4IYSA

Structural and ligand binding properties of the bateman domain of human magnesium transporters cnnm2 and cnnm4
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
155
Chain Sequence
MEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLAIVQRVNNEGEDPFYEVLGIVTLEDVIEEIIKSEILDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and ligand binding properties of the Bateman domain of human magnesium transporters CNNM2 and CNNM4
rcsb
molecule keywords Metal transporter CNNM2
molecule tags Metal transport
source organism Homo sapiens
total genus 44
structure length 155
sequence length 156
ec nomenclature
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4iysA00
2NYCA 3DDJA 2YZIA 3KPCA 5K25C 5MMZA 4L0DA 2EF7A 3T4NC 4IY2A 2YVXA 3FV6A 3K2VA 1PVMA 2QRCE 4GQYA 3LV9A 4P1GA 4ESYB 3LHHA 2QR1E 3ORGA 2QREE 4IY4A 2RIHA 4ESYA 3GBYA 1XKFA 3FWSA 4NOCA 2UV6A 4UUUA 3TE5C 2QRDE 2RIFA 3LQNA 2NYEA 3KPDA 2UV7A 2UV5A 4PCUA 4GQVA 2OOYE 4L3VA 2PFIA 3KXRA 5IIPA 1PBJA 2YZQA 5K24C 1O50A 4P1OA 2YVYA 3SL7A 2QLVC 2OOXE 5LXQA 4DQWA 4GQWA 2EMQA 1Y5HA 3OI8A 3KH5A 5K22B 3PC4A 3OCOA 3FWRA 3FNAA 2YVZA 3PC2A 3I8NA 1YAVA 2D4ZA 2QH1A 2P9MA 2ZY9A 4COOA 3K6EA 4HG0A 3HF7A 4O9KA 2UV4A 3L2BA 4IYSA 4L28A 3L31A 3KPBA 3OCMA 5KS7A 4FXSA 3TDHC 3LFZA 2O16A 2RC3A 5K23C 3FHMA 4L27A 4FRYA 2OUXA 4IY3A 4IY0A 3PC3A
chains in the Genus database with same CATH superfamily
2NYCA 3DDJA 2YZIA 3KPCA 5K25C 5MMZA 2JA3A 4L0DA 2EF7A 3T4NC 4IY2A 2YVXA 3FV6A 3K2VA 1PVMA 2QRCE 4GQYA 3LV9A 4P1GA 4ESYB 3LHHA 2QR1E 3ORGA 2QREE 4IY4A 2RIHA 4ESYA 3GBYA 1XKFA 3FWSA 4NOCA 2UV6A 4UUUA 3TE5C 2QRDE 2RIFA 3LQNA 2NYEA 3KPDA 2UV7A 2UV5A 4PCUA 4GQVA 2OOYE 4L3VA 2PFIA 3KXRA 5IIPA 1PBJA 2YZQA 5K24C 1O50A 4P1OA 2YVYA 3SL7A 2QLVC 2OOXE 5LXQA 4DQWA 4GQWA 2EMQA 1Y5HA 3OI8A 3KH5A 5K22B 3PC4A 3OCOA 3FWRA 3FNAA 2YVZA 3PC2A 3I8NA 1YAVA 2D4ZA 2QH1A 2P9MA 2ZY9A 4COOA 3K6EA 4HG0A 3HF7A 4O9KA 2UV4A 3L2BA 4IYSA 4L28A 3L31A 3KPBA 3OCMA 5KS7A 4FXSA 3TDHC 3LFZA 2O16A 2RC3A 5K23C 3FHMA 4L27A 4FRYA 2J9LA 2OUXA 4IY3A 4IY0A 3PC3A
chains in the Genus database with same CATH topology
2NYCA 3DDJA 2YZIA 3KPCA 5K25C 5MMZA 2JA3A 4L0DA 2EF7A 3T4NC 4IY2A 2YVXA 3FV6A 3K2VA 1PVMA 2QRCE 4GQYA 3LV9A 4P1GA 4ESYB 3LHHA 2QR1E 3ORGA 2QREE 4IY4A 2RIHA 4ESYA 3GBYA 1XKFA 3FWSA 4NOCA 2UV6A 4UUUA 3TE5C 2QRDE 2RIFA 3LQNA 2NYEA 3KPDA 2UV7A 2UV5A 4PCUA 4GQVA 2OOYE 4L3VA 2PFIA 3KXRA 5IIPA 1PBJA 2YZQA 5K24C 1O50A 4P1OA 2YVYA 3SL7A 2QLVC 2OOXE 5LXQA 4DQWA 4GQWA 2EMQA 1Y5HA 3OI8A 3KH5A 5K22B 3PC4A 3OCOA 3FWRA 3FNAA 2YVZA 3PC2A 3I8NA 1YAVA 2D4ZA 2QH1A 2P9MA 2ZY9A 4COOA 3K6EA 4HG0A 3HF7A 4O9KA 2UV4A 3L2BA 4IYSA 4L28A 3L31A 3KPBA 3OCMA 5KS7A 4FXSA 3TDHC 3LFZA 2O16A 2RC3A 5K23C 3FHMA 4L27A 4FRYA 2J9LA 2OUXA 4IY3A 4IY0A 3PC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYC A;  3DDJ A;  2YZI A;  3KPC A;  5K25 C;  5MMZ A;  4L0D A;  2EF7 A;  3T4N C;  4IY2 A;  2YVX A;  3FV6 A;  3K2V A;  1PVM A;  