4IYEA

Crystal structure of adtx1 (rho-da1a) from eastern green mamba (dendroaspis angusticeps)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
GLTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPAIYDSTRGCAATCPIPENYDSIHCCKTDKCNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxin AdTx1
publication title Crystallization of recombinant green mamba rho-Da1a toxin during a lyophilization procedure and its structure determination.
pubmed doi rcsb
source organism Dendroaspis angusticeps
molecule tags Toxin
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4iyeA00
1CXNA 2JVEA 4HQPF 4LFTA 2BTXA 1VB0A 1REWC 5EBXA 1CDRA 1CDQA 1BTEA 4ZQYA 1NYSA 2MJ4A 2L5SA 2NBTA 2H62C 1FRAA 1JE9A 1IQ9A 2HLRA 1I02A 2X8BB 1LSIA 2N99A 1NTNA 1HC9A 1HAJA 1FF4A 1KBAA 1KL8A 2MUOA 2ABXA 4DO8A 2QJ9C 3PLCA 1KBSA 1CVOA 1JBDA 2H7ZB 1RGJA 1NTXA 2MJ0A 2PJYB 1LXHA 4UY2C 2CDXA 2CRSA 2H64C 5DZ5A 4FAOE 2ERAA 3VTSA 2GOOC 1ES7B 1IDHA 1TXAA 1MAHF 1CREA 3BT2U 1CXOA 1F94A 4QTIU 1PLOA 1NXBA 2HLQA 3NEQA 1F8UB 1V6PA 1HOYA 2QJAC 1FFJA 1HAAA 1LJZA 2J8BA 1KFHA 1KXIA 2CTXA 3EVSC 2H5FA 1FASA 2FD6U 5IMTD 3LAQU 3KFDI 4IYEA 1ONJA 4RUDA 4EY8B 1CRFA 1BXPA 1NEAA 1CODA 2JQPA 2LCRA 4OM5A 5IMYC 3ERAA 1FSCA 1RL5A 1COEA 1ZADA 4FAOC 1CTXA 3NH7A 1KS6A 5DU1A 1FSSB 2BHIA 1QM7A 1CCQA 2LA1A 1LX5B 2UX2A 1IDLA 1NYUA 1KC4A 2CCXA 2VLWA 2CRTA 2I9BE 1QKEA 4P7UA 1LXGA 1IJCA 4AEAA 1IDIA 1IK8A 1ERGA 2H7ZA 2MHYA 1HC9B 2PJYC 2H62D 1CB9A 3BT1U 2K3GA 2QJBC 3FEVA 1G6MA 3U74U 1KBTA 1DRSA 4XJJA 1KTZB 3NDSA 1NORA 4BDTB 1IKCA 2UWRA 1MR6A 1CDSA 1QKDA 1L4WA 4BIKB 1CDTA 6EBXA 2H8UA 1TGXA 4OM4A 1CHVS 1TFSA 2MFAA 3U73U 3KFDE 1B41B 1KU6B 2H64B 1S4YA 2MJYA 1YWHA 1M9ZA 2GOOB 2L03A 1IDGA 1UG4A 1ABTA 1XT3A 3EBXA 1H0JA 1TXBA 1W6BA 2MUPA 2OFSA 3HH7A 3QB4B 1ERAA 2QC1A 5DO6A 1JGKA
chains in the Genus database with same CATH superfamily
