4IYPC

Structure of the npp2ac-alpha4 complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
148
structure length
119
Chain Sequence
FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKECGDGQFHDLMELFDTNYLFMGDYVDYSVETVTLLVALKVRYRERITILRGNITQVYGFYDECLRKYGNANVWKYFTDLFDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of protein phosphatase 2A stable latency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Immunoglobulin-binding protein 1
total genus 41
structure length 119
sequence length 148
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2013-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4iypC00
4DHLA 3H67A 5DNYA 3DSCA 5HPEA 4MOVA 4ZVZA 3T1IA 1M63A 3E7AA 2NXFA 3ZU0A 5IOHA 4KKZA 4TUIA 4DT2A 2QFPA 3IB8A 1UTEA 2NYMC 1XM7A 4Q7FA 2Z06A 2WDCA 4H1SA 4WWLA 1HO5A 4I5LC 1HP1A 4FBWA 1S3NA 1IT6A 2NYLC 2CV9A 3H62B 2O8AA 3QFOA 2WDEA 3QFMA 4LTYA 2O8GA 3H63A 4J6OA 2Z72A 3THOB 1T70A 4FBQA 4O43A 2IE4C 2KKNA 4O4KA 5GTUA 3ICFA 3EGGA 4H2GA 4UT3A 1NNWA 5EQVA 1OI8A 4ORAA 1S95A 5JPEA 1OIDA 4LACC 4UT2A 4H2FA 4MP0A 3H69A 2HYOA 4H2IA 1UF3A 3RL4A 3V4YA 1Z2XA 2HY1A 3H64A 1W24A 1XZWA 2NPPC 2IAEC 4H1YP 4G9JA 2USHA 1JK7A 2YVTA 1SU1A 1WARA 4V0XA 3QFKA 1USHA 1II7A 3K7VC 1S3MA 2BQ8X 1S8EA 3DW8C 4LU9A 1T71A 3QFNA 1Z2WA 2XMOA 3E7BA 1V73A 4I5NC 2QJCA 2JOGA 1S70A 4F0ZA 4ZX2A 3H68A 1FJMA 2AHDA 3RQZA 5C1VA 3N5UA 4ORBA 5JPFA 4IL1A 3PSOA 4O5GA 3H66A 3GVEA 4O24A 3H60A 3P71C 1S3LA 4V0VA 2IE3C 2P6BA 3FGAC 3ZTVA 4V0WA 4MOYA 3IVDA 1AUIA 1HPUA 3IVEA 3JYFA 1QHWA 5J28A 3HVQA 1OIEA 3PSNA 4HD0A 4B2OA 3DSDA 2WDFA 3QG5C 2WDDA 1MF8A 2QFRA 3H61A 4ORCA 4XPNA 4YKEA 4KBPA 1QFCA 2R17A 3RL3A 3RL5A 5INBA 3KBPA 2Q8UA 4OR9A 1TCOA 3C9FA 4FCXA 4IYPC 4UT3B 2A22A 4UWQA 3K7WC 4NZVA 3THNA 2DFJA 2Z1AA 4JA7A 3EGHA 4JA9A 3CK2A 4FBKA 3TGHA 4TUGA 1G5BA 3AUZA 2ZBMA 3LL8A 4DSYA 2GJUA 4H2BA 3IB7A 4M0VA 2BDXA 5JJTA 3AV0A 2BCDA 2HYPA 1KBPA 1WAO1 5B8IA 3C5WC 1U32A 5F3WA
chains in the Genus database with same CATH superfamily
