BUCA 4R9CA 2E63A 1ZZ7A 2R32A 4QQ2A 2W0XA 2YGLA 3SNMA 1OF4A 3D8CA 3B7MA 2E6VA 1A78A 3ACHA 3O0VA 3VZNA 1C1FA 1X82A 2VL4A 4ZS3A 3T4VA 4B1LA 4FOVA 4XEZA 4AI8A 4IEOA 4A3XA 1EAH2 3HWJA 4KWJA 1JYNA 5HBAA 2VQUA 3OYWA 4Q1PA 5F2WA 5FYUA 3GALA 1C4RA 4CDXA 1YQ2A 2NZ9A 2P6CA 3NSTA 4M3CB 4QKNA 4E8CA 5K0UC 1W8WA 4N8MA 1S0CA 4OCTA 3JQXA 1BEV2 1YNAA 4P9LA 3SH4A 4BE3A 1DU3D 3UKNA 1GOFA 2OPKA 2WRAA 3LE0A 4CDWB 3ASIA 3GZUC 1I6XA 3OTFA 2P2KA 1RUF3 4A4AA 3RQ0A 3I2IA 4CDQB 4N9IA 3J7NA 4QB6A 1V9U3 3FHQA 4BZ4A 2QDNA 2OUHA 2A6XA 4ISRA 2JEMA 3U4SA 3V0AA 1AR81 1CZVA 3URFA 1FAYA 3HMYA 1NZIA 5IFTA 1QJU2 1PNGA 2VU9A 3ACLA 2PHFA 4CXWA 2I45A 5F9TA 5LK5A 5BNQA 2BGOA 3WCRA 2WLPA 3LWCA 5CKNA 4YZ3A 5LATA 4CUCA 3UT0A 5C3OA 5I93A 2A6VA 2Q1FA 4CEWA 3EBRA 1DQ2A 3D0JA 3ZN6B 2ZX0A 1AR83 2JIJA 4IGOA 3VBOB 4AHZA 1VBB1 3JBG1 3H1WA 1ULCA 1ULEA 1OUSA 4RN5A 4XIOA 3TNQA 4D0QA 4P9IA 1CD3G 3K3OA 2HWD1 3AKPA 4XABA 4QAWA 1W6OA 2V09A 1MZ6A 1BLZA 1UWWA 3K4DA 1WWYA 4LO6B 2F17A 1YO8A 1GQPA 3IDEA 4IE4A 5J7MA 3R4DB 3V56A 3V65A 1H1MA 4XILA 3WNKA 1G9AA 3Q8BA 5HCAA 5L19A 4CVUA 3GJBA 5DUXA 5GLVA 2RDQA 4EN0A 1YI9A 1W6OB 4CP1A 4XJZA 4AL9A 3ZPOA 2Y33A 3RGBA 4FPYA 4YRDA 1GWKA 3A21A 2ZXQA 1GZ9A 3QH6A 3CBNA 2HYKA 2VUDA 4IV1C 2ZOEB 3C7OA 2OUJA 4I0BA 3VZMA 3WEZA 2FDKA 3HPNA 3AXEA 3PURA 4PI0A 1IS5A 4ZPIA 1WMDA 4AEDA 4CUGA 2PN5A 4CDUC 4XHXA 1NCRC 3TEYA 3RYKA 2O8QA 4OHZA 4MSVA 3NV4A 3KVBA 3ZSKA 4M00A 3WNXA 4XZPA 4MGKE 2BNNA 5FP3A 1YFWA 3V0AB 3KVAA 5ABJA 1AJOA 4PHZA 3NAPA 2RS13 1LHWA 5FXXA 3FLRA 2ZGUA 1H2NA 4HN1A 5M0TA 2ZGPA 1SLAA 2JE9A 2KR2A 2C0ZA 1DLLA 4CPBD 2WDBA 2Q1MA 1X9TA 4FBFA 1F2NA 1FYUA 3OBZA 5IT6A 1UY0A 4OUMA 3O1TA 5IVCA 2SBAA 4LBLA 2VQAA 3MIBA 4L0PA 5A1LA 3IIIA 5FY1A 1F4HA 2PTMA 1US2A 1SDWA 1OMIA 1Y9MA 4XFHA 1M06G 1RIRA 1TVGA 1W6QA 4LPLA 5FRAA 1SACA 2CGOA 2GAUA 2JG8A 3ZYBA 4K6BA 2TUNA 2XKOA 1ZRDA 1O3QA 5CFCC 1MS8A 1V6OA 4I01A 1XB9A 4BU2A 4UFMA 4DOUA 1TMF2 1LU1A 3MIEA 3WUCA 2GC0A 1IG3A 2HEWF 3LDRA 4PQQA 5A3OA 4CCDA 2FHRA 1PVC3 3WW4A 4M0NA 4XDQA 1TNFA 1AYN3 4NHYA 2DYCA 4S2GA 1DHKB 1OD3A 5CFDB 5JZGB 4UBGA 3VD9A 4URAA 1D0HA 1HB2A 3C3VA 4MGIE 1REFA 3AMPA 4YW2A 3O1UA 1STMA 3AKRA 1AXYA 5FZDA 4LLOA 1REEA 2FBEA 3OY8B 4N53A 4CXYA 1LENA 4PDWB 2D3PA 1XNKA 1MS4A 5DPNA 3BTZA 4LKDA 1JU4A 2EICA 2PXJA 4HBNA 5CAZA 5LA9A 2O14A 4P5YA 3FBYA 5BPXA 2P4EA 4L11A 2A71A 4NRMA 3FL7A 1S55A 2CAUA 1RUG1 4JGYB 4AI0A 1RUI3 4IE5A 5IK4A 3AVSA 4YZ4A 4C90A 1V00A 3LEKA 5ACA2 4YW7A 3MUZ1 2OYZA 4DY3A 1ZZ8A 1E5SA 5ACA3 2XGXA 2PLV3 1PIV3 3WNNA 5KBFA 2VQ0A 4OHYA 1B35B 1XU2A 4HANA 4D94A 3CL1A 2E7AA 2JG9B 2NM1A 1W8ZA 3VKOA 4XDPA 3WZ1A 1NY71 2BU9A 2D6NA 2W2IA 2WQ4A 2BOIA 3T2TA 4R52A 3VD7A 5IVJA 4LNVA 2D3SA 4XF3A 4AK3A 1RUE3 1SG3A 2V5YA 4COWA 4DINB 1XYOA 3IAQA 2RR13 1RUJ2 1BJQA 1R1A1 1AL21 1ND3B 2J1TA 5EV7A 1C3HA 3AP6A 3GBFA 2YUEA 4B7EA 1COV2 4Q4Y2 5F8PA 4CPBA 2PQSA 3I2GA 1JOJA 1OLRA 1WW6A 2RMU3 5K0UB 2NP0A 1LAJA 3VBHB 2Z4FA 3AMMA 2ZKNA 3ABZA 1UN1A 5H9QA 5LY2A 3HBZA 3T2PA 4LULA 1RXGA 1W39A 