4IXSA

Native structure of xometc at ph 5.2
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
381
structure length
360
Chain Sequence
ALSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSRTHNPTRFAYERCVAALEGGTRAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAGLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQMSGFGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTEQLGISDALVRLSVGIEDLGDLRGDLERALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystathionine gamma-lyase-like protein
publication title PLP undergoes conformational changes during the course of an enzymatic reaction.
pubmed doi rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Lyase
total genus 119
structure length 360
sequence length 381
chains with identical sequence B
ec nomenclature ec 4.4.1.1: Cystathionine gamma-lyase.
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01053 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4ixsA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4ixsA02
4IXZA 4UHNA 4ZSYA 4QGRA 3NDNA 2VI8A 1AY8A 3MAFB 5EQCA 4JF0A 2QLRA 1S0AA 1D7UA 1AHYA 3F0HA 1C7NA 2CINA 2C81A 2ORDA 1PMMA 1CZEA 3B1EA 4W1WA 2VMUA 2AY4A 2D5YA 2VIBA 3FFRA 3JW9A 5EUEA 3TFUA 3HT4A 5JAYA 3RCHA 1TASA 4IXSA 1Z7DA 4WD2A 1QZ9A 2WK7A 1VJOA 4ZLVA 2Z1ZA 5EUNA 2BI2A 4E3RA 2Z9XA 8AATA 2CJGA 2QA3A 4WP0A 3HBXA 2OATA 1IX6A 1LK9A 2W7GA 2C7TA 4MSOA 1VEFA 4BHDA 3GETA 1IX8A 3KE3A 3RQ1A 1YJSA 2DR1A 4K2IA 4GE7A 4DBCA 2ZSMA 3KGXA 3PPLA 1CJ0A 2O7CA 1QJ3A 3NX3A 2TPLA 2JJFA 3ZRQA 4P7YA 2YRIA 4R8DA 1D7RA 4BA4A 4KXKA 2D66A 2CJDA 4GRXA 2VGUA 2E7JA 2BWPA 3MADA 3FFHA 4LNMA 1C9CA 1TPLA 1TATA 2AEUA 1RVUA 3GR9A 4LW4A 1B9HA 3L8AA 1KKPA 1ARSA 3G0TA 2CTZA 3ASBA 3TQXA 4E77A 1W7MA 3II0A 1CZCA 4DQ6A 2X5DA 5EFSA 1BW0A 3DXWA 3GBXA 1X0MA 4OCAA 5EUDA 3AELA 4A0FA 1C7GA 1WYUA 2BIEA 3ELPA 1G7XA 3G8MA 1TOEA 1AIBA 1FG3A 2BYLA 1AJSB 1LS3A 2YKYA 3PJ0A 1JF9A 1ARIA 1BJWA 1C4KA 1CQ6A 1I43A 2FN6A 2HOYA 3CQ6A 3MC6C 2BHXA 2VMSA 4KAMA 4OC9A 4RAEA 2BYJA 4Q76A 1KMJA 4AOAA 2VMZA 3BS8A 2VMWA 3EZ1A 2VMPA 2OKKA 2W7MA 3VP6A 3B1CA 1M0PA 3JZLA 2NMPA 5DX5A 1OHYA 2VLHA 4AO9A 1ZODA 4WYEA 3LG0A 3PDXA 3FDDA 3IHJA 1FC4A 3HDOA 4W1VA 1BJOB 2C0RA 1YAAA 1B8GA 3PDBA 4RKDA 4ZDPA 1I41A 3BC8A 2CJHA 2FM1A 3CAIA 1IBJA 2VI9A 2CB1A 2R5CB 4NOGA 1WYVB 4WBTA 4RJ0A 3RI6A 4OYTA 1DKAA 3EI7A 2JJGA 2BWNA 1AMAA 1X2AA 3A8UX 2W7LA 5BJ4A 3MAFA 3HMUA 1ECXA 4A6TA 2VGSA 5G2QA 1WSTA 4F4EA 4XJLA 3FQ8A 1SFFA 3VK2A 1RV3A 2EPJA 2X5FA 5DJ1A 3BCBA 1M4NA 2VMVA 4P3MA 2FQ6A 4JEVA 4RITA 1B9IA 2HORA 2E54A 4EB7A 3FTBA 4Q31A 5G4IA 2Z9WA 3PIUA 4ZWVA 3HLMA 1GD9A 5G2PA 3B1DA 4FFCA 1B5OA 3LVJA 3WKRA 1TOJA 4MY5A 3QHXA 4MKJA 4PFFA 2GMSA 4WXFA 3TATA 2CH2A 3COGA 3TFTA 2ZY2A 4AO4A 2Z20A 3JWAA 4B9BA 3PAAA 4ISYA 1AKBA 1YOOA 1O62A 4WYAA 1UU2A 4LNJA 2AATA 4M2JA 5I92A 2QB2A 3FZ6A 1AY5A 3ZRPA 2RFVA 3UAKA 1FG7A 3E9KA 1MAPA 2D63A 4GSAA 1W7NA 1ASDA 1O4SA 1V2FA 2PO3A 3QGUA 4OT8A 1ASAA 3ATHA 3FVSA 4W91A 4F5HA 3NUIA 3FD0A 5E4ZA 4XQ2A 3FVUA 2PB2A 3DR7A 2W7FA 3JTXA 3PGYA 5EAAA 4B98A 1TOIA 1GEYA 4RJYA 4J5UA 1LC5A 2YKVA 3AEMC 3VK3A 4AZKA 5EIGA 1BJ4A 4EB5A 4U2HA 2D61A 2W7KA 1J04A 1M0OA 1IAXA 1VP4A 2VGZA 1UU1A 5FT5A 2CSTA 1ZC9A 3AV7A 2BIAA 2EH6A 1ASLA 2OQXA 4M2KA 3WX9A 4ADEA 2PB0A 1IJIA 3FKDA 4XK1A 1YNUA 1GCKA 1AJSA 1IX7A 2D65A 2F8JA 2Z61A 1ASGA 2D7ZA 5M49A 2W7JA 4R2NA 1ORDA 4JF1A 1CL2A 2QMAA 3MEBA 3USFA 3FQ7A 2HUUA 2W7EA 1WKGA 3DU4A 3VOMA 1AHFA 1W7LA 2W8UA 3AENA 1TARA 1X29A 2XH1A 1AX4A 3CQ4A 2DGMA 2VMXA 4A0HA 4JE5A 4RIZA 5LHAA 3N75A 1QITA 4F5JA 3BB8A 3GJUA 1BJOA 1KKJA 3GZDA 4A6UA 4IW7A 4IX8A 4ZSWA 1BT4A 1H0CA 4RLGA 4EFFA 4OMAA 4ZDLA 4F5LA 2R5CA 4A72A 1CL1A 1WYVA 2AY5A 3NU7A 3IF2A 3FZ7A 2AY2A 3FSLA 5DB5A 4WYCA 3RUYA 3LVLB 1G4XA 3TCMA 5EIGB 3E2ZB 5J8QA 1DGEA 1DFOA 3E2FA 2O0RA 3EI8A 2Q7WA 4PFNA 3WZFA 4HVKA 4GE4A 2AY9A 3K28A 4J8LA 1IVRA 1GEXA 1QGNA 2JJEA 4ADBA 4ZAHA 3LVMA 3OKSA 3A9ZA 1MDXA 1SVVA 2DGKA 4LW2A 2GQNA 1AHXA 3DYDA 2E7IA 2D7YA 4MGRA 3PD6B 3EI5A 1OHVA 4A0GA 3AEMA 2O1BA 3DXVA 2ZY5A 1OATA 3DR4A 1MLZA 3H14A 1M0NA 3UWCA 2GB3A 2HP2A 5C6UA 5LH9A 1GC0A 1LC7A 3KGWA 4TV7A 3P1TA 2VLFA 1X28A 1S06A 3AENB 3PA9A 3FCRA 3BCAA 2YOBA 4ZWMA 1QIRA 2W7HA 3EIAA 5E5IA 3JU7A 1G4VA 3WCNA 3H7FA 1AKCA 1M7YA 4R5FA 4F5KA 3B8XA 2JJHA 1BQAA 1MLYA 5G4JA 2CH1A 2YCNA 4RM1A 4E1OA 1KL1A 4UOYA 4ATQA 1G7WA 2HOZA 2X8UA 2YHKA 4ATPA 1S08A 2YCTA 3N5MA 4WB0A 2HZPA 2ZY4A 2ZP7A 4Y0DA 1AY4A 2GSAA 3L44A 5F9SA 3NYTA 1GEWA 2AEVA 4DGTA 2WK8A 1BKGA 3BN1A 3EZSA 2BIGA 1ZOBA 1UU0A 4LNLA 2W8JA 4MKKA 4F5GA 4A00A 4ZM4A 3BCXA 1BQDA 1JS3A 2EZ1A 2BI1A 3GZCA 4I8AA 5FT4A 3RBFA 2EO5A 2AY1A 4W1XA 2E7UA 1UKJA 1RV4A 2VYCA 2ZUKA 2OGAA 3GZDC 4WLHA 4EMYA 1QJ5A 1IAYA 2DKBA 2Z67A 2ZYJA 3BWNA 1LC8A 5D95A 3AEPA 2W8VA 5HXXA 2BKWA 1BJNA 2D64A 2VMTA 3F9TA 3NYUA 4F5MA 1BS0A 3E77A 3MAUA 2WK9A 1JS6A 2GMUA 2VGTA 2FNIA 5M4BA 4OBUA 3ISLA 4Q6RA 1T3IA 1D2FA 4AH3A 4A0RA 3DC1A 5BJ3A 3A2BA 3MBBA 1W23A 3R4TA 4ZM3A 2OKJA 3WKSA 4XAUA 3WCOA 1TOGA 1AMQA 1D7SA 3E6GA 4WB0B 1WKHA 3DRDA 3Q8NA 3ZZKA 3CBFA 1ASNA 2Z9UA 2DKJA 1E5FA 1V2DA 1SZKA 1U08A 2ZJGA 1QISA 4MQPA 3RBLA 3AEJA 3B46A 2VMOA 3E2ZA 1MDZA 1GBNA 3FQAA 4CBRA 4IYOB 1S09A 5K8BA 1GC2A 1N2TA 3A9YA 4ZDOA 4CXQA 3WGBA 1CQ8A 2EGYA 3CQ5A 2ZSLA 3G7QA 3PD6A 3NYSA 2BI9A 1S07A 4ITGA 5IWQA 3W1JA 1PFFA 4IY7A 4XEWA 5G0AA 1AMSA 1ASMA 2W7IA 4W5KA 3VAXA 4IXOA 4OTLA 3I4JA 2R2NA 4GEBA 1AKAA 3ZRRA 1Z3ZA 2BWOA 4R5ZA 1ARHA 4A6RA 4WXGA 2V0YA 1OXOA 1E5EA 1W3UA 2JISA 3QPGA 5FT8A 3UE8A 4W8IA 1KL2A 1PG8A 1N31A 5HHYA 4WXBA 4L0OA 2HUIA 3QI6A 1MGVA 5M46A 3WLXA 1XEYA 1YIZA 1ASBA 1OHWA 2W8TA 4MQQA 3ZZJA 3BV0A 1JG8A 1ARGA 1Y4IA 3EI6A 4AZJA 2ZC0A 9AATA 4BA5A 1YIYA 4ITXA 1J32A 5G09A 2DGLA 4F5IA 3NRAA 4JEZA 2AY8A 1I29A 1SZSA 5D5SA 3FDBA 2AY7A 1AHGA 3GWPA 1YJZA 1O69A 2BI5A 1WYTA 4Y0IA 2XBNA 3W1IA 4CBSA 2Z9VA 1GC3A 3BWNC 1ASCA 3QBOA 1DGDA 4N0BA 4UQVA 3ACZA 1ARTA 3KKIA 1M32A 1D7VA 5AX8A 3WGCA 3NUBA 1EJIA 1SF2A 3EUCA 1V72A 4FL0A 4JEWA 1O61A 3HQTA 4TMRA 4ADDA 