4IY9A

Bmlp3 - c2 crystal form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
235
Chain Sequence
VPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSNDVQGDDGRPAYGDGKDKTSPRVSWKLIALWENNKVYFKILNTERNQYLVLGVGTNWNGDHMAFGVNSVDSFRAQWYLQPAKYDNDVLFYIYNREYSKALTLSRTVEPSGHRMAWGYNGRVIGSPEHYAWGIKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30K protein 1
publication title Two Crystal Structures of Bombyx mori Lipoprotein 3 - Structural Characterization of a New 30-kDa Lipoprotein Family Member.
pubmed doi rcsb
molecule tags Lipid binding protein
total genus 65
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4iy9A02
3VT0A 3UD8A 3MALA 4EB2B 1S0EA 1S0CA 4KEKA 4P0KA 3F62B 3UJ4A 1G9CA 3CRIA 5BVPI 3AH2A 3BAHA 3AZWA 5D62A 4JRAA 1TTUA 1S0GA 1ILR1 3OGFA 4XFUA 4P6AA 3V0BB 3IM5A 3BAGA 5FNXA 3CA5A 4ENDA 1DJSB 3O44A 2HZ9A 4AN6A 1IT0A 1PC8B 4EFPA 4A7ZA 3WO3A 2X2SA 1OQLB 1FV3A 3AJ6A 1IOBA 4QALA 3UD9A 4OWLA 4TLPA 4G6MA 2D23A 3CRHA 1FQ9A 2K43A 4QD2B 4USPA 3VWCA 1BLAA 3O3QA 1DQOA 4J2KA 2KI4A 3VUOA 3T8SA 3CRGA 5D63A 1ISWA 4LO1A 4I7IA 3NBDA 2MLLB 2NTDA 4GAFA 2ZQNA 2LIQA 3FFZA 1BFBA 3O4BA 5FZZA 4ZFYB 3PHZA 3WA1A 4ISQA 1ABRB 3V79C 2FGFA 2P23A 3AJ5A 7I1BA 1JT7A 2Q9XA 3FUQA 5D61A 1V6VA 3VSFA 1FWVA 2FFVA 4ZOTA 3UD7A 1N4KA 1S0LA 1TIEA 2DRYA 4I4VA 41BIA 3HMYA 3OJVA 2P39A 3VT1A 3ILAA 3ZC9A 1Z0HA 3IAGC 1WD4A 3RTJB 3CU1B 4P0LA 2UUSA 4XFSA 2D22A 3V0AB 2HWMA 4LO1C 4PC4A 3VEQA 3FUOA 5JLVA 3I29B 4FGFA 4IZXA 1RG8A 4FVVA 2FFUA 2QN4A 4I4RA 1WD3A 3A07A 4ZFUB 3PUBA 3HSMA 4L4HA 3MPPG 2D7IA 2M49A 3CA6A 1YXWA 2NVHA 1DZCA 3NBCA 5BP5A 2BEBA 4DEPA 4X39A 2D24A 1V6UA 4HA2A 3FJAA 3H6RB 4ZKTB 3CA3A 2R9KB 3LLPA 3BRFA 4LO2A 3N7MA 1XHBA 3BRDA 3FJFA 2BFHA 3QYDA 1AVWB 4I3NA 2MC2A 4OUJA 1WBAA 4II0A 1ONKB 3OGGA 1HWNB 1FN0A 5G00A 3WINC 1HKNA 3OJ2A 2DRZA 1JT3A 1J0SA 2VLCA 5HPZA 1PZZA 4GP3A 1BFGA 1IILA 3RMYA 3C9ZA 2VUAA 1SR4A 4ISRA 4A7KA 1HWMB 2ERMA 5BXPA 2RQ9A 1IJTA 4LO7C 4XKIA 1II4A 3FJ8A 4IONA 3KMVA 5BP5C 1P63A 4J2YA 3BA4A 4QBCA 1R8NA 1SZ6B 3ZX7A 1XYFA 1EV2A 1RMLA 5FZYA 4JAWA 2NZ9A 4LO2C 2KI6B 1JT5A 3P53A 3POKA 2AFGA 3AKIA 4I4YA 1G9BA 4F83A 3OBTA 4H04A 4EKXB 1EYLA 4X37A 4I4QA 3B9UA 5GAQA 2VSAA 4L4IA 1K5UA 1HWPB 4LO3A 2AAIB 5F8SA 1KNMA 3BB2A 2VSEA 2Y9XE 3HN1A 2IHOA 1JT4A 1YBIA 1SR4C 5F8YA 5FZUA 4OEGA 3ZC8A 3FJEA 3HALA 4EEEB 3OJMA 4ZBVB 3IM7A 3D7WB 3AH1A 2HW9A 3HBWA 4ZGRB 3WMUA 2KKIA 4P0JA 1BA7A 2D1ZA 3CA1A 1L2HA 4I6IA 5B2HA 3VSZA 1Z4SA 3EF2A 4IQPA 1TOOA 3Q7WA 2KLLA 4I4OA 4D0ZA 3AKFA 2XOAA 1JQZA 2KH2A 1NZKA 3AH4A 1VCLA 1AF9A 1S0FA 4A7YA 3BAVA 2I1BA 5F90A 8I1BA 1M2TB 1AVXB 3O4CA 4IYBA 4Z9WB 3P6IA 4OW4A 1D0HA 4LO3C 1FGAA 3FJIA 1V6WA 4I4UA 4I8MA 3O4DA 4JKXB 4D8HA 2Q3NB 1WBCA 4LO7B 3O49A 4GP0A 3AKHA 4I4XA 3S8JA 3TC2A 2VU9A 3CA4A 2VXTI 3RMXA 2GZBA 1XZZA 1IHKA 4JPZA 1F31A 1UPSA 1TWEA 2K8RA 3N0KA 2FDBM 4G9MA 4IZEA 2WRYA 1RY7A 4KEJA 3FJCA 3ZXGA 4G1RA 3FJJA 4KEIA 3AKGA 2VXRA 1YTOA 4LO8B 3FJ9A 2NM1A 2X2TA 4QC4A 4I4PA 4ZFWB 2E4MA 3WO4A 4Q9GA 5FNWA 3PMEA 3RSJA 1HIBA 3H6QA 4Q9PA 3P6JA 2IWTB 2Z48A 3FJKA 4AN7B 3QR5A 4QKSA 3CQAA 3JUTA 2MIBA 3A21A 4F34A 3IM6A 2ZQOA 4X3AA 1PWAA 4I96A 5I1BA 1Q1UA 1JTCA 1AVAC 2RG9B 1TWMA 3OBRA 5E24E 1MC9A 4JQ0A 1HWOB 3O4OA 1YF8B 4I2SA 4HJJA 2HWAA 5BXSA 1QQLA 1V6XA 4IHZA 1PUMB 1Z2VA 1G9AA 1TP0A 3VT2A 1RZOB 3RTIB 2E4MC 2ZR1B 3AZVA 5DUYA 3W9TA 2YUGA 4DENA 5BXTA 2D44A 4LO0A 4QKRA 1PUUB 2NP0A 2QYIB 1BFFA 3CA0A 2FO1A 2Y9GA 1ITBA 3SNVA 3A23A 4ZA3B 1T9FA 3BA5A 4Z8SB 4IY9A 3HOMA 4D0TA 2DREA 4QBVA 5F8WA 6I1BA 1JLXA 3BA7A 2RSTA 3UJ0A 3S8KA 4I0YA 1K5VA 5DSSB 1AFCA 4I1EA 4R6UB 4J23B 1GGPB 3V0BA 3UDAA 1ISXA 5EC5A 2D7RA 1Q03A 1I1BA 4GOVA 2F2FA 2WBCA 1FMZA 2L5XA 2D20A 4EFRA 21BIA 1DFQA 1TFMB 4I1BA 1T4QA 3R4UA 1XG6A 3NBEA 1AVUA 1JLYA 1FWUA 3N7JA 5EG6C 4J2SA 1ISZA 4LO0C 5BQUA 4OEEA 4G6JA 3E8LC 1IRPA 4DCKC 3WO2A 1NUNA 2Y9FA 4JP0A 31BIA 4H9WA 3A22A 2LIEA 3N7KA 