4R4XA 2VTXJ 4Q4W3 1R092 4JRAA 1NG0A 3GDBA 5FMOL 4LMFA 4C8DA 2G9ZA 4J25A 2BW8A 2B45X 2C24A 3I3BA 5DQ0A 5FAXA 2BEOA 4AE2A 5FPXA 4XOGA 3N7LA 2FMYA 3IN9A 4JGYC 1QJY1 2W39A 2ZEYA 1UMZA 4META 3VDDC 1CJDA 3ZM8A 1LHOA 4B8EA 2E51A 3JD72 3PMSA 4CEWB 4K40A 2RVAA 3HBKA 5I8SA 2Q8EA 1DP0A 4QDRA 4PIXA 1GNYA 3PUQA 1IGOA 1VBC1 2VUCA 2GALA 5B2GB 4FT8A 4LHSA 2NMNA 2ZGSA 4IV3C 2WO7A 5FK7A 1W3VA 3ZOIA 4LO5B 3POFA 2IXKA 4B3NA 2B9VA 5C4WB 1H4HA 4MGQA 4XHBA 3BI3A 1OOPC 1TME1 4L97A 2YDEA 4OI2A 5T55A 1FMD2 3RG0A 1DYOA 5DDJ2 4CEWC 4CDQA 2QQPA 4LO7A 4LK7A 4AVBA 3LQCA 4UT5A 3CJIB 1DQ6A 3D4KA 2WWUA 3GBGA 4UAPA 3VBFC 4NOTA 3RZGA 1H4GA 2WAOA 3QD6A 3VHPA 3W5NA 5HXMA 2WWSA 5FY8A 2YROA 3WR0A 4Q0VA 1NQJA 4JGYA 4OULA 3O1RA 5J36A 3IM0A 4JV4A 2HWB2 4PBOA 1XNCA 4DUXA 3GNEA 5J98B 3WF3A 4CP9B 1JHJA 3W59A 2DURA 4OI4A 2AGSA 1S0IA 3B93A 3LCPA 2XJRA 4GXLA 3WY6A 3HT2A 4LBNA 1ZZCA 1NX9A 2IXJA 5EJZB 2YMZA 3AYEA 4UW6A 3UGHA 2R072 4LHKA 4BK4A 2ET1A 1AHSA 2AYHA 1ZNPA 4MH0E 3ETQA 3MICA 1HRV1 3VKFC 4GB32 5EXOA 1SQ4A 1UMIA 2BBAA 2VNGA 3I2FA 4Q4X3 3LFMA 1I9RA 4CE8A 1KGYA 5C3QA 5A7WA 5EHDA 4Q0PA 5LBFA 3FE5A 3USSA 3NV2A 5T50A 3EYPA 1HW5A 1WLWA 1ZBE2 5FZ4A 3SHRA 4D8MA 3MIGA 4GWJA 5KXBA 4XZUG 2DVGA 2Y0OA 2YXSA 3BVCA 2HWC2 2VUJA 2VVFA 5AVPA 4LLFA 4IGPA 2QUOA 4SLIA 3ATGA 1A6CA 4YGDA 1NLQA 1T6GC 1AYM1 2IXIA 3ST7A 1LESA 4GD4A 1QXJA 1Z7S2 1Z0HA 4D3WA 2K2SA 2VTFA 4GB31 2VZ1A 4MOAA 1WCQA 1HRV2 1UYZA 2ZX4A 4K7JA 1WLCA 4A7YA 4PLMA 1D4M2 1K12A 3N7JA 4Z92B 2ORXA 2R071 5A6YA 2XJVA 5C8CA 1TME2 2BFUL 4I3PA 1E57A 3HIFA 1O4YA 3KT1A 2C4XA 2JDMA 3WNLA 3U14A 1CIYA 4BOWA 1D0GA 3NV1A 3EHKA 3OY8A 5CEHA 3OBTA 4O9GA 1WCDJ 3J7HA 3VBUC 2YYOA 4FOYA 1T6BX 4A3ZA 4FPOB 4YW5A 3ZX7A 1GP6A 4BQXA 3QH7A 1US3A 1IG0A 1S0FA 2AZ5A 4GAZA 4X6QB 3UV9A 4PCRA 1UY2A 1OVPA 4COZA 4XMAA 3THTA 2H0BA 2JKBA 4AAXA 5IFPA 3DN7A 2P34A 5CISA 3AL6A 1W6MB 1XE7A 3V0BB 4LE4A 3AYCA 1H1AA 3I97A 3ELNA 1MACA 1UL9A 5DAPA 2QQLA 1UOFA 1E5HA 2ZGRA 4XUQA 3WNMA 4C1XA 1RJ8A 1AX0A 1LULA 4RR3B 2HJIA 2VMIA 1N3OA 4N43C 5FMOS 2WC2A 2YC0A 3QLQA 1QNYA 5CYYA 4BDVB 4UF0B 4MO3M 4CU7A 3S7EA 1V6LA 1RHI2 5IVBA 1AYN2 1JUIA 1AR61 3EMRA 1RHI3 3OCPA 1OXCA 4FQ4A 4N9HA 1VBC2 1YQ5A 1N1TA 2A6ZA 5JIAA 3GCWA 1OF3A 4E2QA 5IVFA 5IYYA 3BGAA 1HQNA 5LASA 2GU9A 2WZEA 2ZHLA 4BLIA 3T1LA 2K9ZA 4QGLA 1G6NA 2BJSA 2P3IA 1OH4A 4LBOA 5DG2A 3ZYIB 5FZLA 3JD71 2VOVA 3ES1A 1VALA 4BH9A 1XBFA 3SH5A 1LHVA 1S2BA 2HWD2 3BCWA 1QJY2 4IEYA 4CCCA 2OQ7A 5C70A 2R042 2XKPA 5E8AA 3SITA 4YVSB 1PMHX 4AFDA 3RWNA 4F7ZA 1QOSA 1VBB2 3JBG2 3NNJA 4CP9A 1NUKA 3I2DA 2BUKA 3J8F3 1FNZA 5BXXA 3PUIA 4K3UA 3PJYA 1ZRRA 3UNPA 1AR91 2PAKA 1B35C 2WZR3 4NRPA 2CWMA 4Y5Z0 3NQHA 3ZN4A 1V0AA 4DIQA 5IHRA 4YW4A 4A6SA 1NCQB 1NCQA 1VLNA 2AREA 3IDAA 5GZGA 1BKZA 1KDKA 3K46A 2QFEA 2RMU1 3M7AA 4Q5OA 3RJRA 2CGPA 3A22A 3LEMA 4QHBA 4L92A 3RYRA 1S0EA 4WM7C 1R1A2 3UKTA 1W04A 2EXHA 3WDWA 4DNYA 5FZEA 3TYJA 4JDOA 2VXJA 1BK1A 4X8PA 2Y34A 4JDMA 3SXWA 4KG0A 4AI9A 4XCAA 3CQOA 1ZYBA 1DGWX 1QWRA 1UZWA 5E89A 