1CXNA 2JVEA 4HQPF 4LFTA 2BTXA 1VB0A 1REWC 5EBXA 1CDRA 1CDQA 1BTEA 4ZQYA 1NYSA 2MJ4A 2L5SA 2NBTA 2H62C 1FRAA 1JE9A 1IQ9A 2HLRA 1I02A 2X8BB 1LSIA 2N99A 1NTNA 1HC9A 1HAJA 1FF4A 1KBAA 1KL8A 2MUOA 2ABXA 4DO8A 2QJ9C 3PLCA 1KBSA 1CVOA 1JBDA 2H7ZB 1RGJA 1NTXA 2MJ0A 2PJYB 1LXHA 4UY2C 2CDXA 2CRSA 2H64C 5DZ5A 4FAOE 2ERAA 3VTSA 2GOOC 1ES7B 1IDHA 1TXAA 1MAHF 1CREA 3BT2U 1CXOA 1F94A 4QTIU 1PLOA 1NXBA 2HLQA 3NEQA 1F8UB 1V6PA 1HOYA 2QJAC 4KSNA 1FFJA 1HAAA 1LJZA 2J8BA 1KFHA 1KXIA 2CTXA 3EVSC 2H5FA 1FASA 2FD6U 5IMTD 3LAQU 3KFDI 4IYEA 1ONJA 4RUDA 4EY8B 1CRFA 1BXPA 1NEAA 1CODA 2JQPA 2LCRA 4OM5A 5IMYC 3ERAA 1FSCA 1RL5A 1COEA 1ZADA 4FAOC 1CTXA 3NH7A 1KS6A 5DU1A 1FSSB 2BHIA 1QM7A 1CCQA 2LA1A 1LX5B 2UX2A 1IDLA 1NYUA 1KC4A 2CCXA 2VLWA 2CRTA 2I9BE 1QKEA 4P7UA 1LXGA 1IJCA 4AEAA 1IDIA 1IK8A 1ERGA 2H7ZA 2MHYA 1HC9B 2PJYC 2H62D 1CB9A 3BT1U 2K3GA 2QJBC 3FEVA 1G6MA 3U74U 1KBTA 1DRSA 4XJJA 1KTZB 3NDSA 1NORA 4BDTB 1IKCA 2UWRA 1MR6A 1CDSA 1QKDA 1L4WA 4BIKB 1CDTA 6EBXA 2H8UA 1TGXA 4OM4A 1CHVS 1TFSA 2MFAA 3U73U 3KFDE 1B41B 1KU6B 2H64B 1S4YA 2MJYA 1YWHA 1M9ZA 2GOOB 2L03A 1IDGA 1UG4A 1ABTA 1XT3A 3EBXA 1H0JA 1TXBA 1W6BA 2MUPA 2OFSA 3HH7A 3QB4B 1ERAA 2QC1A 5DO6A 1JGKA
chains in the Genus database with same CATH topology
1CXNA 2JVEA 4HQPF 4LFTA 2BTXA 1VB0A 1REWC 5EBXA 1CDRA 1CDQA 1BTEA 4ZQYA 1NYSA 2MJ4A 2L5SA 2NBTA 2H62C 1FRAA 1JE9A 1IQ9A 2HLRA 1I02A 2X8BB 1LSIA 2N99A 1NTNA 1HC9A 1HAJA 1FF4A 1KBAA 1KL8A 2MUOA 2ABXA 4DO8A 2QJ9C 3PLCA 1KBSA 1CVOA 1JBDA 2H7ZB 1RGJA 1NTXA 2MJ0A 2PJYB 1LXHA 4UY2C 2CDXA 2CRSA 2H64C 5DZ5A 4FAOE 2ERAA 3VTSA 2GOOC 1ES7B 1IDHA 1TXAA 1MAHF 1CREA 3BT2U 1CXOA 1F94A 4QTIU 1PLOA 1NXBA 2HLQA 3NEQA 1F8UB 1V6PA 1HOYA 2QJAC 4KSNA 1FFJA 1HAAA 1LJZA 2J8BA 1KFHA 1KXIA 2CTXA 3EVSC 2H5FA 1FASA 2FD6U 5IMTD 3LAQU 3KFDI 4IYEA 1ONJA 4RUDA 4EY8B 1CRFA 1BXPA 1NEAA 1CODA 2JQPA 2LCRA 4OM5A 5IMYC 3ERAA 1FSCA 1RL5A 1COEA 1ZADA 4FAOC 1CTXA 3NH7A 1KS6A 5DU1A 1FSSB 2BHIA 1QM7A 1CCQA 2LA1A 1LX5B 2UX2A 1IDLA 1NYUA 1KC4A 2CCXA 2VLWA 2CRTA 2I9BE 1QKEA 4P7UA 1LXGA 1IJCA 4AEAA 1IDIA 1IK8A 1ERGA 2H7ZA 2MHYA 1HC9B 2PJYC 2H62D 1CB9A 