1W3FA 3FGMA 5BOWA 1QQKA 5EHAA 2ET2A 1CVSA 3BAQA 4WBCA 1BLDA 3Q7YA 4USOA 1ISYA 3R4SA 2AQZA 1I1EA 1DQGA 3BADA 2J3PA 1G82A 4XFTA 3PG0A 1BARA 2F2FC 3Q7XA 4I37A 4OWKA 3BRGC 1S0BA 4YOLA 1DZDA 4OWJA 4KC3A 1G9DA 2DS0A 4ZLBB 3BX1C 1EPWA 4GOYA 3WINA 4QD2C 4Q91A 3IIRA 1ISVA 3O4AA 3N7LA 3BAUA 4KBBA 5BQUC 1QXMA 3FJBA 2GO2A 2Z49A 3I2AA 3V0AA 1S0DA 2ESUA 4QO3A 3WMVA 4I4SA 2Y9WC 3H6SE 1HCEA 1W3AA 3LTQA 4JKQA 4CJMA 1R8OA 3F1RA 5BXRA 4IY8A 3BAOA 3JRRA 1IRAX 1BASA 4EFQA 5DZUA 4HR6C 3FJHA 1EVTA 1FMMS 4J2XA 1MD6A 3FJDA 1HCDA 1E0OA 9ILBA 4X38A 1AXMA 3CAHA 4GAIA 3NBNA 5DVHA 4G9NA 1BFCA 3BTAA 1FV2A 3O5WB 4OEFA 1DFCA 1DLLA 2F8XC 1DIWA 3H6RA 2NYYA 1CE7B 1M16A 1YYNA 1Q04A 5JMCA 2BEAA 2D43A 3NJ5A 2AXMA 3ZXDA 3I2XA 1A8DA 3K1XA 1JY0A 1W3GA 2K4AB
chains in the Genus database with same CATH superfamily
3VT0A 3UD8A 3MALA 4EB2B 1S0EA 1S0CA 4KEKA 4P0KA 3F62B 3UJ4A 1G9CA 3CRIA 5BVPI 2NS2A 3AH2A 3BAHA 3AZWA 4H75A 5D62A 4JRAA 1TTUA 1S0GA 1ILR1 3OGFA 4XFUA 4P6AA 3V0BB 3IM5A 3BAGA 5FNXA 3CA5A 4ENDA 1DJSB 3O44A 2HZ9A 4AN6A 1IT0A 1PC8B 4EFPA 4A7ZA 3WO3A 2X2SA 1OQLB 1FV3A 3AJ6A 1IOBA 4QALA 3UD9A 4OWLA 4TLPA 4G6MA 2D23A 3CRHA 1FQ9A 2K43A 4QD2B 4USPA 3VWCA 1BLAA 3O3QA 1DQOA 4J2KA 2KI4A 3VUOA 3T8SA 3CRGA 5D63A 1ISWA 4LO1A 4I7IA 3NBDA 2MLLB 2NTDA 4GAFA 2ZQNA 2LIQA 3FFZA 1BFBA 3O4BA 5FZZA 4ZFYB 3PHZA 3WA1A 4ISQA 1ABRB 3V79C 2FGFA 2P23A 3AJ5A 7I1BA 1JT7A 2Q9XA 3FUQA 5D61A 1V6VA 3VSFA 1FWVA 2FFVA 4ZOTA 3UD7A 1N4KA 1S0LA 1TIEA 2DRYA 4I4VA 41BIA 3HMYA 3OJVA 2P39A 3VT1A 3ILAA 3ZC9A 1Z0HA 3IAGC 1WD4A 3RTJB 3CU1B 4P0LA 2UUSA 4XFSA 2D22A 3V0AB 2HWMA 4LO1C 4PC4A 3VEQA 3FUOA 5JLVA 3I29B 4FGFA 4IZXA 1RG8A 4FVVA 2FFUA 2QN4A 4I4RA 1WD3A 3A07A 4ZFUB 3PUBA 3HSMA 4L4HA 3MPPG 2D7IA 4MZHA 2M49A 3CA6A 1YXWA 2NVHA 1DZCA 3NBCA 5BP5A 2BEBA 4DEPA 4X39A 2D24A 1V6UA 4HA2A 3FJAA 3H6RB 4ZKTB 3CA3A 2R9KB 3LLPA 3BRFA 4LO2A 3N7MA 1XHBA 3BRDA 3FJFA 2BFHA 3QYDA 4MZGB 1AVWB 4I3NA 2MC2A 4OUJA 1WBAA 4II0A 1ONKB 3OGGA 1HWNB 1FN0A 5G00A 3WINC 1HKNA 3OJ2A 2DRZA 1JT3A 1J0SA 2VLCA 5HPZA 1PZZA 4GP3A 1BFGA 1IILA 3RMYA 3C9ZA 2VUAA 1SR4A 4ISRA 4A7KA 1HWMB 2ERMA 5BXPA 2RQ9A 1IJTA 4LO7C 4XKIA 1II4A 3FJ8A 4IONA 3KMVA 5BP5C 1P63A 4J2YA 3BA4A 4QBCA 1R8NA 1SZ6B 3ZX7A 1XYFA 1EV2A 1RMLA 5FZYA 4JAWA 2NZ9A 4LO2C 2KI6B 1JT5A 3P53A 3POKA 2AFGA 3AKIA 4I4YA 1G9BA 4F83A 3OBTA 4H04A 4EKXB 1EYLA 4X37A 4I4QA 3B9UA 5GAQA 2VSAA 4L4IA 1K5UA 1HWPB 4LO3A 2AAIB 5F8SA 1KNMA 3BB2A 2VSEA 2Y9XE 3HN1A 2IHOA 1JT4A 1YBIA 1SR4C 5F8YA 5FZUA 4OEGA 3ZC8A 3FJEA 3HALA 4EEEB 3OJMA 4ZBVB 3IM7A 3D7WB 3AH1A 2HW9A 3HBWA 4ZGRB 3WMUA 2KKIA 4P0JA 1BA7A 2D1ZA 3CA1A 1L2HA 4I6IA 5B2HA 3VSZA 1Z4SA 3EF2A 4IQPA 1TOOA 3Q7WA 2KLLA 4I4OA 4D0ZA 3AKFA 2XOAA 1JQZA 2KH2A 1NZKA 3AH4A 1VCLA 1AF9A 1S0FA 4A7YA 3BAVA 2I1BA 5F90A 8I1BA 1M2TB 1AVXB 3O4CA 4IYBA 4Z9WB 3P6IA 4OW4A 1D0HA 4LO3C 1FGAA 3FJIA 1V6WA 4I4UA 4I8MA 3O4DA 4JKXB 4D8HA 2Q3NB 1WBCA 4LO7B 3O49A 4GP0A 3AKHA 4I4XA 3S8JA 3TC2A 2VU9A 3CA4A 2VXTI 3RMXA 2GZBA 1XZZA 1IHKA 4JPZA 1F31A 1UPSA 1TWEA 2K8RA 3N0KA 2FDBM 4G9MA 4IZEA 2WRYA 1RY7A 4KEJA 4MZFB 3FJCA 3ZXGA 4G1RA 3FJJA 4KEIA 3AKGA 2VXRA 1YTOA 4LO8B 3FJ9A 2NM1A 2X2TA 4QC4A 4I4PA 4ZFWB 2E4MA 3WO4A 4Q9GA 5FNWA 3PMEA 3RSJA 1HIBA 3H6QA 4Q9PA 3P6JA 2IWTB 2Z48A 3FJKA 4AN7B 3QR5A 4QKSA 3CQAA 3JUTA 2MIBA 3A21A 4F34A 3IM6A 2ZQOA 4X3AA 1PWAA 4I96A 5I1BA 1Q1UA 1JTCA 1AVAC 2RG9B 1TWMA 3OBRA 5E24E 1MC9A 4JQ0A 1HWOB 3O4OA 1YF8B 4I2SA 4HJJA 2HWAA 5BXSA 1QQLA 1V6XA 4IHZA 1PUMB 1Z2VA 1G9AA 1TP0A 3VT2A 1RZOB 3RTIB 2E4MC 2ZR1B 3AZVA 5DUYA 3W9TA 2YUGA 4DENA 5BXTA 2D44A 4LO0A 4QKRA 1PUUB 2NP0A 2QYIB 1BFFA 3CA0A 2FO1A 2Y9GA 1ITBA 3SNVA 3A23A 4ZA3B 1T9FA 3BA5A 4Z8SB 4IY9A 3HOMA 4D0TA 2DREA 4QBVA 5F8WA 6I1BA 1JLXA 3BA7A 2RSTA 3UJ0A 3S8KA 4I0YA 1K5VA 5DSSB 1AFCA 4I1EA 4R6UB 4J23B 1GGPB 3V0BA 3UDAA 1ISXA 5EC5A 2D7RA 1Q03A 1I1BA 4GOVA 2F2FA 2WBCA 1FMZA 2L5XA 2D20A 4EFRA 21BIA 