4IYIA

The crystal structure of a secreted protein esxb (wild-type, c-term. his-tagged) from bacillus anthracis str. sterne
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
80
structure length
80
Chain Sequence
KITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIPILEGISTDLKRIADKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted protein EsxB
publication title The crystal structure of a secreted protein EsxB (wild-type, C-term. His-tagged) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
total genus 34
structure length 80
sequence length 80
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4iyiA00
4W4KA 4J42A 4J41A 4KXRA 4IYIA 2GTSA 4J7JA 4J7KA 3FX7A 2G38A 4J10A 4J11A 4W4LA 4IYHA
chains in the Genus database with same CATH superfamily
2RQ6A 2Q6AA 3VBBA 1OCCC 3BA8A 5FPOA 4PA3A 1OHHG 1W0JG 3L73H 3W7SA 5KMGA 1L8DA 1Q6HA 3H1IH 3A0HZ 4AQYO 3OMNB 3TJTA 1U96A 4ABMA 3HKDB 2H8PC 1FXHA 4YIOA 1BZKA 3P32A 1RFYA 3AG3C 1Q86W 3SJQC 4DR6B 4JI5O 4YJ3A 1AVMA 4TUYA 1MNGA 3SPHA 4DYLA 4YJ2A 1XMQB 2DN9A 4F6RA 5L3BA 1AB3A 1EN4A 5JQGA 2Q7HA 3UT5B 1BQ0A 2DYRB 3I55V 4ZBMA 1HNXO 2HJFC 1ZAUA 2UXDB 3G67A 3HKEB 3ZRVA 3CRRA 3ZHRA 4I9WA 3D8CA 4BW9A 2HG5C 2PGGA 1F4NA 1N33O 4LF7O 3H01A 2ZINA 1R3KC 3CXCU 2O57A 1GO3F 4R50A 1F51A 3CCSV 1Y6XA 4UCOA 2DW4A 4L87A 5KAFZ 5KHHA 4FLYA 2JEXA 2UXBO 2F4VB 3FB8C 5KHGA 2IH3C 4JI7O 1URFA 4JYCA 2QR4A 4U7OA 4LCUC 5JJEB 2X7RB 2QWQB 1PPJH 3DSQA 3F7VC 1H8HG 1TUEB 4LF8O 2IJIA 3HKCB 4UB8Z 3LSQA 1HNWO 3CRMA 1N32B 3WB2A 4K3AA 1FJGB 3OMIB 3OM3B 3DTUB 2WAMA 1N4CA 1K8AW 3JATA 1WB7A 2F43G 1XDCA 4DV5B 1JJ2U 5J2TA 5LMUB 1LUWA 2DYSC 3FD9A 4W4LA 5FNVA 1I08A 4FLWA 3BY6A 1FXKB 3MHSC 1GN4A 2Y0PA 2ARHA 3OUSA 4CBCA 1WPXA 2WLNA 4BIOA 3AG4C 1SRYA 4I50B 3RYCA 5IYDO 4ZKIA 3HKBB 2DJVA 1T5EA 4HAMA 4KFMA 4O4IB 4MW8A 1SA0A 1M93A 3AG1B 2N74A 1MSDA 1HR0B 4XDJA 4DUYO 5FLXN 3CS5A 4YIPA 5ITZA 2ZKOA 2IJJA 3K03A 4TQFA 4C7UA 4LF9O 3CHXA 3J81N 4FMTA 2KQXA 1EN6A 2AHZA 3G80A 4X20B 5H6QA 2VS0A 4X9QA 5BR8O 3U11A 4LF6O 2Q7EA 2NNUA 4I0XA 3QG5A 2RNBA 1ZWIC 3B40A 2E5LB 1COWG 4X62O 3OTFA 2CH7B 1QLEB 1Y76A 4NYKA 1K73W 3SR2C 1YCIA 1VQMV 2E3CA 2R72A 1Q43A 3SDLA 2VRZA 3L9DA 1VF7A 5IYZB 1XL4A 1S77D 2HVKC 3BABA 2LFSA 3CCEV 4NXMB 3ETGA 5IT9N 3HKEA 3N2KA 3X2QC 2EIJC 4UV8A 4MVOA 4CH6A 1S0VA 4TOIA 1JPXA 4QPKA 2BE3A 4PA9A 3T1HO 1TUBB 3MDSA 1Y66A 3ASOB 4K0KO 5CBGA 1YI2V 5CA0B 2PI5A 2XUMA 3T1YB 4LFAB 2LQTA 2OIGA 5BMVA 1KC8W 2QGNA 3C3SA 3UCSC 1M57C 1KBHA 4BWAA 4I4TA 5JH7A 4ICGA 1N0NA 4LC1A 4NXNO 3B09A 3L70H 2DQ3A 2UU9B 3CC7V 3AK3A 1BHAA 3G6EV 2OT5A 4O2AA 3OR7C 1AI5A 4DW1A 2ZR3A 1K4DC 5LMNO 3OEHG 3A2FA 2HLDG 3OGCC 3STLC 3OTOB 1IXMA 2KKWA 4HNAA 1EZVH 2R9IA 3N2GA 2IBZH 1B3QA 3G4SV 3CXHF 4KP4A 1PP9H 4JI3B 2QTOA 4PI0A 1OCZC 1UPGA 3IC9A 1K34A 1LUVA 1H38A 1SQGA 4DV4O 4I50A 4DO2A 1VQ4V 4BR6A 4DV7B 4CZZA 3VQXA 4X1IB 3AK1A 4FFBB 2PY5A 2B9ZA 3H1KH 2UXXA 3T4ZA 4FLUA 4GCZA 3ETDA 4WBNB 2QTSA 2LJ2A 4O4LB 4R8CA 4O4JB 3I56V 1OCOC 5C93A 2HVJC 1ENVA 2ITCC 3QNEA 2IU0A 5B5EZ 1BS3A 2OCCB 1KECA 4U7NA 1NVPB 1AR4A 2QE7G 3JD1A 1A32A 1IZ3A 3MAQA 3RYIB 1Q6IA 3ABUA 2F66C 4WFAV 2Y4UA 3IFXA 1N36O 2EULA 4JI0O 5L3CA 1X59A 1D5NA 5IE9A 3RYHB 2PYJA 2W0FC 3ZHVA 1UFIA 2EILC 1YHQV 1YVWA 1H2GA 5C8YA 2YIAA 4NVPA 4DR5O 2UUAO 3K9AA 4J10A 2JJ2G 2WLIB 5IYZA 2DE0X 4IT5A 2P06A 1W59A 3ZMTA 2QSAA 4AILC 1K4CC 4K8ZA 4PA4A 2ZM6O 4W4KA 1OCRC 1RSOA 3TCUA 1GMGA 2YXHA 1M56B 2ETNA 3CCQV 2C2AA 4D7TA 3IGAC 1AR5A 1PKXA 2CGNA 3A0RA 4UCTA 3LUTB 4EB6B 3D36A 1XNRO 5KUMA 2ZE5A 3A0BZ 2X6BA 1AROP 2W0XA 5IY5B 2Q68A 1SQBH 5HFMA 5LP6B 1KB9F 2ZDIA 4DV0O 1NI8A 1WP7A 3E83A 3ETQA 2JGUA 3CPWU 3K5NA 3ZBHA 2YICA 4DR3O 1JFFB 1SETA 3RVZA 1IX9A 2ZCEA 3K04A 3NXSA 1IXBA 4KUMA 3K0GA 2VWKA 1KQSU 1DF4A 5KMGB 1M4UA 5TISZ 4JV5B 1DK1A 3ML0A 3W7TA 4X1YA 2EINB 3FB7C 1PV0A 4JF3A 