3BT1U 2K3GA 2QJBC 3FEVA 1G6MA 3U74U 1KBTA 1DRSA 4XJJA 1KTZB 3NDSA 1NORA 4BDTB 1IKCA 2UWRA 1MR6A 1CDSA 1QKDA 1L4WA 4BIKB 1CDTA 6EBXA 2H8UA 1TGXA 4OM4A 1CHVS 1TFSA 2MFAA 3U73U 3KFDE 1B41B 1KU6B 2H64B 1S4YA 2MJYA 1YWHA 1M9ZA 2GOOB 2L03A 1IDGA 1UG4A 1ABTA 1XT3A 3EBXA 1H0JA 1TXBA 1W6BA 2MUPA 2OFSA 3HH7A 3QB4B 1ERAA 2QC1A 5DO6A 1JGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CXN A;  2JVE A;  4HQP F;  4LFT A;  2BTX A;  1VB0 A;  1REW C;  5EBX A;  1CDR A;  1CDQ A;  1BTE A;  4ZQY A;  1NYS A;  2MJ4 A;  2L5S A;  2NBT A;  2H62 C;  1FRA A;  1JE9 A;  1IQ9 A;  2HLR A;  1I02 A;  2X8B B;  1LSI A;  2N99 A;  1NTN A;  1HC9 A;  1HAJ A;  1FF4 A;  1KBA A;  1KL8 A;  2MUO A;  2ABX A;  4DO8 A;  2QJ9 C;  3PLC A;  1KBS A;  1CVO A;  1JBD A;  2H7Z B;  1RGJ A;  1NTX A;  2MJ0 A;  2PJY B;  1LXH A;  4UY2 C;  2CDX A;  2CRS A;  2H64 C;  5DZ5 A;  4FAO E;  2ERA A;  3VTS A;  2GOO C;  1ES7 B;  1IDH A;  1TXA A;  1MAH F;  1CRE A;  3BT2 U;  1CXO A;  1F94 A;  4QTI U;  1PLO A;  1NXB A;  2HLQ A;  3NEQ A;  1F8U B;  1V6P A;  1HOY A;  2QJA C;  1FFJ A;  1HAA A;  1LJZ A;  2J8B A;  1KFH A;  1KXI A;  2CTX A;  3EVS C;  2H5F A;  1FAS A;  2FD6 U;  5IMT D;  3LAQ U;  3KFD I;  4IYE A;  1ONJ A;  4RUD A;  4EY8 B;  1CRF A;  1BXP A;  1NEA A;  1COD A;  2JQP A;  2LCR A;  4OM5 A;  5IMY C;  3ERA A;  1FSC A;  1RL5 A;  1COE A;  1ZAD A;  4FAO C;  1CTX A;  3NH7 A;  1KS6 A;  5DU1 A;  1FSS B;  2BHI A;  1QM7 A;  1CCQ A;  2LA1 A;  1LX5 B;  2UX2 A;  1IDL A;  1NYU A;  1KC4 A;  2CCX A;  2VLW A;  2CRT A;  2I9B E;  1QKE A;  4P7U A;  1LXG A;  1IJC A;  4AEA A;  1IDI A;  1IK8 A;  1ERG A;  2H7Z A;  2MHY A;  1HC9 B;  2PJY C;  2H62 D;  1CB9 A;  3BT1 U;  2K3G A;  2QJB C;  3FEV A;  1G6M A;  3U74 U;  1KBT A;  1DRS A;  4XJJ A;  1KTZ B;  3NDS A;  1NOR A;  4BDT B;  1IKC A;  2UWR A;  1MR6 A;  1CDS A;  1QKD A;  1L4W A;  4BIK B;  1CDT A;  6EBX A;  2H8U A;  1TGX A;  4OM4 A;  1CHV S;  1TFS A;  2MFA A;  3U73 U;  3KFD E;  1B41 B;  1KU6 B;  2H64 B;  1S4Y A;  2MJY A;  1YWH A;  1M9Z A;  2GOO B;  2L03 A;  1IDG A;  1UG4 A;  1ABT A;  1XT3 A;  3EBX A;  1H0J A;  1TXB A;  1W6B A;  2MUP A;  2OFS A;  3HH7 A;  3QB4 B;  1ERA A;  2QC1 A;  5DO6 A;  1JGK A; 