4HPKB 2JB4A 4CU8A 1ZZBA 5JOYA 4LKFA 3DGTA 1CGPA 3O14A 3SISA 3OSDA 1UO9A 4GH4C 3MF9A 5HI0A 1BQPA 2KD7A 4Q0SA 1AYM2 1JU3A 3HQXA 3OGGA 1GWMA 4P5HA 1O3SA 1O3TA 5DABA 5L73A 1J59A 2VVDA 4I2OA 1ENQA 2W5FA 3PTYA 4QPWA 1H6XA 2FZ2A 3HNMA 1N1SA 2P3YA 5C9AB 5F3IA 1NLRA 1WMXA 2FCVA 4LBQB 3AZYA 5E6HA 4XXPA 1PVXA 3S6PA 5F32A 2W47A 4D6QA 5FZOA 4HKWA 1VAMA 2PHDA 4AQSA 5HV4A 3AP5A 4R8HA 4BHPA 1QEXA 1U5IA 3H7YA 3NRUA 4UFKA 4WM8A 4RS5C 1YIFA 1RUH3 1W6MA 3TBDA 5FQ0A 2O0OA 3WCSA 1VBE3 2HEVF 2VG9A 1SLCA 3IT8A 1NA1C 1LODA 4NE9A 3CU7A 5A6ZA 1W8UA 3OGSA 4PIZA 5BNNB 2YFZA 3RSJA 1PGSA 2WFF3 3IPVB 3T0BA 1OC1A 3PNAA 4WVMA 3A4UA 3A0NA 3NWKA 2C1FA 2OS2A 1BBT3 3MLKA 1WLTA 2RJLA 5GZCA 4W4ZA 5I8TA 3N9MA 1KJLA 1OQ1A 2WQ8A 4Z2WA 5JIUA 4Y3OA 1JOBA 4HONA 1HN1A 3ZR5A 2WT1A 1TNRA 1VBA1 1WMFA 2C5DA 2DUPA 1R081 2WL1A 3MHZA 5D8AB 2E7QA 4NN0A 3NKTA 3MV01 5C8CB 4HXCA 3N7KA 1FPN2 1KJRA 4YM1A 4IETA 1X7NA 2F4PA 1OOPB 4LUKA 5KR7A 4NPLA 4AEMA 3OYWB 2Y6HA 3PUHA 4A7ZA 2J1SA 3EQEA 3IIAA 4H7LA 4N43A 1OURA 4YVSA 5EJ1B 1CR7A 5IVVA 1FNYA 2D7FA 1SPPA 1ZX5A 3CIHA 4PDWA 3RI9A 4ZU7A 5CZKA 3AP9A 4LORA 2JIGA 3OPZA 5EP9A 5FYHA 5FYCA 3WF1A 2B42B 3T4HB 1P8JA 2W08A 4CDUA 1MVEA 4XMIA 1GKBA 1RGSA 2B46X 1U0AA 2QQWA 3L9JT 4XQWA 2WA3A 4S2FA 3POIA 4Y4RA 4ES9A 3C7HA 1MS5A 2RR11 4PT6A 2PFWA 2WNVC 5FYSA 4OLLA 1JTZX 4Q4X2 3SC7X 4UF0A 1EUTA 2ZGKA 3IKWA 3OJBA 4Q2FA 3W9AA 2FMDA 4XF1A 4RGKA 2WSUA 4CDUB 4YSFA 5FZBA 1PVC2 2VOKA 2Q0AA 2X5IA 1RUD2 3VZLA 2JENA 1Y9GA 3Q8CA 1X36A 1AZDA 2KA3A 4ARYA 1F9KA 2ZEXA 2XMLA 4IXLA 2GN3A 4NAMA 4XUOA 5I0UA 3ZSMA 2DVBA 4HK9A 5C6CA 1TE1B 3O1OA 5C7GA 2WNVA 2ZTNA 4XJ8A 1I5PA 5EPAA 5FKBA 1MZFA 4QD2A 1BEV3 4JHZA 2JICA 1AL0G 1ULFA 2CDOA 4KNCA 5CA6A 1DFQA 3E5XA 3M3IA 4E4DX 4EN7B 5IVEA 4R9AA 2WSVA 5FY0A 5G04L 2HH9A 1WD4A 3WNPA 2TNFA 3VDAA 1UQXA 4YVSC 4XTMA 4JX0A 1BEV1 2FCUA 4WVMB 1S2KA 2VH9A 2ORZA 2GMPA 2W87A 2Q8DA 2DBIA 2RM23 5C4WA 1J83A 2EVXA 2ILMA 3U37A 3VD3A 2VBBA 1QH6A 3DEMA 3JB4C 1GP5A 1RUG2 1SLIA 5IATA 2XVLA 1HQLA 2XHKA 2VMEA 4O9EA 5FYBA 1UZYA 3V64A 3ALQA 2YBSA 2YPJA 4AHXA 3IBMA 5FY7A 1YYNA 2JG9C 1ONAA 1AR82 2XG3A 1SBDA 2P6HA 3AXDA 2D3RA 2RS33 3C7FA 5FP8A 4ZXKA 2W1SA 1K5MC 3F2ZA 3N9QA 1ZBA2 4NR1A 2C6SA 4RA0A 4S2DA 3VDDB 5C5TA 1FT9A 3W5MA 3UGFA 5C9AA 4ATEA 2AENA 1MEC1 1SLTA 2ZCWA 3KHBA 2VZ3A 1PX3A 3ZXKA 2D44A 3ILFA 5LBEA 1JS9A 4AFMA 4CSWA 1Y3TA 1Q5OA 2GC3A 3T0DA 1OA3A 2XWBB 1QOTA 2VJXA 4ONUA 3WP4A 3ZFGC 4UFLA 3K48A 2XONA 1H9WA 1OHFA 2W3JA 1SPPB 4CDQC 3B5LB 1LEDA 5T5OA 1QJY3 4HPKA 1ND3A 4P00B 4HETA 3ZMNA 2UYAA 1PK6C 2OXBA 1GSLA 1VBE2 3MEPA 4XBQA 5KC6A 1WUVA 3MIDA 4L2NA 4QX2A 4XJAA 4GZ9A 1SLBA 2UWAA 2VW1A 5FIXA 1KITA 2OQ6A 3R4SA 4GKXA 2V4VA 2JDHA 5FDBA 2PLV2 3GBWA 3KHCA 4CP0A 1V6MA 4Q1RA 3SMHA 2JDUA 5FZCA 3T09A 1WZXA 2RS12 2YG0A 4G3YC 3I2JA 4OUSA 5FYVA 5BNNC 2UY9A 4YW3A 1DCSA 1MEC2 5FLJA 1KXGA 3KF3A 1KFUL 3UL2A 5A3UA 4QGMA 3B9CA 1F4AA 1JZ2A 4CYDA 4GQ7A 2G4IA 3TEZA 4DZGA 1PVC1 3KV5A 1W2OA 4HKLA 2G19A 2VXRA 3PVNA 4KU8A 3WNOA 2W68A 5BNPB 