1DFQA 1TFMB 4I1BA 1T4QA 3R4UA 1XG6A 3NBEA 1AVUA 1JLYA 1FWUA 3N7JA 5EG6C 4J2SA 1ISZA 4LO0C 5BQUA 4OEEA 4G6JA 3E8LC 1IRPA 4DCKC 4UY4A 3WO2A 1NUNA 2Y9FA 4JP0A 31BIA 4H9WA 3A22A 2LIEA 3N7KA 1W3FA 3FGMA 5BOWA 1QQKA 5EHAA 2ET2A 1CVSA 3BAQA 4WBCA 1BLDA 3Q7YA 4USOA 1ISYA 3R4SA 2AQZA 1I1EA 1DQGA 3BADA 2J3PA 1G82A 4XFTA 3PG0A 1BARA 2F2FC 3Q7XA 4I37A 4OWKA 3BRGC 1S0BA 4YOLA 1DZDA 4OWJA 4KC3A 1G9DA 2DS0A 4ZLBB 3BX1C 1EPWA 4GOYA 3WINA 4QD2C 4Q91A 3IIRA 1ISVA 3O4AA 3N7LA 3BAUA 4KBBA 5BQUC 1QXMA 3FJBA 2GO2A 2Z49A 3I2AA 3V0AA 1S0DA 2ESUA 4QO3A 3WMVA 4I4SA 2Y9WC 3H6SE 1HCEA 1W3AA 3LTQA 4JKQA 4CJMA 1R8OA 3F1RA 5BXRA 4IY8A 3BAOA 3JRRA 1IRAX 1BASA 4EFQA 5DZUA 4HR6C 3FJHA 1EVTA 1FMMS 4J2XA 1MD6A 3FJDA 1HCDA 1E0OA 9ILBA 4X38A 1AXMA 3CAHA 4GAIA 3NBNA 5DVHA 4G9NA 1BFCA 3BTAA 1FV2A 3O5WB 4OEFA 1DFCA 1DLLA 2F8XC 1DIWA 3H6RA 2NYYA 1CE7B 1M16A 1YYNA 1Q04A 5JMCA 2BEAA 2D43A 3NJ5A 2AXMA 3ZXDA 3I2XA 1A8DA 3K1XA 1JY0A 1W3GA 2K4AB
chains in the Genus database with same CATH topology
3VT0A 3UD8A 3MALA 4EB2B 1S0EA 1S0CA 4KEKA 4P0KA 3F62B 3UJ4A 1G9CA 3CRIA 5BVPI 2NS2A 3AH2A 3BAHA 3AZWA 4H75A 5D62A 4JRAA 1TTUA 1S0GA 1ILR1 3OGFA 4XFUA 4P6AA 3V0BB 3IM5A 3BAGA 5FNXA 3CA5A 4ENDA 1DJSB 3O44A 2HZ9A 4AN6A 1IT0A 1PC8B 4EFPA 4A7ZA 3WO3A 2X2SA 1OQLB 1FV3A 3AJ6A 1IOBA 4QALA 3UD9A 4OWLA 4TLPA 4G6MA 2D23A 3CRHA 1FQ9A 2K43A 4QD2B 4USPA 3VWCA 1BLAA 3O3QA 1DQOA 4J2KA 2KI4A 3VUOA 3T8SA 3CRGA 5D63A 1ISWA 4LO1A 4I7IA 3NBDA 2MLLB 2NTDA 4GAFA 2ZQNA 2LIQA 3FFZA 1BFBA 3O4BA 5FZZA 4ZFYB 3PHZA 3WA1A 4ISQA 1ABRB 3V79C 2FGFA 2P23A 3AJ5A 7I1BA 1JT7A 2Q9XA 3FUQA 5D61A 1V6VA 3VSFA 1FWVA 2FFVA 4ZOTA 3UD7A 1N4KA 1S0LA 1TIEA 2DRYA 4I4VA 41BIA 3HMYA 3OJVA 2P39A 3VT1A 3ILAA 3ZC9A 1Z0HA 3IAGC 1WD4A 3RTJB 3CU1B 4P0LA 2UUSA 4XFSA 2D22A 3V0AB 2HWMA 4LO1C 4PC4A 3VEQA 3FUOA 5JLVA 3I29B 4FGFA 4IZXA 1RG8A 4FVVA 2FFUA 2QN4A 4I4RA 1WD3A 3A07A 4ZFUB 3PUBA 3HSMA 4L4HA 3MPPG 2D7IA 4MZHA 2M49A 3CA6A 1YXWA 2NVHA 1DZCA 3NBCA 5BP5A 2BEBA 4DEPA 4X39A 2D24A 1V6UA 4HA2A 3FJAA 3H6RB 4ZKTB 3CA3A 2R9KB 3LLPA 3BRFA 4LO2A 3N7MA 1XHBA 3BRDA 3FJFA 2BFHA 3QYDA 4MZGB 1AVWB 4I3NA 2MC2A 4OUJA 1WBAA 4II0A 1ONKB 3OGGA 1HWNB 1FN0A 5G00A 3WINC 1HKNA 3OJ2A 2DRZA 1JT3A 1J0SA 2VLCA 5HPZA 1PZZA 4GP3A 1BFGA 1IILA 3RMYA 3C9ZA 2VUAA 1SR4A 4ISRA 4A7KA 1HWMB 2ERMA 5BXPA 2RQ9A 1IJTA 4LO7C 4XKIA 1II4A 3FJ8A 4IONA 3KMVA 5BP5C 1P63A 4J2YA 3BA4A 4QBCA 1R8NA 1SZ6B 3ZX7A 1XYFA 1EV2A 1RMLA 5FZYA 4JAWA 2NZ9A 4LO2C 2KI6B 1JT5A 3P53A 3POKA 2AFGA 3AKIA 4I4YA 1G9BA 4F83A 3OBTA 4H04A 4EKXB 1EYLA 4X37A 4I4QA 3B9UA 5GAQA 2VSAA 4L4IA 1K5UA 1HWPB 4LO3A 2AAIB 5F8SA 1KNMA 3BB2A 2VSEA 2Y9XE 3HN1A 2IHOA 1JT4A 1YBIA 1SR4C 5F8YA 5FZUA 4OEGA 3ZC8A 3FJEA 3HALA 4EEEB 3OJMA 4ZBVB 3IM7A 3D7WB 3AH1A 2HW9A 3HBWA 4ZGRB 3WMUA 2KKIA 4P0JA 1BA7A 2D1ZA 3CA1A 1L2HA 4I6IA 5B2HA 3VSZA 1Z4SA 3EF2A 4IQPA 1TOOA 3Q7WA 2KLLA 4I4OA 4D0ZA 3AKFA 2XOAA 1JQZA 2KH2A 1NZKA 3AH4A 1VCLA 1AF9A 1S0FA 4A7YA 3BAVA 2I1BA 5F90A 8I1BA 1M2TB 1AVXB 3O4CA 4IYBA 4Z9WB 3P6IA 4OW4A 1D0HA 4LO3C 1FGAA 3FJIA 1V6WA 4I4UA 4I8MA 3O4DA 4JKXB 4D8HA 2Q3NB 1WBCA 4LO7B 3O49A 4GP0A 3AKHA 4I4XA 3S8JA 3TC2A 2VU9A 3CA4A 2VXTI 3RMXA 2GZBA 1XZZA 1IHKA 4JPZA 1F31A 1UPSA 1TWEA 2K8RA 3N0KA 2FDBM 4G9MA 4IZEA 2WRYA 1RY7A 4KEJA 4MZFB 3FJCA 3ZXGA 4G1RA 3FJJA 4KEIA 3AKGA 2VXRA 1YTOA 4LO8B 3FJ9A 2NM1A 2X2TA 4QC4A 4I4PA 4ZFWB 2E4MA 3WO4A 4Q9GA 5FNWA 3PMEA 3RSJA 1HIBA 3H6QA 4Q9PA 3P6JA 2IWTB 2Z48A 3FJKA 4AN7B 3QR5A 4QKSA 3CQAA 3JUTA 2MIBA 3A21A 4F34A 3IM6A 2ZQOA 4X3AA 1PWAA 4I96A 5I1BA 1Q1UA 1JTCA 1AVAC 2RG9B 1TWMA 3OBRA 5E24E 1MC9A 4JQ0A 1HWOB 3O4OA 1YF8B 4I2SA 4HJJA 2HWAA 5BXSA 1QQLA 1V6XA 4IHZA 1PUMB 1Z2VA 1G9AA 1TP0A 3VT2A 1RZOB 3RTIB 2E4MC 2ZR1B 3AZVA 5DUYA 3W9TA 2YUGA 4DENA 5BXTA 2D44A 4LO0A 4QKRA 1PUUB 2NP0A 2QYIB 1BFFA 3CA0A 2FO1A 2Y9GA 1ITBA 3SNVA 3A23A 4ZA3B 1T9FA 3BA5A 4Z8SB 4IY9A 3HOMA 4D0TA 2DREA 4QBVA 