3CMEV 2ZT9B 4GX5A 4YJ3B 1JVMA 4N23A 4TUYB 2YC0A 4J7ZA 3ZRSA 1VQ7V 4YY3O 4YJ2B 2JRIA 1LR1A 4F6RB 2N04A 2A0LA 4J41A 2F95B 5JQGB 5FPRA 2EJ7A 4JAVA 2Q0OC 1VQ5V 1W0KG 5IWAB 4FLZA 2P22C 5DN6G 4QNHB 2P90A 1FD9A 2B1IA 3OD4A 4G28B 5EIBD 3AK2A 3K0DA 3RN4A 4LFBB 2EIKB 1NR1A 5B1NA 3PN1A 4EKWA 1ZX3A 2QKCA 1K5QA 3OEEG 2HKOA 3G71V 1FXKC 3D3IA 3RYHA 4UCSA 4EEQA 1SQVH 3N27A 1V55B 3OAAG 3ZHUA 2XAHA 4MTXA 4B3SB 4TV8A 2GBOA 3K79A 1P4RA 2QJ1A 4B3RB 1SQQH 4WFBV 4MVZA 2V4DA 4JI4B 3JATB 1VQOV 1QVGU 4UCUA 3CC4V 2ZXWB 4JI6B 4MTFA 1RPRA 4QJFB 5J2TB 4MTOA 1K7DA 4FK5C 5IDJA 1JOYA 2F1MA 3B8NA 1BSMA 5IJ0A 2EJRA 2P6JA 1IURA 3E8BA 1PNMA 1R3JC 3B4SA 3JD2A 1QLEC 1E1QG 1R6KA 1SQPH 3RYCB 3FAVA 2QWRB 4LNUB 5B3SB 4QE9A 1G8MA 3GWOA 1WP8A 1SF9A 4TT3G 1AJPA 1SA0B 2CGOA 2HR3A 1F4MA 2D3OW 3IJ4A 2OWOA 2BTQA 3K08A 5L3FA 1S76D 5ITZB 4DV1B 1ZL8A 2YI9A 3HR0A 3OE7G 4GX0A 5EBMC 1G1XB 4H33A 2VQFB 4I0XB 3ASNB 3CB2A 4JI8B 1AI4A 1WAZA 5IYBO 1VF5B 5L3EA 3ZCCA 2PZSA 3ZRWA 5K1XA 1Y76B 3U0ZA 3ZX6A 3AG7A 1S5LZ 1I94B 3E22A 4CS4A 4J9ZB 4DV6O 1NKDA 2IU3A 4LF7B 3C90A 2ZD9A 1YZBA 2QDOA 1O9GA 4IYIA 4N21A 5CN0A 2LW7A 3N2KB 3JCZA 5F2VO 3HB3B 4O4HB 3SPJA 5LA6A 4JI7B 3ICXA 5JVDA 4G27B 1XI1A 4CH5A 2YXLA 1J5EO 1JX9A 1NQTA 3LSSA 2MW2B 5BMVB 2R70A 2RN9A 1XMQO 4UVAA 2ITDC 4B3MB 1HNWB 1IBLO 3QO5A 4I4TB 5JH7B 2UXCB 3BAAA 3ZMVA 3E8HA 3KG2A 1G4YB 3CX5F 5IJ9A 4UFZA 5CA1A 4DXWA 2FTKA 4O2AB 2KG7A 5AG2A 3TXSA 2QKSA 4UUJC 2CTRA 4LF5B 3G6BA 4XBFA 3E89A 1I0HA 1YSCA 2M6YA 2Q5ZA 4HNAB 3N2GB 4CC5A 2OCCC 2UXNA 2B1GA 3Q4HA 1R6NA 3LDEA 2JS5A 4JPRA 1GM7A 2YXYA 4GYCB 2P4VA 3ABKC 2MK3A 3ZMUA 5B1AB 3BCCH 2DOSA 2GDSA 4DUYB 4H37A 2HP8A 2QM7A 2Q9LA 2X6AA 5E79Z 1GM9A 4MVQA 5KHKA 4LNUA 4GKJB 3THOA 4P9OA 5BXZA 1FJGO 4LR3A 1YF2A 1QQCA 2YEVA 4DR2B 4LF6B 4P9PA 1XUQA 5JJJB 5EC1C 1IBKB 5CBHA 1F23A 4DV5O 1HDJA 4QIWF 4MVMA 1Y74A 4X62B 4DW0A 4NTXA 3UM7A 3OW2U 5KLVH 5B1OA 2IJHA 3ZEDA 1M56C 4J42A 2Q69A 1DGSA 1SERA 2UUCB 4R7CA 1VQ6V 2JIZG 4RQEA 3WG7B 5LP6C 2XOKG 3BFRA 5J2UA 1HR0O 2YI8A 3DXRA 5C8YB 2JDIG 4F6EA 2LFRA 1P84F 2XASA 1TGOA 3DC5A 3SYCA 3TETA 1BE3H 4GKKO 1NZ6A 3KCYA 2RCVA 4K0KB 3TXQA 1FXVA 4FM2A 4DR7B 2PI4A 3S3XA 2QA4V 2UUBO 1SC5B 2E5LO 1CPYA 1RSOB 1DTOA 3ZN1A 4JI2O 4KHPB 1YTFD 4O4HA 4H44B 1U97A 5CB4A 4ZIBA 5GTHZ 4LF4O 2QKAA 5LYJA 1B04A 1IBMO 5KX5A 2Q4PA 3K5OA 3HPLC 2M7WA 2EINC 1K97A 2RJZA 2A3QA 3RGBA 3F7YC 4B7KA 3ETEA 2KSDA 2IW5A 3ZHTA 1WNSA 4NXMO 2VQEO 1X4TA 4PELA 1S3JA 1XMOB 5EBWC 4EFBA 5JCOA 3EHBB 1XL6A 1Y67A 5CBFA 1NH2D 2WLLA 2GTAA 1D2DA 3P3NA 4UV9A 1NTZH 3T1YO 2ZE8A 2WLJA 4LFCO 4RWUA 4LFAO 1K92A 3CCMV 1IDSA 1GN6A 1FFTB 1B06A 4JAUA 3VQYA 1L1FA 2QEXV 1PNLA 2ZE7A 1THZA 3K3WA 1XEQA 3RFRA 2EIKC 3ZIAG 4X1YB 4FLVA 4GX1A 3ABMB 5BZBA 2UU9O 2YIBD 3FKSG 4DUZB 1EBOA 2Z5UA 2N05A 2OTLV 5KUKA 5L3GA 3PJSK 5EYPA 1M9NA 2Y69B 1V55C 1WLEA 1JA8A 1VQLV 3OTOO 2A9HA 2RMKB 4MVUA 1Q7YW 1SQXH 3QO7A 2KB1A 1TA8A 2EZOA 3JASA 1H2LA 3ZMSA 3JALA 1HWYA 2P4KA 4JI3O 3H1HH 4TSFG 3UO2A 4YHHO 3SYOA 2PYLA 3ZMZA 3RYFA 1QU7A 2Q73A 2BOBC 2ZXWC 1GN3A 1MA1A 5EZYA 4DR1B 3KKYA 2DWDC 3CYOA 3JARA 1UJWB 2F23A 2UUAB 4IHJA 2Z3YA 1ZLZA 2V1DA 4DV7O 4LH6A 2XTAA 2E76B 1RP3B 4NTWA 4B3TB 2G38A 5KA5A 4TV8B 1VIBA 1HNZB 3JSLA 1EZJA 1N34B 4I55A 5B3SC 4FM0A 3AG2B 3K9SA 1YTFB 5LOVA 3E8FA 4JYAB 4CS3A 3B2EE 1XHZA 3RWRD 3ABLB 1PM9A 4RAIA 1HW7A 1ORQC 5H9CA 1GAXA 2K9PA 4MTGA 1YEWA 4B7EA 2ZNJA 4GUNA 3ABTA 2A79B 3CWBH 2WA4A 1VF6A 3ASNC 3LNMB 1MSWD 4R6ZA 4B08A 1Q81W 5IJ0B 1NBMG 2WA3A 4X65B 1NTKH 3FAVB 1NH2B 4QPJA 1PL0A 3SYPA 3K5LA 5KHJA 2XNDG 5EIBC 4PD4F 3FB5C 2DYRC 2BTQB 2HJDA 4OPAA 2L6LA 3TGUH 1WJZA 3MHHC 1ZL8B 3BPZA 1XREA 1SZXA 1S72V 2R9RB 1YDXA 4DK0A 4BIZA 4CC6A 4K35A 3B8MA 3J80N 4PHZA 4FPPA 2EIMB 5LGTA 3EFFK 1GN2A 1VP7A 4IIJA 1K33A 3VOUA 4DV3O 2ZE6A 2WSSG 5DEDA 4YY3B 4JTAB 3JCUZ 1Y4MA 3LDCA 4X64B 2LGWA 2DQ0A 5H2FZ 