4I0WB 3M1HA 1KEXA 5FY5A 1O4ZA 2DVAA 2Y64A 3C2UA 3VKMA 5ABJC 2ZGQA 3BTAA 2JDKA 1JZ8A 5FWJA 1GMMA 5CFDA 2RS52 3VHOA 2UU8A 1HXS2 3LA2A 3DYMA 2Y26A 4IEQA 4MZUA 3KZ4C 3MPBA 1R1ZA 2RM21 3N9NA 5FP9A 4Q4V3 2H6CA 1GNHA 4P9GA 5EIYB 5BNPC 4AQ6A 2ZMLA 4ZONA 1CJPA 3OEAA 4QPIC 4ORFA 4IEZA 5HCBA 2DVDA 3OGVA 1ZRCA 3S57A 3VBHA 3VDCA 3ZN5A 3JXSA 4GALA 2WZR1 4QX0A 1O91A 1SBEA 4AVTA 4GMP0 4ZS2A 1HXS1 1VMHA 4Q4V1 4ZHNA 5A32B 3I3DA 4AHYA 4C0BA 2BDRA 1AR63 2HEYF 2R30A 1YJLA 2XLFA 2GH8A 4AXOA 4XACA 4XW3A 3VBFB 1VAKA 4XF0A 3WT3A 4QPIB 4U36A 3ECQA 4MHRA 2GSYA 1H30A 4LQRA 1WKYA 1JHNA 5T5LA 3H1MA 4PBPA 4DMIA 1SCSA 2UY8A 4CCEA 4DXSA 5FBZA 5JPNB 2QJVA 2DTYA 3AKTA 1OI6A 4ISQA 2X05A 3B01A 3EO6A 2NQYA 3DCQA 4GJYA 1LHUA 1OFSA 1RUC1 5LA1A 2DBNA 4KBZA 2YC4A 4WVVA 3ZSEA 4FPLA 3PVBB 2CU5A 5KHIA 1JH5A 3M3QA 1NKGA 5A6QA 1RJ7A 2NN8A 3NO8A 5IK8A 5FZ9A 5E16A 1MPXA 2XVKA 3OUHA 2JDYA 1NT0A 3T30A 1HLCA 2GNMA 3LAGA 4FAGA 3HJRA 4XFIA 4QX7A 1CAUA 2JDAA 4JZRA 5FCCA 1VBD2 1I5ZA 3O1SA 4P9JA 1YI7A 4WVZA 3T2QA 2Q8CA 3THDA 1UNBA 2J1AA 4QDSA 1HKDA 4MUVA 3T0AA 1C8M2 2XBO3 4M4PA 5DN2A 4OQ8A 1POV0 1C8M3 2GNBA 2XBO2 5FP4A 4DUWA 5E88A 4TWTA 2JD4A 2XB6C 1HRI2 4W6XA 5CG9A 3EJKA 4RYDA 4WBBA 3SKJE 4E27A 3BALA 1AR72 2XPJA 1FATA 3MUY1 4IL7A 5H9PA 2ENRA 2R6QA 2QQIA 1R083 5GZFA 3SCFA 3GCXA 4YZ1A 3VZOA 4A41A 1ZA4A 2VMCA 3AL5A 2FD8A 3NJYA 4MGTA 3NJZA 3WF2A 2QQMA 4ASLA 5AFBA 1RUE1 5JXIA 4HK8A 2J1VA 3BN6A 2VMGA 3I59A 4OUEA 2XLAA 5GLZA 1EP0A 2CGNA 5CFDC 4XFBA 3UJQA 4YM3A 3PUSA 2Q8OA 1RUC2 3OPWA 5CB7A 3K75B 4H7MA 3THPA 1SCRA 1DF0A 3K77A 4M4RA 3ME2A 3POEA 1ULGA 1RUI2 4CUAA 1RUD1 1QJZA 1BVVA 2ZHKA 3D5OA 1N1YA 4GWNA 5IAVA 3B3QE 3N3HA 4RFT0 4UXAA 5K0UA 5A33A 3LEGA 5FPVA 1UX6A 2WFF1 2WN3A 3WP5A 4TZDA 2NPIA 3NVCA 5BNNA 5APAA 2K0GA 4NRQA 1W05A 4Z07A 1OFNA 1B09A 3CDZB 2IC1A 4XCBA 2WZPP 5FO7B 2A75A 5FZGA 3I8TA 1G9BA 1ST8A 4YM0A 3A23A 1XNAA 5FZFA 4M3CA 4Y1VA 1BK0A 2Q4SA 5JOWA 3ZXAC 1QY4A 3S7IA 3CLPA 3U10A
chains in the Genus database with same CATH topology
1QGLA 1H8TC 3KM5A 4H14A 1WD3A 3ZYPA 5AC91 3U11A 1GV9A 1R093 2ZMKA 4XJ9A 1MQTB 1AYM3 4LUMA 1ZZ6A 3H50A 4AGGA 5F6KA 2BGCA 2PHTA 4JGZC 4FOWA 4IV3A 3AZXA 5JVVA 3JZVA 3KQRA 1J3QA 4Q8LA 1ULDA 2AH2A 4BLJA 3AP7A 3RI8A 1BYHA 1LOCA 3VDDA 3O0WA 2GH2A 4M01A 5C8CC 2CTVA 4HT1T 5I0RA 4NVPA 3AP4A 1PZ8A 4CEYC 4ZU5A 4QPGB 3RRDA 1VBB3 3JBG3 4JC1A 4C91A 2CY6A 3E5UA 3WW2A 1YFUA 2XJTA 3ZFEA 4AEJA 1WW4A 5JOZA 3AMNA 5AFEA 3MW4A 1A3KA 2JG9A 3O7OA 4DXZA 4JDNA 1V9U2 4LTAA 1VRH2 1TQ5A 5SV5A 1J1TA 1D4M3 1JXNA 4KQ7A 1PK6B 5T52A 1RUNA 5C4WC 1NA1A 3BIWE 4S2HA 3ZFFA 5A33B 3FC0A 5BYNA 3ZMOA 1BMV1 1MS1A 2VMHA 3INAA 2D98A 5HCFA 5LEJA 5DZFA 2HWC1 4Q0QA 5GLUA 3L2YA 2WS92 1W6PB 5GZDA 4B4PA 4Q0UA 5EWSA 2GNDA 3WVJA 2HWB3 2UWCA 2X29A 3JQWA 3VBUB 1CN1A 3VBSC 3MZHA 3B69A 1U12A 4ZU4A 4K21A 2XH6A 1HXS3 1Q3EA 4GB33 4IV1B 1HQWA 3RZZA 2D6MA 1PGL1 1KQRA 4N53C 4UW4A 3WHUA 4OVEA 2ARBA 2P3JA 1LOFC 2MEV1 4E2SA 1NZCA 4MGYE 4Y22B 1GLHA 1RUH2 2PELA 4JQRA 1AX1A 4BMBA 