4IXLA

Crystal structure of endo-beta-1,4-xylanase from the alkaliphilic bacillus sp. sn5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
206
structure length
206
Chain Sequence
b'SQITGNEIGTHDGYDYEFWKDEGGYGSMTLNSGGTFSAEWTDVHNILFRKGQKFDTTQTHQQLGNINIDYGVNYQPNGSSYLAVYGWTTDPLVEFYIVDSWGTWRPPGAESKGTIHVDGGTYEIYETTRVQQPSIEGTATFQQYWSVRTDKRTSGTISVSEHFHAWEAHGMPMGNMYEVALTVEGWQSSGSADVYRNNLTIGGLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase
publication title Structure Analysis of Alkaline xylanase from Alkaliphilic Bacillus sp. SN5 Implications for pH-dependent enzyme activity
rcsb
source organism Bacillus sp
molecule tags Hydrolase
total genus 58
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2013-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ixlA00
3MFCA 1M4WA 4IXLA 1OA4A 1W2UA 1XXNA 4S2HA 5EJ3A 3LGRA 2BW8A 2VULA 1OA3A 3WP5A 3VHNA 1UU6A 1XYPA 2VGDA 5HXVA 1QH6A 3VZKA 4S2DA 3VZJA 3O7OA 3EXUA 4S2FA 3WQ1A 2QZ3A 1KS5A 1QH7A 1XNCA 1UU5A 2Z79A 2DCZA 3HD8B 1OLRA 3AKQA 3AMNA 3AKRA 3WP4A 3WP6A 3RI8A 4H7MA 3WQ0A 2C1FA 1NLRA 2DFCA 1C5IA 3B7MA 1UKRA 3VZOA 2DCKA 1XNBA 1REFA 1HIXA 2BWCA 5K7PA 1H4HA 3B5LB 1XYOA 2NQYA 3ZSEA 2VUJA 1PVXA 4HK9A 3VGIA 3AMHA 1XNDA 3VZNA 1REDA 4HKLA 3AKTA 1C5HA 3VL9A 2DCJA 1YNAA 3WP3A 2B42B 2B45X 1BVVA 1OLQA 1TE1B 2BWAA 1AXKA 1HV1A 4HKWA 2BVVA 3WR0A 1IGOA 1UU4A 3M4FA 1H8VA 3WY6A 4XQDA 5K9YA 3VLBB 3VZMA 2D97A 3VZLA 1H0BA 2JEMA 3AKPA 3WX5A 4HKOA 2NLRA 3MF6A 1H1AA 2VG9A 4HK8A 4XQWA 3WQ7A 1H4GA 1HV0A 1OA2A 2QZ2A 2D98A 4XQ4A 3VL8A 2DCYA 3VHOA 3LB9A 1KS4A 3AMQA 3MF9A 4XPVA 3VHPA 2DFBA 1T6GC 1XNKA 2JENA 1BK1A 1REEA 1F5JA 1XYNA 3AMMA 3WT3A 1BCXA 2B46X 3RI9A 2F6BA 1ENXA 4NPRA 3WXPA 2JICA 4S2GA 3AMPA 3MFAA 3AKSA
chains in the Genus database with same CATH superfamily
4BH9A 4ET7A 2WFF1 3BIWE 4WVWA 2Y0OA 4AI3A 1OA4A 3IN9A 4A7YA 5CFDC 1HB1A 1R091 5A3WA 4A2UA 2YU1A 2IXJA 3BVCA 1GMMA 3CDZB 2HWF2 1HB4A 4IERA 4Q4W2 4E2GA 1RUJ3 2YROA 5GZGA 2PA7A 3OBRA 1FPN1 4ZXEA 3SH3A 3T2TA 1FOD2 3NNJA 1KRIA 1E5RA 1AX0A 1QJY1 3WQ1A 4HANA 1QH7A 1XE7A 2UYAA 5LBCA 1W39A 1D7PM 3RZKA 1CIYA 2JWPA 5FKBA 4CUBA 1YFUA 2XLFA 2RE9A 4RGKA 3WNLA 3HT1A 4QU2A 1M06G 3O1VA 4IGPA 2HWB1 5ABJB 4LHNA 4IGOA 1UXXX 2VOXA 1V6IA 2DBNA 2UWCA 4CEWB 3LD8A 2IXCA 4XJAA 3O1UA 2WS91 3T2OA 1W8HA 4IV1A 4FPGA 3WNNA 3DYMA 1IPSA 3RMXA 1N1TA 3FN9A 2A71A 2FDJA 4EYUA 2QCSB 2XXZA 2GMPA 2YYOA 4FPHA 5J98B 3TEZA 3NRUA 4FSJA 4NVPA 2SBAA 4GWIA 2AENA 5A7WB 3ITQA 3PJYA 5AC91 1GWKA 1GQGA 2BFUS 3KV4A 4MVTA 1XC6A 3R0RA 2ZX1A 4M0NA 1Z7S3 5FKCA 3ZM8A 2JG8A 4AVSA 4YZ2A 4AZZA 4HKLA 2W2IA 2CYFA 3RJ2X 4N53B 4BXSV 3FHAA 1UIJA 4D0QA 3LOBA 1IZ3A 4W6YA 3WP3A 4OI2A 1ZBE2 4NN0A 1QNYA 3Q8AA 5JMOA 5I8YA 3MEPA 1VBB2 4LA2A 1PX3A 5IVJA 1F8VA 2YB7A 4M3CE 4YVWA 1AXKA 5B4XA 1LB2A 1WZXA 4FPJA 2WAAA 3H9AA 2AUYA 2RR13 3AL6A 3GGLA 5L73A 1CZTA 2EVXA 1VAVA 3HN3A 3PLQA 4LO6B 3AZZA 4TXWA 1AR73 1JODA 2VZQA 5FYCA 2J1TA 3H1MA 2AR6A 2X29A 5FP8A 1WLDA 1OQDA 1LOGA 2W91A 4ONUA 3I59B 4YZ5A 1Q3EA 1JYWA 1JH5A 4CCDA 5I8TA 4CUAA 3P3NA 1V70A 2BTVC 3BALA 4RS5C 2JE7A 1XNAA 1ST8A 5I0RA 4FFHA 4LKEA 4NMIA 2OW4A 4IE6A 1AJKA 4XQ4A 4AEDC 4DUWA 1OXCA 2VBDA 3B01A 1GZWA 2HWD2 3RZZA 1MZEA 1SFNA 4Q26A 4RFT0 5FWJA 1Z7S1 2RHPA 5JPNB 5GLWA 1CZSA 2P3KA 1WA6X 2W0XA 4RHV1 1RUH3 2QNKA 2OKXA 1LAJA 2E7QA 4I02A 1MZ5A 3NNFA 4C90A 2ZX0A 1Q5OA 1OOPB 4XJUA 2LRPA 4AI9A 5BNOA 5IVCA 3KD4A 4CPBA 3AMPA 5A7OA 2ZGLA 2VD7A 1W0PA 3MIGA 1WMEA 2RR11 2A3YA 3MI8A 2NPIA 3N9LA 4B7EA 5FYHA 1YUDA 2FCVA 3UGFA 4AEKA 3O1MA 4P9WA 3WNXA 5FJKA 1AR71 4NHKA 1Z0HA 2GAUA 2Q1FA 3ZN4A 5C3QA 5LA1A 1DLCA 5BUVA 5LA0A 5AFBA 1NE4A 5FZ3A 4GMP0 3VBHA 5FYZA 3OSDA 2MHFA 1O8PA 1W6PA 1QJZA 1D4M3 1HB3A 1MS0A 1ULCA 3OG2A 4Y5Z0 2XUMA 5EHDA 1VBA3 5FYMA 2ATFA 1J1TA 2JD4A 1W8UA 5JZGB 4R8HA 5FYUA 3HR9A 1ZZCA 2NYYA 4FP3A 3C7OA 4BQ5A 5C6CA 1AZDA 1PK6B 2AZ5A 1S0JA 5FO9B 2C4XA 1QQP3 3DXTA 3VKLA 2E51A 5FYYA 1VAKA 2EIGA 4H7MA 1JUHA 2C1FA 5T54A 3UNPA 3AZVA 4Y22A 2E63A 2RS12 3ZR5A 3I3BA 4Z92B 3VBFB 2XVLA 1TNRA 2BUKA 2CHHA 3H3UA 4TLFA 1R082 1MPXA 2RJLA 4JKMA 1UZWA 4JAAA 1RUH1 5DUXA 2PQQA 3BGAA 2P3JA 5FQ0A 4RA0A 4XUNA 5JVVA 1QJFA 5A32B 1W6QA 2A73B 2IWGB 5IK4A 4W65A 1VBD3 2FMDA 2HWC2 4KBZA 5DAWA 4HPKA 5LZ6A 3Q8BA 3M3CA 2PFWA 1FOD3 3WVJA 1UY0A 4PDWB 3CMGA 4Q0PA 4MSVA 1WWYA 3B69A 4B4QA 1RJ8A 4OHWA 2D6KA 2VMIA 3TN92 1H8TA 3KHCA 2A6ZA 2WWUA 5FBZA 2AH2A 1PGL2 1UN1A 5BNNC 5C7GA 4XUOA 1YCIA 1D4VB 2WR9A 1YNAA 3WINE 1CJDA 3PVNA 5EIYB 2RM22 2QVSB 4JGYA 5A3LA 3FZ3A 2LUWA 1UOGA 2PHFA 4CRQA 1VBA1 2XBO2 5LBBA 2K9ZA 2BNMA 4IE4A 1TG7A 1ZM1A 4UBHA 1HRV1 2EAAA 2HEWF 4QHOA 4XOGA 3ZFGA 2XJRA 1NZIA 2VVDA 2VJXA 4CDWB 1RUC1 1K3IA 2LALA 2VC9A 3R05A 4YPJA 1PIV2 3K4AA 3VKNA 4DQAA 2W9XA 1IPKA 2W3JA 3PU3A 2GC0A 1XSRA 4R9BA 4WVMA 2VNRA 2PAKA 1NZCA 1JHJA 2PYTA 2WSUA 4ZS2A 4HVQA 4XXPA 2Z42A 4ITCA 1QJX3 1YXWA 1VBD1 3B3QE 2EXHA 2BERA 1ZBE3 2XJSA 4KNCA 5J48A 1VBB3 1FOD1 3CIHA 1LEMA 2KA3A 4XPVA 2B7YA 2ETEA 5FREA 3ZOIA 2YBPA 3PIGA 2O14A 5CFDB 4AEJA 3O0XA 3WSOA 2ZCWA 3R6SA 3T2PA 1MVEA 1SLBA 4FOQA 2GNBA 3OJBA 4XF1A 4GZ9A 4CDUA 4OHZA 3WF2A 2FBEA 2WT1A 3MFAA 4UOJA 2GSYA 1O59A 2VOVA 