#chains in the Genus database with same CATH topology
 1CXN A;  2JVE A;  4HQP F;  4LFT A;  2BTX A;  1VB0 A;  1REW C;  5EBX A;  1CDR A;  1CDQ A;  1BTE A;  4ZQY A;  1NYS A;  2MJ4 A;  2L5S A;  2NBT A;  2H62 C;  1FRA A;  1JE9 A;  1IQ9 A;  2HLR A;  1I02 A;  2X8B B;  1LSI A;  2N99 A;  1NTN A;  1HC9 A;  1HAJ A;  1FF4 A;  1KBA A;  1KL8 A;  2MUO A;  2ABX A;  4DO8 A;  2QJ9 C;  3PLC A;  1KBS A;  1CVO A;  1JBD A;  2H7Z B;  1RGJ A;  1NTX A;  2MJ0 A;  2PJY B;  1LXH A;  4UY2 C;  2CDX A;  2CRS A;  2H64 C;  5DZ5 A;  4FAO E;  2ERA A;  3VTS A;  2GOO C;  1ES7 B;  1IDH A;  1TXA A;  1MAH F;  1CRE A;  3BT2 U;  1CXO A;  1F94 A;  4QTI U;  1PLO A;  1NXB A;  2HLQ A;  3NEQ A;  1F8U B;  1V6P A;  1HOY A;  2QJA C;  4KSN A;  1FFJ A;  1HAA A;  1LJZ A;  2J8B A;  1KFH A;  1KXI A;  2CTX A;  3EVS C;  2H5F A;  1FAS A;  2FD6 U;  5IMT D;  3LAQ U;  3KFD I;  4IYE A;  1ONJ A;  4RUD A;  4EY8 B;  1CRF A;  1BXP A;  1NEA A;  1COD A;  2JQP A;  2LCR A;  4OM5 A;  5IMY C;  3ERA A;  1FSC A;  1RL5 A;  1COE A;  1ZAD A;  4FAO C;  1CTX A;  3NH7 A;  1KS6 A;  5DU1 A;  1FSS B;  2BHI A;  1QM7 A;  1CCQ A;  2LA1 A;  1LX5 B;  2UX2 A;  1IDL A;  1NYU A;  1KC4 A;  2CCX A;  2VLW A;  2CRT A;  2I9B E;  1QKE A;  4P7U A;  1LXG A;  1IJC A;  4AEA A;  1IDI A;  1IK8 A;  1ERG A;  2H7Z A;  2MHY A;  1HC9 B;  2PJY C;  2H62 D;  1CB9 A;  3BT1 U;  2K3G A;  2QJB C;  3FEV A;  1G6M A;  3U74 U;  1KBT A;  1DRS A;  4XJJ A;  1KTZ B;  3NDS A;  1NOR A;  4BDT B;  1IKC A;  2UWR A;  1MR6 A;  1CDS A;  1QKD A;  1L4W A;  4BIK B;  1CDT A;  6EBX A;  2H8U A;  1TGX A;  4OM4 A;  1CHV S;  1TFS A;  2MFA A;  3U73 U;  3KFD E;  1B41 B;  1KU6 B;  2H64 B;  1S4Y A;  2MJY A;  1YWH A;  1M9Z A;  2GOO B;  2L03 A;  1IDG A;  1UG4 A;  1ABT A;  1XT3 A;  3EBX A;  1H0J A;  1TXB A;  1W6B A;  2MUP A;  2OFS A;  3HH7 A;  3QB4 B;  1ERA A;  2QC1 A;  5DO6 A;  1JGK A; 