3WY7A 2VMRA 1B4XA 3NTJA 4UHOA 1XI9A 4XJOA 3P6KA 4CVQA 4ZASA 1CS1A 3T32A 3ASAA 4XJPA 3FRKA 1ELUA 3DZZA 3GSBA 1H1CA 3M5UA 4K2BA 5F8VA 3RCHB 4E3QA 3DODA 1MDOA 4BMKA 2CFBA 1I48A 3VK4A 2G6WA 4BQ0A 4OBVA 4ADCA 2FNUA 3LVKA 3QM2A 1ELQA 3K7YA 2DOUA 2OGEA 2QBTA 2X3LA 3AEJC 1DTYA 2VGWA 3LV2A 4N0WA 1C0NA 2V1PA 3FVXA 4WYGA 4F5FA 3HL2A 2QB3A 3ECDA 3EI9A 3A9XA 3K40A 4JEYA 2W8WA 4U1TA 2HUFA 1TOKA 2FYFA 5E3KA 3AEOA 1DJUA 4PIWA 1ASFA 1AJRA 3QN6A 4WYDA 5DJ9A 1RVYA 1ASEA 2AY3A 3AOWA 1IUGA 1PMOA 1WYTB 2BI3A 3I5TA 3MKJA 4KYOA 4UHMA 1M0QA 2VGVA 3F6TA 2AY6A 2VIAA 1AAMA 2Z1YA 5M4DA 5TF5A 4IYOA 1EQBA 2JG2A 2YKUA 1V2EA 2CANA 3FZ8A 4GDYA 4CXRA 2HOXA 1DJEA 4WYFA 3NNKA 1LW4A 2EZ2A 1B5PA 4MQRA 1SZUA 3LY1A 3BWOA 5EAVA 2YCPA 1LKCA 3AOVA 1C7OA 7AATA 1CQ7A 1DJ9A 4XJMA 2WKAA 1AMRA 3NU8A 1AICA 1GC4A 2VMYA 1AAWA 3LWSA 4JEXA 3R9AA 3JWBA 1AIAA 4JE5D 3OP7A 3W1HA 2C44A 3N0LA 5FT6A 4HF8A 1SPAA 2R5EA 1AHEA 1N8PA 2R0TA 3EIBA 4WLJA 1WYUB 4RKCA 4H51A 4M2MA 4Y0HA 4EU1A 1M6SA 2YKXA 1LW5A 4K2MA 4O6ZA 2HP1A 4LC3A 3ELEA 4PVFA 1EG5A 2ZY3A 4Q75A 4GE9A 3D6KA 3AATA 5HDMA 2VMQA 2W7DA 2VMNA 2YRRA 3E2YA 3MC6A 3I16A 1OXPA 1GDEA 1MAQA 3PDBB 1P3WA 2CY8A 1KMKA 2JGTA 4TN4A 3HVYA 1YJYA
chains in the Genus database with same CATH superfamily
4IXZA 4UHNA 4ZSYA 4QGRA 3NDNA 2VI8A 1AY8A 3MAFB 5EQCA 4JF0A 2QLRA 1S0AA 1D7UA 1AHYA 3F0HA 1C7NA 2CINA 2C81A 2ORDA 1PMMA 1CZEA 3B1EA 4W1WA 2VMUA 2AY4A 2D5YA 2VIBA 3FFRA 3JW9A 5EUEA 3TFUA 3HT4A 5JAYA 3RCHA 1TASA 4IXSA 1Z7DA 4WD2A 1QZ9A 2WK7A 1VJOA 4ZLVA 2Z1ZA 5EUNA 2BI2A 4E3RA 2Z9XA 8AATA 2CJGA 2QA3A 4WP0A 3HBXA 1KAFA 2OATA 1IX6A 1LK9A 2W7GA 2C7TA 4MSOA 1VEFA 2EYQA 4BHDA 3GETA 1IX8A 3KE3A 3RQ1A 1YJSA 2DR1A 4K2IA 4GE7A 4DBCA 2ZSMA 3KGXA 3PPLA 1CJ0A 2O7CA 1QJ3A 3NX3A 2TPLA 2JJFA 3ZRQA 4P7YA 2YRIA 4R8DA 1D7RA 4BA4A 4KXKA 2D66A 2CJDA 4GRXA 2VGUA 2E7JA 2BWPA 3MADA 3FFHA 4LNMA 1C9CA 1TPLA 1TATA 2AEUA 1RVUA 3GR9A 4LW4A 1B9HA 3L8AA 1KKPA 1ARSA 3G0TA 2CTZA 3ASBA 3TQXA 4E77A 1W7MA 3II0A 1CZCA 4DQ6A 2X5DA 5EFSA 1BW0A 3DXWA 3GBXA 1X0MA 4OCAA 5EUDA 3AELA 4A0FA 1C7GA 1WYUA 2BIEA 3ELPA 1G7XA 3G8MA 1TOEA 1AIBA 1FG3A 2BYLA 1AJSB 1LS3A 2YKYA 3PJ0A 1JF9A 1ARIA 1BJWA 1C4KA 1CQ6A 1I43A 2FN6A 2HOYA 3CQ6A 3MC6C 2BHXA 2VMSA 4KAMA 4OC9A 3N4SA 4RAEA 2BYJA 4Q76A 1KMJA 4AOAA 2VMZA 3BS8A 2VMWA 3EZ1A 2VMPA 2OKKA 2W7MA 3VP6A 3B1CA 1M0PA 3JZLA 2NMPA 5DX5A 1OHYA 2VLHA 4AO9A 1ZODA 4WYEA 3LG0A 3PDXA 3FDDA 3IHJA 1FC4A 3HDOA 4W1VA 1BJOB 2C0RA 1YAAA 1B8GA 3PDBA 4RKDA 4ZDPA 1I41A 3BC8A 2CJHA 2FM1A 3CAIA 1IBJA 2VI9A 2CB1A 2R5CB 4NOGA 1WYVB 4WBTA 4RJ0A 3RI6A 4OYTA 1DKAA 3EI7A 2JJGA 2BWNA 1AMAA 1X2AA 3A8UX 2FKIA 2W7LA 5BJ4A 3MAFA 3HMUA 1ECXA 4A6TA 2VGSA 5G2QA 1WSTA 4F4EA 4XJLA 3FQ8A 1SFFA 3VK2A 1RV3A 2EPJA 2X5FA 5DJ1A 3BCBA 1M4NA 2VMVA 4P3MA 2FQ6A 4JEVA 4RITA 1B9IA 2HORA 2E54A 4EB7A 3FTBA 4Q31A 5G4IA 2Z9WA 3PIUA 4ZWVA 3HLMA 1GD9A 5G2PA 3B1DA 4FFCA 1B5OA 3LVJA 3WKRA 1TOJA 4MY5A 3QHXA 4MKJA 4PFFA 2GMSA 4WXFA 3TATA 2CH2A 3COGA 3TFTA 2ZY2A 4AO4A 2Z20A 3JWAA 4B9BA 3PAAA 4ISYA 1AKBA 1YOOA 2G7JA 1O62A 4WYAA 1UU2A 4LNJA 2AATA 4M2JA 5I92A 2QB2A 3FZ6A 1AY5A 3ZRPA 2RFVA 3UAKA 1FG7A 3E9KA 1MAPA 2D63A 3N7NA 4GSAA 1W7NA 1ASDA 1O4SA 1V2FA 2PO3A 3QGUA 4OT8A 1ASAA 3ATHA 3FVSA 4W91A 4F5HA 3NUIA 3FD0A 5E4ZA 4XQ2A 3FVUA 2PB2A 3DR7A 2W7FA 3JTXA 3PGYA 5EAAA 4B98A 1TOIA 1GEYA 4RJYA 4J5UA 1LC5A 2YKVA 3AEMC 3VK3A 4AZKA 5EIGA 1BJ4A 4EB5A 4U2HA 2D61A 2W7KA 1J04A 1M0OA 1IAXA 1VP4A 2VGZA 1UU1A 5FT5A 2CSTA 1ZC9A 3AV7A 2BIAA 2EH6A 1ASLA 2OQXA 4M2KA 3WX9A 4ADEA 2PB0A 1IJIA 3FKDA 4XK1A 1YNUA 1GCKA 1AJSA 1IX7A 2D65A 2F8JA 2Z61A 1ASGA 2D7ZA 5M49A 2W7JA 4R2NA 1ORDA 4JF1A 1CL2A 2QMAA 3MEBA 3USFA 3FQ7A 2HUUA 2W7EA 1WKGA 3DU4A 3VOMA 1AHFA 1W7LA 2W8UA 3AENA 1TARA 1X29A 2XH1A 1AX4A 3CQ4A 2DGMA 2VMXA 4A0HA 4JE5A 4RIZA 5LHAA 3N75A 1QITA 4F5JA 3BB8A 3GJUA 1BJOA 1KKJA 3GZDA 4A6UA 4IW7A 4IX8A 4ZSWA 1BT4A 1H0CA 4RLGA 4EFFA 4OMAA 4ZDLA 4F5LA 2R5CA 4A72A 1CL1A 1WYVA 2AY5A 3NU7A 3IF2A 3FZ7A 2AY2A 3FSLA 5DB5A 4WYCA 3RUYA 3LVLB 1G4XA 3TCMA 5EIGB 3E2ZB 5J8QA 1DGEA 1DFOA 3E2FA 2O0RA 3EI8A 2Q7WA 4PFNA 3WZFA 4HVKA 4GE4A 2AY9A 3K28A 4J8LA 1IVRA 1GEXA 1QGNA 2JJEA 4ADBA 4ZAHA 3LVMA 3OKSA 3A9ZA 1MDXA 1SVVA 3N4RA 2DGKA 4LW2A 2GQNA 1AHXA 3DYDA 2E7IA 2D7YA 4MGRA 3PD6B 3EI5A 1OHVA 4A0GA 3AEMA 2O1BA 3DXVA 2ZY5A 1OATA 3DR4A 1MLZA 3H14A 1M0NA 3UWCA 2GB3A 2HP2A 5C6UA 5LH9A 1GC0A 1LC7A 3KGWA 4TV7A 3P1TA 2VLFA 1X28A 1S06A 3AENB 3PA9A 3FCRA 3BCAA 2YOBA 4ZWMA 1QIRA 2W7HA 3EIAA 5E5IA 3JU7A 1G4VA 3WCNA 3H7FA 1AKCA 1M7YA 4R5FA 4F5KA 3B8XA 2JJHA 1BQAA 1MLYA 5G4JA 2CH1A 2YCNA 4RM1A 4E1OA 1KL1A 4UOYA 4ATQA 1G7WA 2HOZA 2X8UA 2YHKA 4ATPA 1S08A 2YCTA 3N5MA 4H63Q 4WB0A 2HZPA 2ZY4A 2ZP7A 4Y0DA 2KFPA 1AY4A 2GSAA 3L44A 5F9SA 3NYTA 1GEWA 2AEVA 4DGTA 2WK8A 1BKGA 3BN1A 3EZSA 2BIGA 1ZOBA 1UU0A 4LNLA 2W8JA 4MKKA 4F5GA 4A00A 4ZM4A 3BCXA 1BQDA 1JS3A 2EZ1A 2BI1A 3GZCA 4I8AA 5FT4A 3RBFA 2EO5A 2AY1A 2WB6A 4W1XA 2E7UA 1UKJA 1RV4A 2VYCA 2ZUKA 2OGAA 3GZDC 4WLHA 4EMYA 1QJ5A 1IAYA 2DKBA 2Z67A 2ZYJA 3BWNA 1LC8A 5D95A 3AEPA 2W8VA 5HXXA 2BKWA 1BJNA 2D64A 2VMTA 3F9TA 3NYUA 4F5MA 1BS0A 3E77A 3MAUA 2WK9A 1JS6A 2GMUA 2VGTA 2FNIA 5M4BA 4OBUA 3ISLA 4Q6RA 1T3IA 1D2FA 4AH3A 4A0RA 3DC1A 5BJ3A 3A2BA 3MBBA 1W23A 3R4TA 4ZM3A 2OKJA 3WKSA 4XAUA 3WCOA 1TOGA 1AMQA 1D7SA 3E6GA 4WB0B 1WKHA 3DRDA 3Q8NA 3ZZKA 3CBFA 1ASNA 2Z9UA 2DKJA 1E5FA 1V2DA 1SZKA 1U08A 2ZJGA 1QISA 4MQPA 3RBLA 3AEJA 3B46A 2VMOA 3E2ZA 1MDZA 1GBNA 3FQAA 4CBRA 4IYOB 1S09A 5K8BA 1GC2A 1N2TA 3A9YA 4ZDOA 4CXQA 3WGBA 1CQ8A 2EGYA 3CQ5A 2ZSLA 3G7QA 3PD6A 3NYSA 2BI9A 1S07A 4ITGA 5IWQA 3W1JA 1PFFA 4IY7A 4XEWA 5G0AA 1AMSA 1ASMA 2W7IA 4W5KA 3VAXA 4IXOA 4OTLA 3I4JA 2R2NA 4GEBA 1AKAA 5KTBA 3ZRRA 1Z3ZA 2BWOA 4R5ZA 1ARHA 4A6RA 4WXGA 2V0YA 1OXOA 1E5EA 1W3UA 2JISA 3QPGA 5FT8A 3UE8A 4W8IA 1KL2A 1PG8A 1N31A 5HHYA 4WXBA 4L0OA 2HUIA 3QI6A 1MGVA 5M46A 3WLXA 1XEYA 1YIZA 1ASBA 1OHWA 2W8TA 4MQQA 3ZZJA 3BV0A 1JG8A 1ARGA 1Y4IA 3EI6A 4AZJA 2ZC0A 9AATA 4BA5A 1YIYA 4ITXA 1J32A 5G09A 2DGLA 4F5IA 3NRAA 