3CD6V 3ZRWB 3K5MA 1S5JA 4DR4B 1L0NH 1Z2GA 1I7FA 4BAYA 3SPCA 2EZPA 3E22B 4UCVA 2FKXA 4ZOLA 2WLMA 3FFQA 3E86A 4QGPA 1KKCA 4JYYA 2LW1A 3JAWA 4P2ZA 4JI1B 2HHHB 1K9MW 3RT3C 1ZTEA 1MOFA 2ZQMA 3MD0A 2GSMB 4JV5O 3TK1A 4TWKA 5LA6B 4LP8A 3CMAV 3CSXA 5JVDB 2NLJC 3H1LH 4PDLA 2V7QG 3UO3A 4OX9B 3P30A 4DRXB 2XHBA 1JCHA 2RDCA 1R1BA 1N0JA 1H2MA 5E1AC 1XNQO 5EC2C 5B1AC 5A2QN 4FFKA 5IWAO 5LHIA 1YJWV 5B1BB 1QCEA 4XDLA 1VQPV 4WF9V 4UVBA 1LNQA 2B5UA 5IJ9B 2CTQA 1JQ0A 5CA1B 3AG1C 4I9QA 4YXWG 4J7KA 2KG7B 2CAZC 3CCJV 2Y4TA 4LFBO 1VEWA 1EN5A 1XQ8A 4WFHA 1V54B 2E75B 4RUFA 3W7WA 3Q4HB 3EXAA 2P5OA 1AJQA 3W7XA 4B3SO 4DV2B 1PL4A 4X1KB 2QWOB 2ZR2A 4JZGA 4LH7A 3K06A 4LBEC 4X66O 4Z1MG 2YEVB 1MMMA 4JI4O 4PI2A 3JAMN 2ODMA 3OR6C 3KZIZ 2XAQA 4CS2A 5LGNA 4FM1A 3JD3A 3F5WC 4FZ1A 4X88A 1H2NA 4AQYB 1Q90D 4D7SA 1KU9A 1Y74B 4JASA 3L74H 5H6RA 2YS8A 1JR9A 1Q3EA 2YIBA 5D5PA 4JI5B 3CCVV 4PA7A 3FX7A 1QBZA 1CXZB 3ASOC 5LBQA 4KL1A 4X8AA 3JAKA 5LL6Y 3D36C 1OCRB 3E35A 2DMXA 1PNKA 3FYIB 4JAAA 2FMLA 2QM8A 2JVDA 1HNXB 1XILA 2GHYA 4GX2A 1L0LH 4Q20A 3JSNA 3CEIA 4FLXA 2ZDIC 5J2UB 1FKAO 4NKGB 1XOUA 3DXRB 1B6QA 3BRCA 2CUGA 4DV1O 1N33B 3EVKA 4H0LB 1HP8A 4CH4A 3L72H 1P49A 3SJBC 2VQFO 1J5EB 2CTPA 1K3EA 4JI8O 2UXBB 1GK9A 4UVCA 5GONA 5LXTA 2Z0AA 4FVMA 2Q0AA 1IBLB 2PF4E 5CB4B 4U3JA 3LNNA 4JZ2A 4HBNA 4DR6O 2WWWA 4L8JA 3JD4A 2W6IG 5KA6A 1I94O 5LYJB 1YIJV 4DRXA 5KX5B 5EBLC 1KMIZ 4LF8B 1R73A 3ABMC 3E8GA 1SS3A 4J7JA 2GUZA 4RQFA 3VQWA 2LGQA 2QWNB 3JYCA 2UXDO 1WB8A 2H3OA 2Y69C 4J9YB 3L71H 4MS2A 3ZN0A 3ZRXA 4UXNA 5GW7A 1R6TA 2DWEC 4Q6GA 3SYAA 3A8TA 4WCEV 4GT1A 1KP2A 2WLLB 2Q67A 1ZSPA 1ZUQA 2HFEC 4HZ3A 3SGIA 1W2BU 4PV1B 1Q8IA 3OUFA 1N8RW 1AP6A 4TV9B 2F4VO 4ZI7A 1R3IC 4HYOA 3QO8A 4B3MO 2AZ0A 3M99B 4GZRB 2H94A 2BOCC 4J80A 1VQ8V 4E2LA 1AI6A 4IYHA 2D2CB 2BSKA 4I7ZB 2UXCO 2CDYA 5JWPA 2A7WA 5CMUA 4X1KA 5D5QA 1EM1A 1GKFA 4DK1A 1N32O 4LWSA 5KHIA 5EYPB 2QM4A 4NR1A 1OV9A 1FAFA 3M7MX 4LF9B 2YSUB 1AILA 1I5YA 1FYJA 2ADQB 3CJHB 4ZHQB 1SQFA 4PDRA 2K1EA 4O2BB 2E74B 4WFFA 5LHGA 5BR8B 4LF5O 1V9PA 1M90W 3AG2C 3OMAB 1BHBA 2PUSA 3T1CA 5LMUO 2CE4A 1BGYH 3JASB 2A06H 3ABLC 1WA8A 5DECA 2IM9A 3JALB 3IC7A 5JJNB 2F93B 2JGDA 3H1JH 4WFEA 2VWJA 1NS1A 3RYFB 2GTSA 1NT2B 1TVKA 5EZYB 3JARB 3LDDA 4I5SA 1NR7A 1YITV 1RM1B 4IHJB 3IAYA 4GKJO 3D3QA 3ZHQA 4GKKB 2ZIMA 1RPOA 3SPGA 4MT8A 4DR2O 5IY5C 3CRAA 3ZHSA 2OCHA 3I5DA 4QE7A 1IBKO 1DLBA 1K5SA 2UUBB 4I55B 1F7YA 3HKDA 4JI2B 3FB6C 3CCLV 1KKDA 1Z5WA 3T1HB 5LOVB 1OJHA 1CEZA 1NVPD 2Q8VA 5LGUA 4LF4B 3R66A 1AR1B 4BW5A 2UUCO 1S5HC 4PDMA 3ZS8C 1IBMB 2L35A 1MZEA 1JMKC 1NU1H 5H5NA 1VQ9V 3UT5A 4GLXA 3K58A 4NXNB 2PTMA 4AI8A 2EIMC 4UB6Z 2VQEB 1QR8A 4XDKA 1OCCB 3APOA 1AI7A 3CCRV 1US6A 3M8AA 1E79G 1I5XA 2XAJA 1Q6UA 5LMNB 2IJKA 2QWPB 3S3WA 3UQ8A 5GTIZ 4DR7O 4FIPC 1Q82W 2ILMA 1QNMA 4LFCB 4D6TH 4Z1VA 3K59A 3AG3B 4MW3A 2AZ2A 1QVFU 4KHPO 3APQA 2JEUA 1FFXB 2XAFA 3QTCA 2ZIOA 2X6CA 1G6UA 5FL7G 4Z2WA 5KAIZ 2ZNIA 4JYBA 4TV9A 5B66Z 3O65A 3AEIA 4DV4B 3HKCA 2YUAA 4IIJB 3C3TA 1WPBA 2Q7GA 2X0LA 4K8XA 4OGQB 4IGGA 3SPIA 1EFRG 1XMOO 3BA9A 4UCRA 3LSUA 1YJNV 3WFVA 2FL4A 3CJHA 4ZHQA 5B1BC 4O2BA 2Y0IA 4ZOLB 1FXKA 1AP5A 2ADPA 4OPHA 4YHHB 3SJCC 3JAWB 1P7GA 3F5TA 4FLTA 4FJCC 1BCCH 3HKBA 5HFLA 4AHCA 1N36B 4JI0B 1GH6A 4IL6Z 4O4IA 1V54C 2Y48A 4DUZO 4PA6A 5A9GA 1GM8A 4DR5B 4JGSA 2JJ1G 3H9VA 3CRCA 4X20A 2YIDA 3L75H 5DM6V 5BY1A 2DYSB 3GVMA 1DF5A 2ZM6B 3JD0A 3WB0A 2GV9A 3ABKB 1VMGA 2LP7A 2WLKA 2CH7A 1P7BA 3B77A 1BL8A 3AG4B 1TAEA 1MZFA 4DR1O 4PJ0Z 2IH1C 1MG1A 3FYEB 1XNRB 3CRQA 1H2SB 1VQKV 2EX3A 2W6JG 1XBLA 4F4LA 5CA3A 4DV0B 2JS3A 2CTWA 1KP3A 1Z5VA 4TQDA 4BIUA 4B3TO 2P67A 2AXTZ 1HNZO 1SKVA 1N34O 4DR3B 3K57A 1TUBA 3U10A 4JYAO 2FYUH 1NJIW 5IYCO 1GTOA 5CA0A 5LHHA 3WB1A 4MVSA 3CE2A 3RVYA 1R3LC 2AGAA 1FFXA 4DV3B 3ZJZA 1IVSA 2BCCH 1PD3A 1H8EG 3OT7A 1FPOA 3QF7A 4P30A 4X65O 