4UI9L 1RUNA 2ZA9A 1O7FA 2PXJA 1LOFC 2WNUA 3C7HA 4QX7A 4X8PA 4NHMA 2GN7A 2ET7A 5FZOA 2YXSA 3KGLA 1MR5A 1SDWA 2WLPA 3CO2A 1CIWA 2D93A 1KFUL 4FPYA 5LY1A 4GKYA 1GP5A 1KGYA 1GQHA 1AYM2 2VGDA 4DXZA 3H8RA 4OULA 3ZXDA 4LR4A 3O5SA 5B2GB 3EXUA 4HG6B 3G6JB 3IIIA 5GLZA 4OI4A 1ONAA 5KHHA 2B5HA 1QJX1 1A8DA 4QPGC 1LTEA 1XQNA 1ZBE1 3BYWA 5JOZA 4A6OA 2BBVA 3ZDVA 1VBB1 1P8JA 3OB8A 4HSLA 5A7SA 1JYCA 4OQ8A 3HMYA 1IQDC 1DGRN 1UKRA 2J1VA 2WBKA 2Y6LA 3BOPA 4KGQA 5L7OA 2QTWB 1VMFA 5A1FA 1HQNA 1GYKA 2VH9A 3WW2A 1LGNA 3R4DB 3SC7X 4YGEA 5JXHA 2CTVA 5ABJA 1YFXA 2J1RA 3OYWA 5DAXA 2VQUA 2ZMKA 5FYSA 3SKJE 3FBYA 3U75A 4DUVA 4UW5A 1MQTC 4CEWA 4UF0A 2VY0A 2XLAA 1HJGA 2ZHLA 4A42A 2TEPA 2RJ2A 4N7UA 4Z07A 2BGPA 5IATA 3I3MA 2IUWA 3PVEA 1JOJA 1Z78A 2RS13 3ZSKA 1HW5A 5ERLA 1YJLA 5SV8A 1LESA 1ND2C 1X33A 1R083 3T30A 4A6SA 2CNAA 1WW4A 2MNGA 4HOOA 4RS5B 1Y9GA 2FCUA 3FHQA 3GALA 5FMDA 1G86A 2VZ1A 1OFSA 1L3JA 2P5BA 5FMOS 4AEDB 2JDYA 3ILRA 4QKFA 1CESA 1HXS2 1O4TA 2HWC3 2TUNA 3FC0A 4LKFA 5EV7A 3GF6A 1JZ7A 1H2NA 3FWEA 4B29A 4UXAA 1MVQA 3J7NA 1GSLA 3N7LA 1BHGA 1W6NA 5FFOC 2WINB 2LW8A 2OYZA 3TN93 4RFRB 3X29B 2ZHNA 3N36A 1QJU3 4GWJA 1UOFA 3KT4A 3MIDA 1O91A 3AP5A 1OA2A 2OZJA 4JC1A 1D2QA 3AXDA 2VZSA 1LEDA 2GMMA 3NWKA 2WZ8A 3LB9A 3THTA 1GWMA 5KBFA 4YGDA 4M00A 1VJ2A 1SACA 4YYOA 2XBO3 3CZJA 1O5UA 4P5HA 5F3GA 3USSA 1ULFA 2WRAA 3MGUA 3EMRA 3WDXA 3ZYJB 2XDVA 2ZGUA 3U78A 4AI8A 4RN5A 4JTNA 2MPFA 3RYRA 2YGMA 2IXKA 1G7YA 1SBEA 4AOCA 3FL7A 5CVRA 2F6BA 2RS11 1PIV3 2RV9A 4JGZC 4YW7A 1KXGA 3OY8B 3KCYA 4G3YC 3T4VA 5J96B 4AI0A 5T5PA 5FZFA 1R081 2PELA 2ADDA 3URFA 4BLIA 1NCQC 5H9RA 4COWA 2RS52 2XQXA 1ALYA 3HQRA 3MFCA 4CPBD 1PO12 3AK0A 3MHZA 4GKXA 5FPUA 4FPFA 3WD5A 2HWC1 2B4KA 3ZMNA 2DUOA 2R6QA 4LBMA 1OOPA 1E5SA 1F4HA 3GBWA 5F6LB 3RS6A 3W21A 1XYPA 1NLQA 3WP5A 4AF9A 5JI9A 1GQPA 3SEPA 2DU0A 4P08A 1AX1A 3L2HA 2R062 4EWAA 4GB32 2VZRA 3TN91 1VLNA 3B94A 5CYYA 4BQ4A 5JUVA 3D0JA 4CEYC 4ZZ5A 1XNCA 2QE3A 1PGL1 5FZIA 2GC2A 1K42A 2WT0A 2WFPA 2Q8EA 3RDIA 5J09A 5CKNA 2RJKA 1WMDA 3DUIA 1LHWA 2RM21 3SKVA 3GM8A 4NRPA 4XC9A 2A70A 1NLSA 3RI8A 2W46A 2ZJCA 3AZWA 2JG9C 2UYBA 1TME3 4URTA 1Y43B 4QPWA 5HXMA 1B35A 2XBO1 2F17A 4RR3C 4HFSA 4QQLA 5FP3A 5LBEA 3B7MA 4E8DA 2W1QA 4D3WA 3HBKA 1JUIA 5JZGA 2BV4A 5BNNB 1CPMA 2VMGA 3POGA 3ALQA 2XONA 1K5MC 2YPJA 1N1YA 4IETA 5LK5A 5BY5A 1PIV1 4AQ6A 4DRVA 4NUBA 1AYM3 4LBQB 1U5IA 3AMHA 3VBFA 5FY7A 5A3UA 1WD3A 5DMYA 1OI6A 4UFMA 1CX1A 4TSVA 1EAH3 2D6PA 2D5HA 4MOAA 4BDVB 5A32A 1GOGA 1RUOA 5FYIA 1YQ8A 1CR7A 2RG4A 3C8XA 1J83A 4D6SA 2YMZA 2AACA 1QWRA 2DCTA 3LEKA 4J6GA 1W9SA 2V5DA 3H8UA 3RZLA 3VDDB 4CP9B 4PDWA 3AFGA 1UF2C 5ACA2 2PAMA 5A3PA 1VB2A 3PVOA 1AYN3 5E89A 3MV11 3MZHA 1ULEA 3GHMA 4K21A 5LEJA 2WFF2 2V4VA 4OHVA 2VNGA 3KS7A 1H8VA 3ENRA 5K9YA 4P9LA 4B8EA 3N4MA 4IUGA 5GJ6A 3WG1A 4XF4A 5FLHA 5LA2A 4IEWA 5AVAA 3V0AB 1STMA 1QJY2 5CBLA 2A6XA 1W8FA 3PHMA 2RDSA 3POJA 5F2SA 1HB2A 4PF1A 2GH2A 3K3OA 4Z1VA 1HV0A 1ZVFA 5GZCA 2XQRA 5CIRA 5I0SA 1AYM1 1VMHA 2VBBA 4X8NA 1C57A 4HETA 4RGAA 1X50A 4FPCA 2K2SA 1K5JA 4GIQA 5I0DA 5IFTA 3SHRA 2BYVE 5DZGA 4BE3A 1L7LA 4Q0VA 2TBVA 2Y6HA 1US3A 2OUJA 1HXS3 2KXLA 4EROA 5C70A 2MEV2 4I0BA 1F31A 5FZBA 4NPRA 3K46A 3SITA 2RMU3 1YFWA 3IZOA 4YRDA 3U10A 2YC0A 4QKDA 2NMOA 4I0WB 1RUE3 4OUMA 1AYN1 3UT0A 5AC92 4K7JA 4AGRA 2W87A 2Z5WA 1N3OA 3GCXA 1UOBA 2IXIA 2UY8A 2DWRA 4DOUA 2E26A 3M3EA 3S5AA 2AREA 3IDAA 4B1MA 4PQQA 2WO2A 2D6OX 1XU1A 3FLPA 3ME2A 4GAZA 2AEZA 1UQXA 2OPWA 2HEVF 5IK8A 4X6QB 5IK5A 1RUJ2 2VNOA 4LO5B 4B1LA 2IXHA 4XDQA 3LA2A 2JKXA 4YZ3A 5JWPA 1FNYA 3E5XA 4QPIC 4QKBA 5FY8A 3LQCA 4LITA 4P9YA 3A0NA 3N9QA 4W6XA 3VBSC 2WJSA 2Y8KA 3LZZA 3VBUC 5BNPC 3TOJA 5T55A 4GMP3 1GFF2 3CU7A 1IG0A 1W2AX 1A78A 2A5ZA 3M8LA 2VOKA 3QH6A 1MQTB 1DBNA 2Y6KA 1DG6A 3RWKX 1I6XA 1LHNA 3MPBA 4AI1A 2ID4A 3PMEA 1NCRA 2RS53 4P00B 1UZ0A 3EB7A 5A7QA 3VHRA 3WDTA 1PO13 3C7GA 3MIEA 3N9PA 5GM0A 5JXGA 2DVDA 4XF0A 1V9U2 1HXS1 2VECA 1XPWA 3BN6A 1VP6A 4XZUG 3KGZA 4QB2A 2RMU1 1NOVA 1ND2B 3DYPA 2DURA 5C4WA 1RUE1 2ZGSA 3OF1A 2W52A 5FZ9A 5F3IA 1Z7S2 2CWSA 4NAMA 1RTVA 2I2SA 4QQPA 4F7ZA 5FZCA 3WW1A 3ZFFC 1W8OA 5CG8A 3E6CC 1C1FA 1QF3A 2WDBA 5C9AA 2ZKLA 2V72A 2HWE3 3R4SA 4CXXA 4EWDA 4N43C 2BEOA 3ZN5A 4PIXA 2B45X 4W4ZA 2JDMA 3ZYHA 3I2DA 2JDPA 1ACCA 2RR12 4L0PA 4Q27A 1C8NA 5G04L 2C5DA 2GU9A 2BGOA 2HKXA 1NA1A 1UY1A 3PNAA 4GMP1 1JYVA 2WLQA 3VBOA 2CY6A 1W28A 1ZZBA 2ZGRA 4MG2A 5FOBB 4L2NA 4FT8A 4A7ZA 3I2OA 2RS51 2JIJA 3F2ZA 1IKPA 3GZEA 3QLQA 1H2KA 1PO11 4RS5A 4WV8A 4ZXKA 2D44A 5FK7A 2VCAA 4N9IA 3A7QA 3WQ7A 4O9EA 4QXKA 4C0BA 4A4AA 3WF4A 4JGZB 1GV9A 1MEC3 4YM0A 1GP4A 2R30A 2Q8DA 5C3RA 3MUZ1 4HN0A 5F5AA 3VUOA 3RPQA 2R061 2KD7A 3AZYA 2BOIA 5C5UA 3JBG2 2PN5A 2YC4A 3O14A 2D3SA 4O9GA 5T50A 3HJRA 2BU9A 3H42B 4G4FA 4Q0SA 3MBWA 3AP7A 4AGGA 2RVAA 3AX4A 1F5JA 1CONA 3OBAA 3OEAA 5FXXA 3HNBM 5IT6A 1LR5A 4R52A 3W58A 4OHYA 4LHSA 3ZKYA 1JI6A 2W1WA 5H9QA 1G9FA 1LGBA 3OTFA 4W6WA 1VALA 4CEYB 1JZ2A 1O8SA 4B3NA 3U4XA 3ZX7A 3AVRA 3LOIA 4IV3C 5JIUA 3PVBB 3WCSA 4L8QA 2RS33 4LUMA 3LDBA 2OA2A 2VO5A 2JG9B 3PUAA 2JB8A 5JXJA 4BQ1A 4EN7B 4RR3B 1BQPA 1D4M2 2CDOA 3NKGA 4KI5M 5F8PA 1JZ6A 2XPJA 3P6BA 1WW6A 