4JEZA 2AY8A 1I29A 1SZSA 5D5SA 3FDBA 2AY7A 1AHGA 3GWPA 1YJZA 1O69A 2BI5A 1WYTA 4Y0IA 2XBNA 3W1IA 4CBSA 2Z9VA 1GC3A 3BWNC 1ASCA 3QBOA 1DGDA 4N0BA 4UQVA 3ACZA 1ARTA 3KKIA 1M32A 1D7VA 5AX8A 3WGCA 3NUBA 1EJIA 1SF2A 3EUCA 1V72A 4FL0A 4JEWA 1O61A 3HQTA 4TMRA 4ADDA 3WY7A 2VMRA 1B4XA 3NTJA 4UHOA 1XI9A 4XJOA 3P6KA 4CVQA 4ZASA 1CS1A 3T32A 3ASAA 4XJPA 3FRKA 1ELUA 3DZZA 3GSBA 1H1CA 3M5UA 4K2BA 5F8VA 3RCHB 4E3QA 3DODA 1MDOA 4BMKA 2CFBA 1I48A 3VK4A 2G6WA 4BQ0A 4OBVA 4ADCA 2FNUA 3LVKA 3QM2A 1ELQA 3K7YA 2DOUA 2OGEA 2QBTA 2X3LA 3AEJC 1DTYA 2VGWA 3LV2A 4N0WA 1C0NA 2V1PA 3FVXA 4WYGA 4F5FA 3HL2A 2QB3A 3ECDA 3EI9A 3A9XA 3K40A 4JEYA 2W8WA 4U1TA 2HUFA 1TOKA 2FYFA 5E3KA 3AEOA 1DJUA 4PIWA 1ASFA 1AJRA 3QN6A 4WYDA 5DJ9A 1RVYA 1ASEA 2AY3A 3AOWA 1IUGA 1PMOA 1WYTB 2BI3A 3I5TA 3MKJA 4KYOA 4UHMA 1M0QA 2VGVA 3F6TA 2AY6A 3H9XA 2VIAA 1AAMA 2Z1YA 5M4DA 5TF5A 4IYOA 1EQBA 2JG2A 2YKUA 1V2EA 2CANA 3FZ8A 4GDYA 2QSRA 4CXRA 2HOXA 1DJEA 4WYFA 3NNKA 1LW4A 2EZ2A 1B5PA 4MQRA 1SZUA 3LY1A 3BWOA 5EAVA 2YCPA 1LKCA 3AOVA 1C7OA 7AATA 1CQ7A 1DJ9A 4XJMA 2WKAA 1AMRA 3NU8A 1AICA 2A1VA 1GC4A 2VMYA 1AAWA 3LWSA 4JEXA 3R9AA 3JWBA 1AIAA 4JE5D 3OP7A 3W1HA 2C44A 3N0LA 5FT6A 4HF8A 1SPAA 2R5EA 1AHEA 1N8PA 2R0TA 3EIBA 4WLJA 1WYUB 4RKCA 4H51A 4M2MA 4Y0HA 4EU1A 4K05A 1M6SA 2YKXA 1LW5A 4K2MA 4O6ZA 2HP1A 4LC3A 3ELEA 4PVFA 1EG5A 2ZY3A 4Q75A 4GE9A 3D6KA 3AATA 5HDMA 2VMQA 2W7DA 2VMNA 2YRRA 3E2YA 3MC6A 3I16A 1OXPA 1GDEA 1MAQA 3PDBB 1P3WA 2CY8A 1KMKA 2JGTA 3N4XA 4TN4A 3HVYA 1YJYA
chains in the Genus database with same CATH topology
4IXZA 4UHNA 4ZSYA 4QGRA 3NDNA 2VI8A 1AY8A 3MAFB 5EQCA 4JF0A 2QLRA 1S0AA 1D7UA 1AHYA 3F0HA 1C7NA 2CINA 2C81A 2ORDA 1PMMA 1CZEA 3B1EA 4W1WA 2VMUA 2AY4A 2D5YA 2VIBA 3FFRA 3JW9A 5EUEA 3TFUA 3HT4A 5JAYA 3RCHA 1TASA 4IXSA 1Z7DA 4WD2A 1QZ9A 2WK7A 1VJOA 4ZLVA 2Z1ZA 5EUNA 2BI2A 4E3RA 2Z9XA 8AATA 2CJGA 2QA3A 4WP0A 3HBXA 2OATA 1IX6A 1LK9A 2W7GA 2C7TA 4MSOA 1VEFA 2EYQA 4BHDA 3GETA 1IX8A 3KE3A 3RQ1A 1YJSA 2DR1A 4K2IA 4GE7A 4DBCA 2ZSMA 3KGXA 3PPLA 1CJ0A 2O7CA 1QJ3A 3NX3A 2TPLA 2JJFA 3ZRQA 4P7YA 2YRIA 4R8DA 1D7RA 4BA4A 4KXKA 2D66A 2CJDA 4GRXA 2VGUA 2E7JA 2BWPA 3MADA 3FFHA 4LNMA 1C9CA 1TPLA 1TATA 2AEUA 1RVUA 3GR9A 4LW4A 1B9HA 3L8AA 1KKPA 1ARSA 3G0TA 2CTZA 3ASBA 3TQXA 4E77A 1W7MA 3II0A 1CZCA 4DQ6A 2X5DA 5EFSA 1BW0A 3DXWA 3GBXA 1X0MA 4OCAA 5EUDA 3AELA 4A0FA 1C7GA 1WYUA 2BIEA 3ELPA 1G7XA 3G8MA 1TOEA 1AIBA 1FG3A 2BYLA 1AJSB 1LS3A 2YKYA 3PJ0A 1JF9A 1ARIA 1BJWA 1C4KA 1CQ6A 1I43A 2FN6A 2HOYA 3CQ6A 3MC6C 2BHXA 2VMSA 4KAMA 4OC9A 3N4SA 4RAEA 2BYJA 4Q76A 1KMJA 4AOAA 2VMZA 3BS8A 2VMWA 3EZ1A 2VMPA 2OKKA 2W7MA 3VP6A 3B1CA 1M0PA 3JZLA 2NMPA 5DX5A 1OHYA 2VLHA 4AO9A 1ZODA 4WYEA 3LG0A 3PDXA 3FDDA 3IHJA 1FC4A 3HDOA 4W1VA 1BJOB 2C0RA 1YAAA 1B8GA 3PDBA 4RKDA 4ZDPA 1I41A 3BC8A 2CJHA 2FM1A 3CAIA 1IBJA 2VI9A 2CB1A 2R5CB 4NOGA 1WYVB 4WBTA 4RJ0A 3RI6A 4OYTA 1DKAA 3EI7A 2JJGA 2BWNA 1AMAA 1X2AA 3A8UX 2FKIA 2W7LA 5BJ4A 3MAFA 3HMUA 1ECXA 4A6TA 2VGSA 5G2QA 1WSTA 4F4EA 4XJLA 3FQ8A 1SFFA 3VK2A 1RV3A 2EPJA 2X5FA 5DJ1A 3BCBA 1M4NA 2VMVA 4P3MA 2FQ6A 4JEVA 4RITA 1B9IA 2HORA 2E54A 4EB7A 3FTBA 4Q31A 5G4IA 2Z9WA 3PIUA 4ZWVA 3HLMA 1GD9A 5G2PA 3B1DA 4FFCA 1B5OA 3LVJA 3WKRA 1TOJA 4MY5A 3QHXA 4MKJA 4PFFA 2GMSA 4WXFA 3TATA 2CH2A 3COGA 3TFTA 2ZY2A 4AO4A 2Z20A 3JWAA 4B9BA 3PAAA 4ISYA 1AKBA 1YOOA 2G7JA 1O62A 4WYAA 1UU2A 4LNJA 2AATA 4M2JA 5I92A 2QB2A 3FZ6A 1AY5A 3ZRPA 2RFVA 3UAKA 1FG7A 3E9KA 1MAPA 2D63A 3N7NA 4GSAA 1W7NA 1ASDA 1O4SA 1V2FA 2PO3A 3QGUA 4OT8A 1ASAA 3ATHA 3FVSA 4W91A 4F5HA 3NUIA 3FD0A 5E4ZA 4XQ2A 3FVUA 2PB2A 3DR7A 2W7FA 3JTXA 3PGYA 5EAAA 4B98A 1TOIA 1GEYA 4RJYA 4J5UA 1LC5A 2YKVA 3AEMC 3VK3A 4AZKA 5EIGA 1BJ4A 4EB5A 4U2HA 2D61A 2W7KA 1J04A 1M0OA 1IAXA 1VP4A 2VGZA 1UU1A 5FT5A 2CSTA 1ZC9A 3AV7A 2BIAA 2EH6A 1ASLA 2OQXA 4M2KA 3WX9A 4ADEA 2PB0A 1IJIA 3FKDA 4XK1A 1YNUA 1GCKA 1AJSA 1IX7A 2D65A 2F8JA 2Z61A 1ASGA 2D7ZA 5M49A 2W7JA 4R2NA 1ORDA 4JF1A 1CL2A 2QMAA 3MEBA 3USFA 3FQ7A 2HUUA 2W7EA 1WKGA 3DU4A 3VOMA 1AHFA 1W7LA 2W8UA 3AENA 1TARA 1X29A 2XH1A 1AX4A 3CQ4A 2DGMA 2VMXA 4A0HA 4JE5A 4RIZA 5LHAA 3N75A 1QITA 4F5JA 3BB8A 3GJUA 1BJOA 1KKJA 3GZDA 4A6UA 4IW7A 4IX8A 4ZSWA 1BT4A 1H0CA 4RLGA 4EFFA 4OMAA 4ZDLA 4F5LA 2R5CA 4A72A 1CL1A 1WYVA 2AY5A 3NU7A 3IF2A 3FZ7A 2AY2A 3FSLA 5DB5A 4WYCA 3RUYA 3LVLB 1G4XA 3TCMA 5EIGB 3E2ZB 5J8QA 1DGEA 1DFOA 3E2FA 2O0RA 3EI8A 2Q7WA 4PFNA 3WZFA 4HVKA 4GE4A 2AY9A 3K28A 4J8LA 1IVRA 1GEXA 1QGNA 2JJEA 4ADBA 4ZAHA 3LVMA 3OKSA 3A9ZA 1MDXA 1SVVA 3N4RA 2DGKA 4LW2A 2GQNA 1AHXA 3DYDA 2E7IA 2D7YA 4MGRA 3PD6B 3EI5A 1OHVA 4A0GA 3AEMA 2O1BA 3DXVA 2ZY5A 1OATA 3DR4A 1MLZA 3H14A 1M0NA 3UWCA 2GB3A 2HP2A 5C6UA 5LH9A 1GC0A 1LC7A 3KGWA 4TV7A 3P1TA 2VLFA 1X28A 1S06A 3AENB 3PA9A 3FCRA 3BCAA 2YOBA 4ZWMA 1QIRA 2W7HA 3EIAA 5E5IA 3JU7A 1G4VA 3WCNA 3H7FA 1AKCA 1M7YA 4R5FA 4F5KA 3B8XA 2JJHA 1BQAA 1MLYA 5G4JA 2CH1A 2YCNA 4RM1A 4E1OA 1KL1A 4UOYA 4ATQA 1G7WA 2HOZA 2X8UA 2YHKA 4ATPA 1S08A 2YCTA 3N5MA 4H63Q 4WB0A 2HZPA 2ZY4A 2ZP7A 4Y0DA 2KFPA 1AY4A 2GSAA 3L44A 5F9SA 3NYTA 1GEWA 2AEVA 4DGTA 2WK8A 1BKGA 3BN1A 3EZSA 2BIGA 1ZOBA 1UU0A 4LNLA 2W8JA 4MKKA 4F5GA 4A00A 4ZM4A 3BCXA 1BQDA 1JS3A 2EZ1A 2BI1A 3GZCA 4I8AA 5FT4A 3RBFA 2EO5A 2AY1A 2WB6A 4W1XA 2E7UA 1UKJA 1RV4A 2VYCA 2ZUKA 2OGAA 3GZDC 4WLHA 4EMYA 1QJ5A 1IAYA 2DKBA 2Z67A 2ZYJA 3BWNA 1LC8A 5D95A 3AEPA 2W8VA 5HXXA 2BKWA 1BJNA 2D64A 2VMTA 3F9TA 3NYUA 4F5MA 1BS0A 3E77A 3MAUA 2WK9A 1JS6A 2GMUA 2VGTA 2FNIA 5M4BA 4OBUA 3ISLA 4Q6RA 1T3IA 1D2FA 4AH3A 4A0RA 3DC1A 5BJ3A 3A2BA 3MBBA 1W23A 3R4TA 4ZM3A 2OKJA 3WKSA 4XAUA 3WCOA 1TOGA 1AMQA 1D7SA 3E6GA 4WB0B 1WKHA 3DRDA 3Q8NA 3ZZKA 3CBFA 1ASNA 2Z9UA 2DKJA 1E5FA 1V2DA 1SZKA 1U08A 2ZJGA 1QISA 4MQPA 3RBLA 3AEJA 3B46A 2VMOA 3E2ZA 1MDZA 1GBNA 3FQAA 4CBRA 4IYOB 1S09A 5K8BA 1GC2A 1N2TA 3A9YA 4ZDOA 4CXQA 3WGBA 1CQ8A 2EGYA 3CQ5A 2ZSLA 3G7QA 3PD6A 3NYSA 2BI9A 1S07A 4ITGA 5IWQA 3W1JA 1PFFA 4IY7A 4XEWA 5G0AA 1AMSA 1ASMA 2W7IA 4W5KA 3VAXA 4IXOA 4OTLA 3I4JA 2R2NA 4GEBA 1AKAA 5KTBA 3ZRRA 1Z3ZA 2BWOA 