4IYEA

Crystal structure of adtx1 (rho-da1a) from eastern green mamba (dendroaspis angusticeps)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
GLTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPAIYDSTRGCAATCPIPENYDSIHCCKTDKCNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of recombinant green mamba rho-Da1a toxin during a lyophilization procedure and its structure determination.
pubmed doi rcsb
source organism Dendroaspis angusticeps
molecule tags Toxin
molecule keywords Toxin AdTx1
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4iyeA00
1TGXA 1CXOA 1CHVS 1W6BA 4DO8A 1IQ9A 3FEVA 1YWHA 1IDHA 1ERGA 2ABXA 4HQPF 1TXBA 2H62D 1REWC 1FSCA 2JVEA 1L4WA 1MR6A 1KBSA 3KFDE 1KU6B 1QKDA 1ES7B 1CODA 2FD6U 4QTIU 1MAHF 1QM7A 1F94A 5IMYC 2NBTA 1UG4A 3BT1U 3EVSC 1H0JA 1QKEA 3NDSA 4EY8B 2HLRA 2OFSA 2QJAC 4P7UA 1NEAA 3KFDI 1KS6A 1HC9A 4UY2C 4AEAA 1XT3A 1CDQA 2CDXA 1IK8A 3BT2U 3NH7A 2CRTA 3U73U 1IKCA 1LXGA 2H5FA 4FAOC 2BHIA 3EBXA 3U74U 1IDIA 3VTSA 2H7ZA 2MUOA 1RGJA 3ERAA 5IMTD 1KXIA 2QJBC 5DZ5A 1FRAA 4IYEA 2ERAA 2LCRA 2PJYC 1VB0A 2UWRA 3QB4B 1IJCA 1HOYA 1IDLA 1LSIA 2UX2A 4OM5A 1CDSA 4BIKB 1BTEA 2H8UA 3HH7A 1V6PA 1CTXA 1HAAA 1HAJA 1CDTA 1BXPA 1FF4A 2QJ9C 3PLCA 4ZQYA 1NYUA 1ZADA 2HLQA 2JQPA 2MHYA 4FAOE 1LX5B 2VLWA 1CCQA 1COEA 1FSSB 1CREA 6EBXA 1JBDA 2CTXA 2H62C 2MJYA 2H64B 2X8BB 5EBXA 3LAQU 1ABTA 2MUPA 1S4YA 2GOOB 2H64C 4BDTB 2QC1A 1M9ZA 5DU1A 4LFTA 2N99A 1LJZA 1TXAA 1DRSA 2BTXA 1NTNA 2LA1A 1FFJA 1KTZB 1NORA 1ONJA 1JE9A 4XJJA 1RL5A 2H7ZB 1FASA 2MFAA 2K3GA 2MJ0A 1KC4A 1NYSA 1KFHA 1CRFA 1LXHA 1G6MA 1I02A 1KBTA 1CXNA 1B41B 1IDGA 1CVOA 1TFSA 2PJYB 4RUDA 4OM4A 1CDRA 1NXBA 2L03A 5DO6A 1NTXA 1ERAA 2CRSA 2I9BE 1F8UB 2CCXA 3NEQA 1JGKA 2MJ4A 1KBAA 1HC9B 1CB9A 2L5SA 2GOOC 2J8BA 1KL8A 1PLOA
chains in the Genus database with same CATH superfamily