5F8WA 6I1BA 1JLXA 3BA7A 2RSTA 3UJ0A 3S8KA 4I0YA 1K5VA 5DSSB 1AFCA 4I1EA 4R6UB 4J23B 1GGPB 3V0BA 3UDAA 1ISXA 5EC5A 2D7RA 1Q03A 1I1BA 4GOVA 2F2FA 2WBCA 1FMZA 2L5XA 2D20A 4EFRA 21BIA 1DFQA 1TFMB 4I1BA 1T4QA 3R4UA 1XG6A 3NBEA 1AVUA 1JLYA 1FWUA 3N7JA 5EG6C 4J2SA 1ISZA 4LO0C 5BQUA 4OEEA 4G6JA 3E8LC 1IRPA 4DCKC 4UY4A 3WO2A 1NUNA 2Y9FA 4JP0A 31BIA 4H9WA 3A22A 2LIEA 3N7KA 1W3FA 3FGMA 5BOWA 1QQKA 5EHAA 2ET2A 1CVSA 3BAQA 4WBCA 1BLDA 3Q7YA 4USOA 1ISYA 3R4SA 2AQZA 1I1EA 1DQGA 3BADA 2J3PA 1G82A 4XFTA 3PG0A 1BARA 2F2FC 3Q7XA 4I37A 4OWKA 3BRGC 1S0BA 4YOLA 1DZDA 4OWJA 4KC3A 1G9DA 2DS0A 4ZLBB 3BX1C 1EPWA 4GOYA 3WINA 4QD2C 4Q91A 3IIRA 1ISVA 3O4AA 3N7LA 3BAUA 4KBBA 5BQUC 1QXMA 3FJBA 2GO2A 2Z49A 3I2AA 3V0AA 1S0DA 2ESUA 4QO3A 3WMVA 4I4SA 2Y9WC 3H6SE 1HCEA 1W3AA 3LTQA 4JKQA 4CJMA 1R8OA 3F1RA 5BXRA 4IY8A 3BAOA 3JRRA 1IRAX 1BASA 4EFQA 5DZUA 4HR6C 3FJHA 1EVTA 1FMMS 4J2XA 1MD6A 3FJDA 1HCDA 1E0OA 9ILBA 4X38A 1AXMA 3CAHA 4GAIA 3NBNA 5DVHA 4G9NA 1BFCA 3BTAA 1FV2A 3O5WB 4OEFA 1DFCA 1DLLA 2F8XC 1DIWA 3H6RA 2NYYA 1CE7B 1M16A 1YYNA 1Q04A 5JMCA 2BEAA 2D43A 3NJ5A 2AXMA 3ZXDA 3I2XA 1A8DA 3K1XA 1JY0A 1W3GA 2K4AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VT0 A;  3UD8 A;  3MAL A;  4EB2 B;  1S0E A;  1S0C A;  4KEK A;  4P0K A;  3F62 B;  3UJ4 A;  1G9C A;  3CRI A;  5BVP I;  3AH2 A;  3BAH A;  3AZW A;  5D62 A;  4JRA A;  1TTU A;  1S0G A;  1ILR 1;  3OGF A;  4XFU A;  4P6A A;  3V0B B;  3IM5 A;  3BAG A;  5FNX A;  3CA5 A;  4END A;  1DJS B;  3O44 A;  2HZ9 A;  4AN6 A;  1IT0 A;  1PC8 B;  4EFP A;  4A7Z A;  3WO3 A;  2X2S A;  1OQL B;  1FV3 A;  3AJ6 A;  1IOB A;  4QAL A;  3UD9 A;  4OWL A;  4TLP A;  4G6M A;  2D23 A;  3CRH A;  1FQ9 A;  2K43 A;  4QD2 B;  4USP A;  3VWC A;  1BLA A;  3O3Q A;  1DQO A;  4J2K A;  2KI4 A;  3VUO A;  3T8S A;  3CRG A;  5D63 A;  1ISW A;  4LO1 A;  4I7I A;  3NBD A;  2MLL B;  2NTD A;  4GAF A;  2ZQN A;  2LIQ A;  3FFZ A;  1BFB A;  3O4B A;  5FZZ A;  4ZFY B;  3PHZ A;  3WA1 A;  4ISQ A;  1ABR B;  3V79 C;  2FGF A;  2P23 A;  3AJ5 A;  7I1B A;  1JT7 A;  2Q9X A;  3FUQ A;  5D61 A;  1V6V A;  3VSF A;  1FWV A;  2FFV A;  4ZOT A;  3UD7 A;  1N4K A;  1S0L A;  1TIE A;  2DRY A;  4I4V A;  41BI A;  3HMY A;  3OJV A;  2P39 A;  3VT1 A;  3ILA A;  3ZC9 A;  1Z0H A;  3IAG C;  1WD4 A;  3RTJ B;  3CU1 B;  4P0L A;  2UUS A;  4XFS A;  2D22 A;  3V0A B;  2HWM A;  4LO1 C;  4PC4 A;  3VEQ A;  3FUO A;  5JLV A;  3I29 B;  4FGF A;  4IZX A;  1RG8 A;  4FVV A;  2FFU A;  2QN4 A;  4I4R A;  1WD3 A;  3A07 A;  4ZFU B;  3PUB A;  3HSM A;  4L4H A;  3MPP G;  2D7I A;  2M49 A;  3CA6 A;  1YXW A;  2NVH A;  1DZC A;  3NBC A;  5BP5 A;  2BEB A;  4DEP A;  4X39 A;  2D24 A;  1V6U A;  4HA2 A;  3FJA A;  3H6R B;  4ZKT B;  3CA3 A;  2R9K B;  3LLP A;  3BRF A;  4LO2 A;  3N7M A;  1XHB A;  3BRD A;  3FJF A;  2BFH A;  3QYD A;  1AVW B;  4I3N A;  2MC2 A;  4OUJ A;  1WBA A;  4II0 A;  1ONK B;  3OGG A;  1HWN B;  1FN0 A;  5G00 A;  3WIN C;  1HKN A;  3OJ2 A;  2DRZ A;  1JT3 A;  1J0S A;  2VLC A;  5HPZ A;  1PZZ A;  4GP3 A;  1BFG A;  1IIL A;  3RMY A;  3C9Z A;  2VUA A;  1SR4 A;  4ISR A;  4A7K A;  1HWM B;  2ERM A;  5BXP A;  2RQ9 A;  1IJT A;  4LO7 C;  4XKI A;  1II4 A;  3FJ8 A;  4ION A;  3KMV A;  5BP5 C;  1P63 A;  4J2Y A;  3BA4 A;  4QBC A;  1R8N A;  1SZ6 B;  3ZX7 A;  1XYF A;  1EV2 A;  1RML A;  5FZY A;  4JAW A;  2NZ9 A;  4LO2 C;  2KI6 B;  1JT5 A;  3P53 A;  3POK A;  2AFG A;  3AKI A;  4I4Y A;  1G9B A;  4F83 A;  3OBT A;  4H04 A;  4EKX B;  1EYL A;  4X37 A;  4I4Q A;  3B9U A;  5GAQ A;  2VSA A;  4L4I A;  1K5U A;  1HWP B;  4LO3 A;  2AAI B;  5F8S A;  1KNM A;  3BB2 A;  2VSE A;  2Y9X E;  3HN1 A;  2IHO A;  1JT4 A;  1YBI A;  1SR4 C;  5F8Y A;  5FZU A;  4OEG A;  3ZC8 A;  3FJE A;  3HAL A;  4EEE B;  3OJM A;  4ZBV B;  3IM7 A;  3D7W B;  3AH1 A;  2HW9 A;  3HBW A;  4ZGR B;  3WMU A;  2KKI A;  4P0J A;  1BA7 A;  2D1Z A;  3CA1 A;  1L2H A;  4I6I A;  5B2H A;  