4R5ZA 1ARHA 4A6RA 4WXGA 2V0YA 1OXOA 1E5EA 1W3UA 2JISA 3QPGA 5FT8A 3UE8A 4W8IA 1KL2A 1PG8A 1N31A 5HHYA 4WXBA 4L0OA 2HUIA 3QI6A 1MGVA 5M46A 3WLXA 1XEYA 1YIZA 1ASBA 1OHWA 2W8TA 4MQQA 3ZZJA 3BV0A 1JG8A 1ARGA 1Y4IA 3EI6A 4AZJA 2ZC0A 9AATA 4BA5A 1YIYA 4ITXA 1J32A 5G09A 2DGLA 4F5IA 3NRAA 4JEZA 2AY8A 1I29A 1SZSA 5D5SA 3FDBA 2AY7A 1AHGA 3GWPA 1YJZA 1O69A 2BI5A 1WYTA 4Y0IA 2XBNA 3W1IA 4CBSA 2Z9VA 1GC3A 3BWNC 1ASCA 3QBOA 1DGDA 4N0BA 4UQVA 3ACZA 1ARTA 3KKIA 1M32A 1D7VA 5AX8A 3WGCA 3NUBA 1EJIA 1SF2A 3EUCA 1V72A 4FL0A 4JEWA 1O61A 3HQTA 4TMRA 4ADDA 3WY7A 2VMRA 1B4XA 3NTJA 4UHOA 1XI9A 4XJOA 3P6KA 4CVQA 4ZASA 1CS1A 3T32A 3ASAA 4XJPA 3FRKA 1ELUA 3DZZA 3GSBA 1H1CA 3M5UA 4K2BA 5F8VA 3RCHB 4E3QA 3DODA 1MDOA 4BMKA 2CFBA 1I48A 3VK4A 2G6WA 4BQ0A 4OBVA 4ADCA 2FNUA 3LVKA 3QM2A 1ELQA 3K7YA 2DOUA 2OGEA 2QBTA 2X3LA 3AEJC 1DTYA 2VGWA 3LV2A 4N0WA 1C0NA 2V1PA 3FVXA 4WYGA 4F5FA 3HL2A 2QB3A 3ECDA 3EI9A 3A9XA 3K40A 4JEYA 2W8WA 4U1TA 2HUFA 1TOKA 2FYFA 5E3KA 3AEOA 1DJUA 4PIWA 1ASFA 1AJRA 3QN6A 4WYDA 5DJ9A 1RVYA 1ASEA 2AY3A 3AOWA 1IUGA 1PMOA 1WYTB 2BI3A 3I5TA 3MKJA 4KYOA 4UHMA 1M0QA 2VGVA 3F6TA 2AY6A 3H9XA 2VIAA 1AAMA 2Z1YA 5M4DA 5TF5A 4IYOA 1EQBA 2JG2A 2YKUA 1V2EA 2CANA 3FZ8A 4GDYA 2QSRA 4CXRA 2HOXA 1DJEA 4WYFA 3NNKA 1LW4A 2EZ2A 1B5PA 4MQRA 1SZUA 3LY1A 3BWOA 5EAVA 2YCPA 1LKCA 3AOVA 1C7OA 7AATA 1CQ7A 1DJ9A 4XJMA 2WKAA 1AMRA 3NU8A 1AICA 2A1VA 1GC4A 2VMYA 1AAWA 3LWSA 4JEXA 3R9AA 3JWBA 1AIAA 4JE5D 3OP7A 3W1HA 2C44A 3N0LA 5FT6A 4HF8A 1SPAA 2R5EA 1AHEA 1N8PA 2R0TA 3EIBA 4WLJA 1WYUB 4RKCA 4H51A 4M2MA 4Y0HA 4EU1A 4K05A 1M6SA 2YKXA 1LW5A 4K2MA 4O6ZA 2HP1A 4LC3A 3ELEA 4PVFA 1EG5A 2ZY3A 4Q75A 4GE9A 3D6KA 3AATA 5HDMA 2VMQA 2W7DA 2VMNA 2YRRA 3E2YA 3MC6A 3I16A 1OXPA 1GDEA 1MAQA 3PDBB 1P3WA 2CY8A 1KMKA 2JGTA 3N4XA 4TN4A 3HVYA 1YJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IXZ A;  4UHN A;  4ZSY A;  4QGR A;  3NDN A;  2VI8 A;  1AY8 A;  3MAF B;  5EQC A;  4JF0 A;  2QLR A;  1S0A A;  1D7U A;  1AHY A;  3F0H A;  1C7N A;  2CIN A;  2C81 A;  2ORD A;  1PMM A;  1CZE A;  3B1E A;  4W1W A;  2VMU A;  2AY4 A;  2D5Y A;  2VIB A;  3FFR A;  3JW9 A;  5EUE A;  3TFU A;  3HT4 A;  5JAY A;  3RCH A;  1TAS A;  4IXS A;  1Z7D A;  4WD2 A;  1QZ9 A;  2WK7 A;  1VJO A;  4ZLV A;  2Z1Z A;  5EUN A;  2BI2 A;  4E3R A;  2Z9X A;  8AAT A;  2CJG A;  2QA3 A;  4WP0 A;  3HBX A;  2OAT A;  1IX6 A;  1LK9 A;  2W7G A;  2C7T A;  4MSO A;  1VEF A;  4BHD A;  3GET A;  1IX8 A;  3KE3 A;  3RQ1 A;  1YJS A;  2DR1 A;  4K2I A;  4GE7 A;  4DBC A;  2ZSM A;  3KGX A;  3PPL A;  1CJ0 A;  2O7C A;  1QJ3 A;  3NX3 A;  2TPL A;  2JJF A;  3ZRQ A;  4P7Y A;  2YRI A;  4R8D A;  1D7R A;  4BA4 A;  4KXK A;  2D66 A;  2CJD A;  4GRX A;  2VGU A;  2E7J A;  2BWP A;  3MAD A;  3FFH A;  4LNM A;  1C9C A;  1TPL A;  1TAT A;  2AEU A;  1RVU A;  3GR9 A;  4LW4 A;  1B9H A;  3L8A A;  1KKP A;  1ARS A;  3G0T A;  2CTZ A;  3ASB A;  3TQX A;  4E77 A;  1W7M A;  3II0 A;  1CZC A;  4DQ6 A;  2X5D A;  5EFS A;  1BW0 A;  3DXW A;  3GBX A;  1X0M A;  4OCA A;  5EUD A;  3AEL A;  4A0F A;  1C7G A;  1WYU A;  2BIE A;  3ELP A;  1G7X A;  3G8M A;  1TOE A;  1AIB A;  1FG3 A;  2BYL A;  1AJS B;  1LS3 A;  2YKY A;  3PJ0 A;  1JF9 A;  1ARI A;  1BJW A;  1C4K A;  1CQ6 A;  1I43 A;  2FN6 A;  2HOY A;  3CQ6 A;  3MC6 C;  2BHX A;  2VMS A;  4KAM A;  4OC9 A;  4RAE A;  2BYJ A;  4Q76 A;  1KMJ A;  4AOA A;  2VMZ A;  3BS8 A;  2VMW A;  3EZ1 A;  2VMP A;  2OKK A;  2W7M A;  3VP6 A;  3B1C A;  1M0P A;  3JZL A;  2NMP A;  5DX5 A;  1OHY A;  2VLH A;  4AO9 A;  1ZOD A;  4WYE A;  3LG0 A;  3PDX A;  3FDD A;  3IHJ A;  1FC4 A;  3HDO A;  4W1V A;  1BJO B;  2C0R A;  1YAA A;  1B8G A;  3PDB A;  4RKD A;  4ZDP A;  1I41 A;  3BC8 A;  2CJH A;  2FM1 A;  3CAI A;  1IBJ A;  2VI9 A;  2CB1 A;  2R5C B;  4NOG A;  1WYV B;  4WBT A;  4RJ0 A;  3RI6 A;  4OYT A;  1DKA A;  3EI7 A;  2JJG A;  2BWN A;  1AMA A;  1X2A A;  3A8U X;  2W7L A;  5BJ4 A;  3MAF A;  3HMU A;  1ECX A;  4A6T A;  2VGS A;  5G2Q A;  1WST A;  4F4E A;  4XJL A;  3FQ8 A;  1SFF A;  3VK2 A;  1RV3 A;  2EPJ A;  2X5F A;  5DJ1 A;  3BCB A;  1M4N A;  2VMV A;  4P3M A;  2FQ6 A;  4JEV A;  4RIT A;  1B9I A;  2HOR A;  2E54 A;  4EB7 A;  3FTB A;  4Q31 A;  5G4I A;  2Z9W A;  3PIU A;  4ZWV A;  3HLM A;  1GD9 A;  5G2P A;  3B1D A;  4FFC A;  1B5O A;  3LVJ A;  3WKR A;  1TOJ A;  4MY5 A;  3QHX A;  4MKJ A;  4PFF A;  2GMS A;  4WXF A;  3TAT A;  2CH2 A;  3COG A;  3TFT A;  2ZY2 A;  4AO4 A;  2Z20 A;  3JWA A;  4B9B A;  3PAA A;  4ISY A;  1AKB A;  1YOO A;  1O62 A;  4WYA A;  1UU2 A;  4LNJ A;  2AAT A;  4M2J A;  5I92 A;  2QB2 A;  3FZ6 A;  1AY5 A;  3ZRP A;  2RFV A;  3UAK A;  1FG7 A;  3E9K A;  1MAP A;  2D63 A;  4GSA A;  1W7N A;  1ASD A;  1O4S A;  1V2F A;  2PO3 A;  3QGU A;  4OT8 A;  1ASA A;  3ATH A;  3FVS A;  4W91 A;  4F5H A;  3NUI A;  3FD0 A;  5E4Z A;  4XQ2 A;  3FVU A;  2PB2 A;  3DR7 A;  2W7F A;  3JTX A;  3PGY A;  5EAA A;  4B98 A;  1TOI A;  1GEY A;  4RJY A;  4J5U A;  1LC5 A;  2YKV A;  3AEM C;  3VK3 A;  4AZK A;  5EIG A;  1BJ4 A;  4EB5 A;  4U2H A;  2D61 A;  2W7K A;  1J04 A;  1M0O A;  1IAX A;  1VP4 A;  2VGZ A;  1UU1 A;  5FT5 A;  2CST A;  1ZC9 A;  3AV7 A;  2BIA A;  2EH6 A;  1ASL A;  2OQX A;  4M2K A;  3WX9 A;  4ADE A;  2PB0 A;  1IJI A;  3FKD A;  4XK1 A;  1YNU A;  1GCK A;  1AJS A;  1IX7 A;  2D65 A;  2F8J A;  2Z61 A;  1ASG A;  2D7Z A;  5M49 A;  2W7J A;  4R2N A;  1ORD A;  4JF1 A;  1CL2 A;  2QMA A;  3MEB A;  3USF A;  3FQ7 A;  2HUU A;  2W7E A;  1WKG A;  3DU4 A;  3VOM A;  1AHF A;  1W7L A;  2W8U A;  3AEN A;  1TAR A;  1X29 A;  2XH1 A;  1AX4 A;  3CQ4 A;  2DGM A;  2VMX A;  4A0H A;  4JE5 A;  4RIZ A;  5LHA A;  3N75 A;  1QIT A;  4F5J A;  3BB8 A;  3GJU A;  1BJO A;  1KKJ A;  3GZD A;  4A6U A;  4IW7 A;  4IX8 A;  4ZSW A;  1BT4 A;  1H0C A;  4RLG A;  4EFF A;  4OMA A;  4ZDL A;  4F5L A;  2R5C A;  4A72 A;  1CL1 A;  1WYV A;  2AY5 A;  3NU7 A;  3IF2 A;  3FZ7 A;  2AY2 A;  3FSL A;  5DB5 A;  4WYC A;  3RUY A;  3LVL B;  1G4X A;  3TCM A;  5EIG B;  3E2Z B;  5J8Q A;  1DGE A;  1DFO A;  3E2F A;  