2PHDA 3VZKA 4XJ8A 1VBA2 5HCHA 3H8XA 4CCMA 5KXDA 1UU5A 1K5MB 1WBLA 3PL0A 4NO4A 4RL7A 3KB5A 2DCZA 5A1AA 2DYCA 5FY0A 1IG3A 1MEC1 1QQP2 3D8CA 3HD8B 1SLTA 5J36A 2MEV3 1EUUA 4YW6A 1N3PA 1W3XA 3WP4A 1EPWA 1UL9A 3S30A 1VBC3 3WQ0A 1CWPA 1OMIA 1AXZA 3WV6A 4IE5A 4Q4Y2 2VQTA 2QQOA 1S4CA 3MO4A 4YW2A 3J26N 2LM3A 5IJRA 4BU2A 3RZGA 3BTAA 2VPVA 5FZDA 2EAKA 2H6BA 4CDQA 2EIDA 4W50A 4GD4A 4GWNA 3V65A 1VBD2 4YG6A 5EPAA 3ZPYA 3ZXEA 4COZA 3GNEA 1WLWA 5FPZA 2P1BA 2YG0A 4SBVA 5EZWA 2FZ1A 3D0SA 3RSJA 4UT5A 2K0GA 2VNVA 4PCRA 3AKTA 4HBNA 3DCQA 3ZYGA 5BNNA 5JOWA 2R043 5FP4A 2VZOA 3U07A 1PMJX 3WQBA 1W6MA 2CSGA 3VB9A 2C26A 1RUI3 5CEHA 4LBQA 4OQ9A 1K12A 4L92A 1S0FA 2ARBA 2C9AA 4TTGA 3LDRA 1V6NA 2ZAAA 3P5BA 1V9U3 3NJXA 2ZACA 2ZTNA 4QGMA 4DRRA 1UXZA 2MEV1 4QXCA 4P14A 2JD9A 3OUIA 1VBC1 2FD8A 3NAPC 3IMMA 1ZZ7A 4B7KA 4XXAA 3W20A 2VMHA 4YZ4A 5E6HA 1IQAA 1S0BA 3WEZA 2VR4A 2BNOA 4CP9A 1HN1A 4XHBA 3E5QA 2O1QA 3VBRC 4D6QA 3IPVA 3KT1A 1J3RA 3LCPA 4WM7C 1TQ5A 5G05L 1SCSA 1QJX2 1R64A 4YVSA 5L19A 1RUJ1 3B02A 3Q8CA 4KG8A 3ZIWA 3LA7A 3IMNA 3LFMA 2OVUA 3VHOA 2PHRA 1SZBA 2Q5TA 2W47A 1NE6A 2Q1ZB 2WNVA 4QPYA 1YIPA 2D7FA 3MF9A 4CUCA 3O1TA 3NNGA 4XJZA 4UFIA 4E4HA 1KJRA 4QB1A 1REEA 2Q4SA 1W0NA 3RZHA 3WT3A 1GP6A 2Y26A 3WF0A 1RUI1 3DXUA 4WBBA 2A7AA 4QQOA 1URXA 4FQZA 5GLTA 3O12A 1ENXA 5APAA 3EHKA 4LIVA 4QPIB 3OGSA 5EFUA 4H2AA 1EP0A 1FNZA 1JZ5A 1LOFA 1S2KA 4TLGA 3VBSB 1HJFA 1V9U1 1ZZ6A 2WSVA 1RUD3 1ASJ3 3VBUB 5BNPB 2YFUA 4DIQA 2VW1A 1MS1A 3MLJA 4YSFA 1K45A 1LJ7A 4UW3A 5LY2A 2Y38A 2ZZJA 1YHFA 3JBG3 4JVAA 3SH4A 5FIXA 2H0BA 2CDPA 1MS9A 3W9AA 3ACLA 1EV13 1KS5A 4QPGA 2HEYF 1G9AA 1A3KA 1VRH3 3Q8EA 4WZCA 5JAXA 4FAGA 3AMNA 4A3ZA 5IWFA 5JI7A 1OLMA 2HBUA 3I8TA 5A70A 2KM2A 3OGJA 3BTYA 2WQ8A 4FPEA 3LIHA 4K40A 1H30A 3JB8A 4JQRA 1NKGA 3I2KA 4LBOA 3SXWA 1PGSA 4ES9A 4PI2A 4AQSA 3ZFFB 2CAUA 2P37A 4MLOA 5DAVA 1JS9A 4K8FA 1NXMA 4J1WA 2XH6A 4FOYA 3OCPA 2WN3A 3WDUA 3QACA 3HNYM 4N43B 3FUOA 5FXVA 4LBNA 1FMD3 4PIZA 4QX2A 5FY4A 5FWEA 4D6RA 2GP3A 4GALA 1SBDA 4Z82A 1GNZA 5FOJB 1RUD1 1SMVA 4ARYA 3B93A 2HYXA 3NQHA 1US2A 2OS2A 2X05A 3U1XA 3WW4A 4NROA 1R1A3 1PVC2 5JSRA 3KV5A 1ND2A 3JBG1 3T4HB 3O0WA 1HX6A 4XTPA 3DPRC 2JJ6A 1BVVA 3TEYA 4Q4Y3 2YC2A 1EV11 4PI0A 2BWAA 5EYYA 4C1WA 4HKWA 3KWVA 5K0UC 4P9IA 1W6OB 2OQ7A 1Y3TA 1VRH1 2WYSA 3NV3A 1WGPA 4LTAA 4UW6A 2WA3A 4V1PA 5GZFA 4LOTA 4ARXA 4BXFA 5FUPA 5CFCA 2G19A 4BCUA 2VMDA 2UURA 1F9KA 1XSQA 4I0AA 2BFUL 3VLBB 2GC3A 5F5QA 5LATA 2XL9A 5F5IA 3SQOA 1OH4A 2OX0A 4K3UA 1Q8PA 3J4UH 4LKDA 1H1IA 1QKQA 4YM2A 1RMU3 5FZKA 4HKOA 4EN0A 4M4PA 5CG9A 1QJU2 3ACFA 4LHLA 1W99A 2ZX2A 3MIFA 1VR3A 2WUHA 2QQPA 4P9GA 4ZU7A 5LEKA 1GOFA 1D4M1 1FMD1 2A6WA 4J1XA 3GZUC 1AR83 5CU1A 2DCYA 3KCXA 5JCTA 2PQSA 4YM1A 5IK7A 2C9KA 2XR4A 4FPOB 4L9BA 3UGHA 2G9ZA 1QIQA 3POSA 5FPAA 4IV3B 5CA6A 3CEWA 5FO8B 2ENRA 3I49A 2ADEA 5IAXA 5JXIA 1J3PA 1QQP1 1Y9MA 4LOSA 1CAVB 4OMDA 1RUF3 1XYNA 2FQPA 3H3ZA 4KWUA 1WMXA 3ZSLA 1DQ2A 4FO9A 3AP4A 4OI1A 5EJ1B 5FZ1A 4OYUA 1VMJA 1SLCA 1ZRRA 4Q4Y1 1NCQA 3ZO0B 1UYXA 1JYNA 3VDDC 3IDEA 4ZZ8A 2Y6FA 3NV2A 2VUDA 3AKSA 2ZBJA 1SPPB 2ZGNA 3WNPA 3MDPA 1M4WA 2VU9A 1XOYA 4YLZA 2YGLA 4B4PA 2BOJA 5KR7A 2VULA 1RUG2 4N9HA 4XJ9A 4XCBA 1S0EA 1Q8OA 4AXOA 5FP7A 3LPFA 1CGPA 4G9SB 1RXGA 2B9VA 2P17A 4XIOA 4CEYA 4ZS3A 3RZJA 2A3WA 1U5ZA 3PJQA 2WO3A 5JSOA 4Y5TA 4R9AA 4CTEA 1O3RA 2VTFA 4U2AA 1ENQA 3AYEA 5T5LA 5IUQA 2E7TA 3LSDA 1POQA 1AR81 4XUTA 2JG9A 2YV8A 4YG3A 4AG4A 3OUHA 4MZUA 4XHXA 1TME2 4RR3A 3VD5A 2P2KA 4A3XA 4UFKA 4Y20B 1N1VA 3EQEA 3C2UA 1UYPA 4JRLA 3VV1A 1GNYA 1RUF1 1K5MA 2R32A 2ZXQA 3BTXA 1HIXA 3KV6A 2R0HA 1LODA 3B5LB 3CNAA 4OLLA 2VUJA 2ZGQA 2XUEA 4F83A 4XTMA 3N7JA 3AVSA 2JX9A 3NMBA 4Q4V3 5DABA 3TRSB 1J59A 4HK9A 3VGIA 1UO9A 2VOWA 3UJOA 3VZNA 5L9BA 5BYNA 5AC93 5A6YA 2DVBA 5GALA 1EAH2 2C24A 1KJLA 3ACGA 3OBZA 3OD4A 1QGLA 4MXWB 1ZBA2 3NAPB 3EYPA 4JKLA 2ZHKA 2IFRA 3AFKA 5FZHA 4Y4RA 1OD5A 1DFQA 3IM0A 4XMAA 4YFZA 3VBRB 4M3CF 1JBCA 4NRMA 1T2XA 2WWSA 5C3PA 1TE1B 3MW4A 2GMEA 4QB6A 3E5UA 4YNIA 1AYN2 4BIOA 3ZKUA 3AYCA 3PIJA 4WM7B 3KVBA 1CJPA 1LU1A 3WDWA 4AFAA 4OZXA 2HLEA 3VD3A 1IOAA 3SCGA 3M4FA 4BM8A 4PBOA 5IVBA 2VVFA 1OLME 2W5FA 2QQWA 1BKZA 5F6KA 4UFHA 2W39A 3H50A 4XYXA 1OC1A 3OGRA 4CUGA 5BV6A 4UBGA 3KLSA 5BNOC 4M3CB 2I45A 1WLCA 2VG9A 1LCLA 2JDZA 4XQWA 4ZPIA 2NZ9A 4FP2A 4XDPA 1LOCA 3TWIA 4CSWA 4DY3A 2J1AA 4QQ2A 4BHPA 1PVC3 4K1ZA 3C7FA 4RGGA 5A7WA 1VBE3 2ZX3A 4Q4V1 2R072 1XE8A 1PNFA 1S2BA 3U14A 1LHOA 1QOOA 2XKOA 3E6BA 4UAPA 2VZUA 2EALA 4IEZA 3DECA 4W8JA 3TEWA 4FFFA 3ZIXA 4N53A 2WO7A 4TWTA 1BBT2 2GDFA 5JR2A 4MO3M 4JX0A 3APBA 1W2NA 1BZWA 3D82A 3TNPB 1AHSA 4LQRA 2RMU2 1G9CA 1PGW2 2R0FA 1KEXA 5DDJ2 4IGQA 3NNMA 1OPOA 1RUE2 2E9QA 4IESA 1LENA 2Y60A 4DEQA 1UMIA 1CD3G 1CAUB 1C1LA 4ATFA 4CP2A 2QDRA 3J8F2 2P3YA 5DUUA 3GZAA 1JYTA 4I30A 3I59A 4FFIA 2E33A 4QPIA 4QDQA 2E31A 5GZEA 5DG2A 3PTRB 1W06A 3MLLA 1QOSA 1J1LA 3VBSA 4XJWA 5LW9A 1CAWB 3ORJA 1HKDA 2QZ3A 3O0VA 1DZTA 2EXJA 3ECQA 1UMZA 1UYZA 5K4LA 4XW3A 2NMNA 1V6JA 1PVC1 2VMFA 4E27A 2OQ6A 2VQ0A 1VBE1 2W1SA 1BMV2 3AC0A 4FQ4A 2ARCA 1H8TC 3P1IA 4TN7A 5LA9A 4XBLA 3QBQA 3KV9A 2ET1A 1PNGA 3PMSA 3JXSA 1C5IA 2DVAA 3UGGA 3IIAA 