3VSZ A;  1Z4S A;  3EF2 A;  4IQP A;  1TOO A;  3Q7W A;  2KLL A;  4I4O A;  4D0Z A;  3AKF A;  2XOA A;  1JQZ A;  2KH2 A;  1NZK A;  3AH4 A;  1VCL A;  1AF9 A;  1S0F A;  4A7Y A;  3BAV A;  2I1B A;  5F90 A;  8I1B A;  1M2T B;  1AVX B;  3O4C A;  4IYB A;  4Z9W B;  3P6I A;  4OW4 A;  1D0H A;  4LO3 C;  1FGA A;  3FJI A;  1V6W A;  4I4U A;  4I8M A;  3O4D A;  4JKX B;  4D8H A;  2Q3N B;  1WBC A;  4LO7 B;  3O49 A;  4GP0 A;  3AKH A;  4I4X A;  3S8J A;  3TC2 A;  2VU9 A;  3CA4 A;  2VXT I;  3RMX A;  2GZB A;  1XZZ A;  1IHK A;  4JPZ A;  1F31 A;  1UPS A;  1TWE A;  2K8R A;  3N0K A;  2FDB M;  4G9M A;  4IZE A;  2WRY A;  1RY7 A;  4KEJ A;  3FJC A;  3ZXG A;  4G1R A;  3FJJ A;  4KEI A;  3AKG A;  2VXR A;  1YTO A;  4LO8 B;  3FJ9 A;  2NM1 A;  2X2T A;  4QC4 A;  4I4P A;  4ZFW B;  2E4M A;  3WO4 A;  4Q9G A;  5FNW A;  3PME A;  3RSJ A;  1HIB A;  3H6Q A;  4Q9P A;  3P6J A;  2IWT B;  2Z48 A;  3FJK A;  4AN7 B;  3QR5 A;  4QKS A;  3CQA A;  3JUT A;  2MIB A;  3A21 A;  4F34 A;  3IM6 A;  2ZQO A;  4X3A A;  1PWA A;  4I96 A;  5I1B A;  1Q1U A;  1JTC A;  1AVA C;  2RG9 B;  1TWM A;  3OBR A;  5E24 E;  1MC9 A;  4JQ0 A;  1HWO B;  3O4O A;  1YF8 B;  4I2S A;  4HJJ A;  2HWA A;  5BXS A;  1QQL A;  1V6X A;  4IHZ A;  1PUM B;  1Z2V A;  1G9A A;  1TP0 A;  3VT2 A;  1RZO B;  3RTI B;  2E4M C;  2ZR1 B;  3AZV A;  5DUY A;  3W9T A;  2YUG A;  4DEN A;  5BXT A;  2D44 A;  4LO0 A;  4QKR A;  1PUU B;  2NP0 A;  2QYI B;  1BFF A;  3CA0 A;  2FO1 A;  2Y9G A;  1ITB A;  3SNV A;  3A23 A;  4ZA3 B;  1T9F A;  3BA5 A;  4Z8S B;  4IY9 A;  3HOM A;  4D0T A;  2DRE A;  4QBV A;  5F8W A;  6I1B A;  1JLX A;  3BA7 A;  2RST A;  3UJ0 A;  3S8K A;  4I0Y A;  1K5V A;  5DSS B;  1AFC A;  4I1E A;  4R6U B;  4J23 B;  1GGP B;  3V0B A;  3UDA A;  1ISX A;  5EC5 A;  2D7R A;  1Q03 A;  1I1B A;  4GOV A;  2F2F A;  2WBC A;  1FMZ A;  2L5X A;  2D20 A;  4EFR A;  21BI A;  1DFQ A;  1TFM B;  4I1B A;  1T4Q A;  3R4U A;  1XG6 A;  3NBE A;  1AVU A;  1JLY A;  1FWU A;  3N7J A;  5EG6 C;  4J2S A;  1ISZ A;  4LO0 C;  5BQU A;  4OEE A;  4G6J A;  3E8L C;  1IRP A;  4DCK C;  3WO2 A;  1NUN A;  2Y9F A;  4JP0 A;  31BI A;  4H9W A;  3A22 A;  2LIE A;  3N7K A;  1W3F A;  3FGM A;  5BOW A;  1QQK A;  5EHA A;  2ET2 A;  1CVS A;  3BAQ A;  4WBC A;  1BLD A;  3Q7Y A;  4USO A;  1ISY A;  3R4S A;  2AQZ A;  1I1E A;  1DQG A;  3BAD A;  2J3P A;  1G82 A;  4XFT A;  3PG0 A;  1BAR A;  2F2F C;  3Q7X A;  4I37 A;  4OWK A;  3BRG C;  1S0B A;  4YOL A;  1DZD A;  4OWJ A;  4KC3 A;  1G9D A;  2DS0 A;  4ZLB B;  3BX1 C;  1EPW A;  4GOY A;  3WIN A;  4QD2 C;  4Q91 A;  3IIR A;  1ISV A;  3O4A A;  3N7L A;  3BAU A;  4KBB A;  5BQU C;  1QXM A;  3FJB A;  2GO2 A;  2Z49 A;  3I2A A;  3V0A A;  1S0D A;  2ESU A;  4QO3 A;  3WMV A;  4I4S A;  2Y9W C;  3H6S E;  1HCE A;  1W3A A;  3LTQ A;  4JKQ A;  4CJM A;  1R8O A;  3F1R A;  5BXR A;  4IY8 A;  3BAO A;  3JRR A;  1IRA X;  1BAS A;  4EFQ A;  5DZU A;  4HR6 C;  3FJH A;  1EVT A;  1FMM S;  4J2X A;  1MD6 A;  3FJD A;  1HCD A;  1E0O A;  9ILB A;  4X38 A;  1AXM A;  3CAH A;  4GAI A;  3NBN A;  5DVH A;  4G9N A;  1BFC A;  3BTA A;  1FV2 A;  3O5W B;  4OEF A;  1DFC A;  1DLL A;  2F8X C;  1DIW A;  3H6R A;  2NYY A;  1CE7 B;  1M16 A;  1YYN A;  1Q04 A;  5JMC A;  2BEA A;  2D43 A;  3NJ5 A;  2AXM A;  3ZXD A;  3I2X A;  1A8D A;  3K1X A;  1JY0 A;  1W3G A;  2K4A B; 
#chains in the Genus database with same CATH topology