2O0R A;  3EI8 A;  2Q7W A;  4PFN A;  3WZF A;  4HVK A;  4GE4 A;  2AY9 A;  3K28 A;  4J8L A;  1IVR A;  1GEX A;  1QGN A;  2JJE A;  4ADB A;  4ZAH A;  3LVM A;  3OKS A;  3A9Z A;  1MDX A;  1SVV A;  2DGK A;  4LW2 A;  2GQN A;  1AHX A;  3DYD A;  2E7I A;  2D7Y A;  4MGR A;  3PD6 B;  3EI5 A;  1OHV A;  4A0G A;  3AEM A;  2O1B A;  3DXV A;  2ZY5 A;  1OAT A;  3DR4 A;  1MLZ A;  3H14 A;  1M0N A;  3UWC A;  2GB3 A;  2HP2 A;  5C6U A;  5LH9 A;  1GC0 A;  1LC7 A;  3KGW A;  4TV7 A;  3P1T A;  2VLF A;  1X28 A;  1S06 A;  3AEN B;  3PA9 A;  3FCR A;  3BCA A;  2YOB A;  4ZWM A;  1QIR A;  2W7H A;  3EIA A;  5E5I A;  3JU7 A;  1G4V A;  3WCN A;  3H7F A;  1AKC A;  1M7Y A;  4R5F A;  4F5K A;  3B8X A;  2JJH A;  1BQA A;  1MLY A;  5G4J A;  2CH1 A;  2YCN A;  4RM1 A;  4E1O A;  1KL1 A;  4UOY A;  4ATQ A;  1G7W A;  2HOZ A;  2X8U A;  2YHK A;  4ATP A;  1S08 A;  2YCT A;  3N5M A;  4WB0 A;  2HZP A;  2ZY4 A;  2ZP7 A;  4Y0D A;  1AY4 A;  2GSA A;  3L44 A;  5F9S A;  3NYT A;  1GEW A;  2AEV A;  4DGT A;  2WK8 A;  1BKG A;  3BN1 A;  3EZS A;  2BIG A;  1ZOB A;  1UU0 A;  4LNL A;  2W8J A;  4MKK A;  4F5G A;  4A00 A;  4ZM4 A;  3BCX A;  1BQD A;  1JS3 A;  2EZ1 A;  2BI1 A;  3GZC A;  4I8A A;  5FT4 A;  3RBF A;  2EO5 A;  2AY1 A;  4W1X A;  2E7U A;  1UKJ A;  1RV4 A;  2VYC A;  2ZUK A;  2OGA A;  3GZD C;  4WLH A;  4EMY A;  1QJ5 A;  1IAY A;  2DKB A;  2Z67 A;  2ZYJ A;  3BWN A;  1LC8 A;  5D95 A;  3AEP A;  2W8V A;  5HXX A;  2BKW A;  1BJN A;  2D64 A;  2VMT A;  3F9T A;  3NYU A;  4F5M A;  1BS0 A;  3E77 A;  3MAU A;  2WK9 A;  1JS6 A;  2GMU A;  2VGT A;  2FNI A;  5M4B A;  4OBU A;  3ISL A;  4Q6R A;  1T3I A;  1D2F A;  4AH3 A;  4A0R A;  3DC1 A;  5BJ3 A;  3A2B A;  3MBB A;  1W23 A;  3R4T A;  4ZM3 A;  2OKJ A;  3WKS A;  4XAU A;  3WCO A;  1TOG A;  1AMQ A;  1D7S A;  3E6G A;  4WB0 B;  1WKH A;  3DRD A;  3Q8N A;  3ZZK A;  3CBF A;  1ASN A;  2Z9U A;  2DKJ A;  1E5F A;  1V2D A;  1SZK A;  1U08 A;  2ZJG A;  1QIS A;  4MQP A;  3RBL A;  3AEJ A;  3B46 A;  2VMO A;  3E2Z A;  1MDZ A;  1GBN A;  3FQA A;  4CBR A;  4IYO B;  1S09 A;  5K8B A;  1GC2 A;  1N2T A;  3A9Y A;  4ZDO A;  4CXQ A;  3WGB A;  1CQ8 A;  2EGY A;  3CQ5 A;  2ZSL A;  3G7Q A;  3PD6 A;  3NYS A;  2BI9 A;  1S07 A;  4ITG A;  5IWQ A;  3W1J A;  1PFF A;  4IY7 A;  4XEW A;  5G0A A;  1AMS A;  1ASM A;  2W7I A;  4W5K A;  3VAX A;  4IXO A;  4OTL A;  3I4J A;  2R2N A;  4GEB A;  1AKA A;  3ZRR A;  1Z3Z A;  2BWO A;  4R5Z A;  1ARH A;  4A6R A;  4WXG A;  2V0Y A;  1OXO A;  1E5E A;  1W3U A;  2JIS A;  3QPG A;  5FT8 A;  3UE8 A;  4W8I A;  1KL2 A;  1PG8 A;  1N31 A;  5HHY A;  4WXB A;  4L0O A;  2HUI A;  3QI6 A;  1MGV A;  5M46 A;  3WLX A;  1XEY A;  1YIZ A;  1ASB A;  1OHW A;  2W8T A;  4MQQ A;  3ZZJ A;  3BV0 A;  1JG8 A;  1ARG A;  1Y4I A;  3EI6 A;  4AZJ A;  2ZC0 A;  9AAT A;  4BA5 A;  1YIY A;  4ITX A;  1J32 A;  5G09 A;  2DGL A;  4F5I A;  3NRA A;  4JEZ A;  2AY8 A;  1I29 A;  1SZS A;  5D5S A;  3FDB A;  2AY7 A;  1AHG A;  3GWP A;  1YJZ A;  1O69 A;  2BI5 A;  1WYT A;  4Y0I A;  2XBN A;  3W1I A;  4CBS A;  2Z9V A;  1GC3 A;  3BWN C;  1ASC A;  3QBO A;  1DGD A;  4N0B A;  4UQV A;  3ACZ A;  1ART A;  3KKI A;  1M32 A;  1D7V A;  5AX8 A;  3WGC A;  3NUB A;  1EJI A;  1SF2 A;  3EUC A;  1V72 A;  4FL0 A;  4JEW A;  1O61 A;  3HQT A;  4TMR A;  4ADD A;  3WY7 A;  2VMR A;  1B4X A;  3NTJ A;  4UHO A;  1XI9 A;  4XJO A;  3P6K A;  4CVQ A;  4ZAS A;  1CS1 A;  3T32 A;  3ASA A;  4XJP A;  3FRK A;  1ELU A;  3DZZ A;  3GSB A;  1H1C A;  3M5U A;  4K2B A;  5F8V A;  3RCH B;  4E3Q A;  3DOD A;  1MDO A;  4BMK A;  2CFB A;  1I48 A;  3VK4 A;  2G6W A;  4BQ0 A;  4OBV A;  4ADC A;  2FNU A;  3LVK A;  3QM2 A;  1ELQ A;  3K7Y A;  2DOU A;  2OGE A;  2QBT A;  2X3L A;  3AEJ C;  1DTY A;  2VGW A;  3LV2 A;  4N0W A;  1C0N A;  2V1P A;  3FVX A;  4WYG A;  4F5F A;  3HL2 A;  2QB3 A;  3ECD A;  3EI9 A;  3A9X A;  3K40 A;  4JEY A;  2W8W A;  4U1T A;  2HUF A;  1TOK A;  2FYF A;  5E3K A;  3AEO A;  1DJU A;  4PIW A;  1ASF A;  1AJR A;  3QN6 A;  4WYD A;  5DJ9 A;  1RVY A;  1ASE A;  2AY3 A;  3AOW A;  1IUG A;  1PMO A;  1WYT B;  2BI3 A;  3I5T A;  3MKJ A;  4KYO A;  4UHM A;  1M0Q A;  2VGV A;  3F6T A;  2AY6 A;  2VIA A;  1AAM A;  2Z1Y A;  5M4D A;  5TF5 A;  4IYO A;  1EQB A;  2JG2 A;  2YKU A;  1V2E A;  2CAN A;  3FZ8 A;  4GDY A;  4CXR A;  2HOX A;  1DJE A;  4WYF A;  3NNK A;  1LW4 A;  2EZ2 A;  1B5P A;  4MQR A;  1SZU A;  3LY1 A;  3BWO A;  5EAV A;  2YCP A;  1LKC A;  3AOV A;  1C7O A;  7AAT A;  1CQ7 A;  1DJ9 A;  4XJM A;  2WKA A;  1AMR A;  3NU8 A;  1AIC A;  1GC4 A;  2VMY A;  1AAW A;  3LWS A;  4JEX A;  3R9A A;  3JWB A;  1AIA A;  4JE5 D;  3OP7 A;  3W1H A;  2C44 A;  3N0L A;  5FT6 A;  4HF8 A;  1SPA A;  2R5E A;  1AHE A;  1N8P A;  2R0T A;  3EIB A;  4WLJ A;  1WYU B;  4RKC A;  4H51 A;  4M2M A;  4Y0H A;  4EU1 A;  1M6S A;  2YKX A;  1LW5 A;  4K2M A;  4O6Z A;  2HP1 A;  4LC3 A;  3ELE A;  4PVF A;  1EG5 A;  2ZY3 A;  4Q75 A;  4GE9 A;  3D6K A;  3AAT A;  5HDM A;  2VMQ A;  2W7D A;  2VMN A;  2YRR A;  3E2Y A;  3MC6 A;  3I16 A;  1OXP A;  1GDE A;  1MAQ A;  3PDB B;  1P3W A;  2CY8 A;  1KMK A;  2JGT A;  4TN4 A;  3HVY A;  1YJY A; 
#chains in the Genus database with same CATH topology