2QRC E;  4GQY A;  3LV9 A;  4P1G A;  4ESY B;  3LHH A;  2QR1 E;  3ORG A;  2QRE E;  4IY4 A;  2RIH A;  4ESY A;  3GBY A;  1XKF A;  3FWS A;  4NOC A;  2UV6 A;  4UUU A;  3TE5 C;  2QRD E;  2RIF A;  3LQN A;  2NYE A;  3KPD A;  2UV7 A;  2UV5 A;  4PCU A;  4GQV A;  2OOY E;  4L3V A;  2PFI A;  3KXR A;  5IIP A;  1PBJ A;  2YZQ A;  5K24 C;  1O50 A;  4P1O A;  2YVY A;  3SL7 A;  2QLV C;  2OOX E;  5LXQ A;  4DQW A;  4GQW A;  2EMQ A;  1Y5H A;  3OI8 A;  3KH5 A;  5K22 B;  3PC4 A;  3OCO A;  3FWR A;  3FNA A;  2YVZ A;  3PC2 A;  3I8N A;  1YAV A;  2D4Z A;  2QH1 A;  2P9M A;  2ZY9 A;  4COO A;  3K6E A;  4HG0 A;  3HF7 A;  4O9K A;  2UV4 A;  3L2B A;  4IYS A;  4L28 A;  3L31 A;  3KPB A;  3OCM A;  5KS7 A;  4FXS A;  3TDH C;  3LFZ A;  2O16 A;  2RC3 A;  5K23 C;  3FHM A;  4L27 A;  4FRY A;  2OUX A;  4IY3 A;  4IY0 A;  3PC3 A; 
#chains in the Genus database with same CATH topology
 2NYC A;  3DDJ A;  2YZI A;  3KPC A;  5K25 C;  5MMZ A;  2JA3 A;  4L0D A;  2EF7 A;  3T4N C;  4IY2 A;  2YVX A;  3FV6 A;  3K2V A;  1PVM A;  2QRC E;  4GQY A;  3LV9 A;  4P1G A;  4ESY B;  3LHH A;  2QR1 E;  3ORG A;  2QRE E;  4IY4 A;  2RIH A;  4ESY A;  3GBY A;  1XKF A;  3FWS A;  4NOC A;  2UV6 A;  4UUU A;  3TE5 C;  2QRD E;  2RIF A;  3LQN A;  2NYE A;  3KPD A;  2UV7 A;  2UV5 A;  4PCU A;  4GQV A;  2OOY E;  4L3V A;  2PFI A;  3KXR A;  5IIP A;  1PBJ A;  2YZQ A;  5K24 C;  1O50 A;  4P1O A;  2YVY A;  3SL7 A;  2QLV C;  2OOX E;  5LXQ A;  4DQW A;  4GQW A;  2EMQ A;  1Y5H A;  3OI8 A;  3KH5 A;  5K22 B;  3PC4 A;  3OCO A;  3FWR A;  3FNA A;  2YVZ A;  3PC2 A;  3I8N A;  1YAV A;  2D4Z A;  2QH1 A;  2P9M A;  2ZY9 A;  4COO A;  3K6E A;  4HG0 A;  3HF7 A;  4O9K A;  2UV4 A;  3L2B A;  4IYS A;  4L28 A;  3L31 A;  3KPB A;  3OCM A;  5KS7 A;  4FXS A;  3TDH C;  3LFZ A;  2O16 A;  2RC3 A;  5K23 C;  3FHM A;  4L27 A;  4FRY A;  2J9L A;  2OUX A;  4IY3 A;  4IY0 A;  3PC3 A; 
#chains in the Genus database with same CATH homology
 2NYC A;  3DDJ A;  2YZI A;  3KPC A;  5K25 C;  5MMZ A;  2JA3 A;  4L0D A;  2EF7 A;  3T4N C;  4IY2 A;  2YVX A;  3FV6 A;  3K2V A;  1PVM A;  2QRC E;  4GQY A;  3LV9 A;  4P1G A;  4ESY B;  3LHH A;  2QR1 E;  3ORG A;  2QRE E;  4IY4 A;  2RIH A;  4ESY A;  3GBY A;  1XKF A;  3FWS A;  4NOC A;  2UV6 A;  4UUU A;  3TE5 C;  2QRD E;  2RIF A;  3LQN A;  2NYE A;  3KPD A;  2UV7 A;  2UV5 A;  4PCU A;  4GQV A;  2OOY E;  4L3V A;  2PFI A;  3KXR A;  5IIP A;  1PBJ A;  2YZQ A;  5K24 C;  1O50 A;  4P1O A;  2YVY A;  3SL7 A;  2QLV C;  2OOX E;  5LXQ A;  4DQW A;  4GQW A;  2EMQ A;  1Y5H A;  3OI8 A;  3KH5 A;  5K22 B;  3PC4 A;  3OCO A;  3FWR A;  3FNA A;  2YVZ A;  3PC2 A;  3I8N A;  1YAV A;  2D4Z A;  2QH1 A;  2P9M A;  2ZY9 A;  4COO A;  3K6E A;  4HG0 A;  3HF7 A;  4O9K A;  2UV4 A;  3L2B A;  4IYS A;  4L28 A;  3L31 A;  3KPB A;  3OCM A;  5KS7 A;  4FXS A;  3TDH C;  3LFZ A;  2O16 A;  2RC3 A;  5K23 C;  3FHM A;  4L27 A;  4FRY A;  2J9L A;  2OUX A;  4IY3 A;  4IY0 A;  3PC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...