 3VT0 A;  3UD8 A;  3MAL A;  4EB2 B;  1S0E A;  1S0C A;  4KEK A;  4P0K A;  3F62 B;  3UJ4 A;  1G9C A;  3CRI A;  5BVP I;  2NS2 A;  3AH2 A;  3BAH A;  3AZW A;  4H75 A;  5D62 A;  4JRA A;  1TTU A;  1S0G A;  1ILR 1;  3OGF A;  4XFU A;  4P6A A;  3V0B B;  3IM5 A;  3BAG A;  5FNX A;  3CA5 A;  4END A;  1DJS B;  3O44 A;  2HZ9 A;  4AN6 A;  1IT0 A;  1PC8 B;  4EFP A;  4A7Z A;  3WO3 A;  2X2S A;  1OQL B;  1FV3 A;  3AJ6 A;  1IOB A;  4QAL A;  3UD9 A;  4OWL A;  4TLP A;  4G6M A;  2D23 A;  3CRH A;  1FQ9 A;  2K43 A;  4QD2 B;  4USP A;  3VWC A;  1BLA A;  3O3Q A;  1DQO A;  4J2K A;  2KI4 A;  3VUO A;  3T8S A;  3CRG A;  5D63 A;  1ISW A;  4LO1 A;  4I7I A;  3NBD A;  2MLL B;  2NTD A;  4GAF A;  2ZQN A;  2LIQ A;  3FFZ A;  1BFB A;  3O4B A;  5FZZ A;  4ZFY B;  3PHZ A;  3WA1 A;  4ISQ A;  1ABR B;  3V79 C;  2FGF A;  2P23 A;  3AJ5 A;  7I1B A;  1JT7 A;  2Q9X A;  3FUQ A;  5D61 A;  1V6V A;  3VSF A;  1FWV A;  2FFV A;  4ZOT A;  3UD7 A;  1N4K A;  1S0L A;  1TIE A;  2DRY A;  4I4V A;  41BI A;  3HMY A;  3OJV A;  2P39 A;  3VT1 A;  3ILA A;  3ZC9 A;  1Z0H A;  3IAG C;  1WD4 A;  3RTJ B;  3CU1 B;  4P0L A;  2UUS A;  4XFS A;  2D22 A;  3V0A B;  2HWM A;  4LO1 C;  4PC4 A;  3VEQ A;  3FUO A;  5JLV A;  3I29 B;  4FGF A;  4IZX A;  1RG8 A;  4FVV A;  2FFU A;  2QN4 A;  4I4R A;  1WD3 A;  3A07 A;  4ZFU B;  3PUB A;  3HSM A;  4L4H A;  3MPP G;  2D7I A;  4MZH A;  2M49 A;  3CA6 A;  1YXW A;  2NVH A;  1DZC A;  3NBC A;  5BP5 A;  2BEB A;  4DEP A;  4X39 A;  2D24 A;  1V6U A;  4HA2 A;  3FJA A;  3H6R B;  4ZKT B;  3CA3 A;  2R9K B;  3LLP A;  3BRF A;  4LO2 A;  3N7M A;  1XHB A;  3BRD A;  3FJF A;  2BFH A;  3QYD A;  4MZG B;  1AVW B;  4I3N A;  2MC2 A;  4OUJ A;  1WBA A;  4II0 A;  1ONK B;  3OGG A;  1HWN B;  1FN0 A;  5G00 A;  3WIN C;  1HKN A;  3OJ2 A;  2DRZ A;  1JT3 A;  1J0S A;  2VLC A;  5HPZ A;  1PZZ A;  4GP3 A;  1BFG A;  1IIL A;  3RMY A;  3C9Z A;  2VUA A;  1SR4 A;  4ISR A;  4A7K A;  1HWM B;  2ERM A;  5BXP A;  2RQ9 A;  1IJT A;  4LO7 C;  4XKI A;  1II4 A;  3FJ8 A;  4ION A;  3KMV A;  5BP5 C;  1P63 A;  4J2Y A;  3BA4 A;  4QBC A;  1R8N A;  1SZ6 B;  3ZX7 A;  1XYF A;  1EV2 A;  1RML A;  5FZY A;  4JAW A;  2NZ9 A;  4LO2 C;  2KI6 B;  1JT5 A;  3P53 A;  3POK A;  2AFG A;  3AKI A;  4I4Y A;  1G9B A;  4F83 A;  3OBT A;  4H04 A;  4EKX B;  1EYL A;  4X37 A;  4I4Q A;  3B9U A;  5GAQ A;  2VSA A;  4L4I A;  1K5U A;  1HWP B;  4LO3 A;  2AAI B;  5F8S A;  1KNM A;  3BB2 A;  2VSE A;  2Y9X E;  3HN1 A;  2IHO A;  1JT4 A;  1YBI A;  1SR4 C;  5F8Y A;  5FZU A;  4OEG A;  3ZC8 A;  3FJE A;  3HAL A;  4EEE B;  3OJM A;  4ZBV B;  3IM7 A;  3D7W B;  3AH1 A;  2HW9 A;  3HBW A;  4ZGR B;  3WMU A;  2KKI A;  4P0J A;  1BA7 A;  2D1Z A;  3CA1 A;  1L2H A;  4I6I A;  5B2H A;  3VSZ A;  1Z4S A;  3EF2 A;  4IQP A;  1TOO A;  3Q7W A;  2KLL A;  4I4O A;  4D0Z A;  3AKF A;  2XOA A;  1JQZ A;  2KH2 A;  1NZK A;  3AH4 A;  1VCL A;  1AF9 A;  1S0F A;  4A7Y A;  3BAV A;  2I1B A;  5F90 A;  8I1B A;  1M2T B;  1AVX B;  3O4C A;  4IYB A;  4Z9W B;  3P6I A;  4OW4 A;  1D0H A;  4LO3 C;  1FGA A;  3FJI A;  1V6W A;  4I4U A;  4I8M A;  3O4D A;  4JKX B;  4D8H A;  2Q3N B;  1WBC A;  4LO7 B;  3O49 A;  4GP0 A;  3AKH A;  4I4X A;  3S8J A;  3TC2 A;  2VU9 A;  3CA4 A;  2VXT I;  3RMX A;  2GZB A;  1XZZ A;  1IHK A;  4JPZ A;  1F31 A;  1UPS A;  1TWE A;  2K8R A;  3N0K A;  2FDB M;  4G9M A;  4IZE A;  2WRY A;  1RY7 A;  4KEJ A;  4MZF B;  3FJC A;  3ZXG A;  4G1R A;  3FJJ A;  4KEI A;  3AKG A;  2VXR A;  1YTO A;  4LO8 B;  3FJ9 A;  2NM1 A;  2X2T A;  4QC4 A;  4I4P A;  4ZFW B;  2E4M A;  3WO4 A;  4Q9G A;  5FNW A;  3PME A;  3RSJ A;  1HIB A;  3H6Q A;  4Q9P A;  3P6J A;  2IWT B;  2Z48 A;  3FJK A;  4AN7 B;  3QR5 A;  4QKS A;  3CQA A;  3JUT A;  2MIB A;  3A21 A;  4F34 A;  3IM6 A;  2ZQO A;  4X3A A;  1PWA A;  4I96 A;  5I1B A;  1Q1U A;  1JTC A;  1AVA C;  2RG9 B;  1TWM A;  3OBR A;  5E24 E;  1MC9 A;  4JQ0 A;  1HWO B;  3O4O A;  1YF8 B;  4I2S A;  4HJJ A;  2HWA A;  5BXS A;  1QQL A;  1V6X A;  4IHZ A;  1PUM B;  1Z2V A;  1G9A A;  1TP0 A;  3VT2 A;  1RZO B;  3RTI B;  2E4M C;  2ZR1 B;  3AZV A;  5DUY A;  3W9T A;  2YUG A;  4DEN A;  5BXT A;  2D44 A;  4LO0 A;  4QKR A;  1PUU B;  2NP0 A;  2QYI B;  1BFF A;  3CA0 A;  2FO1 A;  2Y9G A;  1ITB A;  3SNV A;  3A23 A;  4ZA3 B;  1T9F A;  3BA5 A;  4Z8S B;  4IY9 A;  3HOM A;  4D0T A;  2DRE A;  4QBV A;  5F8W A;  6I1B A;  1JLX A;  3BA7 A;  2RST A;  3UJ0 A;  3S8K A;  4I0Y A;  1K5V A;  5DSS B;  1AFC A;  4I1E