4IZ7B

Structure of non-phosphorylated erk2 bound to the pea-15 death effector domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
GMAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ERK2 bound to PEA-15 reveals a mechanism for rapid release of activated MAPK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
total genus 33
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01335 DED Death effector domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4iz7B00
4E9MA 4QOBA 4P4HA 2VGQA 1A1WA 4F42A 1WMGA 4A2QA 2G7RA 2YVIA 4ZBWA 2DBFA 1CWWA 4N1LA 4FH0A 2N97A 2BBZA 1NGRA 2N83A 2DBGA 4F44A 1FADA 3LQQA 2DBDA 1CY5A 2LWDA 2YU0A 4JUPA 2GF5A 1D2ZA 4IZAB 4O6XA 1C15A 3CL3A 3QF2A 4EWIA 2MS7A 3EZQA 1UCPA 1A1ZA 4JQWA 1ICHA 3J63A 1DGNA 2MN4A 4I16A 2MB9A 4M9SA 2OF5H 4UZ0A 2MS8A 2NZ7A 2P1HA 4M9ZA 2DO9A 1YGOA 4O9FA 1WH4A 3MOPG 4DWNA 2LS7A 1DDFA 2YQFA 4A2WA 2N7ZA 3MOPA 1WXPA 2IB1A 2N00A 2LWEA 2YGSA 3LQRA 4NQKA 2OF5A 4P4HI 2D96A 1E3YA 4N1JA 4D8OA 2KN6A 1Z6TA 2BBRA 4LWDA 2N1FA 2A9IA 3KATA 2F1SA 2NAQA 2L9MA 2NSNA 1D2ZB 1E41A 1N3KA 4M9XA 2L6AA 2M5VA 3EZQB 4N1KA 3YGSP 2A5YB 2HM2Q 4IZ7B 2O71A 2MPCA 4RHWA 1PN5A 2KM6A 4O9LA 3J6JA 3T6PA 2DBHA 3CRDA 4O7QA 2B1WA 4IZ5E 4RHWE 2N80A 3MOPK 3YGSC
chains in the Genus database with same CATH superfamily
4E9MA 4QOBA 4P4HA 2VGQA 1A1WA 4F42A 1WMGA 4A2QA 2G7RA 2YVIA 4ZBWA 2DBFA 1CWWA 4N1LA 4FH0A 2N97A 2BBZA 1NGRA 2N83A 2DBGA 4F44A 1FADA 3LQQA 2DBDA 1CY5A 2LWDA 2YU0A 4JUPA 2GF5A 1D2ZA 4IZAB 4O6XA 1C15A 3CL3A 3QF2A 4EWIA 2MS7A 2MJMA 3EZQA 1UCPA 1A1ZA 4JQWA 1ICHA 3J63A 1DGNA 2MN4A 4I16A 2MB9A 4M9SA 2OF5H 4UZ0A 2MS8A 2NZ7A 2P1HA 4M9ZA 2DO9A 1YGOA 4O9FA 1WH4A 3MOPG 4DWNA 2LS7A 1DDFA 2YQFA 4A2WA 2N7ZA 3MOPA 1WXPA 2IB1A 2N00A 2LWEA 2YGSA 3LQRA 4NQKA 2OF5A 4P4HI 2D96A 1E3YA 4N1JA 4D8OA 2KN6A 1Z6TA 2BBRA 4LWDA 2N1FA 2A9IA 3KATA 2F1SA 2NAQA 2L9MA 2NSNA 1D2ZB 1E41A 1N3KA 4M9XA 2L6AA 2M5VA 3EZQB 4N1KA 3YGSP 2A5YB 2XV9A 2HM2Q 4IZ7B 2O71A 2MPCA 4RHWA 1PN5A 2KM6A 4O9LA 3J6JA 3T6PA 2DBHA 3CRDA 4O7QA 2B1WA 4IZ5E 4RHWE 2N80A 3MOPK 3YGSC
chains in the Genus database with same CATH topology