1OZ0A 4JTCB 3X2QB 1BT8A 2EIJB 3W7UA 3JAKB 1KD1W 1D5AA 3DC6A 1YXBA 1M1KW 3GWKC 1FS0G 2R9AA 3QVNA 2NR5A 1M5IA 4RUEA 4U3FH 3SJAC 1MABG 4A5UB 1CP9A 1M57B 4MVRA 5JCOC 3OFNG 2EBOA 3O9OA 2NN4A 3OGIB 4WFGA 3NR7A 4JTDB 5GONB 5LXTB 1ROPA 3KCXA 1O9HA 4X1IA 4FFBA 3UKMA 4NB5A 4X64O 4U3JB 4H13B 1XNQB 1WN7A 5L3DA 1BQZA 4WBNA 4DR4O 4O4LA 4O4JA 5EK0A 1YJ9V 2BTOA 1JJOA 1KUQA 2HEPA 3CC2V 2GUZB 1J95A 2AW9A 3CP1A 4ASUG 1GRJA 3R65A 4NTYA 5K1PA 3J7AU 4JI1O 2HHHO 3STZC 2OTJV 3RW0A 4PDVA 3RYIA 1OCZB 3BVOA 3WU2Z 4J11A 2FB5A 2LO1A 1VARA 4KXRA 1E1RG 3T4DA 2ATKC 4OX9O 1Q5OA 2XT9A 2WLIA 4ZI7B 1VQNV 3E2EA 1XHXA 4X66B 2WLHA 3BEHA 1QR9A 2BSKB 1OCOB 3CCUV 1RM1C 3DGEA 1SZTA 2AHYA 3GB7C 3T2MA 1KYOF 3RBZA 2P7TC 1QHTA 3WG7C 4LWSB 4B3RO 2OIEA 1H2KA 5FNVB 4EB6A 4G2KA 1AJNA 3VQVA 2CK3G 1SESA 5LP6A 2OYQA 4JI6O 2EILB 2JK5C 4EFEA 4E4EA 1WA8B 4FZ0A 1BMFG 4OXSA 5J9PC 2YDEA 2JGDB 4MSWC 4CH3A 3P3PA 4DV2O 1TVKB 1JFFA 3BHPA 1QLNA 2WPDG 2XAGA 1NTMH 1VF6C 4DV6B 3SYQA 4X89A 4RO2A
chains in the Genus database with same CATH topology
4W4KA 4J42A 4J41A 4KXRA 4IYIA 2GTSA 4J7JA 4J7KA 3FX7A 2G38A 4J10A 4J11A 4W4LA 4IYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4K A;  4J42 A;  4J41 A;  4KXR A;  4IYI A;  2GTS A;  4J7J A;  4J7K A;  3FX7 A;  2G38 A;  4J10 A;  4J11 A;  4W4L A;  4IYH A; 
#chains in the Genus database with same CATH topology
 2RQ6 A;  2Q6A A;  3VBB A;  1OCC C;  3BA8 A;  5FPO A;  4PA3 A;  1OHH G;  1W0J G;  3L73 H;  3W7S A;  5KMG A;  1L8D A;  1Q6H A;  3H1I H;  3A0H Z;  4AQY O;  3OMN B;  3TJT A;  1U96 A;  4ABM A;  3HKD B;  2H8P C;  1FXH A;  4YIO A;  1BZK A;  3P32 A;  1RFY A;  3AG3 C;  1Q86 W;  3SJQ C;  4DR6 B;  4JI5 O;  4YJ3 A;  1AVM A;  4TUY A;  1MNG A;  3SPH A;  4DYL A;  4YJ2 A;  1XMQ B;  2DN9 A;  4F6R A;  5L3B A;  1AB3 A;  1EN4 A;  5JQG A;  2Q7H A;  3UT5 B;  1BQ0 A;  2DYR B;  3I55 V;  4ZBM A;  1HNX O;  2HJF C;  1ZAU A;  2UXD B;  3G67 A;  3HKE B;  3ZRV A;  3CRR A;  3ZHR A;  4I9W A;  3D8C A;  4BW9 A;  2HG5 C;  2PGG A;  1F4N A;  1N33 O;  4LF7 O;  3H01 A;  2ZIN A;  1R3K C;  3CXC U;  2O57 A;  1GO3 F;  4R50 A;  1F51 A;  3CCS V;  1Y6X A;  4UCO A;  2DW4 A;  4L87 A;  5KAF Z;  5KHH A;  4FLY A;  2JEX A;  2UXB O;  2F4V B;  3FB8 C;  5KHG A;  2IH3 C;  4JI7 O;  1URF A;  4JYC A;  2QR4 A;  4U7O A;  4LCU C;  5JJE B;  2X7R B;  2QWQ B;  1PPJ H;  3DSQ A;  3F7V C;  1H8H G;  1TUE B;  4LF8 O;  2IJI A;  3HKC B;  4UB8 Z;  3LSQ A;  1HNW O;  3CRM A;  1N32 B;  3WB2 A;  4K3A A;  1FJG B;  3OMI B;  3OM3 B;  3DTU B;  2WAM A;  1N4C A;  1K8A W;  3JAT A;  1WB7 A;  2F43 G;  1XDC A;  4DV5 B;  1JJ2 U;  5J2T A;  5LMU B;  1LUW A;  2DYS C;  3FD9 A;  4W4L A;  5FNV A;  1I08 A;  4FLW A;  3BY6 A;  1FXK B;  3MHS C;  1GN4 A;  2Y0P A;  2ARH A;  3OUS A;  4CBC A;  1WPX A;  2WLN A;  4BIO A;  3AG4 C;  1SRY A;  4I50 B;  3RYC A;  5IYD O;  4ZKI A;  3HKB B;  2DJV A;  1T5E A;  4HAM A;  4KFM A;  4O4I B;  4MW8 A;  1SA0 A;  1M93 A;  3AG1 B;  2N74 A;  1MSD A;  1HR0 B;  4XDJ A;  4DUY O;  5FLX N;  3CS5 A;  4YIP A;  5ITZ A;  2ZKO A;  2IJJ A;  3K03 A;  4TQF A;  4C7U A;  4LF9 O;  3CHX A;  3J81 N;  4FMT A;  2KQX A;  1EN6 A;  2AHZ A;  3G80 A;  4X20 B;  5H6Q A;  2VS0 A;  4X9Q A;  5BR8 O;  3U11 A;  4LF6 O;  2Q7E A;  2NNU A;  4I0X A;  3QG5 A;  2RNB A;  1ZWI C;  3B40 A;  2E5L B;  1COW G;  4X62 O;  3OTF A;  2CH7 B;  1QLE B;  1Y76 A;  4NYK A;  1K73 W;  3SR2 C;  1YCI A;  1VQM V;  2E3C A;  2R72 A;  1Q43 A;  3SDL A;  2VRZ A;  3L9D A;  1VF7 A;  5IYZ B;  1XL4 A;  1S77 D;  2HVK C;  3BAB A;  2LFS A;  3CCE V;  4NXM B;  3ETG A;  5IT9 N;  3HKE A;  3N2K A;  3X2Q C;  2EIJ C;  4UV8 A;  4MVO A;  4CH6 A;  1S0V A;  4TOI A;  1JPX A;  4QPK A;  2BE3 A;  4PA9 A;  3T1H O;  1TUB B;  3MDS A;  1Y66 A;  3ASO B;  4K0K O;  5CBG A;  1YI2 V;  5CA0 B;  2PI5 A;  2XUM A;  3T1Y B;  4LFA B;  