4DHLA 3H67A 5DNYA 3DSCA 5HPEA 4MOVA 4ZVZA 3T1IA 1M63A 3E7AA 2NXFA 3ZU0A 5IOHA 4KKZA 4TUIA 4DT2A 2QFPA 3IB8A 1UTEA 2NYMC 1XM7A 4Q7FA 2Z06A 2WDCA 4H1SA 4WWLA 1HO5A 4I5LC 1HP1A 4FBWA 1S3NA 1IT6A 2NYLC 2CV9A 3H62B 2O8AA 3QFOA 2WDEA 3E0JA 3QFMA 4LTYA 2O8GA 3H63A 4J6OA 2Z72A 3THOB 1T70A 4FBQA 4O43A 2IE4C 2KKNA 4O4KA 5GTUA 3ICFA 3EGGA 4H2GA 4UT3A 1NNWA 5EQVA 1OI8A 4ORAA 1S95A 5JPEA 1OIDA 4LACC 4UT2A 4H2FA 3C5WC 4MP0A 2ZOAA 3FLOA 3H69A 2HYOA 4H2IA 1UF3A 3RL4A 3V4YA 1Z2XA 2HY1A 3H64A 1W24A 1XZWA 2NPPC 2IAEC 4H1YP 4G9JA 2ZO9B 2USHA 1JK7A 2YVTA 1SU1A 1WARA 4V0XA 3QFKA 1USHA 1II7A 3K7VC 1S3MA 2BQ8X 1S8EA 2DXLA 3DW8C 4LU9A 1T71A 3QFNA 1Z2WA 2XMOA 3E7BA 1V73A 4I5NC 2QJCA 2JOGA 1S70A 4F0ZA 4ZX2A 3H68A 1FJMA 2AHDA 3RQZA 5C1VA 3N5UA 4ORBA 5JPFA 4IL1A 3PSOA 4O5GA 3H66A 3GVEA 4O24A 3H60A 3P71C 1S3LA 4V0VA 2IE3C 2P6BA 3FGAC 3ZTVA 4V0WA 3D03A 4MOYA 3IVDA 1AUIA 1HPUA 3IVEA 3JYFA 1QHWA 5J28A 3HVQA 1OIEA 3PSNA 4HD0A 4B2OA 3DSDA 2WDFA 3QG5C 2WDDA 1MF8A 2QFRA 3H61A 4ORCA 4XPNA 4YKEA 4KBPA 1QFCA 2R17A 3RL3A 3RL5A 5INBA 3KBPA 2Q8UA 4OR9A 1TCOA 3C9FA 4FCXA 4IYPC 4UT3B 2A22A 4UWQA 2DXNA 3K7WC 4NZVA 3THNA 2DFJA 2Z1AA 4JA7A 3EGHA 4JA9A 3CK2A 4FBKA 3TGHA 4TUGA 1G5BA 3AUZA 2ZBMA 3LL8A 4DSYA 2GJUA 4H2BA 3IB7A 4M0VA 2BDXA 5JJTA 2YEQA 3AV0A 2BCDA 1KBPA 1WAO1 5B8IA 2HYPA 1U32A 5F3WA
chains in the Genus database with same CATH topology
4DHLA 3H67A 5DNYA 3DSCA 5HPEA 4MOVA 4ZVZA 3T1IA 1M63A 3E7AA 2NXFA 3ZU0A 5IOHA 4KKZA 4TUIA 4DT2A 2QFPA 3IB8A 1UTEA 2NYMC 1XM7A 4Q7FA 2Z06A 2WDCA 4H1SA 4WWLA 1HO5A 4I5LC 1HP1A 4FBWA 1S3NA 1IT6A 2NYLC 2CV9A 3H62B 2O8AA 3QFOA 2WDEA 3E0JA 3QFMA 4LTYA 2O8GA 3H63A 4J6OA 2Z72A 3THOB 1T70A 4FBQA 4O43A 2IE4C 2KKNA 4O4KA 5GTUA 3ICFA 3EGGA 4H2GA 4UT3A 1NNWA 5EQVA 1OI8A 4ORAA 1S95A 5JPEA 1OIDA 4LACC 4UT2A 4H2FA 3C5WC 4MP0A 2ZOAA 3FLOA 3H69A 2HYOA 4H2IA 1UF3A 3RL4A 3V4YA 1Z2XA 2HY1A 3H64A 1W24A 1XZWA 2NPPC 2IAEC 4H1YP 4G9JA 2ZO9B 2USHA 1JK7A 2YVTA 1SU1A 1WARA 4V0XA 3QFKA 1USHA 1II7A 3K7VC 1S3MA 2BQ8X 1S8EA 2DXLA 3DW8C 4LU9A 1T71A 3QFNA 1Z2WA 2XMOA 3E7BA 1V73A 4I5NC 2QJCA 2JOGA 1S70A 4F0ZA 4ZX2A 3H68A 1FJMA 2AHDA 3RQZA 5C1VA 3N5UA 4ORBA 5JPFA 4IL1A 3PSOA 4O5GA 3H66A 3GVEA 4O24A 3H60A 3P71C 1S3LA 4V0VA 2IE3C 2P6BA 3FGAC 3ZTVA 4V0WA 3D03A 4MOYA 3IVDA 1AUIA 1HPUA 3IVEA 3JYFA 1QHWA 5J28A 3HVQA 1OIEA 3PSNA 4HD0A 