4E9MA 4QOBA 4P4HA 2VGQA 1A1WA 4F42A 1WMGA 4A2QA 2G7RA 2YVIA 4ZBWA 2DBFA 1CWWA 4N1LA 4FH0A 2N97A 2BBZA 1NGRA 2N83A 2DBGA 4F44A 1FADA 3LQQA 2DBDA 1CY5A 2LWDA 2YU0A 4JUPA 2GF5A 1D2ZA 4IZAB 4O6XA 1C15A 3CL3A 3QF2A 4EWIA 2MS7A 2MJMA 3EZQA 1UCPA 1A1ZA 4JQWA 1ICHA 3J63A 1DGNA 2MN4A 4I16A 2MB9A 4M9SA 2OF5H 4UZ0A 2MS8A 2NZ7A 2P1HA 4M9ZA 2DO9A 1YGOA 4O9FA 1WH4A 3MOPG 4DWNA 2LS7A 1DDFA 2YQFA 4A2WA 2N7ZA 3MOPA 1WXPA 2IB1A 2N00A 2LWEA 2YGSA 3LQRA 4NQKA 2OF5A 4P4HI 2D96A 1E3YA 4N1JA 4D8OA 2KN6A 1Z6TA 2BBRA 4LWDA 2N1FA 2A9IA 3KATA 2F1SA 2NAQA 2L9MA 2NSNA 1D2ZB 1E41A 1N3KA 4M9XA 2L6AA 2M5VA 3EZQB 4N1KA 3YGSP 2A5YB 2XV9A 2HM2Q 4IZ7B 2O71A 2MPCA 4RHWA 1PN5A 2KM6A 4O9LA 3J6JA 3T6PA 2DBHA 3CRDA 4O7QA 2B1WA 4IZ5E 4RHWE 2N80A 3MOPK 3YGSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E9M A;  4QOB A;  4P4H A;  2VGQ A;  1A1W A;  4F42 A;  1WMG A;  4A2Q A;  2G7R A;  2YVI A;  4ZBW A;  2DBF A;  1CWW A;  4N1L A;  4FH0 A;  2N97 A;  2BBZ A;  1NGR A;  2N83 A;  2DBG A;  4F44 A;  1FAD A;  3LQQ A;  2DBD A;  1CY5 A;  2LWD A;  2YU0 A;  4JUP A;  2GF5 A;  1D2Z A;  4IZA B;  4O6X A;  1C15 A;  3CL3 A;  3QF2 A;  4EWI A;  2MS7 A;  3EZQ A;  1UCP A;  1A1Z A;  4JQW A;  1ICH A;  3J63 A;  1DGN A;  2MN4 A;  4I16 A;  2MB9 A;  4M9S A;  2OF5 H;  4UZ0 A;  2MS8 A;  2NZ7 A;  2P1H A;  4M9Z A;  2DO9 A;  1YGO A;  4O9F A;  1WH4 A;  3MOP G;  4DWN A;  2LS7 A;  1DDF A;  2YQF A;  4A2W A;  2N7Z A;  3MOP A;  1WXP A;  2IB1 A;  2N00 A;  2LWE A;  2YGS A;  3LQR A;  4NQK A;  2OF5 A;  4P4H I;  2D96 A;  1E3Y A;  4N1J A;  4D8O A;  2KN6 A;  1Z6T A;  2BBR A;  4LWD A;  2N1F A;  2A9I A;  3KAT A;  2F1S A;  2NAQ A;  2L9M A;  2NSN A;  1D2Z B;  1E41 A;  1N3K A;  4M9X A;  2L6A A;  2M5V A;  3EZQ B;  4N1K A;  3YGS P;  2A5Y B;  2HM2 Q;  4IZ7 B;  2O71 A;  2MPC A;  4RHW A;  1PN5 A;  2KM6 A;  4O9L A;  3J6J A;  3T6P A;  2DBH A;  3CRD A;  4O7Q A;  2B1W A;  4IZ5 E;  4RHW E;  2N80 A;  3MOP K;  3YGS C; 
#chains in the Genus database with same CATH topology