2LQT A;  2OIG A;  5BMV A;  1KC8 W;  2QGN A;  3C3S A;  3UCS C;  1M57 C;  1KBH A;  4BWA A;  4I4T A;  5JH7 A;  4ICG A;  1N0N A;  4LC1 A;  4NXN O;  3B09 A;  3L70 H;  2DQ3 A;  2UU9 B;  3CC7 V;  3AK3 A;  1BHA A;  3G6E V;  2OT5 A;  4O2A A;  3OR7 C;  1AI5 A;  4DW1 A;  2ZR3 A;  1K4D C;  5LMN O;  3OEH G;  3A2F A;  2HLD G;  3OGC C;  3STL C;  3OTO B;  1IXM A;  2KKW A;  4HNA A;  1EZV H;  2R9I A;  3N2G A;  2IBZ H;  1B3Q A;  3G4S V;  3CXH F;  4KP4 A;  1PP9 H;  4JI3 B;  2QTO A;  4PI0 A;  1OCZ C;  1UPG A;  3IC9 A;  1K34 A;  1LUV A;  1H38 A;  1SQG A;  4DV4 O;  4I50 A;  4DO2 A;  1VQ4 V;  4BR6 A;  4DV7 B;  4CZZ A;  3VQX A;  4X1I B;  3AK1 A;  4FFB B;  2PY5 A;  2B9Z A;  3H1K H;  2UXX A;  3T4Z A;  4FLU A;  4GCZ A;  3ETD A;  4WBN B;  2QTS A;  2LJ2 A;  4O4L B;  4R8C A;  4O4J B;  3I56 V;  1OCO C;  5C93 A;  2HVJ C;  1ENV A;  2ITC C;  3QNE A;  2IU0 A;  5B5E Z;  1BS3 A;  2OCC B;  1KEC A;  4U7N A;  1NVP B;  1AR4 A;  2QE7 G;  3JD1 A;  1A32 A;  1IZ3 A;  3MAQ A;  3RYI B;  1Q6I A;  3ABU A;  2F66 C;  4WFA V;  2Y4U A;  3IFX A;  1N36 O;  2EUL A;  4JI0 O;  5L3C A;  1X59 A;  1D5N A;  5IE9 A;  3RYH B;  2PYJ A;  2W0F C;  3ZHV A;  1UFI A;  2EIL C;  1YHQ V;  1YVW A;  1H2G A;  5C8Y A;  2YIA A;  4NVP A;  4DR5 O;  2UUA O;  3K9A A;  4J10 A;  2JJ2 G;  2WLI B;  5IYZ A;  2DE0 X;  4IT5 A;  2P06 A;  1W59 A;  3ZMT A;  2QSA A;  4AIL C;  1K4C C;  4K8Z A;  4PA4 A;  2ZM6 O;  4W4K A;  1OCR C;  1RSO A;  3TCU A;  1GMG A;  2YXH A;  1M56 B;  2ETN A;  3CCQ V;  2C2A A;  4D7T A;  3IGA C;  1AR5 A;  1PKX A;  2CGN A;  3A0R A;  4UCT A;  3LUT B;  4EB6 B;  3D36 A;  1XNR O;  5KUM A;  2ZE5 A;  3A0B Z;  2X6B A;  1ARO P;  2W0X A;  5IY5 B;  2Q68 A;  1SQB H;  5HFM A;  5LP6 B;  1KB9 F;  2ZDI A;  4DV0 O;  1NI8 A;  1WP7 A;  3E83 A;  3ETQ A;  2JGU A;  3CPW U;  3K5N A;  3ZBH A;  2YIC A;  4DR3 O;  1JFF B;  1SET A;  3RVZ A;  1IX9 A;  2ZCE A;  3K04 A;  3NXS A;  1IXB A;  4KUM A;  3K0G A;  2VWK A;  1KQS U;  1DF4 A;  5KMG B;  1M4U A;  5TIS Z;  4JV5 B;  1DK1 A;  3ML0 A;  3W7T A;  4X1Y A;  2EIN B;  3FB7 C;  1PV0 A;  4JF3 A;  3CME V;  2ZT9 B;  4GX5 A;  4YJ3 B;  1JVM A;  4N23 A;  4TUY B;  2YC0 A;  4J7Z A;  3ZRS A;  1VQ7 V;  4YY3 O;  4YJ2 B;  2JRI A;  1LR1 A;  4F6R B;  2N04 A;  2A0L A;  4J41 A;  2F95 B;  5JQG B;  5FPR A;  2EJ7 A;  4JAV A;  2Q0O C;  1VQ5 V;  1W0K G;  5IWA B;  4FLZ A;  2P22 C;  5DN6 G;  4QNH B;  2P90 A;  1FD9 A;  2B1I A;  3OD4 A;  4G28 B;  5EIB D;  3AK2 A;  3K0D A;  3RN4 A;  4LFB B;  2EIK B;  1NR1 A;  5B1N A;  3PN1 A;  4EKW A;  1ZX3 A;  2QKC A;  1K5Q A;  3OEE G;  2HKO A;  3G71 V;  1FXK C;  3D3I A;  3RYH A;  4UCS A;  4EEQ A;  1SQV H;  3N27 A;  1V55 B;  3OAA G;  3ZHU A;  2XAH A;  4MTX A;  4B3S B;  4TV8 A;  2GBO A;  3K79 A;  1P4R A;  2QJ1 A;  4B3R B;  1SQQ H;  4WFB V;  4MVZ A;  2V4D A;  4JI4 B;  3JAT B;  1VQO V;  1QVG U;  4UCU A;  3CC4 V;  2ZXW B;  4JI6 B;  4MTF A;  1RPR A;  4QJF B;  5J2T B;  4MTO A;  1K7D A;  4FK5 C;  5IDJ A;  1JOY A;  2F1M A;  3B8N A;  1BSM A;  5IJ0 A;  2EJR A;  2P6J A;  1IUR A;  3E8B A;  1PNM A;  1R3J C;  3B4S A;  3JD2 A;  1QLE C;  1E1Q G;  1R6K A;  1SQP H;  3RYC B;  3FAV A;  2QWR B;  4LNU B;  5B3S B;  4QE9 A;  1G8M A;  3GWO A;  1WP8 A;  1SF9 A;  4TT3 G;  1AJP A;  1SA0 B;  2CGO A;  2HR3 A;  1F4M A;  2D3O W;  3IJ4 A;  2OWO A;  2BTQ A;  3K08 A;  5L3F A;  1S76 D;  5ITZ B;  4DV1 B;  1ZL8 A;  2YI9 A;  3HR0 A;  3OE7 G;  4GX0 A;  5EBM C;  1G1X B;  4H33 A;  2VQF B;  4I0X B;  3ASN B;  3CB2 A;  4JI8 B;  1AI4 A;  1WAZ A;  5IYB O;  1VF5 B;  5L3E A;  3ZCC A;  2PZS A;  3ZRW A;  5K1X A;  1Y76 B;  3U0Z A;  3ZX6 A;  3AG7 A;  1S5L Z;  1I94 B;  3E22 A;  4CS4 A;  4J9Z B;  4DV6 O;  1NKD A;  2IU3 A;  4LF7 B;  3C90 A;  2ZD9 A;  1YZB A;  2QDO A;  1O9G A;  4IYI A;  4N21 A;  5CN0 A;  2LW7 A;  3N2K B;  3JCZ A;  5F2V O;  3HB3 B;  4O4H B;  