4NHYA 2R7EB 1WBFA 5GLUA 3WCRA 4JGYC 5LRSA 1WCUA 3AYAA 3BODA 3T3YA 5HCBA 4JHZA 2NQYA 1RUG3 1YC61 3ZSEA 5KC5A 2QQUA 4R9CA 4AVBA 1F35A 1KFXL 3DPRB 2D6MA 3ZFGC 3POYA 3AJZA 2BPA2 1N3QA 4NIHA 3D6EA 4C8DA 1SCRA 5K0UB 1CQ9A 1QJU1 1DYPA 3WG3A 1QMJA 3POBA 1C3HA 3R4UA 3RRDA 2PHLA 1UZVA 4UYBA 1ENRA 4L97A 1ULGA 1VIWB 2HBTA 2Z4FA 3VKMA 2V09A 1DZRA 3HQXA 4AEMA 1NAEA 4N43A 2HWE2 4HONA 2Q8OA 4IEQA 2WL1A 5BXXA 2YBSA 1TMF2 4QX8A 2JDHA 2XWJB 4LKSA 1OLQA 5FZ4A 1IS3A 3WG2A 3LAGA 5FLIA 4KQ7A 2TNFA 2CV6A 1HDKA 1MS5A 2C6SA 2G1MA 4KWLA 1PK6A 4FOVA 2PAEA 1Q8VA 2PHTA 3BOWA 3GCWA 5A6XA 4Y1ZA 3RWNA 5I8SA 3WY6A 2P6HA 4OUEA 4YGBA 5FZEA 2YFZA 5D8AC 2R49A 5EWSA 4D8MA 5C33A 2WYFA 2D97A 1N1SA 5HV4A 5HPOA 2VL4A 4LBLA 1U12A 2QQIA 1ND3C 2JEMA 5FXZA 1S0CA 3UV9A 1N47A 4Y1VA 2NLRA 5FP9A 1W6OA 5A6QA 5F3EA 3ZYRA 4LO7A 3O1OA 1DGRA 1Q43A 1Y9QA 1UOJA 1ZBA3 1RUG1 1H4GA 4ASMB 1MEC2 2PLV3 1WCQA 2WNUC 4LJHA 4OCTA 3N7MA 4OHXA 2D3PA 4YWAA 4BISA 1CN1A 1UPIA 4LEJA 4MV2A 5GZDA 4FXGB 1G9DA 1QDCA 2ZMLA 1OD3A 1QHDA 5E88A 3T0BA 5FMOL 4LK7A 2CGPA 3GYDA 3GZTB 4XUQA 3OUJA 4H7LA 4AVCA 3JU9A 4AK3A 1BVP1 5AVPA 1UY2A 1GBGA 3AMMA 3I2JA 1CAXB 2DUPA 5B4NA 1RL3A 1UX7A 3CJXA 1TME1 3DEMA 2D5FA 3ZVXA 1DU3D 2VE1A 1LRHA 3ZSMA 4P02B 4R4XA 1W8NA 5FYBA 4AI2A 3JQWA 1LHUA 3MW2A 5CKQA 2ZGPA 5A7NA 2QQLA 3K77A 1KDKA 1JXNA 2WQ4A 4AHWA 1CAVA 2RS32 4MGQA 4CDWA 4IEVA 4HN1A 4CU9A 1W2UA 5F32A 2X53S 4MYEA 4NHLA 1ZRIA 4Y1UA 1ZNPA 2R073 4LK6A 3NL1A 5L7OC 2WO1A 3ZXKA 1UD1A 1JYIA 1UU6A 1JZ4A 5EQUA 5FBJA 1LOBA 2V4AA 5GLVA 4I2OA 1EAH1 4IL7A 2H6CA 3NNLA 5IVVA 5F5CA 3KZ4C 5L36A 3V0BB 1A6CA 4QKNA 1ZBA1 3FLRA 1BBT3 3POFA 2Z79A 1WA4A 5A1LA 2PLV1 4COVA 4NIIA 1OLRA 3AKQA 3VDAA 2YBKA 1UX6A 3PDQA 4F3JA 1XNTA 1VBC2 3M7AA 3OD0A 5IAVA 5DDJ3 3ZFEC 1POV0 3KHBA 2V5YA 2DFCA 5CISA 4IEYA 5DUVA 5KXBA 3ZLIA 4FCAA 5T52A 2W92A 3V64A 2HJIA 5CFDA 4A41A 4AHZA 3ELNA 5E1RA 2RDRA 1ZREA 4M01A 4M4RA 2VW2A 3J8F3 1CVNA 3WUDA 2XJTA 1DYOA 3HVDA 4IEXA 4HZFA 1VB4A 3TYJA 1AJOA 2F4LA 2W95A 2EXKA 3NKTA 3CQOA 4Y20A 3WHTA 2X5IC 1DQ6A 5FYTA 3I2GA 1REDA 1G8WA 2ZKNA 3QOPA 4XILA 4KWKA 1O5LA 2R042 1F5FA 4J25A 3H1YA 5A33B 3ZYFA 2R071 4XZPA 1IPJA 1RUI2 1YWKA 2DCJA 3SH5A 4EJRA 1TEIA 3SEEA 4WZFA 5EYXA 5BNOB 4MGKE 2EICA 1KDMA 1BEV2 1W90A 4IEPA 3D3AA 3SCFA 3TAYA 1BBT1 4LA3A 4EV0A 1S1AA 2GN3A 2WZPP 3WZ1A 5HBAA 5FTTC 4FPLA 5IYYA 3NAPA 2VZPA 4XIKA 4V2WA 1PGW1 5FUIA 1DYKA 5DDJ1 4QX0A 4CCJA 3NV4A 4DINB 3VZMA 1DDLA 1NG0A 3EBRA 4HLTA 1OSGA 1PMIA 5FUNA 5IVYA 4Q0UA 3MIBA 3LPGA 4RQPC 4EN9B 2BZDA 3WX5A 3MF6A 4O7XA 1DZQA 4I09A 4HK8A 1YLLA 4KGGA 3J8F1 4OZOA 4QWNA 4QXHA 1X8MA 1UWWA 2A3XA 5FV3A 3RGBA 1WCKA 4DMIA 1TMF3 2XGXA 4L11A 2EIBA 1AL23 1SEFA 3AB0A 4UWDA 1G6NA 1KS4A 2VVEA 3I7DA 1HRI2 3NV1A 2GC1A 4Y22B 3JCIA 4LUKA 5IW0A 4JQTA 3ILFA 3PUSA 4GWMA 4ZKTB 1AF9A 3HT2A 5FZAA 5HCFA 1BMV1 3K3NA 5LK7B 2VCCA 3WLUA 1G9BA 4B4RA 4JHTA 4WM8C 1AR93 1FX5A 1W6QB 2VZTA 4DB5A 5C8WA 1I1EA 2AC1A 3SCHA 4YW5A 2PHWA 1WCDJ 1SQ4A 3BPSA 1QXRA 1ASJ2 1RUD2 4NE9A 2BNNA 3CZUA 1B35C 4AEDA 2DTYA 3ES4A 1I3HA 3FMGA 1D2SA 2DDUA 4L99A 1RGSA 1AXYA 1H8TB 3Q8FA 3LGRA 1DHKB 2O0OA 2BRTA 1UPSA 4Y33A 2ZX4A 2CAVA 1S2EA 5FCCA 3DV8A 4JDNA 4CCOA 5ISLA 3H8OA 4JGYB 4NOTA 1EV12 4XFHA 3ROUA 1JTZX 1D0GA 4Q5OA 4QGLA 1VRH2 3M3QA 1RHI2 1SLLA 3WF3A 3THCA 2HWE1 4QDRA 2FDKA 2VUCA 1FATA 3ZXFA 2CWMA 1TMF1 2YZ4A 2ZZQA 3VD7A 3ZFGB 3M3IA 3W5MA 4FOWA 1F4AA 2WABA 2XWBB 3WP6A 3ETQA 5F39A 1SG3A 4DXSA 3IBMA 5EXOA 5KXEA 5J3UA 3W59A 3ZPOA 1CAWA 3VZOA 4C91A 1H9WA 3CF6E 4WVMB 2DCKA 4EZ4A 1REFA 3UKVA 5DZFA 4U36A 3KT7A 4OI0A 4HT1T 1AR91 4E4SA 1JMUB 1LNSA 1PVXA 2BQPA 1FMD2 2Y34A 2VOTA 2ZGOA 3MIHA 1VAMA 3OY8A 3S7IA 1BK0A 2IVJA 1MS8A 1R093 2DU1A 1AR63 1XNDA 1FV3A 4LT5A 1YEWA 3OPTA 1Q8QA 1GU3A 1U5XA 2JIGA 3K75B 3ZDSA 2QQJA 4AYUA 4URAA 1C5HA 2HYKA 3BPZA 1RVF3 1A8MA 4PLMA 1CX4A 1R1A2 5D8AB 1YQ6A 2DF7A 2ES3A 3ZYIB 3DPRA 4UW4A 1ZZ9A 4DNYA 1APNA 1C28A 4MGYE 1SLIA 1ND3B 2HWB3 2GH8A 4ORFA 4GA9A 5K0UA 4COYA 5I91A 1QNWA 3MYXA 1PMHX 4RD7A 3AP9A 2P3IA 3WR0A 2WNUB 1IGOA 3IAQA 3CHXA 2CGOA 4MGZE 5FZOB 1W05A 5FO7B 1O4YA 4QX5A 1W2TA 1JW6A 4BJ0A 2XJVA 4AFDA 1WW5A 1LULA 1OQEA 1GR3A 3VD9A 1RMU2 3CL1A 3DKQA 5FZ8A 4GH4C 2RS31 2QQKA 4OFGA 5I0TA 1KQRA 2WNOA 4BB3A 4GULA 2VQAA 4PQ9A 4E8CA 1Q8SA 1AR82 2P4EA 4FI9A 3S57A 3LFIA 3HWJA 3AMQA 1AR61 2WC2A 2W08A 3JD72 5JR7B 1BEV3 1JU3A 2Q8CA 2IVIB 2YY1A 3OPWA 5DQ0A 4FTBA 1A34A 3KMHA 1RVF1 2WZR3 1RUF2 3EO6A 2C0ZA 4BQYA 1B09A 5L7OB 1COV2 2BBAA 5D2AA 2J42A 3RI9A 3ON7A 3GDBA 3QD6A 1H6YA 4QU1A 1RINA 4LE4A 4PLOA 4YW3A 3VDDA 4WVVA 4XABA 3BB6A 3OYWB 5T3NA 1DCSA 2CL2A 3ILNA 3I3EA 4P9JA 2WN2A 2VW0A 4N90A 4PIYA 4QM9A 1PZ9A 4UF0B 4XVHA 5KC6A 4AVAA 3RZMA 5FY1A 3KQ4B 4HXCA 4NPMA 2B9UA 2A75A 1NCRC 1WMFA 1CAXA 1PO22 1X82A 4GQ7A 1XXNA 3O1RA 1AVBA 3ZFEB 4UFJA 2G9GA 3K51A 1OA3A 3VHNA 1RC6A 1JYXA 3A4UA 4LLOA 1W8WA 1HRI3 5A3MA 3C3VA 3TBDA 4DXRA 3V0AA 3DYOA 1QH6A 2ZEXA 2XHNA 4D7SA 4S2DA 4ISQA 5J1XA 3S5QA 5FY5A 5M0TA 1EY2A 2R041 3ES1A 3HOBA 4JV4A 1DQ1A 2Q0AA 5C4WC 1SFPA 1DF0A 2ZHMA 3UL2A 4TZDA 5J7MA 1L7RA 2ZAHA 1HQLA 1V0AA 5ANNA 3BCWA 4IE0A 4RHV3 2CGNA 5LASA 3VDBA 5FMCA 1IS5A 2X5IB 4NJ4A 1BEV1 4Y1XA 5C9AC 