3H1YA 3WDXA 1KRIA 1WGPA 1YFXA 2A6YA 1YJKA 2EXIA 3ILRA 4N7UA 1RTVA 1DIWA 3M70A 4QQHA 1UU5A 3FX3A 4XF9A 5I91A 4FPJA 2A7AA 1XQNA 2MEV3 2N7GA 2VW0A 5CFCA 2WNUA 1VRH3 4AHWA 1ND2B 5DDJ1 1QU0A 2BBVA 1SMVA 4Y1UA 4A7KA 1WMEA 2D6OX 3NKGA 1TME3 3TWIA 4JAAA 3T1MA 2ZBJA 2JX9A 4GMP1 2PHXA 4J1WA 1XNDA 5BY5A 1OKQA 2R063 4HVRA 4AVAA 3BU7A 4OZXA 4A2UA 2R062 2DCTA 1M4WA 1RITA 3I54A 3VBHC 3TOJA 3J4UH 1SEFA 3AKSA 3VLBB 3M3EA 3VBRA 5J48A 2RHPA 3NAPC 4WM7B 2IXHA 4RQPA 1NLSA 1JW6A 2HWB1 4Y1ZA 1BXHA 2O8OA 2QKDA 3MIFA 3WG4A 4RSUA 4GWMA 1W0OA 3CF6E 1CPNA 5KXDA 4CZSA 2VGDA 4NHKA 3GZAA 3GHMA 5T5JA 5FPZA 4Z1VA 2ZZJA 3HR9A 1OQDA 1AVBA 1ENSA 2SLIA 4GULA 3RNSA 3FUQA 5DZEA 5E1RA 1IPKA 5JCTA 1CAXB 1RUC3 4G9SB 3KLSA 2QVSB 2CWSA 1V6JA 2D6LX 1PZ7A 2QDRA 2R0HA 2AR6A 1AL23 1FV3A 1PNFA 3OGJA 4I02A 1MS9A 2IWGB 3NAPB 2G9GA 1NA1B 4XETA 3VBSB 3ZXFA 2DUOA 2IFWA 1PK6A 2BFUS 2NYYA 5DDJ3 1CPMA 5FLHA 1LHNA 1WA4A 1HIXA 3MFAA 1PGL2 1X8EA 2I2SA 4QMAA 4GIQA 4WM8B 2ARXA 4L8QA 4BA6A 4BYYA 1O7FA 2R061 4ITCA 3ZFEB 5BUVA 5K9YA 3OD4A 1COV3 4IEPA 4E4ZA 1Z7S1 3LA3A 2UWBA 5JSRA 2WFPA 3H9AA 2LUWA 2C9AA 3WX5A 5F6LB 1K5MA 4KWLA 2PHUA 1S0JA 2DCKA 5EYXA 4OI1A 1Q8SA 2RS53 2UYBA 3MW3A 4YGEA 1PMIA 4PLNA 2D40A 1FX5A 4HSJA 5GM0A 3ZFEC 3GF6A 4IV3B 4YG6A 2G9FA 4XF4A 2CYFA 1KD7A 4OI0A 1RUOA 3D82A 2QZ3A 1ENXA 3ZYGA 3A0KA 3FZ3A 2KXLA 5C33A 4PJYA 2ZS6B 1CESA 2Z79A 3JUUA 3LOIA 4DRVA 3WV6A 1RUD3 4YG3A 5H9RA 1G7YA 2R16A 2HWC3 3ZFGB 4AVSA 4NPRA 3V0BA 2VECA 3E6DA 4Y1XA 1CONA 2HWF1 4EV0A 5J37A 2R1BA 4QX5A 3MLLA 4XXAA 2DVFA 3TAYA 1OPOA 4Y20B 5GLTA 1G8WA 2A3YA 4FSJA 4EN8B 1ZRFA 1GICA 1AR71 1S0DA 2WNUB 3OF1A 1POV3 1TMF1 3Q9OA 4URTA 2ZPXA 5CIRA 1QF3A 3R0RA 1LEMA 4COYA 2ZHNA 3IDBB 2QCSB 5J3UA 5AC92 1GBGA 3I59B 3JB8A 1UU4A 4IESA 5A32A 5JPMB 4RL7A 1PO23 2XL9A 1MS0A 4AGRA 4B4QA 4IEUA 1F5JA 5KXCA 1XNBA 4AYUA 1CVNA 1J3RA 4RR3A 4FXGB 4Q4V2 1LGNA 1OA2A 5D1IA 3E6CC 2PHWA 4P9XA 3ES4A 1FOD1 1XE8A 4RQPB 3FFZA 4XIKA 4HVQA 1YHFA 1R091 2ZA9A 4D7SA 1ASJ1 1MR5A 1ZM1A 4JVAA 2A3XA 4YVWC 4COVA 4LE3A 2YGMA 2I07B 1NYWA 3RMYA 4AI2A 1CAUB 3H3ZA 1NXD1 2HWD3 1WCKA 5GZEA 3ZXJA 1RUJ1 1W6NA 3AJYA 1VR3A 2OW4A 2YZ4A 3DL3A 4QPGC 2WZR2 1ALYA 2A73B 2F6BA 4HZFA 1YCIA 5T54A 4XQDA 1EY2A 3KMHA 4YW1A 4LBJA 1GZCA 2I74A 5D8AA 5A3MA 2D5FA 1QOOA 1ND2A 5L7OC 4RGGA 3PLQA 4RS5A 5ACA1 5CFCB 1PIV1 3QOPA 2RM22 2GC2A 2JJ6A 1IKPA 1OSGA 2H6BA 3AYDA 1RC6A 3DPRA 4YGCA 2E7TA 3KGZA 2E53A 5JZGC 4BM8A 3CJIC 4MLOA 3ZYJB 2PYTA 3G7DA 2ZKLA 1C57A 1KFXL 1JYIA 4KWKA 1TMF3 1VRH1 5BNOB 4XJWA 4SBVA 1ZBA3 1J1LA 1KS5A 1Q43A 5JOXA 5LRSA 1JBCA 4EJRA 3DUIA 3CO2A 2OIIA 4HN0A 2Z5WA 4INDA 2VOWA 1MQTC 5F1RA 1GQGA 4BQ1A 2XJPA 1ZBA1 3S30A 2WJSA 3CJXA 5BNOA 1G9CA 2ZGNA 2XJSA 3LB9A 1W6PA 5K8SA 2ZABA 1CAWA 5JLVA 1LOBA 4LHLA 4U2AA 3RMXA 1RVF1 4NHMA 4PLOA 4XFFA 4M3CF 4M3CE 4D69A 1PIV2 1QJX2 2LALA 1EAH1 1WW5A 4WM8C 4ZKTB 4CRQA 4DFSA 3E6BA 3LOBA 2WINB 5L36A 4UBHA 2RE9A 2D6PA 5CNAA 3PVOA 3LKJA 4IEXA 1J58A 3TB0A 2WS93 2ZAHA 3VKNA 1AXKA 1YFYA 3AB0A 5LEKA 