3SPJ A;  5LA6 A;  4JI7 B;  3ICX A;  5JVD A;  4G27 B;  1XI1 A;  4CH5 A;  2YXL A;  1J5E O;  1JX9 A;  1NQT A;  3LSS A;  2MW2 B;  5BMV B;  2R70 A;  2RN9 A;  1XMQ O;  4UVA A;  2ITD C;  4B3M B;  1HNW B;  1IBL O;  3QO5 A;  4I4T B;  5JH7 B;  2UXC B;  3BAA A;  3ZMV A;  3E8H A;  3KG2 A;  1G4Y B;  3CX5 F;  5IJ9 A;  4UFZ A;  5CA1 A;  4DXW A;  2FTK A;  4O2A B;  2KG7 A;  5AG2 A;  3TXS A;  2QKS A;  4UUJ C;  2CTR A;  4LF5 B;  3G6B A;  4XBF A;  3E89 A;  1I0H A;  1YSC A;  2M6Y A;  2Q5Z A;  4HNA B;  3N2G B;  4CC5 A;  2OCC C;  2UXN A;  2B1G A;  3Q4H A;  1R6N A;  3LDE A;  2JS5 A;  4JPR A;  1GM7 A;  2YXY A;  4GYC B;  2P4V A;  3ABK C;  2MK3 A;  3ZMU A;  5B1A B;  3BCC H;  2DOS A;  2GDS A;  4DUY B;  4H37 A;  2HP8 A;  2QM7 A;  2Q9L A;  2X6A A;  5E79 Z;  1GM9 A;  4MVQ A;  5KHK A;  4LNU A;  4GKJ B;  3THO A;  4P9O A;  5BXZ A;  1FJG O;  4LR3 A;  1YF2 A;  1QQC A;  2YEV A;  4DR2 B;  4LF6 B;  4P9P A;  1XUQ A;  5JJJ B;  5EC1 C;  1IBK B;  5CBH A;  1F23 A;  4DV5 O;  1HDJ A;  4QIW F;  4MVM A;  1Y74 A;  4X62 B;  4DW0 A;  4NTX A;  3UM7 A;  3OW2 U;  5KLV H;  5B1O A;  2IJH A;  3ZED A;  1M56 C;  4J42 A;  2Q69 A;  1DGS A;  1SER A;  2UUC B;  4R7C A;  1VQ6 V;  2JIZ G;  4RQE A;  3WG7 B;  5LP6 C;  2XOK G;  3BFR A;  5J2U A;  1HR0 O;  2YI8 A;  3DXR A;  5C8Y B;  2JDI G;  4F6E A;  2LFR A;  1P84 F;  2XAS A;  1TGO A;  3DC5 A;  3SYC A;  3TET A;  1BE3 H;  4GKK O;  1NZ6 A;  3KCY A;  2RCV A;  4K0K B;  3TXQ A;  1FXV A;  4FM2 A;  4DR7 B;  2PI4 A;  3S3X A;  2QA4 V;  2UUB O;  1SC5 B;  2E5L O;  1CPY A;  1RSO B;  1DTO A;  3ZN1 A;  4JI2 O;  4KHP B;  1YTF D;  4O4H A;  4H44 B;  1U97 A;  5CB4 A;  4ZIB A;  5GTH Z;  4LF4 O;  2QKA A;  5LYJ A;  1B04 A;  1IBM O;  5KX5 A;  2Q4P A;  3K5O A;  3HPL C;  2M7W A;  2EIN C;  1K97 A;  2RJZ A;  2A3Q A;  3RGB A;  3F7Y C;  4B7K A;  3ETE A;  2KSD A;  2IW5 A;  3ZHT A;  1WNS A;  4NXM O;  2VQE O;  1X4T A;  4PEL A;  1S3J A;  1XMO B;  5EBW C;  4EFB A;  5JCO A;  3EHB B;  1XL6 A;  1Y67 A;  5CBF A;  1NH2 D;  2WLL A;  2GTA A;  1D2D A;  3P3N A;  4UV9 A;  1NTZ H;  3T1Y O;  2ZE8 A;  2WLJ A;  4LFC O;  4RWU A;  4LFA O;  1K92 A;  3CCM V;  1IDS A;  1GN6 A;  1FFT B;  1B06 A;  4JAU A;  3VQY A;  1L1F A;  2QEX V;  1PNL A;  2ZE7 A;  1THZ A;  3K3W A;  1XEQ A;  3RFR A;  2EIK C;  3ZIA G;  4X1Y B;  4FLV A;  4GX1 A;  3ABM B;  5BZB A;  2UU9 O;  2YIB D;  3FKS G;  4DUZ B;  1EBO A;  2Z5U A;  2N05 A;  2OTL V;  5KUK A;  5L3G A;  3PJS K;  5EYP A;  1M9N A;  2Y69 B;  1V55 C;  1WLE A;  1JA8 A;  1VQL V;  3OTO O;  2A9H A;  2RMK B;  4MVU A;  1Q7Y W;  1SQX H;  3QO7 A;  2KB1 A;  1TA8 A;  2EZO A;  3JAS A;  1H2L A;  3ZMS A;  3JAL A;  1HWY A;  2P4K A;  4JI3 O;  3H1H H;  4TSF G;  3UO2 A;  4YHH O;  3SYO A;  2PYL A;  3ZMZ A;  3RYF A;  1QU7 A;  2Q73 A;  2BOB C;  2ZXW C;  1GN3 A;  1MA1 A;  5EZY A;  4DR1 B;  3KKY A;  2DWD C;  3CYO A;  3JAR A;  1UJW B;  2F23 A;  2UUA B;  4IHJ A;  2Z3Y A;  1ZLZ A;  2V1D A;  4DV7 O;  4LH6 A;  2XTA A;  2E76 B;  1RP3 B;  4NTW A;  4B3T B;  2G38 A;  5KA5 A;  4TV8 B;  1VIB A;  1HNZ B;  3JSL A;  1EZJ A;  1N34 B;  4I55 A;  5B3S C;  4FM0 A;  3AG2 B;  3K9S A;  1YTF B;  5LOV A;  3E8F A;  4JYA B;  4CS3 A;  3B2E E;  1XHZ A;  3RWR D;  3ABL B;  1PM9 A;  4RAI A;  1HW7 A;  1ORQ C;  5H9C A;  1GAX A;  2K9P A;  4MTG A;  1YEW A;  4B7E A;  2ZNJ A;  4GUN A;  3ABT A;  2A79 B;  3CWB H;  2WA4 A;  1VF6 A;  3ASN C;  3LNM B;  1MSW D;  4R6Z A;  4B08 A;  1Q81 W;  5IJ0 B;  1NBM G;  2WA3 A;  4X65 B;  1NTK H;  3FAV B;  1NH2 B;  4QPJ A;  1PL0 A;  3SYP A;  3K5L A;  5KHJ A;  2XND G;  5EIB C;  4PD4 F;  3FB5 C;  2DYR C;  2BTQ B;  2HJD A;  4OPA A;  2L6L A;  3TGU H;  1WJZ A;  3MHH C;  1ZL8 B;  3BPZ A;  1XRE A;  1SZX A;  1S72 V;  2R9R B;  1YDX A;  4DK0 A;  4BIZ A;  4CC6 A;  4K35 A;  3B8M A;  3J80 N;  4PHZ A;  4FPP A;  2EIM B;  5LGT A;  3EFF K;  