1TGXA 1CXOA 1CHVS 1W6BA 4DO8A 1IQ9A 3FEVA 1YWHA 1IDHA 1ERGA 2ABXA 4HQPF 1TXBA 2H62D 1REWC 1FSCA 2JVEA 1L4WA 1MR6A 1KBSA 3KFDE 1KU6B 1QKDA 1ES7B 1CODA 2FD6U 4QTIU 1MAHF 1QM7A 1F94A 5IMYC 2NBTA 1UG4A 3BT1U 3EVSC 4KSNA 1H0JA 1QKEA 3NDSA 4EY8B 2HLRA 2OFSA 2QJAC 4P7UA 1NEAA 3KFDI 1KS6A 1HC9A 4UY2C 4AEAA 1XT3A 1CDQA 2CDXA 1IK8A 3BT2U 3NH7A 2CRTA 3U73U 1IKCA 1LXGA 2H5FA 4FAOC 2BHIA 3EBXA 3U74U 1IDIA 3VTSA 2H7ZA 2MUOA 1RGJA 3ERAA 5IMTD 1KXIA 2QJBC 5DZ5A 1FRAA 4IYEA 2ERAA 2LCRA 2PJYC 1VB0A 2UWRA 3QB4B 1IJCA 1HOYA 1IDLA 1LSIA 2UX2A 4OM5A 1CDSA 4BIKB 1BTEA 2H8UA 3HH7A 1V6PA 1CTXA 1HAAA 1HAJA 1CDTA 1BXPA 1FF4A 2QJ9C 3PLCA 4ZQYA 1NYUA 1ZADA 2HLQA 2JQPA 2MHYA 4FAOE 1LX5B 2VLWA 1CCQA 1COEA 1FSSB 1CREA 6EBXA 1JBDA 2CTXA 2H62C 2MJYA 2H64B 2X8BB 5EBXA 3LAQU 1ABTA 2MUPA 1S4YA 2GOOB 2H64C 4BDTB 2QC1A 1M9ZA 5DU1A 4LFTA 2N99A 1LJZA 1TXAA 1DRSA 2BTXA 1NTNA 2LA1A 1FFJA 1KTZB 1NORA 1ONJA 1JE9A 4XJJA 1RL5A 2H7ZB 1FASA 2MFAA 2K3GA 2MJ0A 1KC4A 1NYSA 1KFHA 1CRFA 1LXHA 1G6MA 1I02A 1KBTA 1CXNA 1B41B 1IDGA 1CVOA 1TFSA 2PJYB 4RUDA 4OM4A 1CDRA 1NXBA 2L03A 5DO6A 1NTXA 1ERAA 2CRSA 2I9BE 1F8UB 2CCXA 3NEQA 1JGKA 2MJ4A 1KBAA 1HC9B 1CB9A 2L5SA 2GOOC 2J8BA 1KL8A 1PLOA
chains in the Genus database with same CATH topology
1TGXA 1CXOA 1CHVS 1W6BA 4DO8A 1IQ9A 3FEVA 1YWHA 1IDHA 1ERGA 2ABXA 4HQPF 1TXBA 2H62D 1REWC 1FSCA 2JVEA 1L4WA 1MR6A 1KBSA 3KFDE 1KU6B 1QKDA 1ES7B 1CODA 2FD6U 4QTIU 1MAHF 1QM7A 1F94A 5IMYC 2NBTA 1UG4A 3BT1U 3EVSC 4KSNA 1H0JA 1QKEA 3NDSA 4EY8B 2HLRA 2OFSA 2QJAC 4P7UA 1NEAA 3KFDI 1KS6A 1HC9A 4UY2C 4AEAA 1XT3A 1CDQA 2CDXA 1IK8A 3BT2U 3NH7A 2CRTA 3U73U 1IKCA 1LXGA 2H5FA 4FAOC 2BHIA 3EBXA 3U74U 1IDIA 3VTSA 2H7ZA 2MUOA 1RGJA 3ERAA 5IMTD 1KXIA 2QJBC 5DZ5A 1FRAA 4IYEA 2ERAA 2LCRA 2PJYC 1VB0A 2UWRA 3QB4B 1IJCA 1HOYA 1IDLA 1LSIA 2UX2A 4OM5A 1CDSA 4BIKB 1BTEA 2H8UA 3HH7A 1V6PA 1CTXA 1HAAA 1HAJA 1CDTA 1BXPA 1FF4A 2QJ9C 3PLCA 4ZQYA 1NYUA 1ZADA 2HLQA 2JQPA 2MHYA 4FAOE 1LX5B 2VLWA 1CCQA 1COEA 1FSSB 1CREA 6EBXA 1JBDA 2CTXA 2H62C 2MJYA 2H64B 2X8BB 5EBXA 3LAQU 1ABTA 2MUPA 1S4YA 2GOOB 2H64C 4BDTB 2QC1A 1M9ZA 5DU1A 4LFTA 2N99A 1LJZA 