3DF0A 4JGZB 2ERFA 2DUQA 4HMZA 3TN93 4N7IA 1V70A 3TN92 2ETEA 4Q4W2 4Y24A 2X5IB 3QBQA 3WDTA 3AMHA 4CTEA 1SFNA 5JZGA 4MGZE 3UJOA 5FOJB 4NHLA 2RS11 3TN91 4PF5A 2HWF3 3WD5A 2YV8A 4B4RA 1KS4A 1DBNA 1Z78A 4WM7A 2B39A 1IPJA 1ZBE3 2ET7A 1CX4A 1O5LA 4AVVA 4FPHA 2V73A 3USUB 2PAMA 3WXPA 5FFOC 1B35A 2WFF2 1FV2A 4QU2A 1OA4A 5DUVA 1Z7S3 1I3HA 4BWOA 2WLQA 1PO12 1W2UA 3DV8A 2XBO1 4YVWB 1W6NB 3R6SA 4GH4B 2EXKA 3HT1A 3WP3A 2BWAA 4E4SA 2RS51 4HFSA 4XQ4A 1UD1A 5IUQA 4I09A 5CVRA 3RYPA 1UIKA 2VPVA 1QHDA 3TRSB 4QPIA 4I3GA 4I0AA 4Y20A 5JWPA 4GMP3 3WINE 5FTTC 4Q8KA 4UW3A 1GYKA 1BCXA 1H9PA 2Q30A 1Q56A 2DWRA 3K51A 4FCAA 4K9SA 4KU7A 4LLFA 3BPZA 4QPYA 4JRLA 3NW4A 2ES3A 3H8UA 3BOWA 4AQ2A 1GQHA 1NQDA 3ZVXA 1QJX1 2PLV1 1HRI3 4IEVA 1DQ0A 5CU1A 5J96B 1REDA 4P14A 2RS32 4FPKA 4IV1A 1RVF2 4LR4A 1WBFA 2BWCA 5CG8A 4LBQA 1C5HA 1FPN1 3WG2A 3BODA 1XYPA 4V1PA 1KDMA 1R082 2A5ZA 3VBUA 4WVWA 1VB2A 3B02A 1PHMA 1RUF1 4Q26A 3IDCB 1EPWA 4LA3A 4QM9A 2ZZQA 1A8DA 3MFCA 2NLRA 4B7KA 2OZ6A 3O0XA 2EA7A 1DZTA 3G6JB 4Y1YA 3SCGA 4JGZA 4EROA 3WQ7A 4DRRA 1D2QA 1UZZA 4KL1A 4P9WA 1HX6A 4MXWB 1IS6A 1N47A 3VHNA 1FI2A 1OOPA 2ZGOA 2VULA 4D7YA 3I7DA 3HN1A 3J8F1 4WV8A 4JTNA 3MDPA 1BBT2 1W0PA 1APNA 4Q4W1 5C8WA 2JE7A 1O4TA 1OD5A 1LCLA 5SV8A 3ZFGA 4PDWC 4QXKA 3P3NA 3MYXA 1C8NA 3VHRA 4QT6A 1QXPA 2Q1ZB 2RR12 4GA9A 4YLZA 4EWEA 4F8AA 1F31A 2JXAA 4J1XA 1PO11 1ZREA 4MV2A 2WT0A 5JSOA 3VZKA 5FQ0B 4KG8A 5I0SA 1FOD2 3ILNA 4CDWA 5EYYA 4IEWA 1IQAA 3WW1A 1UU6A 4CDXB 3N4MA 3R4UA 2R073 1GANA 5EFUA 3AFKA 3N36A 1N1VA 1Q8PA 2YHJA 4TLFA 3GHNA 1AF9A 1QKQA 1I1EA 3VBOA 1ZZ9A 3CEWA 1X50A 4AFAA 2VNOA 2A70A 1N3PA 2XL7A 1AUYA 1D4VB 1Q8VA 2P17A 2GN7A 4MVTA 4Y26A 1EYBA 5CADA 2MNGA 4RR3C 4H55A 3WQ0A 3AKQA 1AXZA 1IZ3A 1QJU1 1DYPA 1H8TA 3FFQA 3BB6A 4Q4X1 2GC1A 1CAVB 3QACA 2VUAA 1LJ7A 3ZYRA 2PHRA 2WQZC 3X29B 3AFGA 1LTEA 4LO4B 1PGW2 2Y38A 1OLQA 1DQ5A 2DFCA 1NE4A 4FOQA 1MEC3 2MHFA 4LBKA 1CAXA 3ZPYA 5I8YA 1QH7A 1RINA 4W6YA 1VB4A 3EXUA 4FP3A 4Y4YA 4XBLA 4D7TA 2ZGMA 3ZXEA 1BZWA 1DQ4A 3FWEA 2DF7A 3WQ1A 1LRHA 4N53B 3HAGA 5GJ6A 4AI1A 1YXWA 4QQLA 4YNIA 4AVCA 1QMJA 3ZDSA 3CNAA 1U5XA 4RHV1 4QQOA 3HD8B 1PO21 4XPVA 1H8VA 1C28A 4W65A 4DB5A 4RQPC 4FQZA 2HWF2 4NO4A 3ZXGA 5DZGA 4DQAA 3ZIWA 2PHLA 2VNRA 2GNTA 2NMOA 3WHTA 1HV1A 5BNOC 4AEKA 2Q5TA 2DV9A 5JI9A 4ASMB 4TSVA 2GZWA 1S1AA 3MF6A 2EXJA 2JG8B 3KB5A 1XRUA 1ASJ2 1X8MA 4BPZA 4AWDA 1ASJ3 2CL2A 3FMGA 4HKOA 3ZSLA 3FLTA 4B29A 2XWJB 1QQP3 3B94A 1Q8OA 2GMEA 2BYVE 3H7JA 4MYEA 3VKLA 2ZX1A 4H3WA 3GZTB 1MS3A 2WS91 4R4ZA 4FO9A 5L7OB 4FTBA 1LGBA 2ZJCA 2HWE1 2ZHMA 1DG6A 1OPMA 4BCUA 2DU1A 3AJZA 4YM2A 1C1LA 4AEDC 1RL3A 1RB8G 2XUMA 2R0FA 1CQ9A 1QQP1 1AYN1 1RHI1 2FZ1A 3ZFFB 1NXMA 2MPFA 3QCWA 4XTPA 2IXCA 1QJU3 3MGUA 3KT4A 2D5HA 5DXDA 2P37A 1FMD1 4Y22A 2HWE3 4XBNA 2TEPA 3VL9A 1YUDA 4Q29A 4AEDB 1QDOA 3ZO0B 2RMU2 4K20A 3JCIA 4XE9A 1OQEA 4MX3A 3PJQA 4QQPA 1VJ2A 3D0SA 4N90A 4X8NA 1AR93 1V6NA 4L9BA 1AR92 2VY0A 2DU0A 1NE6A 3AK0A 2ZX2A 2TBVA 2B9UA 1L3JA 1LGCA 1JUHA 1G86A 3DPRC 