#chains in the Genus database with same CATH homology
 1CXN A;  2JVE A;  4HQP F;  4LFT A;  2BTX A;  1VB0 A;  1REW C;  5EBX A;  1CDR A;  1CDQ A;  1BTE A;  4ZQY A;  1NYS A;  2MJ4 A;  2L5S A;  2NBT A;  2H62 C;  1FRA A;  1JE9 A;  1IQ9 A;  2HLR A;  1I02 A;  2X8B B;  1LSI A;  2N99 A;  1NTN A;  1HC9 A;  1HAJ A;  1FF4 A;  1KBA A;  1KL8 A;  2MUO A;  2ABX A;  4DO8 A;  2QJ9 C;  3PLC A;  1KBS A;  1CVO A;  1JBD A;  2H7Z B;  1RGJ A;  1NTX A;  2MJ0 A;  2PJY B;  1LXH A;  4UY2 C;  2CDX A;  2CRS A;  2H64 C;  5DZ5 A;  4FAO E;  2ERA A;  3VTS A;  2GOO C;  1ES7 B;  1IDH A;  1TXA A;  1MAH F;  1CRE A;  3BT2 U;  1CXO A;  1F94 A;  4QTI U;  1PLO A;  1NXB A;  2HLQ A;  3NEQ A;  1F8U B;  1V6P A;  1HOY A;  2QJA C;  4KSN A;  1FFJ A;  1HAA A;  1LJZ A;  2J8B A;  1KFH A;  1KXI A;  2CTX A;  3EVS C;  2H5F A;  1FAS A;  2FD6 U;  5IMT D;  3LAQ U;  3KFD I;  4IYE A;  1ONJ A;  4RUD A;  4EY8 B;  1CRF A;  1BXP A;  1NEA A;  1COD A;  2JQP A;  2LCR A;  4OM5 A;  5IMY C;  3ERA A;  1FSC A;  1RL5 A;  1COE A;  1ZAD A;  4FAO C;  1CTX A;  3NH7 A;  1KS6 A;  5DU1 A;  1FSS B;  2BHI A;  1QM7 A;  1CCQ A;  2LA1 A;  1LX5 B;  2UX2 A;  1IDL A;  1NYU A;  1KC4 A;  2CCX A;  2VLW A;  2CRT A;  2I9B E;  1QKE A;  4P7U A;  1LXG A;  1IJC A;  4AEA A;  1IDI A;  1IK8 A;  1ERG A;  2H7Z A;  2MHY A;  1HC9 B;  2PJY C;  2H62 D;  1CB9 A;  3BT1 U;  2K3G A;  2QJB C;  3FEV A;  1G6M A;  3U74 U;  1KBT A;  1DRS A;  4XJJ A;  1KTZ B;  3NDS A;  1NOR A;  4BDT B;  1IKC A;  2UWR A;  1MR6 A;  1CDS A;  1QKD A;  1L4W A;  4BIK B;  1CDT A;  6EBX A;  2H8U A;  1TGX A;  4OM4 A;  1CHV S;  1TFS A;  2MFA A;  3U73 U;  3KFD E;  1B41 B;  1KU6 B;  2H64 B;  1S4Y A;  2MJY A;  1YWH A;  1M9Z A;  2GOO B;  2L03 A;  1IDG A;  1UG4 A;  1ABT A;  1XT3 A;  3EBX A;  1H0J A;  1TXB A;  1W6B A;  2MUP A;  2OFS A;  3HH7 A;  3QB4 B;  1ERA A;  2QC1 A;  5DO6 A;  1JGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...