 4IXZ A;  4UHN A;  4ZSY A;  4QGR A;  3NDN A;  2VI8 A;  1AY8 A;  3MAF B;  5EQC A;  4JF0 A;  2QLR A;  1S0A A;  1D7U A;  1AHY A;  3F0H A;  1C7N A;  2CIN A;  2C81 A;  2ORD A;  1PMM A;  1CZE A;  3B1E A;  4W1W A;  2VMU A;  2AY4 A;  2D5Y A;  2VIB A;  3FFR A;  3JW9 A;  5EUE A;  3TFU A;  3HT4 A;  5JAY A;  3RCH A;  1TAS A;  4IXS A;  1Z7D A;  4WD2 A;  1QZ9 A;  2WK7 A;  1VJO A;  4ZLV A;  2Z1Z A;  5EUN A;  2BI2 A;  4E3R A;  2Z9X A;  8AAT A;  2CJG A;  2QA3 A;  4WP0 A;  3HBX A;  1KAF A;  2OAT A;  1IX6 A;  1LK9 A;  2W7G A;  2C7T A;  4MSO A;  1VEF A;  2EYQ A;  4BHD A;  3GET A;  1IX8 A;  3KE3 A;  3RQ1 A;  1YJS A;  2DR1 A;  4K2I A;  4GE7 A;  4DBC A;  2ZSM A;  3KGX A;  3PPL A;  1CJ0 A;  2O7C A;  1QJ3 A;  3NX3 A;  2TPL A;  2JJF A;  3ZRQ A;  4P7Y A;  2YRI A;  4R8D A;  1D7R A;  4BA4 A;  4KXK A;  2D66 A;  2CJD A;  4GRX A;  2VGU A;  2E7J A;  2BWP A;  3MAD A;  3FFH A;  4LNM A;  1C9C A;  1TPL A;  1TAT A;  2AEU A;  1RVU A;  3GR9 A;  4LW4 A;  1B9H A;  3L8A A;  1KKP A;  1ARS A;  3G0T A;  2CTZ A;  3ASB A;  3TQX A;  4E77 A;  1W7M A;  3II0 A;  1CZC A;  4DQ6 A;  2X5D A;  5EFS A;  1BW0 A;  3DXW A;  3GBX A;  1X0M A;  4OCA A;  5EUD A;  3AEL A;  4A0F A;  1C7G A;  1WYU A;  2BIE A;  3ELP A;  1G7X A;  3G8M A;  1TOE A;  1AIB A;  1FG3 A;  2BYL A;  1AJS B;  1LS3 A;  2YKY A;  3PJ0 A;  1JF9 A;  1ARI A;  1BJW A;  1C4K A;  1CQ6 A;  1I43 A;  2FN6 A;  2HOY A;  3CQ6 A;  3MC6 C;  2BHX A;  2VMS A;  4KAM A;  4OC9 A;  3N4S A;  4RAE A;  2BYJ A;  4Q76 A;  1KMJ A;  4AOA A;  2VMZ A;  3BS8 A;  2VMW A;  3EZ1 A;  2VMP A;  2OKK A;  2W7M A;  3VP6 A;  3B1C A;  1M0P A;  3JZL A;  2NMP A;  5DX5 A;  1OHY A;  2VLH A;  4AO9 A;  1ZOD A;  4WYE A;  3LG0 A;  3PDX A;  3FDD A;  3IHJ A;  1FC4 A;  3HDO A;  4W1V A;  1BJO B;  2C0R A;  1YAA A;  1B8G A;  3PDB A;  4RKD A;  4ZDP A;  1I41 A;  3BC8 A;  2CJH A;  2FM1 A;  3CAI A;  1IBJ A;  2VI9 A;  2CB1 A;  2R5C B;  4NOG A;  1WYV B;  4WBT A;  4RJ0 A;  3RI6 A;  4OYT A;  1DKA A;  3EI7 A;  2JJG A;  2BWN A;  1AMA A;  1X2A A;  3A8U X;  2FKI A;  2W7L A;  5BJ4 A;  3MAF A;  3HMU A;  1ECX A;  4A6T A;  2VGS A;  5G2Q A;  1WST A;  4F4E A;  4XJL A;  3FQ8 A;  1SFF A;  3VK2 A;  1RV3 A;  2EPJ A;  2X5F A;  5DJ1 A;  3BCB A;  1M4N A;  2VMV A;  4P3M A;  2FQ6 A;  4JEV A;  4RIT A;  1B9I A;  2HOR A;  2E54 A;  4EB7 A;  3FTB A;  4Q31 A;  5G4I A;  2Z9W A;  3PIU A;  4ZWV A;  3HLM A;  1GD9 A;  5G2P A;  3B1D A;  4FFC A;  1B5O A;  3LVJ A;  3WKR A;  1TOJ A;  4MY5 A;  3QHX A;  4MKJ A;  4PFF A;  2GMS A;  4WXF A;  3TAT A;  2CH2 A;  3COG A;  3TFT A;  2ZY2 A;  4AO4 A;  2Z20 A;  3JWA A;  4B9B A;  3PAA A;  4ISY A;  1AKB A;  1YOO A;  2G7J A;  1O62 A;  4WYA A;  1UU2 A;  4LNJ A;  2AAT A;  4M2J A;  5I92 A;  2QB2 A;  3FZ6 A;  1AY5 A;  3ZRP A;  2RFV A;  3UAK A;  1FG7 A;  3E9K A;  1MAP A;  2D63 A;  3N7N A;  4GSA A;  1W7N A;  1ASD A;  1O4S A;  1V2F A;  2PO3 A;  3QGU A;  4OT8 A;  1ASA A;  3ATH A;  3FVS A;  4W91 A;  4F5H A;  3NUI A;  3FD0 A;  5E4Z A;  4XQ2 A;  3FVU A;  2PB2 A;  3DR7 A;  2W7F A;  3JTX A;  3PGY A;  5EAA A;  4B98 A;  1TOI A;  1GEY A;  4RJY A;  4J5U A;  1LC5 A;  2YKV A;  3AEM C;  3VK3 A;  4AZK A;  5EIG A;  1BJ4 A;  4EB5 A;  4U2H A;  2D61 A;  2W7K A;  1J04 A;  1M0O A;  1IAX A;  1VP4 A;  2VGZ A;  1UU1 A;  5FT5 A;  2CST A;  1ZC9 A;  3AV7 A;  2BIA A;  2EH6 A;  1ASL A;  2OQX A;  4M2K A;  3WX9 A;  4ADE A;  2PB0 A;  1IJI A;  3FKD A;  4XK1 A;  1YNU A;  1GCK A;  1AJS A;  1IX7 A;  2D65 A;  2F8J A;  2Z61 A;  1ASG A;  2D7Z A;  5M49 A;  2W7J A;  4R2N A;  1ORD A;  4JF1 A;  1CL2 A;  2QMA A;  3MEB A;  3USF A;  3FQ7 A;  2HUU A;  2W7E A;  1WKG A;  3DU4 A;  3VOM A;  1AHF A;  1W7L A;  2W8U A;  3AEN A;  1TAR A;  1X29 A;  2XH1 A;  1AX4 A;  3CQ4 A;  2DGM A;  2VMX A;  4A0H A;  4JE5 A;  4RIZ A;  5LHA A;  3N75 A;  1QIT A;  4F5J A;  3BB8 A;  3GJU A;  1BJO A;  1KKJ A;  3GZD A;  4A6U A;  4IW7 A;  4IX8 A;  4ZSW A;  1BT4 A;  1H0C A;  4RLG A;  4EFF A;  4OMA A;  4ZDL A;  4F5L A;  2R5C A;  4A72 A;  1CL1 A;  1WYV A;  2AY5 A;  3NU7 A;  3IF2 A;  3FZ7 A;  2AY2 A;  3FSL A;  5DB5 A;  4WYC A;  3RUY A;  3LVL B;  1G4X A;  3TCM A;  5EIG B;  3E2Z B;  5J8Q A;  1DGE A;  1DFO A;  3E2F A;  2O0R A;  3EI8 A;  2Q7W A;  4PFN A;  3WZF A;  4HVK A;  4GE4 A;  2AY9 A;  3K28 A;  4J8L A;  1IVR A;  1GEX A;  1QGN A;  2JJE A;  4ADB A;  4ZAH A;  3LVM A;  3OKS A;  3A9Z A;  1MDX A;  1SVV A;  3N4R A;  2DGK A;  4LW2 A;  2GQN A;  1AHX A;  3DYD A;  2E7I A;  2D7Y A;  4MGR A;  3PD6 B;  3EI5 A;  1OHV A;  4A0G A;  3AEM A;  2O1B A;  3DXV A;  2ZY5 A;  1OAT A;  3DR4 A;  1MLZ A;  3H14 A;  1M0N A;  3UWC A;  2GB3 A;  2HP2 A;  5C6U A;  5LH9 A;  1GC0 A;  1LC7 A;  3KGW A;  4TV7 A;  3P1T A;  2VLF A;  1X28 A;  1S06 A;  3AEN B;  3PA9 A;  3FCR A;  3BCA A;  2YOB A;  4ZWM A;  1QIR A;  2W7H A;  3EIA A;  5E5I A;  3JU7 A;  1G4V A;  3WCN A;  3H7F A;  1AKC A;  1M7Y A;  4R5F A;  4F5K A;  3B8X A;  2JJH A;  1BQA A;  1MLY A;  5G4J A;  2CH1 A;  2YCN A;  4RM1 A;  4E1O A;  1KL1 A;  4UOY A;  4ATQ A;  1G7W A;  2HOZ A;  2X8U A;  2YHK A;  4ATP A;  1S08 A;  2YCT A;  3N5M A;  4H63 Q;  4WB0 A;  2HZP A;  2ZY4 A;  2ZP7 A;  4Y0D A;  2KFP A;  1AY4 A;  2GSA A;  3L44 A;  5F9S A;  3NYT A;  1GEW A;  2AEV A;  4DGT A;  2WK8 A;  1BKG A;  3BN1 A;  3EZS A;  2BIG A;  1ZOB A;  1UU0 A;  4LNL A;  2W8J A;  4MKK A;  4F5G A;  4A00 A;  4ZM4 A;  3BCX A;  1BQD A;  1JS3 A;  2EZ1 A;  2BI1 A;  3GZC A;  4I8A A;  5FT4 A;  3RBF A;  2EO5 A;  2AY1 A;  2WB6 A;  4W1X A;  2E7U A;  1UKJ A;  1RV4 A;  2VYC A;  2ZUK A;  2OGA A;  3GZD C;  4WLH A;  4EMY A;  1QJ5 A;  1IAY A;  2DKB A;  2Z67 A;  2ZYJ A;  3BWN A;  1LC8 A;  5D95 A;  3AEP A;  2W8V A;  5HXX A;  2BKW A;  1BJN A;  2D64 A;  2VMT A;  3F9T A;  3NYU A;  4F5M A;  1BS0 A;  3E77 A;  3MAU A;  2WK9 A;  1JS6 A;  2GMU A;  2VGT A;  2FNI A;  5M4B A;  4OBU A;  3ISL A;  4Q6R A;  1T3I A;  1D2F A;  4AH3 A;  4A0R A;  3DC1 A;  5BJ3 A;  3A2B A;  3MBB A;  1W23 A;  3R4T A;  4ZM3 A;  2OKJ A;  3WKS A;  4XAU A;  3WCO A;  1TOG A;  1AMQ A;  1D7S A;  3E6G A;  4WB0 B;  1WKH A;  3DRD A;  3Q8N A;  3ZZK A;  3CBF A;  1ASN A;  2Z9U A;  2DKJ A;  1E5F A;  1V2D A;  1SZK A;  1U08 A;  2ZJG A;  1QIS A;  4MQP A;  3RBL A;  3AEJ A;  3B46 A;  2VMO A;  3E2Z A;  1MDZ A;  1GBN A;  3FQA A;  4CBR A;  4IYO B;  1S09 A;  5K8B A;  1GC2 A;  1N2T A;  3A9Y A;  4ZDO A;  4CXQ A;  3WGB A;  1CQ8 A;  2EGY A;  3CQ5 A;  2ZSL A;  3G7Q A;  3PD6 A;  3NYS A;  2BI9 A;  1S07 A;  4ITG A;  5IWQ A;  3W1J A;  1PFF A;  4IY7 A;  4XEW A;  5G0A A;  1AMS A;  1ASM A;  2W7I A;  4W5K A;  3VAX A;  4IXO A;  4OTL A;  3I4J A;  2R2N A;  4GEB A;  1AKA A;  5KTB A;  3ZRR A;  1Z3Z A;  2BWO A;  4R5Z A;  1ARH A;  4A6R A;  4WXG A;  2V0Y A;  1OXO A;  1E5E A;  1W3U A;  2JIS A;  3QPG A;  5FT8 A;  3UE8 A;  4W8I A;  1KL2 A;  1PG8 A;  1N31 A;  5HHY A;  4WXB A;  4L0O A;  2HUI A;  3QI6 A;  