1TXAA 1DRSA 2BTXA 1NTNA 2LA1A 1FFJA 1KTZB 1NORA 1ONJA 1JE9A 4XJJA 1RL5A 2H7ZB 1FASA 2MFAA 2K3GA 2MJ0A 1KC4A 1NYSA 1KFHA 1CRFA 1LXHA 1G6MA 1I02A 1KBTA 1CXNA 1B41B 1IDGA 1CVOA 1TFSA 2PJYB 4RUDA 4OM4A 1CDRA 1NXBA 2L03A 5DO6A 1NTXA 1ERAA 2CRSA 2I9BE 1F8UB 2CCXA 3NEQA 1JGKA 2MJ4A 1KBAA 1HC9B 1CB9A 2L5SA 2GOOC 2J8BA 1KL8A 1PLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TGX A;  1CXO A;  1CHV S;  1W6B A;  4DO8 A;  1IQ9 A;  3FEV A;  1YWH A;  1IDH A;  1ERG A;  2ABX A;  4HQP F;  1TXB A;  2H62 D;  1REW C;  1FSC A;  2JVE A;  1L4W A;  1MR6 A;  1KBS A;  3KFD E;  1KU6 B;  1QKD A;  1ES7 B;  1COD A;  2FD6 U;  4QTI U;  1MAH F;  1QM7 A;  1F94 A;  5IMY C;  2NBT A;  1UG4 A;  3BT1 U;  3EVS C;  1H0J A;  1QKE A;  3NDS A;  4EY8 B;  2HLR A;  2OFS A;  2QJA C;  4P7U A;  1NEA A;  3KFD I;  1KS6 A;  1HC9 A;  4UY2 C;  4AEA A;  1XT3 A;  1CDQ A;  2CDX A;  1IK8 A;  3BT2 U;  3NH7 A;  2CRT A;  3U73 U;  1IKC A;  1LXG A;  2H5F A;  4FAO C;  2BHI A;  3EBX A;  3U74 U;  1IDI A;  3VTS A;  2H7Z A;  2MUO A;  1RGJ A;  3ERA A;  5IMT D;  1KXI A;  2QJB C;  5DZ5 A;  1FRA A;  4IYE A;  2ERA A;  2LCR A;  2PJY C;  1VB0 A;  2UWR A;  3QB4 B;  1IJC A;  1HOY A;  1IDL A;  1LSI A;  2UX2 A;  4OM5 A;  1CDS A;  4BIK B;  1BTE A;  2H8U A;  3HH7 A;  1V6P A;  1CTX A;  1HAA A;  1HAJ A;  1CDT A;  1BXP A;  1FF4 A;  2QJ9 C;  3PLC A;  4ZQY A;  1NYU A;  1ZAD A;  2HLQ A;  2JQP A;  2MHY A;  4FAO E;  1LX5 B;  2VLW A;  1CCQ A;  1COE A;  1FSS B;  1CRE A;  6EBX A;  1JBD A;  2CTX A;  2H62 C;  2MJY A;  2H64 B;  2X8B B;  5EBX A;  3LAQ U;  1ABT A;  2MUP A;  1S4Y A;  2GOO B;  2H64 C;  4BDT B;  2QC1 A;  1M9Z A;  5DU1 A;  4LFT A;  2N99 A;  1LJZ A;  1TXA A;  1DRS A;  2BTX A;  1NTN A;  2LA1 A;  1FFJ A;  1KTZ B;  1NOR A;  1ONJ A;  1JE9 A;  4XJJ A;  1RL5 A;  2H7Z B;  1FAS A;  2MFA A;  2K3G A;  2MJ0 A;  1KC4 A;  1NYS A;  1KFH A;  1CRF A;  1LXH A;  1G6M A;  1I02 A;  1KBT A;  1CXN A;  1B41 B;  1IDG A;  1CVO A;  1TFS A;  2PJY B;  4RUD A;  4OM4 A;  1CDR A;  1NXB A;  2L03 A;  5DO6 A;  1NTX A;  1ERA A;  2CRS A;  2I9B E;  1F8U B;  2CCX A;  3NEQ A;  1JGK A;  2MJ4 A;  1KBA A;  1HC9 B;  1CB9 A;  2L5S A;  2GOO C;  2J8B A;  1KL8 A;  1PLO A; 