1U0AA 3I4IA 3EJKA 2OZ6A 1FV2A 3V0BA 3T0AA 4M0HA 2OPKA 2WZR1 1W6NB 4CDXC 1ZRCA 3OGGA 1HN0A 2XL7A 3RYKA 2AGSA 5ANQA 3H0OA 1ZA7A 1NA1C 4Q4V2 4IDZA 4IEUA 2J1SA 4Q0QA 4QQHA 2ORXA 4Q4X2 3VBOC 3UESA 4FVVA 5DAQA 4LNVA 2HH9A 5H9PA 3D4KA 1DQ4A 4K20A 4INDA 1RHI3 2DTWA 2I07B 2VTXA 1X9PA 2PHUA 2XMLA 3LWCA 3PURA 4FXKB 4XAEA 3RQ0A 3UKTA 3VKOA 3GJAA 1LGCA 4BQ3A 1J84A 1HRI1 4P5YA 1V00A 3KQRA 1RYYA 3UK9A 1DGLA 2B42B 4RQPB 4AHYA 2BJSA 2VM9A 2WAOA 3H7JA 5F9TA 3BU7A 3GBGA 4LHKA 4EN8B 1J58A 3H1WA 2GZWA 2ARXA 4FAHA 2QKDA 3CJIC 1YJKA 2JECA 5A33A 4R9DA 4GXLA 1YQCA 4JKKA 1MQTA 1Y7BA 1ENSA 1MS4A 2E6VA 5IHRA 3VKFC 2ZS6B 2W68A 5CZKA 2D3RA 2D6NA 4ISRA 3WNMA 2ZGMA 1W04A 4KL1A 5FZ6A 1ASJ1 3VZLA 1E5IA 1H0BA 2WQZC 2YDEA 2O8OA 2JDKA 5FZLA 1H1AA 3FLTA 4E2QA 1GKBA 1OUSA 4JRAA 4Q2FA 4LO8A 4XFAA 4YZ1A 4WM8B 4BQXA 4DPNA 1LECA 2LS6A 1HLCA 1VBE2 2XOMA 3B9CA 3ZYBA 2QZ2A 2ZEZA 1X36A 2D98A 1H2LA 3DN7A 3HBZA 4META 5LB6A 3VL8A 2XJQA 4MH0E 4CU7A 4DXTA 5K8SA 1E5HA 1B35B 4XFFA 2Z69A 1RHI1 4JCKA 5AFEA 1W8ZA 4IEOA 1GZCA 2AYHA 4NWWA 3LEGA 1YQ5A 5L9RA 1ODMA 2B46X 4X6RB 1V6KA 2FDIA 2E53A 1HRV3 1C8M3 5T5OA 2J7MA 4FTSA 1W9TA 1LOEA 1I9RA 1RUC3 1JZ8A 4Y1YA 3BI3A 4K8RB 5A80A 3CKHA 4JDMA 5LCWL 3MV01 4ASLA 4SLIA 5D1IA 2CU5A 1FAYA 4Q1PA 1ZA4A 4XFIA 3T1MA 4LLFA 1GZ9A 4S2HA 5EJ3A 1D0HA 2ZMNA 1RXFA 4AHXA 4AWDA 4QX3A 5C71A 3BUCA 4ZY9A 4CDQC 3JD73 2HWF3 4Q4W3 4BOWA 3DKWA 5HXVA 1NQDA 3UKNA 2OIIA 1J3QA 1XB9A 4S2FA 3ZXJA 3OGVA 3PTYA 4I3PA 3U37A 4AFMA 1FT9A 3LIGA 5CADA 3SMHA 4WVZA 5KHKA 1NY72 1NT0A 1R1A1 3IT8A 4JGZA 1COV3 2V73A 4I3GA 3ACIA 2L9LA 3M70A 3ZXGA 4LBJA 2UU8A 2W1UA 2Q1MA 4NIDA 1DQ0A 2DVGA 1ULDA 4MGSA 1IKQA 3J7MA 1HQWA 2ZGKA 4D7YA 4Q8LA 1PO23 5F1RA 1UIKA 2BWCA 4IV1C 4ASKA 1SFYA 1MZFA 2JE9A 1H4HA 2LROA 3ABZA 5F2WA 5E8AA 1C8M1 3NSTA 1POV3 2GNDA 1XU2A 1RMU1 2RDNA 1X7NA 1O3SA 3P3PA 3ATGA 1IS6A 3WG4A 2AEYA 2QBXA 3LA3A 5IVFA 3ZN6B 1GLHA 1H2MA 2D6LX 4XETA 1PX4A 4BYYA 1IS4A 4KMQA 2E32A 3KVAA 2JG8C 3HN1A 3KCCA 3VL9A 3M2MA 3USUB 3G7DA 3DGTA 3JD71 2HWF1 2VMCA 3FJSA 3I3DA 1C4RA 4H55A 1SLAA 4Q4W1 2PMWB 3JB4C 4YVSC 1F15A 4FTEA 1OKQA 1X9TA 4GH4B 5A7PA 1HV1A 2GNMA 3ZYPA 4CZSA 2WZEA 3B00A 4YVWC 3UJQA 3N9NA 1OF3A 4E9KA 4Y24A 2WNVC 5HI0A 1COV1 1VPHA 4OVEA 1QDOA 5F37A 3MICA 5C5TA 4F8AA 3NO8A 2XKPA 1XJAA 5D8AA 1QXJA 3AJYA 4K9SA 4Q4X3 3LDKA 5CNAA 1ND3A 3IAPA 4DZGA 5KWRA 1E57A 1UKGA 4AQTA 4BMBA 4TYSA 5C8CC 2NM1A 1PO21 4MADA 2ZABA 4H3WA 2BGCA 3BU0A 3UYJA 4YGCA 5TSWA 5FMBA 3SLIA 2PLV2 1POV1 2WKKA 1BYHA 1QY4A 2VXRA 5DZEA 5JLVA 4UFLA 3TB0A 1KITA 1SHWB 1KD7A 2HWD3 4OMCA 2OXBA 4E4DX 3F95A 4LBQD 4IQPA 1XNKA 1BK1A 1GANA 1JN2P 1NCRB 3NJZA 3IDCB 3WDVA 2FDHA 4HVRA 1ZZ8A 4NIGA 1JU4A 3AYDA 1RB8G 2VMEA 2JDNA 1QU0A 1FYUA 3ST7A 4EE2A 5C4WB 4LORA 1PM4A 2B39A 4XFGA 3LE0A 5C3OA 1U5YA 1RITA 3A22A 5H9SA 4QAWA 4NAOA 3KSCA 5DAPA 5FK8A 5F7UA 2QQMA 1UW8A 5BPXA 3MPPG 3BKZA 2FCTA 4JZRA 4CXYA 4ZU4A 4Q4X1 5JPMB 5C9AB 3FBMA 4KBBA 2WNEA 3A0KA 3FFZA 3VBHC 1H6XA 1QXPA 1BJQA 1SBFA 1YO8A 1ZYBA 4RSUA 5BNQA 4CDXB 5DUWA 4P9XA 4XACA 4XF3A 4XMIA 1ZX5A 2IC1A 1LKNA 5FY9A 5HCAA 4MHUA 4PBPA 4LE3A 1NA1B 4CCLA 3ZFEA 3OEBA 3VBOB 2QUOA 4HL0A 4YG0A 1ZRDA 2UWAA 2HWD1 3RNSA 1QOTA 2WIIB 3HEIA 4FPKA 3ASIA 4LULA 4EZHA 4QM8A 1X8EA 4BK4A 3WNKA 3J7HA 3OPZA 4Q29A 1YQ2A 1IHMA 3WDYA 4COUA 1XE0A 3SNMA 2J1UA 5KHGA 3AXEA 3MW3A 4BZ4A 3M3OA 1V6MA 1XRUA 3HQUA 3IWZA 4XF9A 4CYDA 2VCBA 1T6BX 2IXLA 4LPLA 2X5IA 5CFCC 1O3TA 4KWJA 4XURA 2PTMA 3VBUA 5BNPA 3FE5A 5JMCA 5HV0A 2GNTA 5JOYA 1WCSA 1DGWA 1UY4A 3CJIB 2QQNA 4QT6A 5JDBA 5FLJA 1OT5A 3CLPA 3RFRA 2A1XA 1UNBA 3JZVA 2N7GA 2JKBA 1JZ3A 2FDFA 1JOPA 2UY9A 4H14A 2D40A 2RM23 2YPDA 4EWEA 4AW7A 3T0DA 1BLZA 1FXZA 4AFCA 4QX1A 3A23A 1PM7A 1O6UA 1W2OA 2DVFA 4D7TA 1UU4A 1DQ5A 2FMYA 3CBNA 3AL5A 4XQDA 5E16A 2UWBA 2NN8A 4AE2A 2ZOEB 4CVUA 1OVPA 2OT7A 2PHXA 3E6DA 4D94A 3GXUA 4Y4YA 3WUCA 1I5ZA 4RQPA 5D21A 3WHUA 3I54A 3JQXA 3O1PA 3ZFFA 4XFBA 5SV5A 4CP0A 4MHRA 4BIFA 1BXHA 1CPNA 3LEIA 1OBNA 2LTNA 4DFSA 4Z2WA 4Z8BA 4K6BA 3M1HA 1AL22 4NWVA 4KH9A 1O3QA 1OFNA 3GHNA 3S7EA 4E4ZA 1NX9A 4NIAA 1SDDB 4KU8A 2JXAA 3E1F1 4Y26A 4A45A 3HIFA 1NY71 1DIWA 2DV9A 3AP6A 2WT2A 4GJZA 3L9JT 5FZMA 3NVCA 2FHRA 4XDOA 2EIEA 4WM8A 3TEXA 4I01A 1BCXA 1AR92 4CDQB 2QJVA 1L7QA 3J9SA 4NR1A 1JHNA 1XBFA 1R1ZA 3RJRA 3K2OA 3PU8A 4N7IA 4CDUC 1EUTA 2QQVA 5F3CA 3Q9OA 3KF5A 4AGVA 1GICA 3I2HA 4D69A 1DLLA 3KF3A 4IXLA 4PHZA 5FPLA 3MLKA 3ACHA 3PUIA 1OPMA 3POIA 2A6YA 3VD4A 3JUUA 3T1LA 1OH3A 4GJYA 5DN2A 1W6MB 1OVSA 3DL3A 4CCEA 5JIAA 4BQWA 5J37A 2JDUA 1S0GA 2ZEWA 3VZJA 2EXIA 1RIRA 5T5JA 4A44A 2XVGA 4IV1B 2JE8A 4IW3A 4DUXA 2DBIA 4C0HA 4HSJA 3GBFA 3NJYA 4BLJA 3N9OA 2VZVA 3K4DA 4R4ZA 3D5OA 3RG0A 2VZ3A 4Y3OA 2XLGA 1NLRA 4QMAA 1W3VA 4IV3A 2ERFA 4HVOA 2G4IA 4XE9A 2JDAA 4FFGA 1Q56A 2JG8B 4AFBA 3POWA 3E97A 4KG0A 1LU2A 1UMHA 4AR2A 5K7PA 1W0OA 3IPVB 3TNQA 1XYOA 5FJHA 2QFEA 4CCNA 3QH7A 3QCWA 4YVSB 5FYVA 3T2QA 5C8CA 4NHXA 4BWOA 5CAZA 5JSPA 1R092 5ABJC 2J22A 3L2YA 1AR62 4LO4B 4YVWB 1SPPA 2ILMA 2X09A 2WNVB 4YFWA 1FPN2 5FRAA 3C7EA 4E2SA 4CEWC 1OUXA 2P34A 3BTZA 4JTOA 1RVF2 3V56A 3K4ZA 1GOHA 3A21A 5EJZB 4QGNA 3RVHA 2BP6A 4QD2A 4QDSA 1PZ8A 4XEZA 4A7KA 