1GN2 A;  1VP7 A;  4IIJ A;  1K33 A;  3VOU A;  4DV3 O;  2ZE6 A;  2WSS G;  5DED A;  4YY3 B;  4JTA B;  3JCU Z;  1Y4M A;  3LDC A;  4X64 B;  2LGW A;  2DQ0 A;  5H2F Z;  3CD6 V;  3ZRW B;  3K5M A;  1S5J A;  4DR4 B;  1L0N H;  1Z2G A;  1I7F A;  4BAY A;  3SPC A;  2EZP A;  3E22 B;  4UCV A;  2FKX A;  4ZOL A;  2WLM A;  3FFQ A;  3E86 A;  4QGP A;  1KKC A;  4JYY A;  2LW1 A;  3JAW A;  4P2Z A;  4JI1 B;  2HHH B;  1K9M W;  3RT3 C;  1ZTE A;  1MOF A;  2ZQM A;  3MD0 A;  2GSM B;  4JV5 O;  3TK1 A;  4TWK A;  5LA6 B;  4LP8 A;  3CMA V;  3CSX A;  5JVD B;  2NLJ C;  3H1L H;  4PDL A;  2V7Q G;  3UO3 A;  4OX9 B;  3P30 A;  4DRX B;  2XHB A;  1JCH A;  2RDC A;  1R1B A;  1N0J A;  1H2M A;  5E1A C;  1XNQ O;  5EC2 C;  5B1A C;  5A2Q N;  4FFK A;  5IWA O;  5LHI A;  1YJW V;  5B1B B;  1QCE A;  4XDL A;  1VQP V;  4WF9 V;  4UVB A;  1LNQ A;  2B5U A;  5IJ9 B;  2CTQ A;  1JQ0 A;  5CA1 B;  3AG1 C;  4I9Q A;  4YXW G;  4J7K A;  2KG7 B;  2CAZ C;  3CCJ V;  2Y4T A;  4LFB O;  1VEW A;  1EN5 A;  1XQ8 A;  4WFH A;  1V54 B;  2E75 B;  4RUF A;  3W7W A;  3Q4H B;  3EXA A;  2P5O A;  1AJQ A;  3W7X A;  4B3S O;  4DV2 B;  1PL4 A;  4X1K B;  2QWO B;  2ZR2 A;  4JZG A;  4LH7 A;  3K06 A;  4LBE C;  4X66 O;  4Z1M G;  2YEV B;  1MMM A;  4JI4 O;  4PI2 A;  3JAM N;  2ODM A;  3OR6 C;  3KZI Z;  2XAQ A;  4CS2 A;  5LGN A;  4FM1 A;  3JD3 A;  3F5W C;  4FZ1 A;  4X88 A;  1H2N A;  4AQY B;  1Q90 D;  4D7S A;  1KU9 A;  1Y74 B;  4JAS A;  3L74 H;  5H6R A;  2YS8 A;  1JR9 A;  1Q3E A;  2YIB A;  5D5P A;  4JI5 B;  3CCV V;  4PA7 A;  3FX7 A;  1QBZ A;  1CXZ B;  3ASO C;  5LBQ A;  4KL1 A;  4X8A A;  3JAK A;  5LL6 Y;  3D36 C;  1OCR B;  3E35 A;  2DMX A;  1PNK A;  3FYI B;  4JAA A;  2FML A;  2QM8 A;  2JVD A;  1HNX B;  1XIL A;  2GHY A;  4GX2 A;  1L0L H;  4Q20 A;  3JSN A;  3CEI A;  4FLX A;  2ZDI C;  5J2U B;  1FKA O;  4NKG B;  1XOU A;  3DXR B;  1B6Q A;  3BRC A;  2CUG A;  4DV1 O;  1N33 B;  3EVK A;  4H0L B;  1HP8 A;  4CH4 A;  3L72 H;  1P49 A;  3SJB C;  2VQF O;  1J5E B;  2CTP A;  1K3E A;  4JI8 O;  2UXB B;  1GK9 A;  4UVC A;  5GON A;  5LXT A;  2Z0A A;  4FVM A;  2Q0A A;  1IBL B;  2PF4 E;  5CB4 B;  4U3J A;  3LNN A;  4JZ2 A;  4HBN A;  4DR6 O;  2WWW A;  4L8J A;  3JD4 A;  2W6I G;  5KA6 A;  1I94 O;  5LYJ B;  1YIJ V;  4DRX A;  5KX5 B;  5EBL C;  1KMI Z;  4LF8 B;  1R73 A;  3ABM C;  3E8G A;  1SS3 A;  4J7J A;  2GUZ A;  4RQF A;  3VQW A;  2LGQ A;  2QWN B;  3JYC A;  2UXD O;  1WB8 A;  2H3O A;  2Y69 C;  4J9Y B;  3L71 H;  4MS2 A;  3ZN0 A;  3ZRX A;  4UXN A;  5GW7 A;  1R6T A;  2DWE C;  4Q6G A;  3SYA A;  3A8T A;  4WCE V;  4GT1 A;  1KP2 A;  2WLL B;  2Q67 A;  1ZSP A;  1ZUQ A;  2HFE C;  4HZ3 A;  3SGI A;  1W2B U;  4PV1 B;  1Q8I A;  3OUF A;  1N8R W;  1AP6 A;  4TV9 B;  2F4V O;  4ZI7 A;  1R3I C;  4HYO A;  3QO8 A;  4B3M O;  2AZ0 A;  3M99 B;  4GZR B;  2H94 A;  2BOC C;  4J80 A;  1VQ8 V;  4E2L A;  1AI6 A;  4IYH A;  2D2C B;  2BSK A;  4I7Z B;  2UXC O;  2CDY A;  5JWP A;  2A7W A;  5CMU A;  4X1K A;  5D5Q A;  1EM1 A;  1GKF A;  4DK1 A;  1N32 O;  4LWS A;  5KHI A;  5EYP B;  2QM4 A;  4NR1 A;  1OV9 A;  1FAF A;  3M7M X;  4LF9 B;  2YSU B;  1AIL A;  1I5Y A;  1FYJ A;  2ADQ B;  3CJH B;  4ZHQ B;  1SQF A;  4PDR A;  2K1E A;  4O2B B;  2E74 B;  4WFF A;  5LHG A;  5BR8 B;  4LF5 O;  1V9P A;  1M90 W;  3AG2 C;  3OMA B;  1BHB A;  2PUS A;  3T1C A;  5LMU O;  2CE4 A;  1BGY H;  3JAS B;  2A06 H;  3ABL C;  1WA8 A;  5DEC A;  2IM9 A;  3JAL B;  3IC7 A;  5JJN B;  2F93 B;  2JGD A;  3H1J H;  4WFE A;  2VWJ A;  1NS1 A;  3RYF B;  2GTS A;  1NT2 B;  1TVK A;  5EZY B;  3JAR B;  3LDD A;  4I5S A;  1NR7 A;  1YIT V;  1RM1 B;  4IHJ B;  3IAY A;  4GKJ O;  3D3Q A;  3ZHQ A;  4GKK B;  2ZIM A;  1RPO A;  3SPG A;  4MT8 A;  4DR2 O;  5IY5 C;  3CRA A;  3ZHS A;  2OCH A;  3I5D A;  4QE7 A;  1IBK O;  1DLB A;  1K5S A;  2UUB B;  4I55 B;  1F7Y A;  3HKD A;  4JI2 B;  3FB6 C;  