1VBC3 5F5QA 3N7MA 1MZ5A 2R041 3AYAA 3KD4A 4UW5A 5JR7B 5TSWA 2DCZA 5BNPA 2A3WA 1K5MB 1ND2C 3O5SA 5D8AC 1RMU2 1GNZA 4G4FA 4E9KA 4AGVA 1MVQA 2LTNA 4IERA 1MZEA 4FTEA 1COV1 5LRRA 1LKNA 1AL22 1VBA2 1NCRA 2EF6A 3H3UA 1S0GA 3LZZA 4BMEA 3PVEA 1O5UA 3AZVA 1QNWA 4LO8A 1QJX3 1UKGA 2CNAA 2ZMNA 3IMNA 4R9DA 3FJSA 1JYCA 3FBMA 3KGLA 5GLWA 3WP6A 2Y0IA 4FPCA 5GKAC 1G9FA 1DGWA 1NCRB 4NWVA 5KWRA 3VUOA 5JDBA 4NWWA 2VVEA 4MXWA 1CAVA 3P3PA 1YRZA 1FPN3 2VOXA 1UW8A 3N35A 5BV6A 4KH9A 5FO9B 4LEJA 3VV1A 2HKXA 1EV13 4XJUA 3VZJA 4Z82A 4KGQA 3D6EA 3M8LA 1EV12 2EAKA 1FOD3 1CAWB 2WNUC 3E97A 1VBD3 1H2KA 4JCKA 2EAAA 5FO8B 1EV11 4FP2A 5H9SA 2RJKA 1D4M1 3RDIA 2XJUA 1XXNA 5A3LA 4W6WA 1GR3A 3AZZA 3AZWA 4FXKB 4RD7A 3JD73 3VBOC 2EALA 1AR73 1HRI1 3U4XA 1RMU3 1HV0A 1POV1 4QGNA 5C9AC 2XJQA 1U5YA 1ZBE1 4WZCA 4DS0A 5KHGA 5JSPA 1FXZA 3DPRB 1TEIA 5GALA 2D6KA 4XYXA 4AFCA 1CIWA 1AR62 2DCJA 4FPFA 4XFCA 5AVAA 5I0TA 1BVP1 1DYKA 2UURA 1RMU1 1DQ1A 3MI8A 1WCSA 1IS3A 5HXVA 2GMMA 1JN2P 1Y43B 4K1ZA 4BIFA 3ROUA 2QNKA 1Y9QA 3NL1A 4YVWA 2WA4A 1V6KA 1A8MA 4C1WA 3WW3A 4R9BA 2KM2A 2Z42A 2X53S 3WDUA 3WOGA 1PM7A 4YYOA 1LOGA 3M2MA 1H2LA 2ATFA 1N3QA 5J09A 1PO22 4LHNA 5JI7A 5EZWA 2XVGA 4RHV2 4L99A 3SLIA 3ZXLA 1WBLA 5IK5A 1BMV2 1DGLA 3IWZA 3B00A 3GYDA 1V9U1 1S0BA 3JU9A 2H0VA 1YIPA 4LBMA 3L2HA 4PQ9A 1NY72 2GDFA 5KHKA 5EJ3A 4CEYB 3ZXDA 3MPPG 4CP2A 2X5IC 4HL0A 1X33A 2YY1A 2JDZA 2CV6A 3LSDA 3RS6A 3KS7A 4LBQD 2VW2A 1DGRA 3LA7A 3UKVA 4COUA 1EAH3 3PHMA 1W6QB 4AFBA 4N43B 1F5FA 4EN6B 2BVVA 4DY5A 2EIGA 2B8MA 2PAEA 1WLDA 3WLUA 3ZN6A 2MEV2 4FPEA 1HRV3 3H0OA 2Z69A 3J9SA 3U07A 1LOAA 1VBA3 3KT7A 2JG8C 3J8F2 2IZWA 1Q8QA 3POWA 1QXRA 3S0MA 1ENRA 2IFRA 4GH4A 2WKKA 1DGRN 3M3CA 1LB2A 1GFF2 1H8TB 5FOBB 3WDYA 2HWE2 1RUE2 4FPGA 4RHV3 1UCXA 4JTOA 4K1YA 4AI3A 4AW7A 5KC5A 1WW7A 4QM8A 2D97A 3E5QA 4KGGA 4Q4Y3 1H2MA 1VIWB 1QDCA 3W58A 1C5IA 3SCHA 3BOPA 2WNEA 4J6GA 1UPSA 3ZSJA 5DG1A 2O1QA 3I4IA 1RVF3 5LK7B 2R1DA 4YGBA 2QZ2A 4TYSA 1AX2A 5T3NA 1UF2C 1RUH1 2BVBA 2X8KA 3VGIA 3LGRA 3OD0A 2B7YA 3VBRC 1LOEA 1ZVFA 4C0HA 1U5ZA 4MXVA 1PGW1 4K8FA 1SBFA 2D93A 1G9DA 4LT5A 1IOAA 1MQTA 1BBT1 3KSCA 5KHHA 5T5PA 2BTVC 4I30A 2P3KA 1IHMA 3M3OA 2BPA2 5CBLA 1PZ9A 5JAXA 2XLGA 5K7PA 4YZ2A 4E2GA 4WZFA 1UKRA 2AUYA 4HSLA 3KCXA 4X6RB 1FMD3 3M4FA 3RJ2X 3CJIA 3MW2A 3POYA 5DUWA 4DPNA 1LR5A 2ZGLA 1XYNA 1V6IA 1XU1A 3VBSA 1R1A3 3APBA 4XFGA 1O3RA 4YARA 2OA2A 3NV3A 4OHXA 3WG1A 3B9IA 1VP6A 4PIYA 4FTSA 1DZQA 1NCQC 1F8VA 3OBRA 5L7OA 1D2SA 1H0BA 1LOFA 4AQTA 1SLLA 2JECA 4OHVA 3UK9A 3ZFFC 5FREA 2Z2SB 3RPQA 2WNVB 1DZRA 2BNOA 4YG0A 3AMQA 3MIHA 2OZJA 2E9QA 2PQQA 1RUI1 2ZX3A 3FUOA 4LA2A 2CAVA 4BIOA 5JMCA 2W52A 5DUUA 4ATFA 3POSA 4F83A 4CDWC 2WIIB 1LU2A 3WDVA 4Q4Y1 4CEYA 1DDLA 4CDXC 4KBBA 2LM3A 1UPIA 4HVOA 2OVUA 4OHWA 1AJKA 2A6WA 4Q27A 4YFZA 2BNMA 2IXLA 1EPZA 2R49A 4EWDA 3FLPA 3VN4A 3SH3A 4M0HA 2WT2A 3VBRB 3ZIXA 4OFGA 2B5HA 1IKQA 2DFBA 1QQP2 4YZ5A 2R043 1VAVA 4XFAA 1Y7BA 4RS5B 2ZAAA 3AM2A 3ENRA 4P9YA 1PO13 1GZWA 1UIJA 4YFWA 5IK7A 