 4E9M A;  4QOB A;  4P4H A;  2VGQ A;  1A1W A;  4F42 A;  1WMG A;  4A2Q A;  2G7R A;  2YVI A;  4ZBW A;  2DBF A;  1CWW A;  4N1L A;  4FH0 A;  2N97 A;  2BBZ A;  1NGR A;  2N83 A;  2DBG A;  4F44 A;  1FAD A;  3LQQ A;  2DBD A;  1CY5 A;  2LWD A;  2YU0 A;  4JUP A;  2GF5 A;  1D2Z A;  4IZA B;  4O6X A;  1C15 A;  3CL3 A;  3QF2 A;  4EWI A;  2MS7 A;  2MJM A;  3EZQ A;  1UCP A;  1A1Z A;  4JQW A;  1ICH A;  3J63 A;  1DGN A;  2MN4 A;  4I16 A;  2MB9 A;  4M9S A;  2OF5 H;  4UZ0 A;  2MS8 A;  2NZ7 A;  2P1H A;  4M9Z A;  2DO9 A;  1YGO A;  4O9F A;  1WH4 A;  3MOP G;  4DWN A;  2LS7 A;  1DDF A;  2YQF A;  4A2W A;  2N7Z A;  3MOP A;  1WXP A;  2IB1 A;  2N00 A;  2LWE A;  2YGS A;  3LQR A;  4NQK A;  2OF5 A;  4P4H I;  2D96 A;  1E3Y A;  4N1J A;  4D8O A;  2KN6 A;  1Z6T A;  2BBR A;  4LWD A;  2N1F A;  2A9I A;  3KAT A;  2F1S A;  2NAQ A;  2L9M A;  2NSN A;  1D2Z B;  1E41 A;  1N3K A;  4M9X A;  2L6A A;  2M5V A;  3EZQ B;  4N1K A;  3YGS P;  2A5Y B;  2XV9 A;  2HM2 Q;  4IZ7 B;  2O71 A;  2MPC A;  4RHW A;  1PN5 A;  2KM6 A;  4O9L A;  3J6J A;  3T6P A;  2DBH A;  3CRD A;  4O7Q A;  2B1W A;  4IZ5 E;  4RHW E;  2N80 A;  3MOP K;  3YGS C; 
#chains in the Genus database with same CATH homology
 4E9M A;  4QOB A;  4P4H A;  2VGQ A;  1A1W A;  4F42 A;  1WMG A;  4A2Q A;  2G7R A;  2YVI A;  4ZBW A;  2DBF A;  1CWW A;  4N1L A;  4FH0 A;  2N97 A;  2BBZ A;  1NGR A;  2N83 A;  2DBG A;  4F44 A;  1FAD A;  3LQQ A;  2DBD A;  1CY5 A;  2LWD A;  2YU0 A;  4JUP A;  2GF5 A;  1D2Z A;  4IZA B;  4O6X A;  1C15 A;  3CL3 A;  3QF2 A;  4EWI A;  2MS7 A;  2MJM A;  3EZQ A;  1UCP A;  1A1Z A;  4JQW A;  1ICH A;  3J63 A;  1DGN A;  2MN4 A;  4I16 A;  2MB9 A;  4M9S A;  2OF5 H;  4UZ0 A;  2MS8 A;  2NZ7 A;  2P1H A;  4M9Z A;  2DO9 A;  1YGO A;  4O9F A;  1WH4 A;  3MOP G;  4DWN A;  2LS7 A;  1DDF A;  2YQF A;  4A2W A;  2N7Z A;  3MOP A;  1WXP A;  2IB1 A;  2N00 A;  2LWE A;  2YGS A;  3LQR A;  4NQK A;  2OF5 A;  4P4H I;  2D96 A;  1E3Y A;  4N1J A;  4D8O A;  2KN6 A;  1Z6T A;  2BBR A;  4LWD A;  2N1F A;  2A9I A;  3KAT A;  2F1S A;  2NAQ A;  2L9M A;  2NSN A;  1D2Z B;  1E41 A;  1N3K A;  4M9X A;  2L6A A;  2M5V A;  3EZQ B;  4N1K A;  3YGS P;  2A5Y B;  2XV9 A;  2HM2 Q;  4IZ7 B;  2O71 A;  2MPC A;  4RHW A;  1PN5 A;  2KM6 A;  4O9L A;  3J6J A;  3T6P A;  2DBH A;  3CRD A;  4O7Q A;  2B1W A;  4IZ5 E;  4RHW E;  2N80 A;  3MOP K;  3YGS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...