1MGV A;  5M46 A;  3WLX A;  1XEY A;  1YIZ A;  1ASB A;  1OHW A;  2W8T A;  4MQQ A;  3ZZJ A;  3BV0 A;  1JG8 A;  1ARG A;  1Y4I A;  3EI6 A;  4AZJ A;  2ZC0 A;  9AAT A;  4BA5 A;  1YIY A;  4ITX A;  1J32 A;  5G09 A;  2DGL A;  4F5I A;  3NRA A;  4JEZ A;  2AY8 A;  1I29 A;  1SZS A;  5D5S A;  3FDB A;  2AY7 A;  1AHG A;  3GWP A;  1YJZ A;  1O69 A;  2BI5 A;  1WYT A;  4Y0I A;  2XBN A;  3W1I A;  4CBS A;  2Z9V A;  1GC3 A;  3BWN C;  1ASC A;  3QBO A;  1DGD A;  4N0B A;  4UQV A;  3ACZ A;  1ART A;  3KKI A;  1M32 A;  1D7V A;  5AX8 A;  3WGC A;  3NUB A;  1EJI A;  1SF2 A;  3EUC A;  1V72 A;  4FL0 A;  4JEW A;  1O61 A;  3HQT A;  4TMR A;  4ADD A;  3WY7 A;  2VMR A;  1B4X A;  3NTJ A;  4UHO A;  1XI9 A;  4XJO A;  3P6K A;  4CVQ A;  4ZAS A;  1CS1 A;  3T32 A;  3ASA A;  4XJP A;  3FRK A;  1ELU A;  3DZZ A;  3GSB A;  1H1C A;  3M5U A;  4K2B A;  5F8V A;  3RCH B;  4E3Q A;  3DOD A;  1MDO A;  4BMK A;  2CFB A;  1I48 A;  3VK4 A;  2G6W A;  4BQ0 A;  4OBV A;  4ADC A;  2FNU A;  3LVK A;  3QM2 A;  1ELQ A;  3K7Y A;  2DOU A;  2OGE A;  2QBT A;  2X3L A;  3AEJ C;  1DTY A;  2VGW A;  3LV2 A;  4N0W A;  1C0N A;  2V1P A;  3FVX A;  4WYG A;  4F5F A;  3HL2 A;  2QB3 A;  3ECD A;  3EI9 A;  3A9X A;  3K40 A;  4JEY A;  2W8W A;  4U1T A;  2HUF A;  1TOK A;  2FYF A;  5E3K A;  3AEO A;  1DJU A;  4PIW A;  1ASF A;  1AJR A;  3QN6 A;  4WYD A;  5DJ9 A;  1RVY A;  1ASE A;  2AY3 A;  3AOW A;  1IUG A;  1PMO A;  1WYT B;  2BI3 A;  3I5T A;  3MKJ A;  4KYO A;  4UHM A;  1M0Q A;  2VGV A;  3F6T A;  2AY6 A;  3H9X A;  2VIA A;  1AAM A;  2Z1Y A;  5M4D A;  5TF5 A;  4IYO A;  1EQB A;  2JG2 A;  2YKU A;  1V2E A;  2CAN A;  3FZ8 A;  4GDY A;  2QSR A;  4CXR A;  2HOX A;  1DJE A;  4WYF A;  3NNK A;  1LW4 A;  2EZ2 A;  1B5P A;  4MQR A;  1SZU A;  3LY1 A;  3BWO A;  5EAV A;  2YCP A;  1LKC A;  3AOV A;  1C7O A;  7AAT A;  1CQ7 A;  1DJ9 A;  4XJM A;  2WKA A;  1AMR A;  3NU8 A;  1AIC A;  2A1V A;  1GC4 A;  2VMY A;  1AAW A;  3LWS A;  4JEX A;  3R9A A;  3JWB A;  1AIA A;  4JE5 D;  3OP7 A;  3W1H A;  2C44 A;  3N0L A;  5FT6 A;  4HF8 A;  1SPA A;  2R5E A;  1AHE A;  1N8P A;  2R0T A;  3EIB A;  4WLJ A;  1WYU B;  4RKC A;  4H51 A;  4M2M A;  4Y0H A;  4EU1 A;  4K05 A;  1M6S A;  2YKX A;  1LW5 A;  4K2M A;  4O6Z A;  2HP1 A;  4LC3 A;  3ELE A;  4PVF A;  1EG5 A;  2ZY3 A;  4Q75 A;  4GE9 A;  3D6K A;  3AAT A;  5HDM A;  2VMQ A;  2W7D A;  2VMN A;  2YRR A;  3E2Y A;  3MC6 A;  3I16 A;  1OXP A;  1GDE A;  1MAQ A;  3PDB B;  1P3W A;  2CY8 A;  1KMK A;  2JGT A;  3N4X A;  4TN4 A;  3HVY A;  1YJY A; 
#chains in the Genus database with same CATH homology
 4IXZ A;  4UHN A;  4ZSY A;  4QGR A;  3NDN A;  2VI8 A;  1AY8 A;  3MAF B;  5EQC A;  4JF0 A;  2QLR A;  1S0A A;  1D7U A;  1AHY A;  3F0H A;  1C7N A;  2CIN A;  2C81 A;  2ORD A;  1PMM A;  1CZE A;  3B1E A;  4W1W A;  2VMU A;  2AY4 A;  2D5Y A;  2VIB A;  3FFR A;  3JW9 A;  5EUE A;  3TFU A;  3HT4 A;  5JAY A;  3RCH A;  1TAS A;  4IXS A;  1Z7D A;  4WD2 A;  1QZ9 A;  2WK7 A;  1VJO A;  4ZLV A;  2Z1Z A;  5EUN A;  2BI2 A;  4E3R A;  2Z9X A;  8AAT A;  2CJG A;  2QA3 A;  4WP0 A;  3HBX A;  2OAT A;  1IX6 A;  1LK9 A;  2W7G A;  2C7T A;  4MSO A;  1VEF A;  2EYQ A;  4BHD A;  3GET A;  1IX8 A;  3KE3 A;  3RQ1 A;  1YJS A;  2DR1 A;  4K2I A;  4GE7 A;  4DBC A;  2ZSM A;  3KGX A;  3PPL A;  1CJ0 A;  2O7C A;  1QJ3 A;  3NX3 A;  2TPL A;  2JJF A;  3ZRQ A;  4P7Y A;  2YRI A;  4R8D A;  1D7R A;  4BA4 A;  4KXK A;  2D66 A;  2CJD A;  4GRX A;  2VGU A;  2E7J A;  2BWP A;  3MAD A;  3FFH A;  4LNM A;  1C9C A;  1TPL A;  1TAT A;  2AEU A;  1RVU A;  3GR9 A;  4LW4 A;  1B9H A;  3L8A A;  1KKP A;  1ARS A;  3G0T A;  2CTZ A;  3ASB A;  3TQX A;  4E77 A;  1W7M A;  3II0 A;  1CZC A;  4DQ6 A;  2X5D A;  5EFS A;  1BW0 A;  3DXW A;  3GBX A;  1X0M A;  4OCA A;  5EUD A;  3AEL A;  4A0F A;  1C7G A;  1WYU A;  2BIE A;  3ELP A;  1G7X A;  3G8M A;  1TOE A;  1AIB A;  1FG3 A;  2BYL A;  1AJS B;  1LS3 A;  2YKY A;  3PJ0 A;  1JF9 A;  1ARI A;  1BJW A;  1C4K A;  1CQ6 A;  1I43 A;  2FN6 A;  2HOY A;  3CQ6 A;  3MC6 C;  2BHX A;  2VMS A;  4KAM A;  4OC9 A;  3N4S A;  4RAE A;  2BYJ A;  4Q76 A;  1KMJ A;  4AOA A;  2VMZ A;  3BS8 A;  2VMW A;  3EZ1 A;  2VMP A;  2OKK A;  2W7M A;  3VP6 A;  3B1C A;  1M0P A;  3JZL A;  2NMP A;  5DX5 A;  1OHY A;  2VLH A;  4AO9 A;  1ZOD A;  4WYE A;  3LG0 A;  3PDX A;  3FDD A;  3IHJ A;  1FC4 A;  3HDO A;  4W1V A;  1BJO B;  2C0R A;  1YAA A;  1B8G A;  3PDB A;  4RKD A;  4ZDP A;  1I41 A;  3BC8 A;  2CJH A;  2FM1 A;  3CAI A;  1IBJ A;  2VI9 A;  2CB1 A;  2R5C B;  4NOG A;  1WYV B;  4WBT A;  4RJ0 A;  3RI6 A;  4OYT A;  1DKA A;  3EI7 A;  2JJG A;  2BWN A;  1AMA A;  1X2A A;  3A8U X;  2FKI A;  2W7L A;  5BJ4 A;  3MAF A;  3HMU A;  1ECX A;  4A6T A;  2VGS A;  5G2Q A;  1WST A;  4F4E A;  4XJL A;  3FQ8 A;  1SFF A;  3VK2 A;  1RV3 A;  2EPJ A;  2X5F A;  5DJ1 A;  3BCB A;  1M4N A;  2VMV A;  4P3M A;  2FQ6 A;  4JEV A;  4RIT A;  1B9I A;  2HOR A;  2E54 A;  4EB7 A;  3FTB A;  4Q31 A;  5G4I A;  2Z9W A;  3PIU A;  4ZWV A;  3HLM A;  1GD9 A;  5G2P A;  3B1D A;  4FFC A;  1B5O A;  3LVJ A;  3WKR A;  1TOJ A;  4MY5 A;  3QHX A;  4MKJ A;  4PFF A;  2GMS A;  4WXF A;  3TAT A;  2CH2 A;  3COG A;  3TFT A;  2ZY2 A;  4AO4 A;  2Z20 A;  3JWA A;  4B9B A;  3PAA A;  4ISY A;  1AKB A;  1YOO A;  2G7J A;  1O62 A;  4WYA A;  1UU2 A;  4LNJ A;  2AAT A;  4M2J A;  5I92 A;  2QB2 A;  3FZ6 A;  1AY5 A;  3ZRP A;  2RFV A;  3UAK A;  1FG7 A;  3E9K A;  1MAP A;  2D63 A;  3N7N A;  4GSA A;  1W7N A;  1ASD A;  1O4S A;  1V2F A;  2PO3 A;  3QGU A;  4OT8 A;  1ASA A;  3ATH A;  3FVS A;  4W91 A;  4F5H A;  3NUI A;  3FD0 A;  5E4Z A;  4XQ2 A;  3FVU A;  2PB2 A;  3DR7 A;  2W7F A;  3JTX A;  3PGY A;  5EAA A;  4B98 A;  1TOI A;  1GEY A;  4RJY A;  4J5U A;  1LC5 A;  2YKV A;  3AEM C;  3VK3 A;  4AZK A;  5EIG A;  1BJ4 A;  4EB5 A;  4U2H A;  2D61 A;  2W7K A;  1J04 A;  1M0O A;  1IAX A;  1VP4 A;  2VGZ A;  1UU1 A;  5FT5 A;  2CST A;  1ZC9 A;  3AV7 A;  2BIA A;  2EH6 A;  1ASL A;  2OQX A;  4M2K A;  3WX9 A;  4ADE A;  2PB0 A;  1IJI A;  3FKD A;  4XK1 A;  1YNU