3CCL V;  1KKD A;  1Z5W A;  3T1H B;  5LOV B;  1OJH A;  1CEZ A;  1NVP D;  2Q8V A;  5LGU A;  4LF4 B;  3R66 A;  1AR1 B;  4BW5 A;  2UUC O;  1S5H C;  4PDM A;  3ZS8 C;  1IBM B;  2L35 A;  1MZE A;  1JMK C;  1NU1 H;  5H5N A;  1VQ9 V;  3UT5 A;  4GLX A;  3K58 A;  4NXN B;  2PTM A;  4AI8 A;  2EIM C;  4UB6 Z;  2VQE B;  1QR8 A;  4XDK A;  1OCC B;  3APO A;  1AI7 A;  3CCR V;  1US6 A;  3M8A A;  1E79 G;  1I5X A;  2XAJ A;  1Q6U A;  5LMN B;  2IJK A;  2QWP B;  3S3W A;  3UQ8 A;  5GTI Z;  4DR7 O;  4FIP C;  1Q82 W;  2ILM A;  1QNM A;  4LFC B;  4D6T H;  4Z1V A;  3K59 A;  3AG3 B;  4MW3 A;  2AZ2 A;  1QVF U;  4KHP O;  3APQ A;  2JEU A;  1FFX B;  2XAF A;  3QTC A;  2ZIO A;  2X6C A;  1G6U A;  5FL7 G;  4Z2W A;  5KAI Z;  2ZNI A;  4JYB A;  4TV9 A;  5B66 Z;  3O65 A;  3AEI A;  4DV4 B;  3HKC A;  2YUA A;  4IIJ B;  3C3T A;  1WPB A;  2Q7G A;  2X0L A;  4K8X A;  4OGQ B;  4IGG A;  3SPI A;  1EFR G;  1XMO O;  3BA9 A;  4UCR A;  3LSU A;  1YJN V;  3WFV A;  2FL4 A;  3CJH A;  4ZHQ A;  5B1B C;  4O2B A;  2Y0I A;  4ZOL B;  1FXK A;  1AP5 A;  2ADP A;  4OPH A;  4YHH B;  3SJC C;  3JAW B;  1P7G A;  3F5T A;  4FLT A;  4FJC C;  1BCC H;  3HKB A;  5HFL A;  4AHC A;  1N36 B;  4JI0 B;  1GH6 A;  4IL6 Z;  4O4I A;  1V54 C;  2Y48 A;  4DUZ O;  4PA6 A;  5A9G A;  1GM8 A;  4DR5 B;  4JGS A;  2JJ1 G;  3H9V A;  3CRC A;  4X20 A;  2YID A;  3L75 H;  5DM6 V;  5BY1 A;  2DYS B;  3GVM A;  1DF5 A;  2ZM6 B;  3JD0 A;  3WB0 A;  2GV9 A;  3ABK B;  1VMG A;  2LP7 A;  2WLK A;  2CH7 A;  1P7B A;  3B77 A;  1BL8 A;  3AG4 B;  1TAE A;  1MZF A;  4DR1 O;  4PJ0 Z;  2IH1 C;  1MG1 A;  3FYE B;  1XNR B;  3CRQ A;  1H2S B;  1VQK V;  2EX3 A;  2W6J G;  1XBL A;  4F4L A;  5CA3 A;  4DV0 B;  2JS3 A;  2CTW A;  1KP3 A;  1Z5V A;  4TQD A;  4BIU A;  4B3T O;  2P67 A;  2AXT Z;  1HNZ O;  1SKV A;  1N34 O;  4DR3 B;  3K57 A;  1TUB A;  3U10 A;  4JYA O;  2FYU H;  1NJI W;  5IYC O;  1GTO A;  5CA0 A;  5LHH A;  3WB1 A;  4MVS A;  3CE2 A;  3RVY A;  1R3L C;  2AGA A;  1FFX A;  4DV3 B;  3ZJZ A;  1IVS A;  2BCC H;  1PD3 A;  1H8E G;  3OT7 A;  1FPO A;  3QF7 A;  4P30 A;  4X65 O;  1OZ0 A;  4JTC B;  3X2Q B;  1BT8 A;  2EIJ B;  3W7U A;  3JAK B;  1KD1 W;  1D5A A;  3DC6 A;  1YXB A;  1M1K W;  3GWK C;  1FS0 G;  2R9A A;  3QVN A;  2NR5 A;  1M5I A;  4RUE A;  4U3F H;  3SJA C;  1MAB G;  4A5U B;  1CP9 A;  1M57 B;  4MVR A;  5JCO C;  3OFN G;  2EBO A;  3O9O A;  2NN4 A;  3OGI B;  4WFG A;  3NR7 A;  4JTD B;  5GON B;  5LXT B;  1ROP A;  3KCX A;  1O9H A;  4X1I A;  4FFB A;  3UKM A;  4NB5 A;  4X64 O;  4U3J B;  4H13 B;  1XNQ B;  1WN7 A;  5L3D A;  1BQZ A;  4WBN A;  4DR4 O;  4O4L A;  4O4J A;  5EK0 A;  1YJ9 V;  2BTO A;  1JJO A;  1KUQ A;  2HEP A;  3CC2 V;  2GUZ B;  1J95 A;  2AW9 A;  3CP1 A;  4ASU G;  1GRJ A;  3R65 A;  4NTY A;  5K1P A;  3J7A U;  4JI1 O;  2HHH O;  3STZ C;  2OTJ V;  3RW0 A;  4PDV A;  3RYI A;  1OCZ B;  3BVO A;  3WU2 Z;  4J11 A;  2FB5 A;  2LO1 A;  1VAR A;  4KXR A;  1E1R G;  3T4D A;  2ATK C;  4OX9 O;  1Q5O A;  2XT9 A;  2WLI A;  4ZI7 B;  1VQN V;  3E2E A;  1XHX A;  4X66 B;  2WLH A;  3BEH A;  1QR9 A;  2BSK B;  1OCO B;  3CCU V;  1RM1 C;  3DGE A;  1SZT A;  2AHY A;  3GB7 C;  3T2M A;  1KYO F;  3RBZ A;  2P7T C;  1QHT A;  3WG7 C;  4LWS B;  4B3R O;  2OIE A;  1H2K A;  5FNV B;  4EB6 A;  4G2K A;  1AJN A;  3VQV A;  2CK3 G;  1SES A;  5LP6 A;  2OYQ A;  4JI6 O;  2EIL B;  2JK5 C;  4EFE A;  4E4E A;  1WA8 B;  4FZ0 A;  1BMF G;  4OXS A;  5J9P C;  2YDE A;  2JGD B;  4MSW C;  4CH3 A;  3P3P A;  4DV2 O;  1TVK B;  1JFF A;  3BHP A;  1QLN A;  2WPD G;  2XAG A;  1NTM H;  1VF6 C;  4DV6 B;  3SYQ A;  4X89 A;  4RO2 A; 
#chains in the Genus database with same CATH homology
 4W4K A;  4J42 A;  4J41 A;  4KXR A;  4IYI A;  2GTS A;  4J7J A;  4J7K A;  3FX7 A;  2G38 A;  4J10 A;  4J11 A;  4W4L A;  4IYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...