2R1DA 4LXLA 2HWB2 3IDBB 5C8CB 2X8KA 2FDGA 3SISA 2J1EA 2WA4A 3HPNA 3ZN6A 2GP5A 4ZONA 3N9MA 3N35A 2WS92 4PT6A 1CZVA 4XUPA 1YI7A 1GUIA 1OQ1A 1PHMA 1ODNA 1PZ7A 2VAUA 4CP1A 1LOAA 2XJUA 4V2VA 3USUA 3NW4A 4N53C 5I93A 5IVEA 4PF5A 5A3OA 3INAA 4O65A 5FPBA 2VXJA 1GZWB 4GH4A 5FZGA 3FFQA 3ZMOA 2XB6C 3FHIB 2GALA 2Y0IA 3VN4A 2ZGTA 2JB4A 2VTXJ 1WKYA 3B9IA 1TZOA 4QPGB 1S0DA 2VUAA 4BK5A 4CE8A 4ZU5A 3J7LA 1MS3A 1WUVA 2H0VA 2ORZA 3FX3A 3NJVA 4DS0A 5L9VA 1WW7A 3WW3A 1YFYA 3U11A 1MACA 3H3LA 2ZPXA 5LBFA 1W03A 2EF6A 4Q1RA 2DFBA 4O61A 2Q30A 4MXWA 2JENA 2WZR2 5FXWA 1YRZA 4BPZA 1AL0G 2ARAA 3ETPA 2SLIA 3POEA 4XFCA 3O1SA 3GJBA 4PJYA 5LRRA 2Z2SB 3VBHB 1JOBA 1QJEA 3VBRA 1W6PB 4CCKA 1GWLA 1NUKA 2WWJA 4XBQA 4S2GA 3RMYA 2E7AA 4MUVA 4WM7A 2B8MA 4NRQA 1OHFA 4AQ2A 2Y33A 2YUEA 2XVKA 1F2NA 3WOGA 1RJ7A 4PLNA 4CU8A 3ZXAC 5LWBA 1FI2A 5A6ZA 1WLTA 1ZRFA 2XHKA 1UCXA 1YYNA 2BW8A 4XBNA 4YM3A 2OUHA 2XJPA 2KR2A 1EPZA 5KHJA 4ZHNA 3MUY1 4ATEA 3AZXA 3VDCA 1OOPC 4AAXA 1H1MA 4M3CA 1MZ6A 1ULPA 1TVGA 1UZYA 2R063 3O7OA 1GNHA 4GB33 4CA9A 2QDNA 4AVTA 1LHVA 1H9PA 2Y64A 4LBKA 4DEVA 5FQ0B 4RHV2 2BVBA 4Q8KA 2XG3A 3AKRA 3I2FA 4HMZA 3ZR6A 5CFCB 4BA6A 3LEMA 1QEXA 2BDRA 3LSEA 4HPKB 1UZZA 4N8MA 3S6PA 1NQJA 5FPVA 1W9YA 5CKMA 1EYBA 4CDXA 2FZ2A 2EA7A 1UY3A 1YI9A 3WNOA 4CU6A 4MXVA 1XNBA 4RYDA 3LF7A 3IKWA 2IFWA 3HNMA 3PUHA 5JZGC 4K1YA 1UYYA 2VCMA 4IE7A 4MGIE 5IFPA 1AR72 4OUSA 5KHIA 1PK6C 1VE0A 4Z2AA 3U4SA 4Y5SA 1WD4A 3KM5A 4XCAA 1I5PA 2R16A 2W94A 2X10A 4MGTA 3PUQA 3UETA 2YHJA 1S55A 5DXDA 3VBFC 1CAUA 4MX3A 4DO0A 5I0UA 3HAGA 4NPLA 4QHBA 3W5NA 1S0IA 1AL21 2K46A 3I3QA 4CCCA 5FR3A 1DGWX 4YW4A 5FZ7A 1V6OA 1OF4A 2I74A 3I2IA 5C3SA 3I97A 5FPXA 4YARA 5A3NA 1NXD1 1OURA 2YU2A 1NCQB 4GB31 5EP9A 1AUYA 4DY5A 4LMFA 4EN6B 4QXBA 5ACA3 5FAXA 4PDWC 2BVVA 2RDQA 3CJIA 5FDBA 3U0ZA 3N7KA 2D43A 5GKAC 1W8TA 1RUH2 4LIUA 2WFF3 4XAAA 5A3TA 4BQ2A 1TNFA 4EQVA 4JDOA 3N3HA 5KXCA 3IB3A 4QHZA 4AVVA 4AL9A 1FPN3 2Y6JA 3ZSJA 1W9FA 3THPA 3OOXA 1OKOA 3AKPA 1QJY3 2NP0A 3RYPA 4FBFA 2F4PA 3ZXLA 3LKJA 2R1BA 2IZWA 1AX2A 4KU7A 3T09A 3THDA 2Y6GA 5DG1A 3DF0A 4CDUB 4CDWC 1Y4WA 2P6CA 1YIFA 2G9FA 1W9WA 2ZEYA 3FUQA 3K48A 3H7YA 3T08A 4BMEA 1UAIA 3BIEA 2DUQA 3VHPA 1T6GC 3OBTA 2VBPA 1NYWA 5FZ0A 2WS93 4ES8A 3WF1A 4C1XA 1V6LA 1O4ZA 2A6VA 1HRV2 4CXWA 1C8M2 1DP0A 1GZTA 1ULOA 1RUC2 4YW1A 2JICA 3WXPA 4AAPA 5JOXA 5DPNA 5ACA1 2O8QA 3S0MA 5CB7A 1VRBA 3AM2A
chains in the Genus database with same CATH topology
4BH9A 2WFF1 3BIWE 4WVWA 2Y0OA 4AI3A 1OA4A 3IN9A 4A7YA 5CFDC 1R091 4A2UA 2IXJA 4E2GA 4Q4W2 2HWF2 4IERA 5GZGA 1RUJ3 2YROA 2PA7A 3OBRA 1FPN1 3SH3A 3T2TA 1FOD2 1KRIA 1AX0A 1QJY1 3WQ1A 4HANA 1QH7A 1XE7A 2UYAA 1W39A 1YFUA 2XLFA 2RE9A 3HT1A 4QU2A 1M06G 2HWB1 5ABJB 4LHNA 2VOXA 1V6IA 2UWCA 4CEWB 4XJAA 2IXCA 2WS91 4IV1A 4FPGA 3RMXA 1N1TA 2A71A 2QCSB 4FPHA 2GMPA 2YYOA 5J98B 4FSJA 4NVPA 2SBAA 2AENA 3PJYA 5AC91 1GQGA 2BFUS 4MVTA 4M0NA 3R0RA 2ZX1A 1Z7S3 4AVSA 4YZ2A 2JG8A 4HKLA 2CYFA 3RJ2X 4N53B 1UIJA 3LOBA 1IZ3A 4W6YA 3WP3A 4OI2A 1ZBE2 4NN0A 1QNYA 5I8YA 3MEPA 1VBB2 4LA2A 1F8VA 4M3CE 4YVWA 1AXKA 1LB2A 4FPJA 5L73A 3H9AA 2AUYA 2RR13 2EVXA 1VAVA 3PLQA 4LO6B 3AZZA 1AR73 3H1MA 2AR6A 2X29A 1WLDA 1OQDA 1LOGA 4YZ5A 4ONUA 3I59B 1Q3EA 1JH5A 5I8TA 3P3NA 1V70A 2BTVC 3BALA 4RS5C 2JE7A 5I0RA 4AEDC 2OW4A 1AJKA 4XQ4A 3B01A 1GZWA 2HWD2 3RZZA 1MZEA 1SFNA 4Q26A 4RFT0 1Z7S1 2RHPA 5JPNB 5GLWA 2P3KA 2W0XA 4RHV1 1RUH3 2QNKA 2E7QA 4I02A 1MZ5A 4C90A 2ZX0A 1Q5OA 1OOPB 4XJUA 5BNOA 3KD4A 3AMPA 2ZGLA 1W0PA 3MIGA 1WMEA 2RR11 2A3YA 3MI8A 2NPIA 4B7EA 1YUDA 4AEKA 4P9WA 3WNXA 1AR71 4NHKA 1Z0HA 2GAUA 3ZN4A 5BUVA 5AFBA 1NE4A 3VBHA 4GMP0 2MHFA 1W6PA 1QJZA 1D4M3 1ULCA 1MS0A 4Y5Z0 2XUMA 1VBA3 2ATFA 1J1TA 2JD4A 5JZGB 4R8HA 3HR9A 1ZZCA 2NYYA 4FP3A 5C6CA 5FO9B 1AZDA 1PK6B 2AZ5A 1S0JA 1QQP3 3VKLA 2E51A 1VAKA 2EIGA 4H7MA 1JUHA 2C1FA 5T54A 3AZVA 4Y22A 2E63A 2RS12 4Z92B 3VBFB 2XVLA 1TNRA 2BUKA 3H3UA 4TLFA 1R082 2RJLA 4JAAA 1RUH1 5DUXA 2PQQA 2P3JA 5FQ0A 4RA0A 5JVVA 5A32B 1W6QA 2A73B 2IWGB 5IK4A 4W65A 1VBD3 2FMDA 2HWC2 4HPKA 3M3CA 2PFWA 1FOD3 3WVJA 4PDWB 4Q0PA 4MSVA 3B69A 4B4QA 1RJ8A 4OHWA 2D6KA 2VMIA 3TN92 1H8TA 2A6ZA 5FBZA 2AH2A 1PGL2 1UN1A 5BNNC 1YCIA 1D4VB 1YNAA 3WINE 1CJDA 3PVNA 2RM22 2QVSB 4JGYA 5A3LA 3FZ3A 2LUWA 2PHFA 4CRQA 1VBA1 2XBO2 2K9ZA 2BNMA 1ZM1A 4UBHA 1HRV1 2EAAA 2HEWF 4XOGA 3ZFGA 2XJRA 2VVDA 4CDWB 1RUC1 2LALA 3R05A 1PIV2 3VKNA 4DQAA 1IPKA 2GC0A 4R9BA 4WVMA 2VNRA 2PAKA 1NZCA 2PYTA 2WSUA 4HVQA 4XXPA 2Z42A 4ITCA 1QJX3 1YXWA 1VBD1 3B3QE 2EXHA 1ZBE3 2XJSA 4KNCA 5J48A 1VBB3 1FOD1 1LEMA 2KA3A 4XPVA 2B7YA 2ETEA 5FREA 5CFDB 4AEJA 3O0XA 2ZCWA 3R6SA 1MVEA 1SLBA 4FOQA 2GNBA 3OJBA 4XF1A 4CDUA 4OHZA 2FBEA 2WT1A 3MFAA 2GSYA 2VOVA 1RUNA 2ZA9A 1O7FA 2WNUA 1LOFC 4X8PA 4NHMA 2GN7A 2ET7A 2YXSA 3KGLA 1MR5A 1SDWA 2WLPA 3CO2A 1CIWA 2D93A 1KFUL 4FPYA 4GKYA 1GQHA 1AYM2 2VGDA 4DXZA 4OULA 3ZXDA 4LR4A 3O5SA 5B2GB 3EXUA 3G6JB 5GLZA 4OI4A 1ONAA 5KHHA 2B5HA 1QJX1 1A8DA 4QPGC 1LTEA 1XQNA 1ZBE1 5JOZA 2BBVA 1VBB1 4HSLA 1JYCA 3HMYA 1DGRN 1UKRA 3BOPA 4KGQA 5L7OA 1HQNA 1GYKA 2VH9A 3WW2A 1LGNA 3R4DB 4YGEA 2CTVA 5ABJA 1YFXA 3OYWA 2ZMKA 3FBYA 4UW5A 1MQTC 4CEWA 2VY0A 2XLAA 2ZHLA 