A;  4R6U B;  4J23 B;  1GGP B;  3V0B A;  3UDA A;  1ISX A;  5EC5 A;  2D7R A;  1Q03 A;  1I1B A;  4GOV A;  2F2F A;  2WBC A;  1FMZ A;  2L5X A;  2D20 A;  4EFR A;  21BI A;  1DFQ A;  1TFM B;  4I1B A;  1T4Q A;  3R4U A;  1XG6 A;  3NBE A;  1AVU A;  1JLY A;  1FWU A;  3N7J A;  5EG6 C;  4J2S A;  1ISZ A;  4LO0 C;  5BQU A;  4OEE A;  4G6J A;  3E8L C;  1IRP A;  4DCK C;  4UY4 A;  3WO2 A;  1NUN A;  2Y9F A;  4JP0 A;  31BI A;  4H9W A;  3A22 A;  2LIE A;  3N7K A;  1W3F A;  3FGM A;  5BOW A;  1QQK A;  5EHA A;  2ET2 A;  1CVS A;  3BAQ A;  4WBC A;  1BLD A;  3Q7Y A;  4USO A;  1ISY A;  3R4S A;  2AQZ A;  1I1E A;  1DQG A;  3BAD A;  2J3P A;  1G82 A;  4XFT A;  3PG0 A;  1BAR A;  2F2F C;  3Q7X A;  4I37 A;  4OWK A;  3BRG C;  1S0B A;  4YOL A;  1DZD A;  4OWJ A;  4KC3 A;  1G9D A;  2DS0 A;  4ZLB B;  3BX1 C;  1EPW A;  4GOY A;  3WIN A;  4QD2 C;  4Q91 A;  3IIR A;  1ISV A;  3O4A A;  3N7L A;  3BAU A;  4KBB A;  5BQU C;  1QXM A;  3FJB A;  2GO2 A;  2Z49 A;  3I2A A;  3V0A A;  1S0D A;  2ESU A;  4QO3 A;  3WMV A;  4I4S A;  2Y9W C;  3H6S E;  1HCE A;  1W3A A;  3LTQ A;  4JKQ A;  4CJM A;  1R8O A;  3F1R A;  5BXR A;  4IY8 A;  3BAO A;  3JRR A;  1IRA X;  1BAS A;  4EFQ A;  5DZU A;  4HR6 C;  3FJH A;  1EVT A;  1FMM S;  4J2X A;  1MD6 A;  3FJD A;  1HCD A;  1E0O A;  9ILB A;  4X38 A;  1AXM A;  3CAH A;  4GAI A;  3NBN A;  5DVH A;  4G9N A;  1BFC A;  3BTA A;  1FV2 A;  3O5W B;  4OEF A;  1DFC A;  1DLL A;  2F8X C;  1DIW A;  3H6R A;  2NYY A;  1CE7 B;  1M16 A;  1YYN A;  1Q04 A;  5JMC A;  2BEA A;  2D43 A;  3NJ5 A;  2AXM A;  3ZXD A;  3I2X A;  1A8D A;  3K1X A;  1JY0 A;  1W3G A;  2K4A B; 
#chains in the Genus database with same CATH homology
 3VT0 A;  3UD8 A;  3MAL A;  4EB2 B;  1S0E A;  1S0C A;  4KEK A;  4P0K A;  3F62 B;  3UJ4 A;  1G9C A;  3CRI A;  5BVP I;  2NS2 A;  3AH2 A;  3BAH A;  3AZW A;  4H75 A;  5D62 A;  4JRA A;  1TTU A;  1S0G A;  1ILR 1;  3OGF A;  4XFU A;  4P6A A;  3V0B B;  3IM5 A;  3BAG A;  5FNX A;  3CA5 A;  4END A;  1DJS B;  3O44 A;  2HZ9 A;  4AN6 A;  1IT0 A;  1PC8 B;  4EFP A;  4A7Z A;  3WO3 A;  2X2S A;  1OQL B;  1FV3 A;  3AJ6 A;  1IOB A;  4QAL A;  3UD9 A;  4OWL A;  4TLP A;  4G6M A;  2D23 A;  3CRH A;  1FQ9 A;  2K43 A;  4QD2 B;  4USP A;  3VWC A;  1BLA A;  3O3Q A;  1DQO A;  4J2K A;  2KI4 A;  3VUO A;  3T8S A;  3CRG A;  5D63 A;  1ISW A;  4LO1 A;  4I7I A;  3NBD A;  2MLL B;  2NTD A;  4GAF A;  2ZQN A;  2LIQ A;  3FFZ A;  1BFB A;  3O4B A;  5FZZ A;  4ZFY B;  3PHZ A;  3WA1 A;  4ISQ A;  1ABR B;  3V79 C;  2FGF A;  2P23 A;  3AJ5 A;  7I1B A;  1JT7 A;  2Q9X A;  3FUQ A;  5D61 A;  1V6V A;  3VSF A;  1FWV A;  2FFV A;  4ZOT A;  3UD7 A;  1N4K A;  1S0L A;  1TIE A;  2DRY A;  4I4V A;  41BI A;  3HMY A;  3OJV A;  2P39 A;  3VT1 A;  3ILA A;  3ZC9 A;  1Z0H A;  3IAG C;  1WD4 A;  3RTJ B;  3CU1 B;  4P0L A;  2UUS A;  4XFS A;  2D22 A;  3V0A B;  2HWM A;  4LO1 C;  4PC4 A;  3VEQ A;  3FUO A;  5JLV A;  3I29 B;  4FGF A;  4IZX A;  1RG8 A;  4FVV A;  2FFU A;  2QN4 A;  4I4R A;  1WD3 A;  3A07 A;  4ZFU B;  3PUB A;  3HSM A;  4L4H A;  3MPP G;  2D7I A;  4MZH A;  2M49 A;  3CA6 A;  1YXW A;  2NVH A;  1DZC A;  3NBC A;  5BP5 A;  2BEB A;  4DEP A;  4X39 A;  2D24 A;  1V6U A;  4HA2 A;  3FJA A;  3H6R B;  4ZKT B;  3CA3 A;  2R9K B;  3LLP A;  3BRF A;  4LO2 A;  3N7M A;  1XHB A;  3BRD A;  3FJF A;  2BFH A;  3QYD A;  4MZG B;  1AVW B;  4I3N A;  2MC2 A;  4OUJ A;  1WBA A;  4II0 A;  1ONK B;  3OGG A;  1HWN B;  1FN0 A;  5G00 A;  3WIN C;  1HKN A;  3OJ2 A;  2DRZ A;  1JT3 A;  1J0S A;  2VLC A;  5HPZ A;  1PZZ A;  4GP3 A;  1BFG A;  1IIL A;  3RMY A;  3C9Z A;  2VUA A;  1SR4 A;  4ISR A;  4A7K A;  1HWM B;  2ERM A;  5BXP A;  2RQ9 A;  1IJT A;  4LO7 C;  4XKI A;  1II4 A;  3FJ8 A;  4ION A;  3KMV A;  5BP5 C;  1P63 A;  4J2Y A;  3BA4 A;  4QBC A;  1R8N A;  1SZ6 B;  3ZX7 A;  1XYF A;  1EV2 A;  1RML A;  5FZY A;  4JAW A;  2NZ9 A;  4LO2 C;  2KI6 B;  1JT5 A;  3P53 A;  3POK