4B2OA 3DSDA 2WDFA 3QG5C 2WDDA 1MF8A 2QFRA 3H61A 4ORCA 4XPNA 4YKEA 4KBPA 1QFCA 2R17A 3RL3A 3RL5A 5INBA 3KBPA 2Q8UA 4OR9A 1TCOA 3C9FA 4FCXA 4IYPC 4UT3B 2A22A 4UWQA 2DXNA 3K7WC 4NZVA 3THNA 2DFJA 2Z1AA 4JA7A 3EGHA 4JA9A 3CK2A 4FBKA 3TGHA 4TUGA 1G5BA 3AUZA 2ZBMA 3LL8A 4DSYA 2GJUA 4H2BA 3IB7A 4M0VA 2BDXA 5JJTA 2YEQA 3AV0A 2BCDA 1KBPA 1WAO1 5B8IA 2HYPA 1U32A 5F3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DHL A;  3H67 A;  5DNY A;  3DSC A;  5HPE A;  4MOV A;  4ZVZ A;  3T1I A;  1M63 A;  3E7A A;  2NXF A;  3ZU0 A;  5IOH A;  4KKZ A;  4TUI A;  4DT2 A;  2QFP A;  3IB8 A;  1UTE A;  2NYM C;  1XM7 A;  4Q7F A;  2Z06 A;  2WDC A;  4H1S A;  4WWL A;  1HO5 A;  4I5L C;  1HP1 A;  4FBW A;  1S3N A;  1IT6 A;  2NYL C;  2CV9 A;  3H62 B;  2O8A A;  3QFO A;  2WDE A;  3QFM A;  4LTY A;  2O8G A;  3H63 A;  4J6O A;  2Z72 A;  3THO B;  1T70 A;  4FBQ A;  4O43 A;  2IE4 C;  2KKN A;  4O4K A;  5GTU A;  3ICF A;  3EGG A;  4H2G A;  4UT3 A;  1NNW A;  5EQV A;  1OI8 A;  4ORA A;  1S95 A;  5JPE A;  1OID A;  4LAC C;  4UT2 A;  4H2F A;  4MP0 A;  3H69 A;  2HYO A;  4H2I A;  1UF3 A;  3RL4 A;  3V4Y A;  1Z2X A;  2HY1 A;  3H64 A;  1W24 A;  1XZW A;  2NPP C;  2IAE C;  4H1Y P;  4G9J A;  2USH A;  1JK7 A;  2YVT A;  1SU1 A;  1WAR A;  4V0X A;  3QFK A;  1USH A;  1II7 A;  3K7V C;  1S3M A;  2BQ8 X;  1S8E A;  3DW8 C;  4LU9 A;  1T71 A;  3QFN A;  1Z2W A;  2XMO A;  3E7B A;  1V73 A;  4I5N C;  2QJC A;  2JOG A;  1S70 A;  4F0Z A;  4ZX2 A;  3H68 A;  1FJM A;  2AHD A;  3RQZ A;  5C1V A;  3N5U A;  4ORB A;  5JPF A;  4IL1 A;  3PSO A;  4O5G A;  3H66 A;  3GVE A;  4O24 A;  3H60 A;  3P71 C;  1S3L A;  4V0V A;  2IE3 C;  2P6B A;  3FGA C;  3ZTV A;  4V0W A;  4MOY A;  3IVD A;  1AUI A;  1HPU A;  3IVE A;  3JYF A;  1QHW A;  5J28 A;  3HVQ A;  1OIE A;  3PSN A;  4HD0 A;  4B2O A;  3DSD A;  2WDF A;  3QG5 C;  2WDD A;  1MF8 A;  2QFR A;  3H61 A;  4ORC A;  4XPN A;  4YKE A;  4KBP A;  1QFC A;  2R17 A;  3RL3 A;  3RL5 A;  5INB A;  3KBP A;  2Q8U A;  4OR9 A;  1TCO A;  3C9F A;  4FCX A;  4IYP C;  4UT3 B;  2A22 A;  4UWQ A;  3K7W C;  4NZV A;  3THN A;  2DFJ A;  2Z1A A;  4JA7 A;  3EGH A;  4JA9 A;  3CK2 A;  4FBK A;  3TGH A;  4TUG A;  1G5B A;  3AUZ A;  2ZBM A;  3LL8 A;  4DSY A;  2GJU A;  4H2B A;  3IB7 A;  4M0V A;  2BDX A;  5JJT A;  3AV0 A;  2BCD A;  2HYP A;  1KBP A;  1WAO 1;  5B8I A;  3C5W C;  1U32 A;  5F3W A; 