2TEPA 4N7UA 4Z07A 3PVEA 1JOJA 1Z78A 2RS13 3ZSKA 1HW5A 1YJLA 5SV8A 1LESA 1ND2C 1X33A 1R083 2CNAA 1WW4A 2MNGA 4RS5B 3GALA 1G86A 1OFSA 1L3JA 4AEDB 5FMOS 3ILRA 1CESA 1HXS2 1O4TA 2HWC3 2TUNA 3FC0A 5EV7A 3GF6A 1H2NA 3FWEA 4B29A 4UXAA 1MVQA 1GSLA 3N7LA 5FFOC 1W6NA 2WINB 2OYZA 3TN93 2ZHNA 3N36A 1QJU3 3KT4A 3MIDA 1O91A 3AP5A 1OA2A 2OZJA 4JC1A 1D2QA 3AXDA 1LEDA 2GMMA 3NWKA 3LB9A 3THTA 5KBFA 4YGDA 4M00A 1VJ2A 1SACA 4YYOA 2XBO3 4P5HA 1O5UA 3WDXA 3USSA 3X29B 1ULFA 3MGUA 3ZYJB 2ZGUA 4AI8A 4JTNA 2MPFA 3RYRA 2YGMA 2IXKA 1G7YA 1SBEA 5CVRA 2F6BA 2RS11 1PIV3 4JGZC 1KXGA 3OY8B 3KCYA 4G3YC 5J96B 4AI0A 5T5PA 1R081 2PELA 3URFA 4BLIA 1NCQC 5H9RA 4COWA 2RS52 1ALYA 3MFCA 1PO12 3AK0A 4GKXA 4FPFA 3WD5A 2HWC1 3ZMNA 2R6QA 2DUOA 4LBMA 1OOPA 3GBWA 5F6LB 3WP5A 3RS6A 4AF9A 5JI9A 1XYPA 2DU0A 1AX1A 3L2HA 2R062 4EWAA 4GB32 3TN91 1VLNA 3B94A 3D0JA 4CEYC 1XNCA 2QE3A 1PGL1 2GC2A 2WT0A 2WFPA 3RDIA 5J09A 2RJKA 1WMDA 3DUIA 1LHWA 2RM21 5J7MA 2A70A 1NLSA 3RI8A 2ZJCA 3AZWA 2JG9C 2UYBA 1TME3 4URTA 1Y43B 1B35A 2XBO1 4RR3C 4HFSA 4QQLA 3B7MA 4D3WA 1JUIA 5JZGA 5BNNB 1CPMA 2VMGA 3ALQA 1K5MC 2YPJA 1N1YA 4IETA 5LK5A 5BY5A 1PIV1 4AQ6A 4DRVA 1AYM3 4LBQB 1U5IA 3AMHA 3VBFA 1WD3A 1OI6A 4TSVA 1EAH3 2D6PA 2D5HA 5A32A 1RUOA 1CR7A 2YMZA 2DCTA 1QWRA 4J6GA 3H8UA 3VDDB 4PDWA 3AFGA 1UF2C 5ACA2 2PAMA 1VB2A 3PVOA 1AYN3 5E89A 3MZHA 1ULEA 3GHMA 4K21A 5LEJA 2WFF2 4OHVA 2VNGA 3KS7A 1H8VA 3ENRA 5K9YA 4P9LA 4B8EA 3N4MA 5GJ6A 3WG1A 4XF4A 5FLHA 4IEWA 5AVAA 3V0AB 1QJY2 5CBLA 2A6XA 3PHMA 2GH2A 4Z1VA 1HV0A 1ZVFA 5GZCA 5CIRA 5I0SA 1AYM1 4X8NA 1C57A 4HETA 4RGAA 1X50A 4FPCA 2K2SA 4GIQA 3SHRA 2BYVE 5DZGA 4BE3A 4Q0VA 2TBVA 2OUJA 1HXS3 2KXLA 4EROA 2MEV2 4I0BA 1F31A 4NPRA 3SITA 2RMU3 1YFWA 4YRDA 3U10A 2YC0A 2NMOA 4I0WB 1RUE3 4OUMA 1AYN1 5AC92 4K7JA 4AGRA 2Z5WA 1N3OA 2IXIA 2UY8A 2DWRA 4DOUA 3M3EA 2AREA 3FLPA 2D6OX 1XU1A 3ME2A 5IK8A 2HEVF 4X6QB 5IK5A 1RUJ2 2VNOA 4LO5B 2IXHA 4XDQA 3LA2A 4YZ3A 5JWPA 1FNYA 3E5XA 4QPIC 4P9YA 3A0NA 4W6XA 3VBSC 2WJSA 3LZZA 3VBUC 5BNPC 3TOJA 5T55A 4GMP3 1GFF2 3CU7A 1A78A 2A5ZA 3M8LA 2VOKA 3QH6A 1MQTB 1DBNA 1DG6A 1I6XA 1LHNA 3MPBA 4AI1A 3PMEA 1NCRA 2RS53 3WDTA 3VHRA 1PO13 3MIEA 5GM0A 2DVDA 4XF0A 1V9U2 1HXS1 2VECA 1VP6A 3KGZA 2RMU1 1NOVA 1ND2B 2DURA 5C4WA 1RUE1 2ZGSA 3OF1A 2W52A 1Z7S2 2CWSA 1RTVA 2I2SA 4QQPA 4F7ZA 3WW1A 3ZFFC 5CG8A 3E6CC 1C1FA 1QF3A 5C9AA 2ZKLA 3R4SA 2HWE3 4EWDA 4N43C 2BEOA 3ZN5A 4PIXA 2B45X 3I2DA 2RR12 4Q27A 1C8NA 2C5DA 2GU9A 2HKXA 1NA1A 3PNAA 4GMP1 2WLQA 3VBOA 2CY6A 1ZZBA 2ZGRA 5FOBB 4L2NA 4FT8A 4A7ZA 2RS51 1IKPA 3QLQA 4WV8A 1H2KA 1PO11 4RS5A 4ZXKA 2D44A 4N9IA 3WQ7A 4O9EA 4QXKA 4C0BA 4JGZB 1GV9A 1MEC3 4YM0A 2R30A 4HN0A 3VUOA 3RPQA 2R061 3AZYA 3JBG2 2PN5A 3O14A 2D3SA 4O9GA 5T50A 4Q0SA 4G4FA 3AP7A 4AGGA 3AX4A 1F5JA 1CONA 5IT6A 1LR5A 4R52A 3W58A 4OHYA 5H9QA 1G9FA 1LGBA 3OTFA 4W6WA 1VALA 4CEYB 4B3NA 3U4XA 3ZX7A 3LOIA 4IV3C 5JIUA 3PVBB 3WCSA 4L8QA 2RS33 4LUMA 2OA2A 2JG9B 4BQ1A 4EN7B 4RR3B 1BQPA 1D4M2 3NKGA 2XPJA 1WW6A 2PHDA 3VZKA 4XJ8A 1VBA2 5KXDA 1UU5A 1K5MB 1WBLA 4NO4A 4RL7A 3KB5A 2DCZA 2DYCA 5J36A 1MEC1 1QQP2 3D8CA 3HD8B 1SLTA 2MEV3 3WP4A 1N3PA 1EPWA 1UL9A 3S30A 1VBC3 3WQ0A 1OMIA 1AXZA 3WV6A 4Q4Y2 4YW2A 3J26N 2LM3A 3BTAA 2VPVA 2EAKA 2H6BA 4CDQA 4GWNA 3V65A 1VBD2 4YG6A 3ZPYA 3ZXEA 4COZA 3GNEA 1WLWA 5FPZA 4SBVA 5EZWA 2FZ1A 3D0SA 3RSJA 2K0GA 4PCRA 3AKTA 4HBNA 3ZYGA 5BNNA 5JOWA 2R043 3U07A 1W6MA 1RUI3 4LBQA 4L92A 1S0FA 2ARBA 2C9AA 1V6NA 2ZAAA 1V9U3 2ZACA 2ZTNA 4QGMA 4DRRA 2MEV1 4P14A 1VBC1 3NAPC 1ZZ7A 4B7KA 4XXAA 2VMHA 4YZ4A 1IQAA 1S0BA 2BNOA 4XHBA 3E5QA 2O1QA 3VBRC 3IPVA 3KT1A 1J3RA 3LCPA 4WM7C 1TQ5A 1SCSA 1QJX2 4YVSA 1RUJ1 3B02A 4KG8A 3ZIWA 3LA7A 3IMNA 3VHOA 2OVUA 2PHRA 2Q5TA 1NE6A 2Q1ZB 2WNVA 4QPYA 1YIPA 2D7FA 3MF9A 4XJZA 1KJRA 1REEA 2Q4SA 3WT3A 2Y26A 1RUI1 4WBBA 2A7AA 4QQOA 1URXA 4FQZA 5GLTA 3O12A 1ENXA 5C8CA 3EHKA 4QPIB 5EFUA 1EP0A 1FNZA 1LOFA 1S2KA 3VBSB 3VBUB 1V9U1 1ZZ6A 2WSVA 1RUD3 1ASJ3 5BNPB 2VW1A 1MS1A 3MLJA 4YSFA 1LJ7A 4UW3A 2Y38A 2ZZJA 1YHFA 3JBG3 4JVAA 3SH4A 2H0BA 1MS9A 3W9AA 3ACLA 1EV13 1KS5A 4QPGA 2HEYF 1G9AA 1A3KA 1VRH3 5JAXA 4WZCA 4FAGA 3AMNA 5JI7A 3I8TA 2KM2A 3OGJA 4FPEA 4K40A 1H30A 3JB8A 4JQRA 4LBOA 3SXWA 1PGSA 4ES9A 4AQSA 3ZFFB 2CAUA 2P37A 4MLOA 4K8FA 1NXMA 4J1WA 2XH6A 4FOYA 3OCPA 3WDUA 3QACA 4N43B 3FUOA 4LBNA 1FMD3 4PIZA 4GALA 4Z82A 1SBDA 1GNZA 5FOJB 1RUD1 1SMVA 3B93A 3WW4A 1R1A3 1PVC2 5JSRA 1ND2A 3JBG1 3O0WA 1HX6A 4XTPA 3DPRC 2JJ6A 1BVVA 4Q4Y3 1EV11 2BWAA 5EYYA 4C1WA 4HKWA 5K0UC 4P9IA 1W6OB 4UW6A 1Y3TA 1VRH1 3NV3A 4V1PA 1WGPA 4LTAA 5GZFA 2WA3A 5CFCA 4BCUA 2UURA 1F9KA 4I0AA 2BFUL 3VLBB 2GC3A 5F5QA 2XL9A 4K3UA 1Q8PA 3J4UH 1H1IA 1QKQA 4YM2A 1RMU3 4HKOA 4EN0A 5CG9A 1QJU2 4LHLA 2ZX2A 3MIFA 1VR3A 2QQPA 4P9GA 4ZU7A 5LEKA 1D4M1 1FMD1 2A6WA 4J1XA 3GZUC 1AR83 5CU1A 2DCYA 3KCXA 5JCTA 5IK7A 4YM1A 4FPOB 4L9BA 3POSA 4IV3B 5CA6A 3CEWA 5FO8B 2ENRA 1J3PA 1QQP1 1CAVB 1RUF3 1XYNA 2FQPA 3H3ZA 3ZSLA 1DQ2A 4FO9A 3AP4A 4OI1A 1SLCA 1ZRRA 4Q4Y1 1NCQA 3ZO0B 3VDDC 3IDEA 3NV2A 3AKSA 2ZBJA 2ZGNA 3MDPA 1M4WA 2VU9A 4YLZA 2YGLA 4B4PA 2VULA 1RUG2 4N9HA 4XJ9A 1S0EA 1Q8OA 4AXOA 1CGPA 4G9SB 2P17A 4XIOA 4CEYA 2A3WA 1U5ZA 3PJQA 