#chains in the Genus database with same CATH topology
 1TGX A;  1CXO A;  1CHV S;  1W6B A;  4DO8 A;  1IQ9 A;  3FEV A;  1YWH A;  1IDH A;  1ERG A;  2ABX A;  4HQP F;  1TXB A;  2H62 D;  1REW C;  1FSC A;  2JVE A;  1L4W A;  1MR6 A;  1KBS A;  3KFD E;  1KU6 B;  1QKD A;  1ES7 B;  1COD A;  2FD6 U;  4QTI U;  1MAH F;  1QM7 A;  1F94 A;  5IMY C;  2NBT A;  1UG4 A;  3BT1 U;  3EVS C;  4KSN A;  1H0J A;  1QKE A;  3NDS A;  4EY8 B;  2HLR A;  2OFS A;  2QJA C;  4P7U A;  1NEA A;  3KFD I;  1KS6 A;  1HC9 A;  4UY2 C;  4AEA A;  1XT3 A;  1CDQ A;  2CDX A;  1IK8 A;  3BT2 U;  3NH7 A;  2CRT A;  3U73 U;  1IKC A;  1LXG A;  2H5F A;  4FAO C;  2BHI A;  3EBX A;  3U74 U;  1IDI A;  3VTS A;  2H7Z A;  2MUO A;  1RGJ A;  3ERA A;  5IMT D;  1KXI A;  2QJB C;  5DZ5 A;  1FRA A;  4IYE A;  2ERA A;  2LCR A;  2PJY C;  1VB0 A;  2UWR A;  3QB4 B;  1IJC A;  1HOY A;  1IDL A;  1LSI A;  2UX2 A;  4OM5 A;  1CDS A;  4BIK B;  1BTE A;  2H8U A;  3HH7 A;  1V6P A;  1CTX A;  1HAA A;  1HAJ A;  1CDT A;  1BXP A;  1FF4 A;  2QJ9 C;  3PLC A;  4ZQY A;  1NYU A;  1ZAD A;  2HLQ A;  2JQP A;  2MHY A;  4FAO E;  1LX5 B;  2VLW A;  1CCQ A;  1COE A;  1FSS B;  1CRE A;  6EBX A;  1JBD A;  2CTX A;  2H62 C;  2MJY A;  2H64 B;  2X8B B;  5EBX A;  3LAQ U;  1ABT A;  2MUP A;  1S4Y A;  2GOO B;  2H64 C;  4BDT B;  2QC1 A;  1M9Z A;  5DU1 A;  4LFT A;  2N99 A;  1LJZ A;  1TXA A;  1DRS A;  2BTX A;  1NTN A;  2LA1 A;  1FFJ A;  1KTZ B;  1NOR A;  1ONJ A;  1JE9 A;  4XJJ A;  1RL5 A;  2H7Z B;  1FAS A;  2MFA A;  2K3G A;  2MJ0 A;  1KC4 A;  1NYS A;  1KFH A;  1CRF A;  1LXH A;  1G6M A;  1I02 A;  1KBT A;  1CXN A;  1B41 B;  1IDG A;  1CVO A;  1TFS A;  2PJY B;  4RUD A;  4OM4 A;  1CDR A;  1NXB A;  2L03 A;  5DO6 A;  1NTX A;  1ERA A;  2CRS A;  2I9B E;  1F8U B;  2CCX A;  3NEQ A;  1JGK A;  2MJ4 A;  1KBA A;  1HC9 B;  1CB9 A;  2L5S A;  2GOO C;  2J8B A;  1KL8 A;  1PLO A; 