#chains in the Genus database with same CATH topology
 4DHL A;  3H67 A;  5DNY A;  3DSC A;  5HPE A;  4MOV A;  4ZVZ A;  3T1I A;  1M63 A;  3E7A A;  2NXF A;  3ZU0 A;  5IOH A;  4KKZ A;  4TUI A;  4DT2 A;  2QFP A;  3IB8 A;  1UTE A;  2NYM C;  1XM7 A;  4Q7F A;  2Z06 A;  2WDC A;  4H1S A;  4WWL A;  1HO5 A;  4I5L C;  1HP1 A;  4FBW A;  1S3N A;  1IT6 A;  2NYL C;  2CV9 A;  3H62 B;  2O8A A;  3QFO A;  2WDE A;  3E0J A;  3QFM A;  4LTY A;  2O8G A;  3H63 A;  4J6O A;  2Z72 A;  3THO B;  1T70 A;  4FBQ A;  4O43 A;  2IE4 C;  2KKN A;  4O4K A;  5GTU A;  3ICF A;  3EGG A;  4H2G A;  4UT3 A;  1NNW A;  5EQV A;  1OI8 A;  4ORA A;  1S95 A;  5JPE A;  1OID A;  4LAC C;  4UT2 A;  4H2F A;  3C5W C;  4MP0 A;  2ZOA A;  3FLO A;  3H69 A;  2HYO A;  4H2I A;  1UF3 A;  3RL4 A;  3V4Y A;  1Z2X A;  2HY1 A;  3H64 A;  1W24 A;  1XZW A;  2NPP C;  2IAE C;  4H1Y P;  4G9J A;  2ZO9 B;  2USH A;  1JK7 A;  2YVT A;  1SU1 A;  1WAR A;  4V0X A;  3QFK A;  1USH A;  1II7 A;  3K7V C;  1S3M A;  2BQ8 X;  1S8E A;  2DXL A;  3DW8 C;  4LU9 A;  1T71 A;  3QFN A;  1Z2W A;  2XMO A;  3E7B A;  1V73 A;  4I5N C;  2QJC A;  2JOG A;  1S70 A;  4F0Z A;  4ZX2 A;  3H68 A;  1FJM A;  2AHD A;  3RQZ A;  5C1V A;  3N5U A;  4ORB A;  5JPF A;  4IL1 A;  3PSO A;  4O5G A;  3H66 A;  3GVE A;  4O24 A;  3H60 A;  3P71 C;  1S3L A;  4V0V A;  2IE3 C;  2P6B A;  3FGA C;  3ZTV A;  4V0W A;  3D03 A;  4MOY A;  3IVD A;  1AUI A;  1HPU A;  3IVE A;  3JYF A;  1QHW A;  5J28 A;  3HVQ A;  1OIE A;  3PSN A;  4HD0 A;  4B2O A;  3DSD A;  2WDF A;  3QG5 C;  2WDD A;  1MF8 A;  2QFR A;  3H61 A;  4ORC A;  4XPN A;  4YKE A;  4KBP A;  1QFC A;  2R17 A;  3RL3 A;  3RL5 A;  5INB A;  3KBP A;  2Q8U A;  4OR9 A;  1TCO A;  3C9F A;  4FCX A;  4IYP C;  4UT3 B;  2A22 A;  4UWQ A;  2DXN A;  3K7W C;  4NZV A;  3THN A;  2DFJ A;  2Z1A A;  4JA7 A;  3EGH A;  4JA9 A;  3CK2 A;  4FBK A;  3TGH A;  4TUG A;  1G5B A;  3AUZ A;  2ZBM A;  3LL8 A;  4DSY A;  2GJU A;  4H2B A;  3IB7 A;  4M0V A;  2BDX A;  5JJT A;  2YEQ A;  3AV0 A;  2BCD A;  1KBP A;  1WAO 1;  5B8I A;  2HYP A;  1U32 A;  5F3W A; 