5JSOA 4R9AA 4CTEA 1O3RA 4U2AA 1ENQA 3AYEA 5T5LA 5IUQA 2E7TA 3LSDA 4YG3A 1AR81 2JG9A 2YV8A 4AG4A 4MZUA 4XHXA 1TME2 4RR3A 2P2KA 4A3XA 4Y20B 1N1VA 3EQEA 3C2UA 4JRLA 3VV1A 1RUF1 1K5MA 2R32A 1HIXA 2R0HA 1LODA 3B5LB 3CNAA 4OLLA 2VUJA 2ZGQA 4F83A 4XTMA 3N7JA 4Q4V3 2JX9A 3TRSB 1J59A 4HK9A 3VGIA 2VOWA 3UJOA 3VZNA 5BYNA 5AC93 2DVBA 5GALA 1EAH2 1KJLA 3OD4A 4MXWB 1QGLA 1ZBA2 3NAPB 2ZHKA 2IFRA 3AFKA 1OD5A 1DFQA 3IM0A 4XMAA 4YFZA 3VBRB 4M3CF 1JBCA 2WWSA 1TE1B 3MW4A 2GMEA 4YNIA 3E5UA 4BIOA 1AYN2 3AYCA 4WM7B 1CJPA 1LU1A 3WDWA 4AFAA 4OZXA 1IOAA 3SCGA 3M4FA 4BM8A 4PBOA 2VVFA 1BKZA 5F6KA 2W39A 3H50A 4XYXA 5BV6A 4UBGA 3KLSA 5BNOC 4M3CB 2I45A 1WLCA 2VG9A 1LCLA 2JDZA 4XQWA 2NZ9A 4FP2A 1LOCA 3TWIA 4DY3A 4QQ2A 4BHPA 1PVC3 4K1ZA 4RGGA 1VBE3 2ZX3A 4Q4V1 2R072 1XE8A 1PNFA 1S2BA 1LHOA 1QOOA 2XKOA 3E6BA 4IEZA 2EALA 3ZIXA 4N53A 4TWTA 1BBT2 2GDFA 3APBA 1BZWA 3D82A 3TNPB 1AHSA 2RMU2 1G9CA 1PGW2 2R0FA 5DDJ2 1OPOA 1RUE2 2E9QA 4IESA 1LENA 1CD3G 1CAUB 1C1LA 4ATFA 4CP2A 2QDRA 3J8F2 5DUUA 3GZAA 4I30A 3I59A 5GZEA 4QPIA 5DG2A 3MLLA 1QOSA 1J1LA 3VBSA 4XJWA 1CAWB 1HKDA 2QZ3A 3O0VA 1DZTA 2EXJA 3ECQA 1UMZA 4XW3A 2NMNA 1V6JA 1PVC1 4E27A 2VQ0A 1VBE1 1BMV2 4FQ4A 1H8TC 4XBLA 3QBQA 2ET1A 1PNGA 3PMSA 1C5IA 2DVAA 3IIAA 3WCRA 1WBFA 5GLUA 4JGYC 5LRSA 3AYAA 3BODA 5HCBA 2NQYA 1RUG3 3ZSEA 5KC5A 4R9CA 4AVBA 1KFXL 3DPRB 2D6MA 3ZFGC 3POYA 3AJZA 2BPA2 1N3QA 3D6EA 1SCRA 5K0UB 1CQ9A 1QJU1 1DYPA 3WG3A 1QMJA 3R4UA 1C3HA 3RRDA 2PHLA 1ENRA 4L97A 1ULGA 1VIWB 3VKMA 2V09A 1DZRA 3HQXA 4AEMA 4N43A 2HWE2 2Q8OA 4IEQA 2WL1A 5BXXA 1TMF2 2XWJB 1OLQA 1IS3A 3WG2A 3LAGA 5FLIA 4KQ7A 2TNFA 2CV6A 1HDKA 1MS5A 4KWLA 1PK6A 4FOVA 2PAEA 1Q8VA 2PHTA 3BOWA 4Y1ZA 3RWNA 5I8SA 3WY6A 4YGBA 5D8AC 2R49A 5EWSA 5C33A 2D97A 1N1SA 4LBLA 1U12A 1ND3C 2JEMA 3UV9A 1S0CA 1N47A 4Y1VA 2NLRA 1W6OA 3ZYRA 4LO7A 1DGRA 1Q43A 1Y9QA 1ZBA3 1RUG1 1H4GA 4ASMB 1MEC2 2PLV3 2WNUC 4OHXA 3N7MA 2D3PA 1CN1A 1UPIA 4LEJA 4MV2A 5GZDA 4FXGB 1G9DA 1QDCA 2ZMLA 1QHDA 5E88A 5FMOL 2CGPA 3GYDA 3GZTB 4H7LA 4AVCA 3JU9A 4AK3A 1BVP1 5AVPA 1GBGA 3AMMA 1CAXB 2DUPA 1RL3A 3CJXA 1TME1 2D5FA 3ZVXA 1DU3D 3ZSMA 1LRHA 4R4XA 4AI2A 3JQWA 1LHUA 3MW2A 2ZGPA 1KDKA 1JXNA 2WQ4A 4AHWA 1CAVA 2RS32 4CDWA 4IEVA 4HN1A 1W2UA 2X53S 4MYEA 4NHLA 4Y1UA 1ZNPA 2R073 3NL1A 5L7OC 3ZXKA 1UD1A 1JYIA 1UU6A 1LOBA 5GLVA 4I2OA 1EAH1 4IL7A 2H6CA 3KZ4C 5L36A 3V0BB 1A6CA 1ZBA1 3FLRA 1BBT3 2Z79A 1WA4A 2PLV1 4COVA 1OLRA 3AKQA 1UX6A 4F3JA 3OD0A 1VBC2 3M7AA 5DDJ3 3ZFEC 1POV0 2V5YA 2DFCA 5KXBA 4IEYA 5DUVA 4FCAA 5T52A 3V64A 2HJIA 5CFDA 4AHZA 3ELNA 5E1RA 1ZREA 4M01A 2VW2A 3J8F3 1CVNA 3WUDA 2XJTA 4IEXA 4HZFA 1VB4A 3TYJA 1AJOA 2EXKA 3NKTA 4Y20A 3WHTA 2X5IC 1DQ6A 1REDA 1G8WA 2ZKNA 3QOPA 4XILA 4KWKA 1O5LA 2R042 1F5FA 3H1YA 5A33B 2R071 4XZPA 1IPJA 1RUI2 1YWKA 2DCJA 3SH5A 4EJRA 1TEIA 4WZFA 5EYXA 5BNOB 4MGKE 1KDMA 1BEV2 4IEPA 3SCFA 3TAYA 1BBT1 4LA3A 4EV0A 1S1AA 2GN3A 2WZPP 3WZ1A 5HBAA 5FTTC 4FPLA 3NAPA 4XIKA 1PGW1 1DYKA 5DDJ1 3NV4A 4DINB 3VZMA 1DDLA 1NG0A 3EBRA 4HLTA 1OSGA 1PMIA 4Q0UA 3MIBA 4RQPC 4EN9B 3WX5A 3MF6A 1DZQA 4I09A 4HK8A 1YLLA 4KGGA 3J8F1 1X8MA 4DMIA 2A3XA 1WCKA 1TMF3 2XGXA 4L11A 3AB0A 1AL23 1SEFA 1G6NA 1KS4A 2VVEA 3I7DA 1HRI2 3NV1A 2GC1A 4Y22B 3JCIA 4LUKA 3ILFA 4GWMA 4ZKTB 1AF9A 3HT2A 5HCFA 1BMV1 5LK7B 3WLUA 1G9BA 4B4RA 4WM8C 1AR93 1FX5A 1W6QB 4DB5A 5C8WA 1I1EA 3SCHA 4YW5A 2PHWA 1WCDJ 1SQ4A 1QXRA 1ASJ2 1RUD2 2BNNA 1B35C 4AEDA 2DTYA 3ES4A 1I3HA 3FMGA 1D2SA 4L99A 1RGSA 1AXYA 1H8TB 3LGRA 1DHKB 2O0OA 1UPSA 2ZX4A 2CAVA 5FCCA 3DV8A 4JDNA 4JGYB 4NOTA 1EV12 4XFHA 3ROUA 1JTZX 1D0GA 4QGLA 1VRH2 3M3QA 1RHI2 1SLLA 2HWE1 1FATA 3ZXFA 2CWMA 1TMF1 2YZ4A 2ZZQA 3ZFGB 3M3IA 4FOWA 2XWBB 3WP6A 3ETQA 3IBMA 5EXOA 5KXEA 5J3UA 3W59A 1CAWA 3VZOA 4C91A 1H9WA 3CF6E 4WVMB 2DCKA 1REFA 3UKVA 5DZFA 4U36A 3KT7A 4OI0A 4HT1T 1AR91 4E4SA 2BQPA 1PVXA 2ZGOA 1FMD2 3OY8A 3T1MA 3MIHA 1VAMA 3S7IA 1MS8A 1R093 2DU1A 1AR63 1XNDA 1FV3A 4LT5A 1Q8QA 1U5XA 3ZDSA 4AYUA 1C5HA 2HYKA 3BPZA 1RVF3 1A8MA 1CX4A 1R1A2 5D8AB 2DF7A 2ES3A 3ZYIB 3DPRA 4UW4A 1ZZ9A 4DNYA 1APNA 1C28A 4MGYE 1SLIA 1ND3B 2HWB3 2GH8A 4ORFA 4GA9A 5K0UA 4COYA 5I91A 1QNWA 3MYXA 4RD7A 3AP9A 2P3IA 3WR0A 2WNUB 1IGOA 2CGOA 4MGZE 5FO7B 1O4YA 4QX5A 1JW6A 2XJVA 4AFDA 1WW5A 1LULA 1OQEA 1GR3A 1RMU2 3CL1A 4GH4C 2RS31 4OFGA 5I0TA 1KQRA 4GULA 2VQAA 4PQ9A 1Q8SA 1AR82 3HWJA 3AMQA 1AR61 2WC2A 2W08A 3JD72 5JR7B 1BEV3 2YY1A 4FTBA 3KMHA 1RVF1 2WZR3 1RUF2 3EO6A 2C0ZA 1B09A 5L7OB 1COV2 3RI9A 3QD6A 1RINA 4LE4A 4PLOA 4YW3A 3VDDA 4WVVA 3BB6A 3OYWB 5T3NA 2CL2A 3ILNA 4P9JA 4N90A 2VW0A 4PIYA 4QM9A 1PZ9A 5KC6A 4AVAA 2B9UA 2A75A 1NCRC 1WMFA 1CAXA 1PO22 1X82A 4GQ7A 1XXNA 1AVBA 3ZFEB 2G9GA 3K51A 1OA3A 3VHNA 1RC6A 3A4UA 4LLOA 5A3MA 1HRI3 3C3VA 3TBDA 3V0AA 1QH6A 4D7SA 4S2DA 4ISQA 1EY2A 2R041 3ES1A 4JV4A 1DQ1A 2Q0AA 5C4WC 1DF0A 2ZHMA 3UL2A 4TZDA 2ZAHA 1HQLA 3BCWA 4RHV3 2CGNA 1IS5A 2X5IB 1BEV1 4Y1XA 5C9AC 1U0AA 3I4IA 3EJKA 2OZ6A 1FV2A 3V0BA 4M0HA 2OPKA 2WZR1 1W6NB 4CDXC 1ZRCA 3OGGA 2XL7A 3RYKA 2AGSA 3H0OA 1NA1C 4Q4V2 4Q0QA 4IEUA 4QQHA 4Q4X2 3VBOC 4FVVA 4LNVA 5H9PA 3D4KA 1DQ4A 4K20A 4INDA 1RHI3 2DTWA 2I07B 3RQ0A 2PHUA 3LWCA 4FXKB 3UKTA 3VKOA 1LGCA 1HRI1 1V00A