#chains in the Genus database with same CATH homology
 1TGX A;  1CXO A;  1CHV S;  1W6B A;  4DO8 A;  1IQ9 A;  3FEV A;  1YWH A;  1IDH A;  1ERG A;  2ABX A;  4HQP F;  1TXB A;  2H62 D;  1REW C;  1FSC A;  2JVE A;  1L4W A;  1MR6 A;  1KBS A;  3KFD E;  1KU6 B;  1QKD A;  1ES7 B;  1COD A;  2FD6 U;  4QTI U;  1MAH F;  1QM7 A;  1F94 A;  5IMY C;  2NBT A;  1UG4 A;  3BT1 U;  3EVS C;  4KSN A;  1H0J A;  1QKE A;  3NDS A;  4EY8 B;  2HLR A;  2OFS A;  2QJA C;  4P7U A;  1NEA A;  3KFD I;  1KS6 A;  1HC9 A;  4UY2 C;  4AEA A;  1XT3 A;  1CDQ A;  2CDX A;  1IK8 A;  3BT2 U;  3NH7 A;  2CRT A;  3U73 U;  1IKC A;  1LXG A;  2H5F A;  4FAO C;  2BHI A;  3EBX A;  3U74 U;  1IDI A;  3VTS A;  2H7Z A;  2MUO A;  1RGJ A;  3ERA A;  5IMT D;  1KXI A;  2QJB C;  5DZ5 A;  1FRA A;  4IYE A;  2ERA A;  2LCR A;  2PJY C;  1VB0 A;  2UWR A;  3QB4 B;  1IJC A;  1HOY A;  1IDL A;  1LSI A;  2UX2 A;  4OM5 A;  1CDS A;  4BIK B;  1BTE A;  2H8U A;  3HH7 A;  1V6P A;  1CTX A;  1HAA A;  1HAJ A;  1CDT A;  1BXP A;  1FF4 A;  2QJ9 C;  3PLC A;  4ZQY A;  1NYU A;  1ZAD A;  2HLQ A;  2JQP A;  2MHY A;  4FAO E;  1LX5 B;  2VLW A;  1CCQ A;  1COE A;  1FSS B;  1CRE A;  6EBX A;  1JBD A;  2CTX A;  2H62 C;  2MJY A;  2H64 B;  2X8B B;  5EBX A;  3LAQ U;  1ABT A;  2MUP A;  1S4Y A;  2GOO B;  2H64 C;  4BDT B;  2QC1 A;  1M9Z A;  5DU1 A;  4LFT A;  2N99 A;  1LJZ A;  1TXA A;  1DRS A;  2BTX A;  1NTN A;  2LA1 A;  1FFJ A;  1KTZ B;  1NOR A;  1ONJ A;  1JE9 A;  4XJJ A;  1RL5 A;  2H7Z B;  1FAS A;  2MFA A;  2K3G A;  2MJ0 A;  1KC4 A;  1NYS A;  1KFH A;  1CRF A;  1LXH A;  1G6M A;  1I02 A;  1KBT A;  1CXN A;  1B41 B;  1IDG A;  1CVO A;  1TFS A;  2PJY B;  4RUD A;  4OM4 A;  1CDR A;  1NXB A;  2L03 A;  5DO6 A;  1NTX A;  1ERA A;  2CRS A;  2I9B E;  1F8U B;  2CCX A;  3NEQ A;  1JGK A;  2MJ4 A;  1KBA A;  1HC9 B;  1CB9 A;  2L5S A;  2GOO C;  2J8B A;  1KL8 A;  1PLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...