A;  2AFG A;  3AKI A;  4I4Y A;  1G9B A;  4F83 A;  3OBT A;  4H04 A;  4EKX B;  1EYL A;  4X37 A;  4I4Q A;  3B9U A;  5GAQ A;  2VSA A;  4L4I A;  1K5U A;  1HWP B;  4LO3 A;  2AAI B;  5F8S A;  1KNM A;  3BB2 A;  2VSE A;  2Y9X E;  3HN1 A;  2IHO A;  1JT4 A;  1YBI A;  1SR4 C;  5F8Y A;  5FZU A;  4OEG A;  3ZC8 A;  3FJE A;  3HAL A;  4EEE B;  3OJM A;  4ZBV B;  3IM7 A;  3D7W B;  3AH1 A;  2HW9 A;  3HBW A;  4ZGR B;  3WMU A;  2KKI A;  4P0J A;  1BA7 A;  2D1Z A;  3CA1 A;  1L2H A;  4I6I A;  5B2H A;  3VSZ A;  1Z4S A;  3EF2 A;  4IQP A;  1TOO A;  3Q7W A;  2KLL A;  4I4O A;  4D0Z A;  3AKF A;  2XOA A;  1JQZ A;  2KH2 A;  1NZK A;  3AH4 A;  1VCL A;  1AF9 A;  1S0F A;  4A7Y A;  3BAV A;  2I1B A;  5F90 A;  8I1B A;  1M2T B;  1AVX B;  3O4C A;  4IYB A;  4Z9W B;  3P6I A;  4OW4 A;  1D0H A;  4LO3 C;  1FGA A;  3FJI A;  1V6W A;  4I4U A;  4I8M A;  3O4D A;  4JKX B;  4D8H A;  2Q3N B;  1WBC A;  4LO7 B;  3O49 A;  4GP0 A;  3AKH A;  4I4X A;  3S8J A;  3TC2 A;  2VU9 A;  3CA4 A;  2VXT I;  3RMX A;  2GZB A;  1XZZ A;  1IHK A;  4JPZ A;  1F31 A;  1UPS A;  1TWE A;  2K8R A;  3N0K A;  2FDB M;  4G9M A;  4IZE A;  2WRY A;  1RY7 A;  4KEJ A;  4MZF B;  3FJC A;  3ZXG A;  4G1R A;  3FJJ A;  4KEI A;  3AKG A;  2VXR A;  1YTO A;  4LO8 B;  3FJ9 A;  2NM1 A;  2X2T A;  4QC4 A;  4I4P A;  4ZFW B;  2E4M A;  3WO4 A;  4Q9G A;  5FNW A;  3PME A;  3RSJ A;  1HIB A;  3H6Q A;  4Q9P A;  3P6J A;  2IWT B;  2Z48 A;  3FJK A;  4AN7 B;  3QR5 A;  4QKS A;  3CQA A;  3JUT A;  2MIB A;  3A21 A;  4F34 A;  3IM6 A;  2ZQO A;  4X3A A;  1PWA A;  4I96 A;  5I1B A;  1Q1U A;  1JTC A;  1AVA C;  2RG9 B;  1TWM A;  3OBR A;  5E24 E;  1MC9 A;  4JQ0 A;  1HWO B;  3O4O A;  1YF8 B;  4I2S A;  4HJJ A;  2HWA A;  5BXS A;  1QQL A;  1V6X A;  4IHZ A;  1PUM B;  1Z2V A;  1G9A A;  1TP0 A;  3VT2 A;  1RZO B;  3RTI B;  2E4M C;  2ZR1 B;  3AZV A;  5DUY A;  3W9T A;  2YUG A;  4DEN A;  5BXT A;  2D44 A;  4LO0 A;  4QKR A;  1PUU B;  2NP0 A;  2QYI B;  1BFF A;  3CA0 A;  2FO1 A;  2Y9G A;  1ITB A;  3SNV A;  3A23 A;  4ZA3 B;  1T9F A;  3BA5 A;  4Z8S B;  4IY9 A;  3HOM A;  4D0T A;  2DRE A;  4QBV A;  5F8W A;  6I1B A;  1JLX A;  3BA7 A;  2RST A;  3UJ0 A;  3S8K A;  4I0Y A;  1K5V A;  5DSS B;  1AFC A;  4I1E A;  4R6U B;  4J23 B;  1GGP B;  3V0B A;  3UDA A;  1ISX A;  5EC5 A;  2D7R A;  1Q03 A;  1I1B A;  4GOV A;  2F2F A;  2WBC A;  1FMZ A;  2L5X A;  2D20 A;  4EFR A;  21BI A;  1DFQ A;  1TFM B;  4I1B A;  1T4Q A;  3R4U A;  1XG6 A;  3NBE A;  1AVU A;  1JLY A;  1FWU A;  3N7J A;  5EG6 C;  4J2S A;  1ISZ A;  4LO0 C;  5BQU A;  4OEE A;  4G6J A;  3E8L C;  1IRP A;  4DCK C;  4UY4 A;  3WO2 A;  1NUN A;  2Y9F A;  4JP0 A;  31BI A;  4H9W A;  3A22 A;  2LIE A;  3N7K A;  1W3F A;  3FGM A;  5BOW A;  1QQK A;  5EHA A;  2ET2 A;  1CVS A;  3BAQ A;  4WBC A;  1BLD A;  3Q7Y A;  4USO A;  1ISY A;  3R4S A;  2AQZ A;  1I1E A;  1DQG A;  3BAD A;  2J3P A;  1G82 A;  4XFT A;  3PG0 A;  1BAR A;  2F2F C;  3Q7X A;  4I37 A;  4OWK A;  3BRG C;  1S0B A;  4YOL A;  1DZD A;  4OWJ A;  4KC3 A;  1G9D A;  2DS0 A;  4ZLB B;  3BX1 C;  1EPW A;  4GOY A;  3WIN A;  4QD2 C;  4Q91 A;  3IIR A;  1ISV A;  3O4A A;  3N7L A;  3BAU A;  4KBB A;  5BQU C;  1QXM A;  3FJB A;  2GO2 A;  2Z49 A;  3I2A A;  3V0A A;  1S0D A;  2ESU A;  4QO3 A;  3WMV A;  4I4S A;  2Y9W C;  3H6S E;  1HCE A;  1W3A A;  3LTQ A;  4JKQ A;  4CJM A;  1R8O A;  3F1R A;  5BXR A;  4IY8 A;  3BAO A;  3JRR A;  1IRA X;  1BAS A;  4EFQ A;  5DZU A;  4HR6 C;  3FJH A;  1EVT A;  1FMM S;  4J2X A;  1MD6 A;  3FJD A;  1HCD A;  1E0O A;  9ILB A;  4X38 A;  1AXM A;  3CAH A;  4GAI A;  3NBN A;  5DVH A;  4G9N A;  1BFC A;  3BTA A;  1FV2 A;  3O5W B;  4OEF A;  1DFC A;  1DLL A;  2F8X C;  1DIW A;  3H6R A;  2NYY A;  1CE7 B;  1M16 A;  1YYN A;  1Q04 A;  5JMC A;  2BEA A;  2D43 A;  3NJ5 A;  2AXM A;  3ZXD A;  3I2X A;  1A8D A;  3K1X A;  1JY0 A;  1W3G A;  2K4A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...