A;  1GCK A;  1AJS A;  1IX7 A;  2D65 A;  2F8J A;  2Z61 A;  1ASG A;  2D7Z A;  5M49 A;  2W7J A;  4R2N A;  1ORD A;  4JF1 A;  1CL2 A;  2QMA A;  3MEB A;  3USF A;  3FQ7 A;  2HUU A;  2W7E A;  1WKG A;  3DU4 A;  3VOM A;  1AHF A;  1W7L A;  2W8U A;  3AEN A;  1TAR A;  1X29 A;  2XH1 A;  1AX4 A;  3CQ4 A;  2DGM A;  2VMX A;  4A0H A;  4JE5 A;  4RIZ A;  5LHA A;  3N75 A;  1QIT A;  4F5J A;  3BB8 A;  3GJU A;  1BJO A;  1KKJ A;  3GZD A;  4A6U A;  4IW7 A;  4IX8 A;  4ZSW A;  1BT4 A;  1H0C A;  4RLG A;  4EFF A;  4OMA A;  4ZDL A;  4F5L A;  2R5C A;  4A72 A;  1CL1 A;  1WYV A;  2AY5 A;  3NU7 A;  3IF2 A;  3FZ7 A;  2AY2 A;  3FSL A;  5DB5 A;  4WYC A;  3RUY A;  3LVL B;  1G4X A;  3TCM A;  5EIG B;  3E2Z B;  5J8Q A;  1DGE A;  1DFO A;  3E2F A;  2O0R A;  3EI8 A;  2Q7W A;  4PFN A;  3WZF A;  4HVK A;  4GE4 A;  2AY9 A;  3K28 A;  4J8L A;  1IVR A;  1GEX A;  1QGN A;  2JJE A;  4ADB A;  4ZAH A;  3LVM A;  3OKS A;  3A9Z A;  1MDX A;  1SVV A;  3N4R A;  2DGK A;  4LW2 A;  2GQN A;  1AHX A;  3DYD A;  2E7I A;  2D7Y A;  4MGR A;  3PD6 B;  3EI5 A;  1OHV A;  4A0G A;  3AEM A;  2O1B A;  3DXV A;  2ZY5 A;  1OAT A;  3DR4 A;  1MLZ A;  3H14 A;  1M0N A;  3UWC A;  2GB3 A;  2HP2 A;  5C6U A;  5LH9 A;  1GC0 A;  1LC7 A;  3KGW A;  4TV7 A;  3P1T A;  2VLF A;  1X28 A;  1S06 A;  3AEN B;  3PA9 A;  3FCR A;  3BCA A;  2YOB A;  4ZWM A;  1QIR A;  2W7H A;  3EIA A;  5E5I A;  3JU7 A;  1G4V A;  3WCN A;  3H7F A;  1AKC A;  1M7Y A;  4R5F A;  4F5K A;  3B8X A;  2JJH A;  1BQA A;  1MLY A;  5G4J A;  2CH1 A;  2YCN A;  4RM1 A;  4E1O A;  1KL1 A;  4UOY A;  4ATQ A;  1G7W A;  2HOZ A;  2X8U A;  2YHK A;  4ATP A;  1S08 A;  2YCT A;  3N5M A;  4H63 Q;  4WB0 A;  2HZP A;  2ZY4 A;  2ZP7 A;  4Y0D A;  2KFP A;  1AY4 A;  2GSA A;  3L44 A;  5F9S A;  3NYT A;  1GEW A;  2AEV A;  4DGT A;  2WK8 A;  1BKG A;  3BN1 A;  3EZS A;  2BIG A;  1ZOB A;  1UU0 A;  4LNL A;  2W8J A;  4MKK A;  4F5G A;  4A00 A;  4ZM4 A;  3BCX A;  1BQD A;  1JS3 A;  2EZ1 A;  2BI1 A;  3GZC A;  4I8A A;  5FT4 A;  3RBF A;  2EO5 A;  2AY1 A;  2WB6 A;  4W1X A;  2E7U A;  1UKJ A;  1RV4 A;  2VYC A;  2ZUK A;  2OGA A;  3GZD C;  4WLH A;  4EMY A;  1QJ5 A;  1IAY A;  2DKB A;  2Z67 A;  2ZYJ A;  3BWN A;  1LC8 A;  5D95 A;  3AEP A;  2W8V A;  5HXX A;  2BKW A;  1BJN A;  2D64 A;  2VMT A;  3F9T A;  3NYU A;  4F5M A;  1BS0 A;  3E77 A;  3MAU A;  2WK9 A;  1JS6 A;  2GMU A;  2VGT A;  2FNI A;  5M4B A;  4OBU A;  3ISL A;  4Q6R A;  1T3I A;  1D2F A;  4AH3 A;  4A0R A;  3DC1 A;  5BJ3 A;  3A2B A;  3MBB A;  1W23 A;  3R4T A;  4ZM3 A;  2OKJ A;  3WKS A;  4XAU A;  3WCO A;  1TOG A;  1AMQ A;  1D7S A;  3E6G A;  4WB0 B;  1WKH A;  3DRD A;  3Q8N A;  3ZZK A;  3CBF A;  1ASN A;  2Z9U A;  2DKJ A;  1E5F A;  1V2D A;  1SZK A;  1U08 A;  2ZJG A;  1QIS A;  4MQP A;  3RBL A;  3AEJ A;  3B46 A;  2VMO A;  3E2Z A;  1MDZ A;  1GBN A;  3FQA A;  4CBR A;  4IYO B;  1S09 A;  5K8B A;  1GC2 A;  1N2T A;  3A9Y A;  4ZDO A;  4CXQ A;  3WGB A;  1CQ8 A;  2EGY A;  3CQ5 A;  2ZSL A;  3G7Q A;  3PD6 A;  3NYS A;  2BI9 A;  1S07 A;  4ITG A;  5IWQ A;  3W1J A;  1PFF A;  4IY7 A;  4XEW A;  5G0A A;  1AMS A;  1ASM A;  2W7I A;  4W5K A;  3VAX A;  4IXO A;  4OTL A;  3I4J A;  2R2N A;  4GEB A;  1AKA A;  5KTB A;  3ZRR A;  1Z3Z A;  2BWO A;  4R5Z A;  1ARH A;  4A6R A;  4WXG A;  2V0Y A;  1OXO A;  1E5E A;  1W3U A;  2JIS A;  3QPG A;  5FT8 A;  3UE8 A;  4W8I A;  1KL2 A;  1PG8 A;  1N31 A;  5HHY A;  4WXB A;  4L0O A;  2HUI A;  3QI6 A;  1MGV A;  5M46 A;  3WLX A;  1XEY A;  1YIZ A;  1ASB A;  1OHW A;  2W8T A;  4MQQ A;  3ZZJ A;  3BV0 A;  1JG8 A;  1ARG A;  1Y4I A;  3EI6 A;  4AZJ A;  2ZC0 A;  9AAT A;  4BA5 A;  1YIY A;  4ITX A;  1J32 A;  5G09 A;  2DGL A;  4F5I A;  3NRA A;  4JEZ A;  2AY8 A;  1I29 A;  1SZS A;  5D5S A;  3FDB A;  2AY7 A;  1AHG A;  3GWP A;  1YJZ A;  1O69 A;  2BI5 A;  1WYT A;  4Y0I A;  2XBN A;  3W1I A;  4CBS A;  2Z9V A;  1GC3 A;  3BWN C;  1ASC A;  3QBO A;  1DGD A;  4N0B A;  4UQV A;  3ACZ A;  1ART A;  3KKI A;  1M32 A;  1D7V A;  5AX8 A;  3WGC A;  3NUB A;  1EJI A;  1SF2 A;  3EUC A;  1V72 A;  4FL0 A;  4JEW A;  1O61 A;  3HQT A;  4TMR A;  4ADD A;  3WY7 A;  2VMR A;  1B4X A;  3NTJ A;  4UHO A;  1XI9 A;  4XJO A;  3P6K A;  4CVQ A;  4ZAS A;  1CS1 A;  3T32 A;  3ASA A;  4XJP A;  3FRK A;  1ELU A;  3DZZ A;  3GSB A;  1H1C A;  3M5U A;  4K2B A;  5F8V A;  3RCH B;  4E3Q A;  3DOD A;  1MDO A;  4BMK A;  2CFB A;  1I48 A;  3VK4 A;  2G6W A;  4BQ0 A;  4OBV A;  4ADC A;  2FNU A;  3LVK A;  3QM2 A;  1ELQ A;  3K7Y A;  2DOU A;  2OGE A;  2QBT A;  2X3L A;  3AEJ C;  1DTY A;  2VGW A;  3LV2 A;  4N0W A;  1C0N A;  2V1P A;  3FVX A;  4WYG A;  4F5F A;  3HL2 A;  2QB3 A;  3ECD A;  3EI9 A;  3A9X A;  3K40 A;  4JEY A;  2W8W A;  4U1T A;  2HUF A;  1TOK A;  2FYF A;  5E3K A;  3AEO A;  1DJU A;  4PIW A;  1ASF A;  1AJR A;  3QN6 A;  4WYD A;  5DJ9 A;  1RVY A;  1ASE A;  2AY3 A;  3AOW A;  1IUG A;  1PMO A;  1WYT B;  2BI3 A;  3I5T A;  3MKJ A;  4KYO A;  4UHM A;  1M0Q A;  2VGV A;  3F6T A;  2AY6 A;  3H9X A;  2VIA A;  1AAM A;  2Z1Y A;  5M4D A;  5TF5 A;  4IYO A;  1EQB A;  2JG2 A;  2YKU A;  1V2E A;  2CAN A;  3FZ8 A;  4GDY A;  2QSR A;  4CXR A;  2HOX A;  1DJE A;  4WYF A;  3NNK A;  1LW4 A;  2EZ2 A;  1B5P A;  4MQR A;  1SZU A;  3LY1 A;  3BWO A;  5EAV A;  2YCP A;  1LKC A;  3AOV A;  1C7O A;  7AAT A;  1CQ7 A;  1DJ9 A;  4XJM A;  2WKA A;  1AMR A;  3NU8 A;  1AIC A;  2A1V A;  1GC4 A;  2VMY A;  1AAW A;  3LWS A;  4JEX A;  3R9A A;  3JWB A;  1AIA A;  4JE5 D;  3OP7 A;  3W1H A;  2C44 A;  3N0L A;  5FT6 A;  4HF8 A;  1SPA A;  2R5E A;  1AHE A;  1N8P A;  2R0T A;  3EIB A;  4WLJ A;  1WYU B;  4RKC A;  4H51 A;  4M2M A;  4Y0H A;  4EU1 A;  4K05 A;  1M6S A;  2YKX A;  1LW5 A;  4K2M A;  4O6Z A;  2HP1 A;  4LC3 A;  3ELE A;  4PVF A;  1EG5 A;  2ZY3 A;  4Q75 A;  4GE9 A;  3D6K A;  3AAT A;  5HDM A;  2VMQ A;  2W7D A;  2VMN A;  2YRR A;  3E2Y A;  3MC6 A;  3I16 A;  1OXP A;  1GDE A;  1MAQ A;  3PDB B;  1P3W A;  2CY8 A;  1KMK A;  2JGT A;  3N4X A;  4TN4 A;  3HVY A;  1YJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...