5KXEA 1UAIA 1C8M1 1HDKA 1RUF2 3PMEA 3MLJA 4AG4A 2DTWA 1YLLA 3U0ZA 4RGAA 3DKWA 2D43A 3R05A 4EWAA 1SFYA 1VBE1 1URXA 1VBD1 4FVVA 4HLTA 1GZWB 1YWKA 4ES8A 3LSEA 1J3PA 1H1IA 4FAHA 3J26N 3TNPB 4EN9B 3AX4A 2PA7A 2RS31 5FLIA 3USUA 4IQPA 4Z8BA 1LECA 2FQPA 3VBFA 2ZACA 1RUG3 2ZGTA 4QPGA 3KCYA 2QE3A 3IPVA 2DCYA 3VL8A 1RUJ3 1NOVA 3WUDA 2BQPA 3WG3A 3KCCA 3O12A 3FHIB 1ND3C 4GKYA 1IS4A 4R9CA 2E63A 1ZZ7A 2R32A 4QQ2A 2W0XA 2YGLA 3SNMA 3D8CA 3B7MA 2E6VA 1A78A 3VZNA 3O0VA 1C1FA 1X82A 4FOVA 4XEZA 4AI8A 4IEOA 4A3XA 1EAH2 3HWJA 4KWJA 5HBAA 3OYWA 4Q1PA 3GALA 1C4RA 4CDXA 2NZ9A 3NSTA 4M3CB 5K0UC 1S0CA 3SH4A 3JQXA 1BEV2 1YNAA 4P9LA 4BE3A 1DU3D 3UKNA 2OPKA 4CDWB 3ASIA 3GZUC 1I6XA 3OTFA 2P2KA 1RUF3 3RQ0A 4CDQB 4N9IA 1V9U3 4BZ4A 2QDNA 2OUHA 2A6XA 4ISRA 2JEMA 3V0AA 1AR81 3URFA 1FAYA 3HMYA 1QJU2 1PNGA 2VU9A 3ACLA 2PHFA 2I45A 5F9TA 5LK5A 5BNQA 3WCRA 2WLPA 3LWCA 4YZ3A 5I93A 2A6VA 4CEWA 3EBRA 1DQ2A 3D0JA 3ZN6B 2ZX0A 1AR83 3VBOB 4AHZA 1VBB1 3JBG1 3H1WA 1ULCA 1ULEA 4XIOA 3TNQA 4P9IA 1CD3G 2HWD1 3AKPA 1W6OA 2V09A 1MZ6A 4LO6B 3IDEA 1YO8A 5J7MA 3R4DB 3V56A 3V65A 1H1MA 4XILA 1G9AA 5HCAA 5L19A 5DUXA 5GLVA 4EN0A 1YI9A 1W6OB 4CP1A 4XJZA 4FPYA 4YRDA 4IV1C 1GZ9A 3QH6A 4COZA 2HYKA 2ZOEB 3VZMA 2OUJA 4I0BA 3AXEA 1IS5A 1WMDA 4AEDA 2PN5A 4CDUC 4XHXA 1NCRC 3RYKA 2O8QA 4OHZA 4MSVA 3NV4A 3ZSKA 4M00A 3WNXA 4XZPA 4MGKE 2BNNA 1YFWA 3V0AB 5ABJA 5K0UB 1AJOA 3NAPA 2RS13 1LHWA 3FLRA 2ZGUA 1H2NA 4HN1A 2ZGPA 1SLAA 2JE9A 2C0ZA 1DLLA 2Q1MA 4FBFA 1F2NA 1FYUA 5IT6A 4OUMA 2SBAA 4LBLA 2VQAA 3MIBA 5AC93 2PTMA 1SDWA 1OMIA 4XFHA 1M06G 1RIRA 1W6QA 5FRAA 1SACA 2CGOA 2GAUA 2JG8A 4K6BA 2TUNA 2XKOA 1ZRDA 1O3QA 5CFCC 1MS8A 1V6OA 4I01A 4DOUA 1TMF2 1LU1A 3MIEA 3WUCA 2GC0A 2HEWF 2FHRA 1PVC3 3WW4A 4M0NA 4XDQA 1TNFA 1AYN3 2DYCA 4S2GA 1DHKB 5CFDB 5JZGB 4UBGA 1D0HA 3C3VA 4MGIE 4YW2A 1REFA 3AMPA 3AKRA 1AXYA 4LLOA 1REEA 2FBEA 3OY8B 4N53A 1LENA 4PDWB 2D3PA 1XNKA 1MS4A 5CAZA 4HBNA 3FBYA 5BPXA 4L11A 2A71A 1S55A 2CAUA 1RUG1 4JGYB 4AI0A 1RUI3 5IK4A 4YZ4A 4C90A 1V00A 5ACA2 2OYZA 4DY3A 1ZZ8A 5ACA3 2XGXA 2PLV3 1PIV3 5KBFA 2VQ0A 4OHYA 1B35B 1XU2A 4HANA 4D94A 3CL1A 2E7AA 2JG9B 2NM1A 3VKOA 3WZ1A 1NY71 2D6NA 2WQ4A 3T2TA 4R52A 4LNVA 2D3SA 4XF3A 4AK3A 1RUE3 2V5YA 4COWA 4DINB 1XYOA 2RR13 1RUJ2 1BJQA 1R1A1 1AL21 1ND3B 5EV7A 4B7EA 1C3HA 3AP6A 3GBFA 2YUEA 1COV2 4Q4Y2 1JOJA 1OLRA 1WW6A 2RMU3 2NP0A 3VBHB 3AMMA 2ZKNA 1UN1A 5H9QA 3HBZA 4LULA 1W39A 4R4XA 4Q4W3 1R092 4JRAA 1NG0A 5FMOL 2BW8A 2B45X 5FAXA 2BEOA 4AE2A 5FPXA 4XOGA 3N7LA 2FMYA 3IN9A 4JGYC 1QJY1 2W39A 4META 1UMZA 3VDDC 4B8EA 1CJDA 1LHOA 2E51A 3JD72 3PMSA 4CEWB 4K40A 5I8SA 4PIXA 1IGOA 1VBC1 5B2GB 2GALA 4FT8A 2NMNA 2ZGSA 4IV3C 4LO5B 2IXKA 4B3NA 5C4WB 1H4HA 4XHBA 1OOPC 1TME1 4L97A 2YDEA 4OI2A 5T55A 1FMD2 3RG0A 5DDJ2 4CEWC 4CDQA 2QQPA 4LO7A 4AVBA 3CJIB 1DQ6A 3D4KA 3GBGA 3VBFC 4NOTA 1H4GA 3QD6A 3VHPA 2WWSA 2YROA 3WR0A 4Q0VA 1NQJA 4JGYA 4OULA 5J36A 3IM0A 4JV4A 2HWB2 4PBOA 1XNCA 3GNEA 5J98B 4F3JA 3W59A 2DURA 4OI4A 2AGSA 1S0IA 3B93A 3LCPA