#chains in the Genus database with same CATH homology
 4DHL A;  3H67 A;  5DNY A;  3DSC A;  5HPE A;  4MOV A;  4ZVZ A;  3T1I A;  1M63 A;  3E7A A;  2NXF A;  3ZU0 A;  5IOH A;  4KKZ A;  4TUI A;  4DT2 A;  2QFP A;  3IB8 A;  1UTE A;  2NYM C;  1XM7 A;  4Q7F A;  2Z06 A;  2WDC A;  4H1S A;  4WWL A;  1HO5 A;  4I5L C;  1HP1 A;  4FBW A;  1S3N A;  1IT6 A;  2NYL C;  2CV9 A;  3H62 B;  2O8A A;  3QFO A;  2WDE A;  3E0J A;  3QFM A;  4LTY A;  2O8G A;  3H63 A;  4J6O A;  2Z72 A;  3THO B;  1T70 A;  4FBQ A;  4O43 A;  2IE4 C;  2KKN A;  4O4K A;  5GTU A;  3ICF A;  3EGG A;  4H2G A;  4UT3 A;  1NNW A;  5EQV A;  1OI8 A;  4ORA A;  1S95 A;  5JPE A;  1OID A;  4LAC C;  4UT2 A;  4H2F A;  3C5W C;  4MP0 A;  2ZOA A;  3FLO A;  3H69 A;  2HYO A;  4H2I A;  1UF3 A;  3RL4 A;  3V4Y A;  1Z2X A;  2HY1 A;  3H64 A;  1W24 A;  1XZW A;  2NPP C;  2IAE C;  4H1Y P;  4G9J A;  2ZO9 B;  2USH A;  1JK7 A;  2YVT A;  1SU1 A;  1WAR A;  4V0X A;  3QFK A;  1USH A;  1II7 A;  3K7V C;  1S3M A;  2BQ8 X;  1S8E A;  2DXL A;  3DW8 C;  4LU9 A;  1T71 A;  3QFN A;  1Z2W A;  2XMO A;  3E7B A;  1V73 A;  4I5N C;  2QJC A;  2JOG A;  1S70 A;  4F0Z A;  4ZX2 A;  3H68 A;  1FJM A;  2AHD A;  3RQZ A;  5C1V A;  3N5U A;  4ORB A;  5JPF A;  4IL1 A;  3PSO A;  4O5G A;  3H66 A;  3GVE A;  4O24 A;  3H60 A;  3P71 C;  1S3L A;  4V0V A;  2IE3 C;  2P6B A;  3FGA C;  3ZTV A;  4V0W A;  3D03 A;  4MOY A;  3IVD A;  1AUI A;  1HPU A;  3IVE A;  3JYF A;  1QHW A;  5J28 A;  3HVQ A;  1OIE A;  3PSN A;  4HD0 A;  4B2O A;  3DSD A;  2WDF A;  3QG5 C;  2WDD A;  1MF8 A;  2QFR A;  3H61 A;  4ORC A;  4XPN A;  4YKE A;  4KBP A;  1QFC A;  2R17 A;  3RL3 A;  3RL5 A;  5INB A;  3KBP A;  2Q8U A;  4OR9 A;  1TCO A;  3C9F A;  4FCX A;  4IYP C;  4UT3 B;  2A22 A;  4UWQ A;  2DXN A;  3K7W C;  4NZV A;  3THN A;  2DFJ A;  2Z1A A;  4JA7 A;  3EGH A;  4JA9 A;  3CK2 A;  4FBK A;  3TGH A;  4TUG A;  1G5B A;  3AUZ A;  2ZBM A;  3LL8 A;  4DSY A;  2GJU A;  4H2B A;  3IB7 A;  4M0V A;  2BDX A;  5JJT A;  2YEQ A;  3AV0 A;  2BCD A;  1KBP A;  1WAO 1;  5B8I A;  2HYP A;  1U32 A;  5F3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...